F484115

General Info

Members Datasets Scaffolds Average Seq Length
869 375 866 85

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100013879|Ga0075436_1000138792
Length 96
Sequence MPACRWRSELPKVLMYCTAACPFCQAAERLLMQKGAAIDKVRVDLDPARRAEMMQKSGGRRTVPQIWIGERHIGGCDDLYELERQGGLDPLLKAAP

Samples

Sample ID Description Type Environment
1 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
239 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
240 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
241 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
242 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
243 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
244 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
305 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
306 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
330 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
331 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
332 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
333 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
334 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
335 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
336 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
345 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
361 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
371 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
374 639633007 Azoarcus olearius BH72 Isolate Unclassified
375 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.11
Nodule 0
Rhizoplane 0.35
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10028116 3300005295 Bacteria 1276
2 Ga0065707_10871671 3300005295 Bacteria 575
3 Ga0070676_10103520 3300005328 Bacteria 1762
4 Ga0070676_11251514 3300005328 Bacteria 565
5 Ga0070676_11415428 3300005328 Bacteria 534
6 Ga0070683_100042576 3300005329 Bacteria 4182
7 Ga0070690_100064489 3300005330 Bacteria 2366
8 Ga0070690_100472920 3300005330 Bacteria 933
9 Ga0070690_100687442 3300005330 Bacteria 785
10 Ga0068869_100426532 3300005334 Bacteria 1095
11 Ga0068869_101819970 3300005334 Bacteria 545
12 Ga0070666_10054465 3300005335 Bacteria 2699
13 Ga0070680_100001647 3300005336 Bacteria 16321
14 Ga0070680_100014660 3300005336 Bacteria 6129
15 Ga0070680_100130054 3300005336 Bacteria 2106
16 Ga0070680_100348645 3300005336 Bacteria 1259
17 Ga0070680_100461677 3300005336 Bacteria 1085
18 Ga0070680_100866695 3300005336 Bacteria 779
19 Ga0068868_100398664 3300005338 Unclassified 1187
20 Ga0068868_100932668 3300005338 Bacteria 791
21 Ga0070689_100100857 3300005340 Bacteria 2284
22 Ga0070689_100299742 3300005340 Bacteria 1338
23 Ga0070689_101242183 3300005340 Bacteria 670
24 Ga0070689_101798149 3300005340 Bacteria 559
25 Ga0070691_10082614 3300005341 Bacteria 1575
26 Ga0070687_100028343 3300005343 Bacteria 2715
27 Ga0070687_100246522 3300005343 Bacteria 1107
28 Ga0070687_100608565 3300005343 Bacteria 752
29 Ga0070692_10009924 3300005345 Bacteria 4313
30 Ga0070692_10026413 3300005345 Bacteria 2870
31 Ga0070692_10120828 3300005345 Bacteria 1461
32 Ga0070692_10190452 3300005345 Bacteria 1195
33 Ga0070692_10307961 3300005345 Bacteria 969
34 Ga0070668_100044754 3300005347 Bacteria 3396
35 Ga0070669_100002067 3300005353 Bacteria 14507
36 Ga0070675_100022309 3300005354 Bacteria 5058
37 Ga0070675_100026908 3300005354 Bacteria 4618
38 Ga0070675_101571969 3300005354 Bacteria 607
39 Ga0070671_100120039 3300005355 Bacteria 2212
40 Ga0070674_100068540 3300005356 Bacteria 2500
41 Ga0070674_101073413 3300005356 Bacteria 710
42 Ga0070673_100170665 3300005364 Bacteria 1856
43 Ga0070673_100409789 3300005364 Unclassified 1213
44 Ga0070673_100937721 3300005364 Bacteria 804
45 Ga0070688_100181417 3300005365 Bacteria 1461
46 Ga0070688_100942601 3300005365 Bacteria 683
47 Ga0070667_100581313 3300005367 Bacteria 1031
48 Ga0070703_10011852 3300005406 Bacteria 2466
49 Ga0070709_10706679 3300005434 Bacteria 785
50 Ga0070709_11547529 3300005434 Bacteria 539
51 Ga0070714_100005253 3300005435 Bacteria 9862
52 Ga0070714_100405452 3300005435 Bacteria 1289
53 Ga0070710_10054037 3300005437 Bacteria 2265
54 Ga0070710_10366270 3300005437 Bacteria 958
55 Ga0070701_10120497 3300005438 Bacteria 1478
56 Ga0070701_10469921 3300005438 Bacteria 811
57 Ga0070701_11135196 3300005438 Bacteria 552
58 Ga0070711_100250517 3300005439 Unclassified 1389
59 Ga0070711_100286534 3300005439 Bacteria 1305
60 Ga0070705_100004688 3300005440 Bacteria 6659
61 Ga0070705_100008519 3300005440 Bacteria 5079
62 Ga0070705_100025712 3300005440 Bacteria 3194
63 Ga0070705_100043610 3300005440 Bacteria 2572
64 Ga0070705_100414441 3300005440 Bacteria 1001
65 Ga0070700_100027816 3300005441 Bacteria 3357
66 Ga0070700_100140900 3300005441 Bacteria 1638
67 Ga0070700_101292780 3300005441 Bacteria 613
68 Ga0070694_100006497 3300005444 Bacteria 7103
69 Ga0070694_100049845 3300005444 Bacteria 2821
70 Ga0070694_100139566 3300005444 Bacteria 1759
71 Ga0070694_100276151 3300005444 Bacteria 1279
72 Ga0070694_100426276 3300005444 Bacteria 1043
73 Ga0070694_100618473 3300005444 Bacteria 874
74 Ga0070694_101830984 3300005444 Bacteria 518
75 Ga0070708_100911355 3300005445 Bacteria 825
76 Ga0070708_101215005 3300005445 Bacteria 705
77 Ga0070678_100805798 3300005456 Bacteria 853
78 Ga0070678_101916247 3300005456 Bacteria 560
79 Ga0070662_100383642 3300005457 Bacteria 1157
80 Ga0070681_10000001 3300005458 Bacteria 946857
81 Ga0070681_10094117 3300005458 Bacteria 2945
82 Ga0070681_10445988 3300005458 Bacteria 1206
83 Ga0070681_11245986 3300005458 Bacteria 666
84 Ga0068867_100022379 3300005459 Bacteria 4519
85 Ga0068867_100604498 3300005459 Bacteria 957
86 Ga0068867_100724918 3300005459 Bacteria 880
87 Ga0070706_100137927 3300005467 Bacteria 2276
88 Ga0070706_100326868 3300005467 Bacteria 1430
89 Ga0070706_100355782 3300005467 Bacteria 1365
90 Ga0070706_100573621 3300005467 Bacteria 1049
91 Ga0070698_100965601 3300005471 Bacteria 799
92 Ga0070699_100351464 3300005518 Bacteria 1328
93 Ga0070679_100002513 3300005530 Bacteria 16622
94 Ga0070679_100198136 3300005530 Bacteria 1975
95 Ga0070684_100305627 3300005535 Bacteria 1460
96 Ga0070697_100004494 3300005536 Bacteria 10724
97 Ga0070697_100053069 3300005536 Bacteria 3295
98 Ga0070697_100057369 3300005536 Bacteria 3168
99 Ga0070697_100226051 3300005536 Bacteria 1595
100 Ga0070697_100364181 3300005536 Bacteria 1250
101 Ga0070697_101320195 3300005536 Bacteria 644
102 Ga0068853_100028005 3300005539 Bacteria 4739
103 Ga0070672_100498263 3300005543 Bacteria 1053
104 Ga0070686_100007410 3300005544 Bacteria 6121
105 Ga0070686_100411030 3300005544 Unclassified 1031
106 Ga0070686_100604058 3300005544 Bacteria 865
107 Ga0070695_100078323 3300005545 Bacteria 2179
108 Ga0070695_100257651 3300005545 Bacteria 1272
109 Ga0070695_100306039 3300005545 Bacteria 1176
110 Ga0070695_100520744 3300005545 Bacteria 923
111 Ga0070696_100002386 3300005546 Bacteria 12422
112 Ga0070696_100008433 3300005546 Bacteria 6898
113 Ga0070696_100093635 3300005546 Bacteria 2143
114 Ga0070696_100118825 3300005546 Bacteria 1911
115 Ga0070696_100343812 3300005546 Bacteria 1154
116 Ga0070696_100433147 3300005546 Bacteria 1035
117 Ga0070693_100454006 3300005547 Bacteria 900
118 Ga0070693_100743420 3300005547 Bacteria 722
119 Ga0070693_101560022 3300005547 Bacteria 518
120 Ga0070704_100211114 3300005549 Bacteria 1573
121 Ga0070704_100246246 3300005549 Bacteria 1466
122 Ga0070704_100381457 3300005549 Bacteria 1198
123 Ga0070704_100427388 3300005549 Bacteria 1136
124 Ga0070704_100743609 3300005549 Bacteria 873
125 Ga0068855_100004637 3300005563 Bacteria 16776
126 Ga0068857_100193769 3300005577 Bacteria 1851
127 Ga0068857_101464925 3300005577 Bacteria 665
128 Ga0068854_100432821 3300005578 Bacteria 1095
129 Ga0070702_100002197 3300005615 Bacteria 8312
130 Ga0070702_100023235 3300005615 Bacteria 3292
131 Ga0070702_100077339 3300005615 Bacteria 1983
132 Ga0070702_100311021 3300005615 Bacteria 1094
133 Ga0070702_100379878 3300005615 Unclassified 1004
134 Ga0070702_101897332 3300005615 Bacteria 500
135 Ga0068859_100596615 3300005617 Bacteria 1198
136 Ga0068866_10012298 3300005718 Bacteria 3728
137 Ga0068866_10506576 3300005718 Bacteria 800
138 Ga0068861_100009213 3300005719 Bacteria 6810
139 Ga0068861_100240491 3300005719 Bacteria 1539
140 Ga0068861_102003632 3300005719 Bacteria 578
141 Ga0068870_10341645 3300005840 Bacteria 958
142 Ga0068863_100024667 3300005841 Bacteria 5734
143 Ga0068858_100053157 3300005842 Bacteria 3748
144 Ga0068858_100737964 3300005842 Bacteria 959
145 Ga0068858_102348515 3300005842 Bacteria 527
146 Ga0068860_100646843 3300005843 Bacteria 1065
147 Ga0068860_102418809 3300005843 Bacteria 545
148 Ga0068862_100074102 3300005844 Bacteria 2942
149 Ga0070717_11387854 3300006028 Unclassified 638
150 Ga0075365_10103843 3300006038 Bacteria 1948
151 Ga0075368_10010084 3300006042 Bacteria 3410
152 Ga0075363_100034829 3300006048 Bacteria 2630
153 Ga0075364_10150137 3300006051 Bacteria 1570
154 Ga0070715_10990523 3300006163 Bacteria 523
155 Ga0070716_100627921 3300006173 Bacteria 812
156 Ga0070716_100631297 3300006173 Bacteria 810
157 Ga0070712_101566888 3300006175 Bacteria 576
158 Ga0075362_10006044 3300006177 Bacteria 4482
159 Ga0075362_10133282 3300006177 Bacteria 1183
160 Ga0075367_10061280 3300006178 Bacteria 2245
161 Ga0075369_10057250 3300006186 Bacteria 1695
162 Ga0075369_10126071 3300006186 Bacteria 1161
163 Ga0075366_10039707 3300006195 Bacteria 2781
164 Ga0075366_10594528 3300006195 Bacteria 686
165 Ga0097621_100713566 3300006237 Bacteria 924
166 Ga0075370_10043340 3300006353 Bacteria 2543
167 Ga0068871_100004840 3300006358 Bacteria 9410
168 Ga0075428_100118548 3300006844 Bacteria 2882
169 Ga0075428_100164836 3300006844 Bacteria 2404
170 Ga0075428_100261508 3300006844 Bacteria 1863
171 Ga0075428_100479135 3300006844 Bacteria 1332
172 Ga0075428_101013708 3300006844 Bacteria 879
173 Ga0075428_101855871 3300006844 Bacteria 627
174 Ga0075430_100000730 3300006846 Bacteria 25201
175 Ga0075430_100009943 3300006846 Bacteria 8046
176 Ga0075430_100033130 3300006846 Bacteria 4386
177 Ga0075430_100041067 3300006846 Bacteria 3914
178 Ga0075430_100659057 3300006846 Bacteria 863
179 Ga0075430_100705892 3300006846 Bacteria 831
180 Ga0075431_100345869 3300006847 Bacteria 1496
181 Ga0075431_100735627 3300006847 Bacteria 962
182 Ga0075431_100943170 3300006847 Bacteria 831
183 Ga0075431_101658512 3300006847 Bacteria 596
184 Ga0075433_10057667 3300006852 Bacteria 3395
185 Ga0075433_11687564 3300006852 Bacteria 546
186 Ga0075434_100000002 3300006871 Bacteria 135661
187 Ga0075434_100007245 3300006871 Bacteria 10262
188 Ga0075434_100362020 3300006871 Bacteria 1471
189 Ga0075429_100121187 3300006880 Bacteria 2286
190 Ga0075429_100159017 3300006880 Bacteria 1978
191 Ga0075429_100284557 3300006880 Bacteria 1448
192 Ga0075429_101514493 3300006880 Bacteria 583
193 Ga0068865_100034667 3300006881 Bacteria 3388
194 Ga0068865_100664788 3300006881 Bacteria 887
195 Ga0075436_100002239 3300006914 Bacteria 13356
196 Ga0075436_100013730 3300006914 Bacteria 5548
197 Ga0075436_100013879 3300006914 Bacteria 5517
198 Ga0075436_100025072 3300006914 Bacteria 4100
199 Ga0075436_100050698 3300006914 Bacteria 2865
200 Ga0075436_100103101 3300006914 Bacteria 1988
201 Ga0075436_100497326 3300006914 Bacteria 892
202 Ga0097620_100596576 3300006931 Bacteria 1198
203 Ga0075435_100006511 3300007076 Bacteria 8263
204 Ga0075435_100017646 3300007076 Bacteria 5407
205 Ga0075435_100021908 3300007076 Bacteria 4924
206 Ga0075435_100024406 3300007076 Bacteria 4692
207 Ga0075435_100055502 3300007076 Bacteria 3199
208 Ga0075435_101431945 3300007076 Bacteria 606
209 Ga0075435_101641423 3300007076 Bacteria 564
210 Ga0105244_10097012 3300009036 Bacteria 1445
211 Ga0105250_10051134 3300009092 Bacteria 1658
212 Ga0105240_10905603 3300009093 Unclassified 949
213 Ga0111539_10011706 3300009094 Bacteria 11007
214 Ga0111539_10017672 3300009094 Bacteria 8829
215 Ga0111539_10059932 3300009094 Bacteria 4512
216 Ga0111539_10076537 3300009094 Bacteria 3940
217 Ga0111539_10077714 3300009094 Bacteria 3906
218 Ga0111539_10110814 3300009094 Bacteria 3221
219 Ga0111539_10486917 3300009094 Bacteria 1437
220 Ga0111539_10543565 3300009094 Bacteria 1353
221 Ga0111539_11302360 3300009094 Bacteria 843
222 Ga0105245_10000221 3300009098 Bacteria 54253
223 Ga0105245_11371883 3300009098 Unclassified 757
224 Ga0105245_12826722 3300009098 Bacteria 538
225 Ga0114129_10003624 3300009147 Bacteria 21726
226 Ga0114129_10097900 3300009147 Bacteria 4061
227 Ga0114129_10248304 3300009147 Bacteria 2390
228 Ga0114129_10373163 3300009147 Bacteria 1885
229 Ga0114129_10587238 3300009147 Bacteria 1445
230 Ga0114129_10832561 3300009147 Bacteria 1175
231 Ga0114129_11768688 3300009147 Bacteria 752
232 Ga0114129_12217238 3300009147 Bacteria 661
233 Ga0114129_13070298 3300009147 Bacteria 547
234 Ga0105243_10000288 3300009148 Bacteria 55680
235 Ga0105243_10006310 3300009148 Bacteria 9162
236 Ga0105243_11016653 3300009148 Bacteria 832
237 Ga0105241_10008452 3300009174 Bacteria 7567
238 Ga0105241_10283579 3300009174 Unclassified 1415
239 Ga0105242_10007197 3300009176 Bacteria 8582
240 Ga0105242_10415247 3300009176 Bacteria 1259
241 Ga0105248_10076185 3300009177 Bacteria 3770
242 Ga0105248_10207763 3300009177 Bacteria 2206
243 Ga0105237_10227743 3300009545 Bacteria 1865
244 Ga0105238_11111166 3300009551 Unclassified 813
245 Ga0105249_10005927 3300009553 Bacteria 10589
246 Ga0105249_10022286 3300009553 Bacteria 5674
247 Ga0105239_10012819 3300010375 Bacteria 9327
248 Ga0105239_10594092 3300010375 Bacteria 1262
249 Ga0105239_12591736 3300010375 Bacteria 591
250 Ga0105246_10207704 3300011119 Bacteria 1526
251 Ga0157373_10696520 3300013100 Bacteria 744
252 Ga0157371_10419793 3300013102 Bacteria 981
253 Ga0157370_10003517 3300013104 Bacteria 18362
254 Ga0157374_11960119 3300013296 Unclassified 612
255 Ga0157378_10003188 3300013297 Bacteria 14572
256 Ga0157378_12000765 3300013297 Bacteria 629
257 Ga0163162_10056188 3300013306 Bacteria 3965
258 Ga0157372_10309715 3300013307 Bacteria 1838
259 Ga0157372_12509286 3300013307 Unclassified 592
260 Ga0157375_10468627 3300013308 Bacteria 1425
261 Ga0157375_11348671 3300013308 Bacteria 839
262 Ga0157380_10009333 3300014326 Bacteria 7026
263 Ga0157380_10098992 3300014326 Bacteria 2424
264 Ga0157380_11504193 3300014326 Bacteria 726
265 Ga0157377_10013623 3300014745 Bacteria 4120
266 Ga0157377_10264271 3300014745 Bacteria 1121
267 Ga0157377_10750923 3300014745 Bacteria 714
268 Ga0157377_11461920 3300014745 Bacteria 542
269 Ga0157379_10106150 3300014968 Bacteria 2521
270 Ga0157379_11828707 3300014968 Unclassified 597
271 Ga0157376_10001746 3300014969 Bacteria 14461
272 Ga0157376_10286919 3300014969 Bacteria 1553
273 Ga0163161_10467650 3300017792 Bacteria 1022
274 Ga0213874_10005372 3300021377 Bacteria 2981
275 Ga0213874_10013425 3300021377 Bacteria 2122
276 Ga0213874_10299369 3300021377 Unclassified 605
277 Ga0213876_10001256 3300021384 Bacteria 16010
278 Ga0213876_10036599 3300021384 Bacteria 2589
279 Ga0207697_10144651 3300025315 Bacteria 1032
280 Ga0207713_1061471 3300025735 Bacteria 1429
281 Ga0207682_10418066 3300025893 Bacteria 634
282 Ga0207692_10057561 3300025898 Bacteria 1999
283 Ga0207692_10506127 3300025898 Unclassified 767
284 Ga0207642_10003522 3300025899 Bacteria 4954
285 Ga0207688_10675278 3300025901 Bacteria 653
286 Ga0207699_11076180 3300025906 Bacteria 595
287 Ga0207645_10118144 3300025907 Bacteria 1720
288 Ga0207643_10244328 3300025908 Bacteria 1104
289 Ga0207684_10220114 3300025910 Bacteria 1638
290 Ga0207684_10567981 3300025910 Bacteria 970
291 Ga0207684_10770131 3300025910 Bacteria 815
292 Ga0207707_10000011 3300025912 Bacteria 282857
293 Ga0207695_10958872 3300025913 Unclassified 735
294 Ga0207693_10329762 3300025915 Bacteria 1195
295 Ga0207663_10272808 3300025916 Bacteria 1253
296 Ga0207663_10313118 3300025916 Bacteria 1177
297 Ga0207663_10397729 3300025916 Bacteria 1053
298 Ga0207660_10000737 3300025917 Bacteria 21749
299 Ga0207660_10030384 3300025917 Bacteria 3713
300 Ga0207660_10195231 3300025917 Bacteria 1578
301 Ga0207660_10262698 3300025917 Bacteria 1365
302 Ga0207660_10340980 3300025917 Bacteria 1199
303 Ga0207660_11449484 3300025917 Bacteria 556
304 Ga0207662_10019308 3300025918 Bacteria 3877
305 Ga0207662_10068058 3300025918 Bacteria 2149
306 Ga0207662_10097379 3300025918 Bacteria 1818
307 Ga0207662_11070407 3300025918 Bacteria 573
308 Ga0207652_10000089 3300025921 Bacteria 99680
309 Ga0207646_10457410 3300025922 Bacteria 1151
310 Ga0207681_10053432 3300025923 Bacteria 2742
311 Ga0207659_10124321 3300025926 Bacteria 1981
312 Ga0207664_10228422 3300025929 Bacteria 1617
313 Ga0207664_10454001 3300025929 Unclassified 1144
314 Ga0207706_10999899 3300025933 Bacteria 703
315 Ga0207706_11089290 3300025933 Bacteria 668
316 Ga0207709_10001207 3300025935 Bacteria 18567
317 Ga0207670_10169816 3300025936 Bacteria 1634
318 Ga0207669_10165317 3300025937 Bacteria 1568
319 Ga0207704_10024843 3300025938 Bacteria 3259
320 Ga0207704_10165512 3300025938 Bacteria 1579
321 Ga0207704_11758919 3300025938 Bacteria 533
322 Ga0207665_10263842 3300025939 Bacteria 1277
323 Ga0207665_10876608 3300025939 Bacteria 711
324 Ga0207665_11342615 3300025939 Unclassified 570
325 Ga0207691_10174066 3300025940 Bacteria 1883
326 Ga0207711_10073423 3300025941 Bacteria 2973
327 Ga0207689_10323681 3300025942 Bacteria 1280
328 Ga0207689_10505762 3300025942 Bacteria 1012
329 Ga0207661_10052438 3300025944 Bacteria 3259
330 Ga0207667_10005674 3300025949 Bacteria 15217
331 Ga0207651_10474454 3300025960 Bacteria 1077
332 Ga0207651_10790595 3300025960 Bacteria 841
333 Ga0207668_10480330 3300025972 Bacteria 1066
334 Ga0207658_10730508 3300025986 Unclassified 896
335 Ga0207677_10747720 3300026023 Bacteria 871
336 Ga0207703_10331808 3300026035 Bacteria 1395
337 Ga0207703_10831526 3300026035 Bacteria 882
338 Ga0207708_10001100 3300026075 Bacteria 20249
339 Ga0207708_10136147 3300026075 Bacteria 1924
340 Ga0207708_10257433 3300026075 Bacteria 1408
341 Ga0207708_10486535 3300026075 Bacteria 1032
342 Ga0207708_11869509 3300026075 Unclassified 526
343 Ga0207641_10085726 3300026088 Bacteria 2745
344 Ga0207641_11211641 3300026088 Bacteria 755
345 Ga0207648_10000362 3300026089 Bacteria 50094
346 Ga0207648_11464088 3300026089 Bacteria 642
347 Ga0207676_12368148 3300026095 Bacteria 528
348 Ga0207674_10399198 3300026116 Bacteria 1329
349 Ga0207675_100005714 3300026118 Bacteria 11903
350 Ga0207675_100122055 3300026118 Bacteria 2466
351 Ga0207675_100529425 3300026118 Bacteria 1176
352 Ga0207675_101338940 3300026118 Bacteria 737
353 Ga0209969_1001335 3300027360 Bacteria 3395
354 Ga0209967_1003252 3300027364 Bacteria 2139
355 Ga0209967_1014672 3300027364 Bacteria 1117
356 Ga0209967_1032935 3300027364 Bacteria 778
357 Ga0209996_1003376 3300027395 Bacteria 2007
358 Ga0209996_1005223 3300027395 Bacteria 1663
359 Ga0210000_1001500 3300027462 Bacteria 3289
360 Ga0210000_1009972 3300027462 Bacteria 1403
361 Ga0210000_1024580 3300027462 Bacteria 930
362 Ga0209968_1008614 3300027526 Bacteria 1556
363 Ga0209999_1001417 3300027543 Bacteria 4110
364 Ga0209999_1009079 3300027543 Bacteria 1797
365 Ga0209999_1033388 3300027543 Bacteria 957
366 Ga0209971_1000991 3300027682 Bacteria 7301
367 Ga0209966_1001526 3300027695 Bacteria 4028
368 Ga0209966_1171794 3300027695 Bacteria 508
369 Ga0209998_10009393 3300027717 Bacteria 2030
370 Ga0209813_10002903 3300027866 Bacteria 3966
371 Ga0209974_10021299 3300027876 Bacteria 2146
372 Ga0209974_10208343 3300027876 Bacteria 724
373 Ga0207428_10153594 3300027907 Bacteria 1751
374 Ga0207428_10178931 3300027907 Bacteria 1603
375 Ga0207428_10187015 3300027907 Bacteria 1562
376 Ga0207428_10244406 3300027907 Bacteria 1340
377 Ga0207428_10305724 3300027907 Bacteria 1176
378 Ga0268265_10067183 3300028380 Bacteria 2774
379 Ga0268265_10130052 3300028380 Bacteria 2090
380 Ga0268265_10447727 3300028380 Bacteria 1205
381 Ga0268265_10845328 3300028380 Bacteria 895
382 Ga0268264_11316250 3300028381 Bacteria 733
383 Ga0307515_10453965 3300028794 Bacteria 897
384 Ga0265328_10051733 3300031239 Bacteria 1508
385 Ga0265328_10222646 3300031239 Unclassified 719
386 Ga0265331_10003722 3300031250 Bacteria 9693
387 Ga0265331_10004122 3300031250 Bacteria 9123
388 Ga0265327_10000451 3300031251 Bacteria 73966
389 Ga0265327_10002955 3300031251 Bacteria 16994
390 Ga0265327_10034803 3300031251 Bacteria 2790
391 Ga0265327_10119036 3300031251 Bacteria 1253
392 Ga0265327_10257525 3300031251 Bacteria 775
393 Ga0265316_10000490 3300031344 Bacteria 44853
394 Ga0265316_11043032 3300031344 Unclassified 568
395 Ga0307408_100076693 3300031548 Bacteria 2487
396 Ga0307408_100107514 3300031548 Bacteria 2136
397 Ga0307408_100187661 3300031548 Bacteria 1663
398 Ga0307408_100543101 3300031548 Bacteria 1024
399 Ga0307408_100567143 3300031548 Bacteria 1004
400 Ga0307408_101269024 3300031548 Bacteria 689
401 Ga0316576_10016154 3300031727 Bacteria 5032
402 Ga0316578_10048061 3300031728 Bacteria 2491
403 Ga0307516_10164543 3300031730 Bacteria 1965
404 Ga0307405_10318514 3300031731 Bacteria 1187
405 Ga0307405_10411127 3300031731 Bacteria 1062
406 Ga0307405_11603465 3300031731 Bacteria 574
407 Ga0316577_10021920 3300031733 Bacteria 3545
408 Ga0307410_10525666 3300031852 Bacteria 977
409 Ga0307410_12005519 3300031852 Bacteria 516
410 Ga0307406_10525460 3300031901 Bacteria 964
411 Ga0307406_11273274 3300031901 Bacteria 641
412 Ga0307407_10214433 3300031903 Bacteria 1298
413 Ga0307407_10406707 3300031903 Bacteria 978
414 Ga0307407_11046527 3300031903 Bacteria 632
415 Ga0307412_10725979 3300031911 Bacteria 855
416 Ga0307412_11189004 3300031911 Bacteria 682
417 Ga0307412_11939303 3300031911 Bacteria 544
418 Ga0307416_100033663 3300032002 Bacteria 3888
419 Ga0307416_100096838 3300032002 Bacteria 2553
420 Ga0307416_100232215 3300032002 Bacteria 1779
421 Ga0307416_100291683 3300032002 Bacteria 1615
422 Ga0307416_100320812 3300032002 Bacteria 1551
423 Ga0307416_100409182 3300032002 Bacteria 1397
424 Ga0307416_102647614 3300032002 Bacteria 599
425 Ga0307416_102818127 3300032002 Bacteria 581
426 Ga0307416_102862261 3300032002 Unclassified 577
427 Ga0307416_103120224 3300032002 Bacteria 554
428 Ga0307411_10034549 3300032005 Bacteria 3148
429 Ga0307411_10056564 3300032005 Bacteria 2586
430 Ga0307411_10122118 3300032005 Bacteria 1887
431 Ga0307411_10161476 3300032005 Bacteria 1679
432 Ga0307411_10643556 3300032005 Bacteria 917
433 Ga0307411_10656028 3300032005 Bacteria 909
434 Ga0307415_100312981 3300032126 Bacteria 1306
435 Ga0307415_100880296 3300032126 Bacteria 824
436 Ga0307415_100892409 3300032126 Bacteria 819
437 Ga0373930_0032470 3300034816 Bacteria 1080
438 Ga0373930_0043553 3300034816 Bacteria 963
439 Ga0373930_0152478 3300034816 Bacteria 580
440 Ga0373948_0023578 3300034817 Bacteria 1195
441 Ga0373950_0048983 3300034818 Bacteria 826
442 Ga0373959_0026709 3300034820 Bacteria 1142
443 Ga0373926_0000464 3300035083 Bacteria 10647
444 Ga0373928_0006357 3300035084 Bacteria 2273
445 Ga0373928_0109765 3300035084 Unclassified 729
446 Ga0373929_0062317 3300035085 Bacteria 876
447 Ga0373929_0066936 3300035085 Bacteria 852
448 Ga0373934_0060537 3300035086 Bacteria 1508
449 Ga0373940_0000708 3300035088 Bacteria 5403
450 Ga0373940_0039661 3300035088 Bacteria 1290
451 Ga0373944_0020582 3300035089 Bacteria 1902
452 Ga0373949_0030698 3300035090 Bacteria 1278
453 Ga0373951_0005230 3300035091 Bacteria 3027
454 Ga0373951_0154554 3300035091 Bacteria 645
455 Ga0373952_0058187 3300035092 Bacteria 938
456 Ga0373923_0050934 3300035111 Bacteria 1736
457 Ga0373932_0009214 3300035112 Bacteria 2370
458 Ga0373932_0018277 3300035112 Bacteria 1810
459 Ga0373932_0063356 3300035112 Bacteria 1129
460 Ga0373936_0002795 3300035113 Bacteria 6505
461 Ga0373936_0034261 3300035113 Bacteria 2016
462 Ga0373936_0140469 3300035113 Bacteria 1043
463 Ga0373936_0181788 3300035113 Bacteria 923
464 Ga0373936_0358828 3300035113 Bacteria 665
465 Ga0373939_0090529 3300035114 Unclassified 1033
466 Ga0373939_0303079 3300035114 Bacteria 637
467 Ga0373941_0114359 3300035115 Bacteria 955
468 Ga0373941_0151384 3300035115 Bacteria 851
469 Ga0373945_0001048 3300035116 Bacteria 8289
470 Ga0373945_0279154 3300035116 Bacteria 711
471 Ga0373945_0509761 3300035116 Bacteria 537
472 Ga0373953_0021168 3300035117 Bacteria 2437
473 Ga0373953_0201610 3300035117 Bacteria 860
474 Ga0373954_0011161 3300035118 Bacteria 3977
475 Ga0373954_0341182 3300035118 Bacteria 740
476 Ga0373956_0025350 3300035119 Bacteria 2562
477 Ga0373960_0004813 3300035121 Bacteria 3110
478 Ga0373960_0018656 3300035121 Bacteria 1813
479 Ga0373960_0254437 3300035121 Bacteria 639
480 Ga0373943_0010748 3300035170 Bacteria 4107
481 Ga0373943_0017103 3300035170 Bacteria 3316
482 Ga0373943_0574066 3300035170 Bacteria 663
483 Ga0373946_0298177 3300035171 Bacteria 796
484 Ga0373946_0495805 3300035171 Bacteria 626
485 Ga0373955_0031742 3300035172 Bacteria 2768
486 Ga0373955_0185381 3300035172 Bacteria 1236
487 Ga0373955_0732922 3300035172 Unclassified 607
488 Ga0373942_0004365 3300035207 Bacteria 3285
489 Ga0373961_0071384 3300035241 Bacteria 1074
490 Ga0373961_0129669 3300035241 Bacteria 843
491 Ga0373961_0133896 3300035241 Bacteria 832
492 Ga0373961_0300507 3300035241 Bacteria 594
493 Ga0373962_0028594 3300035242 Bacteria 1513
494 Ga0373962_0065057 3300035242 Bacteria 1078
495 Ga0373962_0065905 3300035242 Bacteria 1073
496 Ga0316574_0330547 3300035398 Bacteria 966
497 Ga0373924_0003642 3300035410 Bacteria 5314
498 Ga0373924_0094514 3300035410 Bacteria 1281
499 Ga0373924_0224116 3300035410 Bacteria 831
500 Ga0373924_0405028 3300035410 Bacteria 610
501 Ga0373931_0000307 3300035691 Bacteria 20644
502 Ga0373931_0006244 3300035691 Bacteria 5558
503 Ga0373931_0335253 3300035691 Bacteria 943
504 Ga0373931_0448778 3300035691 Bacteria 824
505 Ga0373931_0536838 3300035691 Bacteria 758
506 Ga0373931_0666747 3300035691 Bacteria 684
507 Ga0373935_0011866 3300035692 Bacteria 5235
508 Ga0373935_0062741 3300035692 Bacteria 2381
509 Ga0373935_0099751 3300035692 Bacteria 1912
510 Ga0373927_0004060 3300035695 Bacteria 10339
511 Ga0373927_0123300 3300035695 Bacteria 1691
512 Ga0373933_0013854 3300035724 Bacteria 4473
513 Ga0373947_0006433 3300035725 Bacteria 6825
514 Ga0373947_0009590 3300035725 Bacteria 5555
515 Ga0373947_0939040 3300035725 Bacteria 590
516 Ga0373937_0006625 3300036401 Bacteria 10000
517 Ga0373937_0074297 3300036401 Bacteria 3137
518 Ga0373937_0120336 3300036401 Bacteria 2446
519 Ga0316584_0044808 3300036712 Bacteria 3300
520 Ga0373925_0037020 3300037068 Bacteria 3600
521 Ga0373925_0038703 3300037068 Bacteria 3527
522 Ga0373925_0042408 3300037068 Bacteria 3375
523 Ga0373925_0651787 3300037068 Bacteria 868
524 Ga0400483_086891 3300039062 Bacteria 3269
525 Ga0400483_151143 3300039062 Bacteria 268199
526 Ga0400483_174877 3300039062 Bacteria 1393
527 Ga0436365_0295636 3300039437 Bacteria 653
528 Ga0436365_0665212 3300039437 Bacteria 526
529 Ga0436365_0981941 3300039437 Bacteria 54107
530 Ga0436365_1621958 3300039437 Bacteria 3062
531 Ga0436360_0520014 3300039438 Bacteria 1949
532 Ga0436360_1127633 3300039438 Bacteria 553
533 Ga0436361_0438991 3300039447 Bacteria 100787
534 Ga0436363_0005179 3300039450 Bacteria 2122
535 Ga0436363_0954949 3300039450 Bacteria 5294
536 Ga0436363_1020652 3300039450 Unclassified 605
537 Ga0436363_1155895 3300039450 Bacteria 501
538 Ga0436362_0323154 3300039453 Bacteria 1813
539 Ga0439453_0033402 3300041408 Bacteria 983
540 Ga0451807_1790131 3300041486 Bacteria 806
541 Ga0451839_0103274 3300041496 Bacteria 503
542 Ga0451849_1374968 3300041505 Bacteria 703
543 Ga0439441_000435 3300042001 Bacteria 4439
544 Ga0439441_129826 3300042001 Bacteria 583
545 Ga0439443_000936 3300042003 Bacteria 2971
546 Ga0439443_017168 3300042003 Bacteria 1111
547 Ga0439451_024285 3300042009 Bacteria 1221
548 Ga0439462_0139409 3300042015 Bacteria 679
549 Ga0450910_106578 3300042147 Bacteria 506
550 Ga0439446_0051165 3300042156 Bacteria 1234
551 Ga0439446_0084409 3300042156 Bacteria 987
552 Ga0439435_0000533 3300042436 Bacteria 6085
553 Ga0439435_0004325 3300042436 Bacteria 3047
554 Ga0439444_0001431 3300042437 Bacteria 3096
555 Ga0439444_0005867 3300042437 Bacteria 1835
556 Ga0439464_0134296 3300042439 Bacteria 767
557 Ga0439460_0000168 3300042461 Bacteria 12269
558 Ga0439460_0017553 3300042461 Bacteria 1918
559 Ga0451577_0001239 3300042876 Bacteria 35327
560 Ga0451577_0035786 3300042876 Bacteria 4472
561 Ga0451577_0043111 3300042876 Bacteria 4042
562 Ga0451577_0708124 3300042876 Bacteria 912
563 Ga0453683_0622793 3300044673 Bacteria 705
564 Ga0466964_0607517 3300044706 Bacteria 600
565 Ga0453684_0000694 3300044712 Bacteria 119688
566 Ga0453684_0070950 3300044712 Bacteria 4408
567 Ga0453684_0088552 3300044712 Bacteria 3833
568 Ga0453684_0800201 3300044712 Bacteria 1017
569 Ga0466957_0497286 3300044842 Bacteria 845
570 Ga0466960_0532896 3300044901 Bacteria 691
571 Ga0451576_0000909 3300045051 Bacteria 56035
572 Ga0451576_0001279 3300045051 Bacteria 43839
573 Ga0451576_0001966 3300045051 Bacteria 32695
574 Ga0451576_0002087 3300045051 Bacteria 31196
575 Ga0451576_0019385 3300045051 Bacteria 7426
576 Ga0451576_0025603 3300045051 Bacteria 6354
577 Ga0451576_0076559 3300045051 Bacteria 3481
578 Ga0451576_0121672 3300045051 Bacteria 2717
579 Ga0451576_0271418 3300045051 Bacteria 1773
580 Ga0451576_1121199 3300045051 Bacteria 823
581 Ga0451576_1908921 3300045051 Unclassified 613
582 Ga0466958_0806492 3300045836 Bacteria 612
583 Ga0466967_0018731 3300045976 Bacteria 5544
584 Ga0466967_0218491 3300045976 Bacteria 1810
585 Ga0466967_1410853 3300045976 Bacteria 694
586 Ga0495592_0000306 3300046454 Bacteria 41265
587 Ga0495629_0765326 3300046459 Bacteria 638
588 Ga0495651_0566299 3300046462 Bacteria 720
589 Ga0495580_0005769 3300046472 Bacteria 10165
590 Ga0495582_0015381 3300046473 Bacteria 4203
591 Ga0495662_0014882 3300046476 Bacteria 3780
592 Ga0495662_0659047 3300046476 Bacteria 511
593 Ga0495584_0392948 3300046491 Bacteria 705
594 Ga0495608_0000439 3300046511 Bacteria 29042
595 Ga0495608_0165747 3300046511 Bacteria 1403
596 Ga0495618_0208052 3300046514 Bacteria 1237
597 Ga0495628_0001253 3300046516 Bacteria 23229
598 Ga0495628_0256099 3300046516 Bacteria 1305
599 Ga0495630_0003035 3300046517 Bacteria 11651
600 Ga0495630_0005926 3300046517 Bacteria 8641
601 Ga0495630_0131061 3300046517 Bacteria 1904
602 Ga0495630_0311486 3300046517 Bacteria 1203
603 Ga0495666_0031317 3300046526 Bacteria 2606
604 Ga0495666_0149015 3300046526 Bacteria 1088
605 Ga0495642_0036413 3300046528 Bacteria 1989
606 Ga0495652_0068067 3300046529 Bacteria 2984
607 Ga0495652_1136903 3300046529 Bacteria 506
608 Ga0495640_0000418 3300046533 Bacteria 30693
609 Ga0495640_0280960 3300046533 Bacteria 1037
610 Ga0495640_0295934 3300046533 Bacteria 1006
611 Ga0495586_0001224 3300046535 Bacteria 14424
612 Ga0495586_0001587 3300046535 Bacteria 12505
613 Ga0495587_0120979 3300046536 Bacteria 1499
614 Ga0495621_0017526 3300046539 Bacteria 2316
615 Ga0495621_0021150 3300046539 Bacteria 2142
616 Ga0495621_0314817 3300046539 Bacteria 651
617 Ga0495621_0510295 3300046539 Bacteria 519
618 Ga0495667_0010719 3300046559 Bacteria 6198
619 Ga0495667_0250774 3300046559 Bacteria 1126
620 Ga0495667_0528568 3300046559 Bacteria 738
621 Ga0495656_0024863 3300046615 Bacteria 2370
622 Ga0495634_0003074 3300046642 Bacteria 13580
623 Ga0495634_0377511 3300046642 Bacteria 845
624 Ga0495635_0028372 3300046663 Bacteria 3890
625 Ga0495635_0061769 3300046663 Bacteria 2573
626 Ga0495588_0057101 3300046674 Bacteria 2016
627 Ga0495657_0249489 3300046675 Bacteria 1069
628 Ga0495599_0015851 3300046678 Bacteria 4679
629 Ga0495599_0092952 3300046678 Bacteria 1882
630 Ga0495647_0000374 3300046681 Bacteria 12660
631 Ga0495647_0251175 3300046681 Bacteria 787
632 Ga0495658_0001390 3300046683 Bacteria 12703
633 Ga0495658_0002491 3300046683 Bacteria 9263
634 Ga0495669_0041437 3300046684 Bacteria 2045
635 Ga0495613_0003181 3300046689 Bacteria 12293
636 Ga0495624_0045756 3300046690 Bacteria 2784
637 Ga0495624_0075287 3300046690 Bacteria 2096
638 Ga0495600_0010182 3300046809 Bacteria 5827
639 Ga0495600_0202265 3300046809 Bacteria 1275
640 Ga0495581_0103252 3300047315 Bacteria 1656
641 Ga0495581_0298821 3300047315 Bacteria 941
642 Ga0495604_0001668 3300047317 Bacteria 18261
643 Ga0495604_0639811 3300047317 Bacteria 679
644 Ga0495636_0008982 3300047318 Bacteria 3932
645 Ga0495674_0280489 3300047319 Bacteria 1365
646 Ga0495674_0285853 3300047319 Bacteria 1350
647 Ga0495676_0060550 3300047321 Bacteria 2966
648 Ga0495680_0003157 3300047322 Bacteria 16416
649 Ga0495680_0043168 3300047322 Bacteria 3572
650 Ga0495675_0129817 3300047444 Bacteria 1567
651 Ga0495684_0801372 3300047471 Bacteria 615
652 Ga0495593_0246809 3300047673 Bacteria 894
653 Ga0495602_0271182 3300048088 Bacteria 1254
654 Ga0495614_0408506 3300048089 Bacteria 639
655 Ga0496106_0340692 3300048909 Bacteria 1204
656 Ga0496108_1442762 3300048911 Unclassified 574
657 Ga0496121_0011858 3300048924 Bacteria 9598
658 Ga0496121_0041821 3300048924 Bacteria 3998
659 Ga0501296_003303 3300049519 Bacteria 1716
660 Ga0501296_021179 3300049519 Bacteria 832
661 Ga0501297_051530 3300049520 Bacteria 607
662 Ga0501299_171738 3300049522 Bacteria 561
663 Ga0501031_0106389 3300049568 Bacteria 1831
664 Ga0501031_0843241 3300049568 Bacteria 587
665 Ga0501032_0935075 3300049569 Bacteria 545
666 Ga0501033_0000364 3300049570 Bacteria 43293
667 Ga0501033_0000897 3300049570 Bacteria 27231
668 Ga0501033_0005748 3300049570 Bacteria 9772
669 Ga0501033_0290772 3300049570 Bacteria 1152
670 Ga0501033_0619462 3300049570 Bacteria 741
671 Ga0501036_0000974 3300049572 Bacteria 21624
672 Ga0501036_0003934 3300049572 Bacteria 11933
673 Ga0501036_0100839 3300049572 Bacteria 2442
674 Ga0501036_0182819 3300049572 Bacteria 1765
675 Ga0501036_1475469 3300049572 Bacteria 550
676 Ga0501037_0077406 3300049573 Bacteria 2413
677 Ga0501037_0578017 3300049573 Bacteria 756
678 Ga0501038_0000189 3300049574 Bacteria 53371
679 Ga0501038_0119876 3300049574 Bacteria 2171
680 Ga0501038_0290282 3300049574 Bacteria 1286
681 Ga0501038_0308845 3300049574 Bacteria 1239
682 Ga0501038_0431277 3300049574 Bacteria 1016
683 Ga0501039_0000247 3300049575 Bacteria 39539
684 Ga0501039_0045851 3300049575 Bacteria 3378
685 Ga0501039_0048437 3300049575 Bacteria 3285
686 Ga0501039_0049647 3300049575 Bacteria 3244
687 Ga0501039_0186776 3300049575 Bacteria 1630
688 Ga0501039_0428170 3300049575 Bacteria 1039
689 Ga0501039_1139179 3300049575 Bacteria 604
690 Ga0501039_1269065 3300049575 Bacteria 569
691 Ga0501040_0000229 3300049576 Bacteria 32741
692 Ga0501040_0010067 3300049576 Bacteria 6177
693 Ga0501040_0012950 3300049576 Bacteria 5482
694 Ga0501040_0363040 3300049576 Bacteria 1038
695 Ga0501041_0000032 3300049577 Bacteria 44999
696 Ga0501041_0023023 3300049577 Bacteria 3733
697 Ga0501041_0081874 3300049577 Bacteria 1988
698 Ga0501041_0194884 3300049577 Bacteria 1269
699 Ga0501041_0467832 3300049577 Bacteria 801
700 Ga0501041_0926351 3300049577 Bacteria 560
701 Ga0501042_0002212 3300049578 Bacteria 11860
702 Ga0501042_0025550 3300049578 Bacteria 4149
703 Ga0501042_0614759 3300049578 Bacteria 790
704 Ga0501042_0998199 3300049578 Bacteria 610
705 Ga0501043_0110342 3300049579 Bacteria 2160
706 Ga0501043_0305142 3300049579 Bacteria 1216
707 Ga0501043_0364372 3300049579 Bacteria 1096
708 Ga0501043_0466224 3300049579 Bacteria 947
709 Ga0501046_0000156 3300049580 Bacteria 70512
710 Ga0501046_0035383 3300049580 Bacteria 4025
711 Ga0501046_0103451 3300049580 Bacteria 2183
712 Ga0501046_0141756 3300049580 Bacteria 1818
713 Ga0501047_0315703 3300049581 Bacteria 1403
714 Ga0501047_0377969 3300049581 Bacteria 1251
715 Ga0501048_0002226 3300049582 Bacteria 14775
716 Ga0501048_0008280 3300049582 Bacteria 7867
717 Ga0501048_0123418 3300049582 Bacteria 1831
718 Ga0501048_0903584 3300049582 Bacteria 635
719 Ga0501068_0015765 3300049584 Bacteria 4347
720 Ga0501068_0408253 3300049584 Bacteria 876
721 Ga0501070_0035376 3300049586 Bacteria 4174
722 Ga0501071_0002557 3300049587 Bacteria 11093
723 Ga0501071_0020882 3300049587 Bacteria 4555
724 Ga0501071_1113973 3300049587 Bacteria 610
725 Ga0501072_0001593 3300049588 Bacteria 16962
726 Ga0501072_0008225 3300049588 Bacteria 7923
727 Ga0501072_0180004 3300049588 Bacteria 1686
728 Ga0501072_0721374 3300049588 Bacteria 783
729 Ga0501072_0758442 3300049588 Bacteria 761
730 Ga0501072_0766609 3300049588 Bacteria 756
731 Ga0501074_0045233 3300049590 Bacteria 3185
732 Ga0501074_0170602 3300049590 Bacteria 1553
733 Ga0501074_0249181 3300049590 Bacteria 1263
734 Ga0501074_0367302 3300049590 Bacteria 1021
735 Ga0501075_0000053 3300049591 Bacteria 49110
736 Ga0501075_0000179 3300049591 Bacteria 32841
737 Ga0501075_0070543 3300049591 Bacteria 2640
738 Ga0501075_0738232 3300049591 Bacteria 750
739 Ga0501075_0764436 3300049591 Bacteria 735
740 Ga0501076_0001036 3300049592 Bacteria 18262
741 Ga0501076_0002539 3300049592 Bacteria 12558
742 Ga0501076_0373052 3300049592 Bacteria 1172
743 Ga0501076_0759579 3300049592 Bacteria 800
744 Ga0501077_0000086 3300049593 Bacteria 46652
745 Ga0501077_0016526 3300049593 Bacteria 4650
746 Ga0501209_101302 3300049656 Bacteria 845
747 Ga0501217_061056 3300049661 Bacteria 1007
748 Ga0501233_189627 3300049668 Bacteria 593
749 Ga0501235_045511 3300049669 Bacteria 1010
750 Ga0501236_050158 3300049670 Bacteria 715
751 Ga0501249_111244 3300049679 Bacteria 662
752 Ga0501221_026409 3300049704 Bacteria 1181
753 Ga0501225_0161326 3300049705 Bacteria 690
754 Ga0501079_0000208 3300049741 Bacteria 34357
755 Ga0501079_0021705 3300049741 Bacteria 4914
756 Ga0501079_0624157 3300049741 Bacteria 848
757 Ga0501080_0012555 3300049742 Bacteria 7768
758 Ga0501080_0083308 3300049742 Bacteria 2971
759 Ga0501080_0097910 3300049742 Bacteria 2723
760 Ga0501081_0000127 3300049743 Bacteria 33437
761 Ga0501081_0020455 3300049743 Bacteria 4411
762 Ga0501283_059842 3300049779 Bacteria 687
763 Ga0501035_0000199 3300049822 Bacteria 73522
764 Ga0501035_0008469 3300049822 Bacteria 9580
765 Ga0501035_0409561 3300049822 Bacteria 1127
766 Ga0501035_0465516 3300049822 Bacteria 1044
767 Ga0501044_0064530 3300049823 Bacteria 3738
768 Ga0501044_0078329 3300049823 Bacteria 3349
769 Ga0501044_0131650 3300049823 Bacteria 2495
770 Ga0501044_0233246 3300049823 Bacteria 1787
771 Ga0501045_0000372 3300049824 Bacteria 26953
772 Ga0501045_0075506 3300049824 Bacteria 2482
773 Ga0501045_0107427 3300049824 Bacteria 2068
774 Ga0501045_0132815 3300049824 Bacteria 1851
775 Ga0501212_065447 3300049851 Bacteria 636
776 nmdc:mga03683_149651_c1 3300050489 Bacteria 1053
777 nmdc:mga03683_58400_c1 3300050489 Bacteria 1626
778 nmdc:mga03n38_3825_c1 3300050490 Bacteria 4892
779 nmdc:mga00v17_104175_c1 3300050491 Bacteria 1794
780 nmdc:mga0yw44_142269_c1 3300050492 Bacteria 1560
781 nmdc:mga0k408_49291_c1 3300050493 Bacteria 2438
782 nmdc:mga06z11_498652_c1 3300050494 Bacteria 738
783 nmdc:mga04h51_2135_c1 3300050495 Bacteria 4633
784 nmdc:mga07m45_1893_c1 3300050496 Bacteria 9652
785 nmdc:mga07m45_64752_c1 3300050496 Bacteria 1585
786 nmdc:mga05p37_1445139_c1 3300050507 Bacteria 689
787 nmdc:mga05p37_1475_c1 3300050507 Bacteria 27330
788 nmdc:mga05p37_1835823_c1 3300050507 Bacteria 583
789 nmdc:mga05p37_208988_c1 3300050507 Bacteria 2360
790 nmdc:mga05p37_306457_c1 3300050507 Bacteria 1884
791 nmdc:mga05p37_347132_c1 3300050507 Bacteria 1748
792 nmdc:mga05p37_71309_c1 3300050507 Bacteria 4273
793 nmdc:mga05p37_769363_c1 3300050507 Bacteria 1058
794 nmdc:mga05p37_863354_c1 3300050507 Bacteria 981
795 nmdc:mga09592_103350_c1 3300050508 Bacteria 2441
796 nmdc:mga09592_1566_c1 3300050508 Bacteria 18396
797 nmdc:mga09592_257724_c1 3300050508 Bacteria 1512
798 nmdc:mga09592_646716_c1 3300050508 Bacteria 903
799 nmdc:mga09592_6982_c1 3300050508 Bacteria 9183
800 nmdc:mga0qj67_1051459_c1 3300050509 Bacteria 637
801 nmdc:mga0qj67_11625_c1 3300050509 Bacteria 6602
802 nmdc:mga0qj67_128777_c1 3300050509 Bacteria 2049
803 nmdc:mga0qj67_1451309_c1 3300050509 Bacteria 529
804 nmdc:mga0qj67_1485354_c1 3300050509 Bacteria 522
805 nmdc:mga0qj67_196433_c1 3300050509 Bacteria 1640
806 nmdc:mga0qj67_308145_c1 3300050509 Bacteria 1282
807 nmdc:mga0qj67_408299_c1 3300050509 Bacteria 1096
808 nmdc:mga0qj67_62102_c1 3300050509 Bacteria 2969
809 nmdc:mga06r32_1127658_c1 3300050510 Bacteria 733
810 nmdc:mga06r32_1166086_c1 3300050510 Bacteria 718
811 nmdc:mga06r32_1383553_c1 3300050510 Bacteria 646
812 nmdc:mga06r32_192855_c1 3300050510 Bacteria 2024
813 nmdc:mga06r32_59746_c1 3300050510 Bacteria 3668
814 nmdc:mga08y16_119157_c1 3300050511 Bacteria 2747
815 nmdc:mga08y16_14684_c1 3300050511 Bacteria 8234
816 nmdc:mga08y16_379628_c1 3300050511 Bacteria 1449
817 nmdc:mga08y16_394757_c1 3300050511 Bacteria 1417
818 nmdc:mga08y16_396805_c1 3300050511 Bacteria 1412
819 nmdc:mga08y16_43170_c1 3300050511 Bacteria 4724
820 nmdc:mga08y16_5848_c1 3300050511 Bacteria 12887
821 nmdc:mga08y16_9319_c1 3300050511 Bacteria 10297
822 nmdc:mga0n895_1315640_c1 3300050512 Bacteria 693
823 nmdc:mga0n895_134457_c1 3300050512 Bacteria 2499
824 nmdc:mga0n895_3063_c1 3300050512 Bacteria 13289
825 nmdc:mga0n895_4921_c1 3300050512 Bacteria 11077
826 nmdc:mga0n895_529_c1 3300050512 Bacteria 26051
827 nmdc:mga0rr50_1174228_c1 3300050513 Bacteria 652
828 nmdc:mga0rr50_1273963_c1 3300050513 Bacteria 624
829 nmdc:mga0rr50_128_c1 3300050513 Bacteria 41482
830 nmdc:mga0rr50_165129_c1 3300050513 Bacteria 1800
831 nmdc:mga0rr50_205455_c1 3300050513 Bacteria 1621
832 nmdc:mga0rr50_376479_c1 3300050513 Bacteria 1197
833 nmdc:mga0rr50_4412_c1 3300050513 Bacteria 8270
834 nmdc:mga08x19_109576_c1 3300050514 Bacteria 1841
835 nmdc:mga08x19_12231_c2 3300050514 Bacteria 4036
836 nmdc:mga08x19_15014_c1 3300050514 Bacteria 4704
837 nmdc:mga08x19_15549_c1 3300050514 Bacteria 4632
838 nmdc:mga08x19_27559_c1 3300050514 Bacteria 3553
839 nmdc:mga08x19_42965_c1 3300050514 Bacteria 2883
840 nmdc:mga08x19_434_c1 3300050514 Bacteria 28646
841 nmdc:mga08x19_463096_c1 3300050514 Bacteria 893
842 nmdc:mga08x19_484770_c1 3300050514 Unclassified 872
843 nmdc:mga0a205_160_c1 3300050515 Bacteria 44269
844 nmdc:mga0a205_289330_c1 3300050515 Bacteria 1513
845 nmdc:mga0a205_49483_c1 3300050515 Bacteria 4057
846 nmdc:mga0sz30_111980_c1 3300050516 Bacteria 1197
847 Ga0495601_0018876 3300053077 Bacteria 4201
848 Ga0495601_0058240 3300053077 Bacteria 2448
849 Ga0495612_0365206 3300053078 Bacteria 653
850 Ga0495595_0197920 3300053084 Bacteria 1000
851 Ga0495619_0024756 3300053085 Bacteria 3851
852 Ga0495619_0908250 3300053085 Bacteria 592
853 Ga0500595_001363 3300053119 Bacteria 13145
854 Ga0500568_0139805 3300053139 Unclassified 898
855 Ga0501084_0003487 3300054114 Bacteria 12782
856 Ga0501084_0068009 3300054114 Bacteria 2982
857 Ga0501084_0330355 3300054114 Bacteria 1288
858 Ga0500661_053594 3300055283 Bacteria 722
859 Ga0590077_099849 3300059426 Bacteria 678
860 Ga0590077_169523 3300059426 Bacteria 525
861 Ga0501082_0003275 3300060353 Bacteria 14136
862 Ga0501082_0006747 3300060353 Bacteria 9925
863 Ga0501082_0804227 3300060353 Bacteria 822
864 Ga0530510_0000087 3300061734 Bacteria 49212
865 Ga0530510_0000160 3300061734 Bacteria 40364
866 Ga0530510_0496633 3300061734 Bacteria 925

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100432821 Ga0068854_1004328212 78
2 3300006852 Ga0075433_11687564 Ga0075433_116875642 79
3 3300007076 Ga0075435_100017646 Ga0075435_1000176466 79
4 3300009094 Ga0111539_10543565 Ga0111539_105435651 79
5 3300031911 Ga0307412_11939303 Ga0307412_119393032 79
6 3300035113 Ga0373936_0140469 Ga0373936_0140469_240_482 79
7 3300005329 Ga0070683_100042576 Ga0070683_1000425762 80
8 3300005330 Ga0070690_100472920 Ga0070690_1004729202 80
9 3300005334 Ga0068869_100426532 Ga0068869_1004265322 80
10 3300005334 Ga0068869_101819970 Ga0068869_1018199702 80
11 3300005336 Ga0070680_100130054 Ga0070680_1001300543 80
12 3300005338 Ga0068868_100932668 Ga0068868_1009326682 80
13 3300005340 Ga0070689_100100857 Ga0070689_1001008573 80
14 3300005340 Ga0070689_100299742 Ga0070689_1002997422 80
15 3300005340 Ga0070689_101242183 Ga0070689_1012421831 80
16 3300005341 Ga0070691_10082614 Ga0070691_100826142 80
17 3300005343 Ga0070687_100246522 Ga0070687_1002465223 80
18 3300005343 Ga0070687_100608565 Ga0070687_1006085652 80
19 3300005345 Ga0070692_10190452 Ga0070692_101904522 80
20 3300005345 Ga0070692_10307961 Ga0070692_103079611 80
21 3300005347 Ga0070668_100044754 Ga0070668_1000447541 80
22 3300005356 Ga0070674_101073413 Ga0070674_1010734132 80
23 3300005364 Ga0070673_100937721 Ga0070673_1009377212 80
24 3300005434 Ga0070709_10706679 Ga0070709_107066792 80
25 3300005434 Ga0070709_11547529 Ga0070709_115475292 80
26 3300005435 Ga0070714_100405452 Ga0070714_1004054522 80
27 3300005437 Ga0070710_10054037 Ga0070710_100540373 80
28 3300005437 Ga0070710_10366270 Ga0070710_103662702 80
29 3300005438 Ga0070701_10120497 Ga0070701_101204972 80
30 3300005438 Ga0070701_10469921 Ga0070701_104699212 80
31 3300005439 Ga0070711_100286534 Ga0070711_1002865342 80
32 3300005440 Ga0070705_100004688 Ga0070705_1000046885 80
33 3300005440 Ga0070705_100025712 Ga0070705_1000257125 80
34 3300005440 Ga0070705_100043610 Ga0070705_1000436103 80
35 3300005441 Ga0070700_101292780 Ga0070700_1012927802 80
36 3300005444 Ga0070694_100006497 Ga0070694_1000064976 80
37 3300005444 Ga0070694_100049845 Ga0070694_1000498453 80
38 3300005444 Ga0070694_100276151 Ga0070694_1002761512 80
39 3300005444 Ga0070694_101830984 Ga0070694_1018309841 80
40 3300005445 Ga0070708_101215005 Ga0070708_1012150052 80
41 3300005467 Ga0070706_100573621 Ga0070706_1005736213 80
42 3300005518 Ga0070699_100351464 Ga0070699_1003514641 80
43 3300005536 Ga0070697_100057369 Ga0070697_1000573695 80
44 3300005543 Ga0070672_100498263 Ga0070672_1004982632 80
45 3300005544 Ga0070686_100411030 Ga0070686_1004110302 80
46 3300005544 Ga0070686_100604058 Ga0070686_1006040581 80
47 3300005545 Ga0070695_100078323 Ga0070695_1000783232 80
48 3300005545 Ga0070695_100306039 Ga0070695_1003060392 80
49 3300005545 Ga0070695_100520744 Ga0070695_1005207442 80
50 3300005546 Ga0070696_100002386 Ga0070696_10000238615 80
51 3300005546 Ga0070696_100433147 Ga0070696_1004331472 80
52 3300005547 Ga0070693_100454006 Ga0070693_1004540062 80
53 3300005547 Ga0070693_100743420 Ga0070693_1007434202 80
54 3300005547 Ga0070693_101560022 Ga0070693_1015600222 80
55 3300005549 Ga0070704_100246246 Ga0070704_1002462463 80
56 3300005549 Ga0070704_100381457 Ga0070704_1003814572 80
57 3300005549 Ga0070704_100427388 Ga0070704_1004273883 80
58 3300005549 Ga0070704_100743609 Ga0070704_1007436092 80
59 3300005615 Ga0070702_100023235 Ga0070702_1000232353 80
60 3300005615 Ga0070702_100311021 Ga0070702_1003110212 80
61 3300005718 Ga0068866_10506576 Ga0068866_105065762 80
62 3300005719 Ga0068861_100240491 Ga0068861_1002404912 80
63 3300005842 Ga0068858_100053157 Ga0068858_1000531572 80
64 3300005842 Ga0068858_100737964 Ga0068858_1007379642 80
65 3300005843 Ga0068860_100646843 Ga0068860_1006468433 80
66 3300006173 Ga0070716_100627921 Ga0070716_1006279212 80
67 3300006173 Ga0070716_100631297 Ga0070716_1006312972 80
68 3300006846 Ga0075430_100033130 Ga0075430_1000331304 80
69 3300006871 Ga0075434_100007245 Ga0075434_1000072457 80
70 3300006880 Ga0075429_100284557 Ga0075429_1002845573 80
71 3300006881 Ga0068865_100664788 Ga0068865_1006647882 80
72 3300006914 Ga0075436_100013730 Ga0075436_1000137303 80
73 3300006914 Ga0075436_100050698 Ga0075436_1000506983 80
74 3300007076 Ga0075435_100021908 Ga0075435_1000219086 80
75 3300007076 Ga0075435_100055502 Ga0075435_1000555024 80
76 3300007076 Ga0075435_101431945 Ga0075435_1014319452 80
77 3300009094 Ga0111539_10011706 Ga0111539_100117065 80
78 3300009094 Ga0111539_10076537 Ga0111539_100765373 80
79 3300009094 Ga0111539_11302360 Ga0111539_113023602 80
80 3300009098 Ga0105245_12826722 Ga0105245_128267222 80
81 3300009147 Ga0114129_10248304 Ga0114129_102483043 80
82 3300009147 Ga0114129_10373163 Ga0114129_103731633 80
83 3300009147 Ga0114129_12217238 Ga0114129_122172382 80
84 3300009176 Ga0105242_10415247 Ga0105242_104152472 80
85 3300013307 Ga0157372_10309715 Ga0157372_103097153 80
86 3300014745 Ga0157377_11461920 Ga0157377_114619201 80
87 3300025898 Ga0207692_10057561 Ga0207692_100575613 80
88 3300025906 Ga0207699_11076180 Ga0207699_110761802 80
89 3300025916 Ga0207663_10272808 Ga0207663_102728082 80
90 3300025916 Ga0207663_10313118 Ga0207663_103131181 80
91 3300025917 Ga0207660_10262698 Ga0207660_102626983 80
92 3300025918 Ga0207662_10097379 Ga0207662_100973792 80
93 3300025918 Ga0207662_11070407 Ga0207662_110704071 80
94 3300025929 Ga0207664_10228422 Ga0207664_102284223 80
95 3300025936 Ga0207670_10169816 Ga0207670_101698163 80
96 3300025938 Ga0207704_11758919 Ga0207704_117589191 80
97 3300025939 Ga0207665_10876608 Ga0207665_108766082 80
98 3300025942 Ga0207689_10323681 Ga0207689_103236812 80
99 3300025942 Ga0207689_10505762 Ga0207689_105057622 80
100 3300025972 Ga0207668_10480330 Ga0207668_104803302 80
101 3300025986 Ga0207658_10730508 Ga0207658_107305082 80
102 3300026035 Ga0207703_10831526 Ga0207703_108315262 80
103 3300026075 Ga0207708_10136147 Ga0207708_101361473 80
104 3300026075 Ga0207708_11869509 Ga0207708_118695092 80
105 3300026118 Ga0207675_100529425 Ga0207675_1005294252 80
106 3300027360 Ga0209969_1001335 Ga0209969_10013354 80
107 3300027364 Ga0209967_1032935 Ga0209967_10329352 80
108 3300027395 Ga0209996_1003376 Ga0209996_10033763 80
109 3300027462 Ga0210000_1024580 Ga0210000_10245802 80
110 3300027543 Ga0209999_1009079 Ga0209999_10090793 80
111 3300027543 Ga0209999_1033388 Ga0209999_10333882 80
112 3300027682 Ga0209971_1000991 Ga0209971_10009915 80
113 3300027695 Ga0209966_1001526 Ga0209966_10015266 80
114 3300027717 Ga0209998_10009393 Ga0209998_100093933 80
115 3300027876 Ga0209974_10021299 Ga0209974_100212992 80
116 3300027907 Ga0207428_10153594 Ga0207428_101535943 80
117 3300031250 Ga0265331_10004122 Ga0265331_100041221 80
118 3300031548 Ga0307408_100076693 Ga0307408_1000766933 80
119 3300031548 Ga0307408_100187661 Ga0307408_1001876613 80
120 3300031731 Ga0307405_10318514 Ga0307405_103185143 80
121 3300031731 Ga0307405_11603465 Ga0307405_116034651 80
122 3300031901 Ga0307406_11273274 Ga0307406_112732742 80
123 3300031911 Ga0307412_10725979 Ga0307412_107259792 80
124 3300032002 Ga0307416_100232215 Ga0307416_1002322153 80
125 3300032002 Ga0307416_102818127 Ga0307416_1028181271 80
126 3300032005 Ga0307411_10161476 Ga0307411_101614763 80
127 3300034816 Ga0373930_0152478 Ga0373930_0152478_300_548 80
128 3300035085 Ga0373929_0062317 Ga0373929_0062317_13_264 80
129 3300035086 Ga0373934_0060537 Ga0373934_0060537_570_815 80
130 3300035113 Ga0373936_0181788 Ga0373936_0181788_421_669 80
131 3300035116 Ga0373945_0509761 Ga0373945_0509761_186_431 80
132 3300035117 Ga0373953_0021168 Ga0373953_0021168_919_1164 80
133 3300035118 Ga0373954_0011161 Ga0373954_0011161_379_624 80
134 3300035119 Ga0373956_0025350 Ga0373956_0025350_1536_1781 80
135 3300035121 Ga0373960_0254437 Ga0373960_0254437_163_408 80
136 3300035170 Ga0373943_0574066 Ga0373943_0574066_186_431 80
137 3300035171 Ga0373946_0495805 Ga0373946_0495805_14_262 80
138 3300035172 Ga0373955_0031742 Ga0373955_0031742_570_815 80
139 3300035241 Ga0373961_0300507 Ga0373961_0300507_295_543 80
140 3300035242 Ga0373962_0065905 Ga0373962_0065905_336_584 80
141 3300035398 Ga0316574_0330547 Ga0316574_0330547_570_815 80
142 3300035410 Ga0373924_0003642 Ga0373924_0003642_3656_3901 80
143 3300035692 Ga0373935_0062741 Ga0373935_0062741_731_976 80
144 3300035724 Ga0373933_0013854 Ga0373933_0013854_1364_1609 80
145 3300035725 Ga0373947_0939040 Ga0373947_0939040_125_370 80
146 3300036401 Ga0373937_0120336 Ga0373937_0120336_976_1221 80
147 3300036712 Ga0316584_0044808 Ga0316584_0044808_713_958 80
148 3300039438 Ga0436360_0520014 Ga0436360_0520014_919_1167 80
149 3300039438 Ga0436360_1127633 Ga0436360_1127633_189_437 80
150 3300042001 Ga0439441_000435 Ga0439441_000435_1141_1386 80
151 3300042001 Ga0439441_129826 Ga0439441_129826_79_327 80
152 3300042003 Ga0439443_000936 Ga0439443_000936_146_391 80
153 3300042009 Ga0439451_024285 Ga0439451_024285_779_1024 80
154 3300042436 Ga0439435_0000533 Ga0439435_0000533_2121_2366 80
155 3300042437 Ga0439444_0001431 Ga0439444_0001431_1378_1623 80
156 3300042439 Ga0439464_0134296 Ga0439464_0134296_346_591 80
157 3300042461 Ga0439460_0000168 Ga0439460_0000168_7385_7630 80
158 3300045051 Ga0451576_0076559 Ga0451576_0076559_2381_2632 80
159 3300045976 Ga0466967_1410853 Ga0466967_1410853_171_416 80
160 3300046459 Ga0495629_0765326 Ga0495629_0765326_327_575 80
161 3300046462 Ga0495651_0566299 Ga0495651_0566299_288_533 80
162 3300046476 Ga0495662_0014882 Ga0495662_0014882_339_587 80
163 3300046476 Ga0495662_0659047 Ga0495662_0659047_49_294 80
164 3300046511 Ga0495608_0000439 Ga0495608_0000439_13204_13452 80
165 3300046511 Ga0495608_0165747 Ga0495608_0165747_778_1023 80
166 3300046514 Ga0495618_0208052 Ga0495618_0208052_283_531 80
167 3300046516 Ga0495628_0001253 Ga0495628_0001253_21158_21406 80
168 3300046516 Ga0495628_0256099 Ga0495628_0256099_430_675 80
169 3300046517 Ga0495630_0003035 Ga0495630_0003035_2904_3152 80
170 3300046517 Ga0495630_0005926 Ga0495630_0005926_2069_2317 80
171 3300046517 Ga0495630_0311486 Ga0495630_0311486_778_1023 80
172 3300046529 Ga0495652_0068067 Ga0495652_0068067_653_898 80
173 3300046533 Ga0495640_0000418 Ga0495640_0000418_23862_24110 80
174 3300046533 Ga0495640_0295934 Ga0495640_0295934_156_401 80
175 3300046535 Ga0495586_0001587 Ga0495586_0001587_694_942 80
176 3300046539 Ga0495621_0017526 Ga0495621_0017526_161_409 80
177 3300046539 Ga0495621_0510295 Ga0495621_0510295_149_394 80
178 3300046559 Ga0495667_0010719 Ga0495667_0010719_5259_5507 80
179 3300046559 Ga0495667_0250774 Ga0495667_0250774_783_1028 80
180 3300046642 Ga0495634_0003074 Ga0495634_0003074_5378_5626 80
181 3300046642 Ga0495634_0377511 Ga0495634_0377511_399_647 80
182 3300046663 Ga0495635_0061769 Ga0495635_0061769_285_530 80
183 3300046678 Ga0495599_0015851 Ga0495599_0015851_1085_1333 80
184 3300046678 Ga0495599_0092952 Ga0495599_0092952_1524_1772 80
185 3300046681 Ga0495647_0251175 Ga0495647_0251175_219_467 80
186 3300046683 Ga0495658_0001390 Ga0495658_0001390_6461_6709 80
187 3300046684 Ga0495669_0041437 Ga0495669_0041437_767_1015 80
188 3300046689 Ga0495613_0003181 Ga0495613_0003181_6787_7035 80
189 3300046690 Ga0495624_0045756 Ga0495624_0045756_2396_2644 80
190 3300046690 Ga0495624_0075287 Ga0495624_0075287_1111_1359 80
191 3300046809 Ga0495600_0010182 Ga0495600_0010182_92_340 80
192 3300046809 Ga0495600_0202265 Ga0495600_0202265_792_1037 80
193 3300047315 Ga0495581_0298821 Ga0495581_0298821_454_702 80
194 3300047317 Ga0495604_0639811 Ga0495604_0639811_320_565 80
195 3300047319 Ga0495674_0280489 Ga0495674_0280489_1035_1280 80
196 3300047319 Ga0495674_0285853 Ga0495674_0285853_11_259 80
197 3300047322 Ga0495680_0043168 Ga0495680_0043168_2457_2702 80
198 3300047444 Ga0495675_0129817 Ga0495675_0129817_1110_1358 80
199 3300047471 Ga0495684_0801372 Ga0495684_0801372_290_538 80
200 3300048088 Ga0495602_0271182 Ga0495602_0271182_743_988 80
201 3300048089 Ga0495614_0408506 Ga0495614_0408506_92_340 80
202 3300049520 Ga0501297_051530 Ga0501297_051530_233_487 80
203 3300049522 Ga0501299_171738 Ga0501299_171738_65_310 80
204 3300049570 Ga0501033_0619462 Ga0501033_0619462_189_434 80
205 3300049572 Ga0501036_0100839 Ga0501036_0100839_2055_2300 80
206 3300049572 Ga0501036_1475469 Ga0501036_1475469_210_455 80
207 3300049574 Ga0501038_0290282 Ga0501038_0290282_478_723 80
208 3300049574 Ga0501038_0431277 Ga0501038_0431277_415_660 80
209 3300049575 Ga0501039_0045851 Ga0501039_0045851_739_984 80
210 3300049575 Ga0501039_0048437 Ga0501039_0048437_1904_2149 80
211 3300049575 Ga0501039_0428170 Ga0501039_0428170_376_618 80
212 3300049576 Ga0501040_0012950 Ga0501040_0012950_44_289 80
213 3300049576 Ga0501040_0363040 Ga0501040_0363040_425_670 80
214 3300049577 Ga0501041_0023023 Ga0501041_0023023_944_1189 80
215 3300049577 Ga0501041_0081874 Ga0501041_0081874_1432_1677 80
216 3300049577 Ga0501041_0467832 Ga0501041_0467832_52_294 80
217 3300049578 Ga0501042_0025550 Ga0501042_0025550_2840_3085 80
218 3300049578 Ga0501042_0614759 Ga0501042_0614759_320_565 80
219 3300049579 Ga0501043_0305142 Ga0501043_0305142_783_1028 80
220 3300049580 Ga0501046_0103451 Ga0501046_0103451_1704_1949 80
221 3300049580 Ga0501046_0141756 Ga0501046_0141756_174_419 80
222 3300049582 Ga0501048_0008280 Ga0501048_0008280_3526_3771 80
223 3300049584 Ga0501068_0408253 Ga0501068_0408253_603_845 80
224 3300049587 Ga0501071_0020882 Ga0501071_0020882_2763_3008 80
225 3300049588 Ga0501072_0008225 Ga0501072_0008225_4989_5234 80
226 3300049588 Ga0501072_0758442 Ga0501072_0758442_169_411 80
227 3300049590 Ga0501074_0170602 Ga0501074_0170602_939_1184 80
228 3300049591 Ga0501075_0000179 Ga0501075_0000179_24947_25192 80
229 3300049591 Ga0501075_0070543 Ga0501075_0070543_1097_1342 80
230 3300049591 Ga0501075_0764436 Ga0501075_0764436_416_658 80
231 3300049592 Ga0501076_0002539 Ga0501076_0002539_7082_7327 80
232 3300049592 Ga0501076_0759579 Ga0501076_0759579_158_400 80
233 3300049593 Ga0501077_0016526 Ga0501077_0016526_3909_4154 80
234 3300049656 Ga0501209_101302 Ga0501209_101302_87_332 80
235 3300049661 Ga0501217_061056 Ga0501217_061056_611_856 80
236 3300049669 Ga0501235_045511 Ga0501235_045511_476_721 80
237 3300049741 Ga0501079_0000208 Ga0501079_0000208_13842_14087 80
238 3300049741 Ga0501079_0021705 Ga0501079_0021705_2575_2820 80
239 3300049742 Ga0501080_0083308 Ga0501080_0083308_1559_1804 80
240 3300049743 Ga0501081_0020455 Ga0501081_0020455_3758_4003 80
241 3300049779 Ga0501283_059842 Ga0501283_059842_191_436 80
242 3300049822 Ga0501035_0465516 Ga0501035_0465516_117_362 80
243 3300049824 Ga0501045_0075506 Ga0501045_0075506_486_731 80
244 3300049824 Ga0501045_0132815 Ga0501045_0132815_1061_1306 80
245 3300049851 Ga0501212_065447 Ga0501212_065447_74_319 80
246 3300050507 nmdc:mga05p37_1835823_c1 nmdc:mga05p37_1835823_c1_309_554 80
247 3300050507 nmdc:mga05p37_306457_c1 nmdc:mga05p37_306457_c1_1159_1407 80
248 3300050507 nmdc:mga05p37_347132_c1 nmdc:mga05p37_347132_c1_1006_1254 80
249 3300050508 nmdc:mga09592_103350_c1 nmdc:mga09592_103350_c1_12_260 80
250 3300050509 nmdc:mga0qj67_128777_c1 nmdc:mga0qj67_128777_c1_1791_2036 80
251 3300050511 nmdc:mga08y16_379628_c1 nmdc:mga08y16_379628_c1_738_986 80
252 3300050511 nmdc:mga08y16_5848_c1 nmdc:mga08y16_5848_c1_3527_3775 80
253 3300050513 nmdc:mga0rr50_1273963_c1 nmdc:mga0rr50_1273963_c1_261_506 80
254 3300053077 Ga0495601_0018876 Ga0495601_0018876_2811_3059 80
255 3300053077 Ga0495601_0058240 Ga0495601_0058240_1303_1551 80
256 3300053078 Ga0495612_0365206 Ga0495612_0365206_168_416 80
257 3300053084 Ga0495595_0197920 Ga0495595_0197920_237_485 80
258 3300053085 Ga0495619_0908250 Ga0495619_0908250_128_373 80
259 3300054114 Ga0501084_0068009 Ga0501084_0068009_2687_2932 80
260 3300060353 Ga0501082_0006747 Ga0501082_0006747_6944_7189 80
261 3300060353 Ga0501082_0804227 Ga0501082_0804227_162_407 80
262 3300061734 Ga0530510_0000160 Ga0530510_0000160_11435_11680 80
263 3300061734 Ga0530510_0496633 Ga0530510_0496633_351_596 80
264 iso_pu_bacteria 8002745576 8002746986 80
265 3300005459 Ga0068867_100022379 Ga0068867_1000223794 82
266 3300006844 Ga0075428_100479135 Ga0075428_1004791351 82
267 3300006846 Ga0075430_100000730 Ga0075430_1000007303 82
268 3300025901 Ga0207688_10675278 Ga0207688_106752781 82
269 3300025917 Ga0207660_10195231 Ga0207660_101952311 82
270 3300035691 Ga0373931_0448778 Ga0373931_0448778_107_358 82
271 3300042156 Ga0439446_0051165 Ga0439446_0051165_28_288 82
272 3300049570 Ga0501033_0290772 Ga0501033_0290772_731_991 82
273 3300049576 Ga0501040_0010067 Ga0501040_0010067_374_634 82
274 3300049577 Ga0501041_0194884 Ga0501041_0194884_173_433 82
275 3300049588 Ga0501072_0180004 Ga0501072_0180004_1019_1279 82
276 3300049822 Ga0501035_0409561 Ga0501035_0409561_356_616 82
277 3300050509 nmdc:mga0qj67_1485354_c1 nmdc:mga0qj67_1485354_c1_11_271 82
278 3300050509 nmdc:mga0qj67_62102_c1 nmdc:mga0qj67_62102_c1_134_394 82
279 3300050510 nmdc:mga06r32_192855_c1 nmdc:mga06r32_192855_c1_1347_1607 82
280 3300053139 Ga0500568_0139805 Ga0500568_0139805_457_708 82
281 3300005457 Ga0070662_100383642 Ga0070662_1003836421 83
282 3300005458 Ga0070681_10445988 Ga0070681_104459881 83
283 3300005467 Ga0070706_100355782 Ga0070706_1003557823 83
284 3300009174 Ga0105241_10283579 Ga0105241_102835792 83
285 3300025913 Ga0207695_10958872 Ga0207695_109588721 83
286 3300025929 Ga0207664_10454001 Ga0207664_104540011 83
287 3300025933 Ga0207706_11089290 Ga0207706_110892902 83
288 3300048924 Ga0496121_0011858 Ga0496121_0011858_7573_7836 83
289 3300049570 Ga0501033_0000364 Ga0501033_0000364_38308_38562 83
290 3300049572 Ga0501036_0003934 Ga0501036_0003934_5885_6139 83
291 3300049575 Ga0501039_0049647 Ga0501039_0049647_1492_1746 83
292 3300049580 Ga0501046_0035383 Ga0501046_0035383_628_882 83
293 3300049824 Ga0501045_0107427 Ga0501045_0107427_744_998 83
294 3300050513 nmdc:mga0rr50_165129_c1 nmdc:mga0rr50_165129_c1_457_708 83
295 iso_pu_bacteria 639633007 639787967 83
296 3300005336 Ga0070680_100866695 Ga0070680_1008666952 84
297 3300005435 Ga0070714_100005253 Ga0070714_1000052538 84
298 3300005445 Ga0070708_100911355 Ga0070708_1009113552 84
299 3300005459 Ga0068867_100724918 Ga0068867_1007249182 84
300 3300005467 Ga0070706_100137927 Ga0070706_1001379274 84
301 3300005536 Ga0070697_100053069 Ga0070697_1000530694 84
302 3300005536 Ga0070697_100364181 Ga0070697_1003641813 84
303 3300005546 Ga0070696_100118825 Ga0070696_1001188253 84
304 3300005546 Ga0070696_100343812 Ga0070696_1003438122 84
305 3300005549 Ga0070704_100211114 Ga0070704_1002111142 84
306 3300005615 Ga0070702_100379878 Ga0070702_1003798782 84
307 3300006163 Ga0070715_10990523 Ga0070715_109905232 84
308 3300006186 Ga0075369_10126071 Ga0075369_101260712 84
309 3300006195 Ga0075366_10594528 Ga0075366_105945282 84
310 3300006844 Ga0075428_101013708 Ga0075428_1010137082 84
311 3300006846 Ga0075430_100009943 Ga0075430_1000099435 84
312 3300006847 Ga0075431_100345869 Ga0075431_1003458692 84
313 3300006852 Ga0075433_10057667 Ga0075433_100576672 84
314 3300006871 Ga0075434_100362020 Ga0075434_1003620202 84
315 3300006914 Ga0075436_100025072 Ga0075436_1000250723 84
316 3300006914 Ga0075436_100497326 Ga0075436_1004973262 84
317 3300007076 Ga0075435_100024406 Ga0075435_1000244066 84
318 3300009036 Ga0105244_10097012 Ga0105244_100970123 84
319 3300009093 Ga0105240_10905603 Ga0105240_109056032 84
320 3300009094 Ga0111539_10486917 Ga0111539_104869173 84
321 3300013104 Ga0157370_10003517 Ga0157370_100035177 84
322 3300017792 Ga0163161_10467650 Ga0163161_104676502 84
323 3300025735 Ga0207713_1061471 Ga0207713_10614712 84
324 3300025917 Ga0207660_10340980 Ga0207660_103409802 84
325 3300031239 Ga0265328_10051733 Ga0265328_100517332 84
326 3300031239 Ga0265328_10222646 Ga0265328_102226462 84
327 3300031250 Ga0265331_10003722 Ga0265331_100037225 84
328 3300031251 Ga0265327_10034803 Ga0265327_100348032 84
329 3300031251 Ga0265327_10257525 Ga0265327_102575252 84
330 3300031344 Ga0265316_11043032 Ga0265316_110430321 84
331 3300031548 Ga0307408_100543101 Ga0307408_1005431011 84
332 3300031548 Ga0307408_100567143 Ga0307408_1005671432 84
333 3300031730 Ga0307516_10164543 Ga0307516_101645432 84
334 3300032002 Ga0307416_100409182 Ga0307416_1004091823 84
335 3300032002 Ga0307416_102862261 Ga0307416_1028622612 84
336 3300032005 Ga0307411_10656028 Ga0307411_106560282 84
337 3300032126 Ga0307415_100880296 Ga0307415_1008802962 84
338 3300035112 Ga0373932_0009214 Ga0373932_0009214_684_944 84
339 3300035115 Ga0373941_0114359 Ga0373941_0114359_361_621 84
340 3300035172 Ga0373955_0732922 Ga0373955_0732922_304_561 84
341 3300035691 Ga0373931_0536838 Ga0373931_0536838_248_508 84
342 3300039062 Ga0400483_086891 Ga0400483_086891_1718_1972 84
343 3300039062 Ga0400483_151143 Ga0400483_151143_132048_132305 84
344 3300039062 Ga0400483_174877 Ga0400483_174877_1114_1368 84
345 3300039447 Ga0436361_0438991 Ga0436361_0438991_48157_48468 84
346 3300042876 Ga0451577_0001239 Ga0451577_0001239_18124_18381 84
347 3300042876 Ga0451577_0035786 Ga0451577_0035786_3969_4226 84
348 3300042876 Ga0451577_0708124 Ga0451577_0708124_462_719 84
349 3300044673 Ga0453683_0622793 Ga0453683_0622793_349_606 84
350 3300044712 Ga0453684_0000694 Ga0453684_0000694_101770_102027 84
351 3300044712 Ga0453684_0070950 Ga0453684_0070950_448_705 84
352 3300044712 Ga0453684_0088552 Ga0453684_0088552_3564_3821 84
353 3300045051 Ga0451576_0000909 Ga0451576_0000909_14163_14420 84
354 3300045051 Ga0451576_0001279 Ga0451576_0001279_26966_27223 84
355 3300045051 Ga0451576_0001966 Ga0451576_0001966_16963_17220 84
356 3300045051 Ga0451576_0002087 Ga0451576_0002087_12759_13016 84
357 3300045051 Ga0451576_0271418 Ga0451576_0271418_559_816 84
358 3300045051 Ga0451576_1121199 Ga0451576_1121199_371_634 84
359 3300045051 Ga0451576_1908921 Ga0451576_1908921_20_277 84
360 3300046539 Ga0495621_0021150 Ga0495621_0021150_1223_1480 84
361 3300046539 Ga0495621_0314817 Ga0495621_0314817_14_274 84
362 3300048924 Ga0496121_0041821 Ga0496121_0041821_3541_3798 84
363 3300049568 Ga0501031_0843241 Ga0501031_0843241_106_363 84
364 3300049570 Ga0501033_0000897 Ga0501033_0000897_19881_20180 84
365 3300049573 Ga0501037_0578017 Ga0501037_0578017_42_341 84
366 3300049574 Ga0501038_0119876 Ga0501038_0119876_1224_1523 84
367 3300049574 Ga0501038_0308845 Ga0501038_0308845_582_881 84
368 3300049575 Ga0501039_1139179 Ga0501039_1139179_183_437 84
369 3300049579 Ga0501043_0364372 Ga0501043_0364372_126_425 84
370 3300049579 Ga0501043_0466224 Ga0501043_0466224_598_897 84
371 3300049581 Ga0501047_0377969 Ga0501047_0377969_633_890 84
372 3300049592 Ga0501076_0373052 Ga0501076_0373052_18_275 84
373 3300049742 Ga0501080_0012555 Ga0501080_0012555_3773_4030 84
374 3300049822 Ga0501035_0000199 Ga0501035_0000199_58618_58917 84
375 3300049823 Ga0501044_0064530 Ga0501044_0064530_1251_1550 84
376 3300049823 Ga0501044_0078329 Ga0501044_0078329_761_1060 84
377 3300049823 Ga0501044_0131650 Ga0501044_0131650_1149_1403 84
378 3300050507 nmdc:mga05p37_863354_c1 nmdc:mga05p37_863354_c1_170_430 84
379 3300050509 nmdc:mga0qj67_11625_c1 nmdc:mga0qj67_11625_c1_5967_6245 84
380 3300050510 nmdc:mga06r32_1383553_c1 nmdc:mga06r32_1383553_c1_17_295 84
381 3300050511 nmdc:mga08y16_396805_c1 nmdc:mga08y16_396805_c1_352_612 84
382 3300050512 nmdc:mga0n895_134457_c1 nmdc:mga0n895_134457_c1_2052_2312 84
383 3300050513 nmdc:mga0rr50_376479_c1 nmdc:mga0rr50_376479_c1_401_661 84
384 3300050514 nmdc:mga08x19_12231_c2 nmdc:mga08x19_12231_c2_2183_2443 84
385 3300050514 nmdc:mga08x19_463096_c1 nmdc:mga08x19_463096_c1_337_597 84
386 3300050515 nmdc:mga0a205_49483_c1 nmdc:mga0a205_49483_c1_2891_3151 84
387 3300053119 Ga0500595_001363 Ga0500595_001363_8660_8917 84
388 3300055283 Ga0500661_053594 Ga0500661_053594_188_445 84
389 3300005295 Ga0065707_10028116 Ga0065707_100281162 85
390 3300005295 Ga0065707_10871671 Ga0065707_108716712 85
391 3300005328 Ga0070676_10103520 Ga0070676_101035203 85
392 3300005328 Ga0070676_11251514 Ga0070676_112515141 85
393 3300005328 Ga0070676_11415428 Ga0070676_114154282 85
394 3300005330 Ga0070690_100064489 Ga0070690_1000644893 85
395 3300005330 Ga0070690_100687442 Ga0070690_1006874422 85
396 3300005335 Ga0070666_10054465 Ga0070666_100544654 85
397 3300005336 Ga0070680_100001647 Ga0070680_10000164711 85
398 3300005336 Ga0070680_100014660 Ga0070680_1000146604 85
399 3300005336 Ga0070680_100348645 Ga0070680_1003486452 85
400 3300005336 Ga0070680_100461677 Ga0070680_1004616771 85
401 3300005338 Ga0068868_100398664 Ga0068868_1003986642 85
402 3300005340 Ga0070689_101798149 Ga0070689_1017981492 85
403 3300005343 Ga0070687_100028343 Ga0070687_1000283434 85
404 3300005345 Ga0070692_10009924 Ga0070692_100099246 85
405 3300005345 Ga0070692_10026413 Ga0070692_100264134 85
406 3300005345 Ga0070692_10120828 Ga0070692_101208283 85
407 3300005353 Ga0070669_100002067 Ga0070669_10000206718 85
408 3300005354 Ga0070675_100022309 Ga0070675_1000223094 85
409 3300005354 Ga0070675_100026908 Ga0070675_1000269082 85
410 3300005354 Ga0070675_101571969 Ga0070675_1015719691 85
411 3300005355 Ga0070671_100120039 Ga0070671_1001200393 85
412 3300005356 Ga0070674_100068540 Ga0070674_1000685402 85
413 3300005364 Ga0070673_100170665 Ga0070673_1001706653 85
414 3300005364 Ga0070673_100409789 Ga0070673_1004097892 85
415 3300005365 Ga0070688_100181417 Ga0070688_1001814172 85
416 3300005365 Ga0070688_100942601 Ga0070688_1009426011 85
417 3300005367 Ga0070667_100581313 Ga0070667_1005813132 85
418 3300005406 Ga0070703_10011852 Ga0070703_100118524 85
419 3300005438 Ga0070701_11135196 Ga0070701_111351962 85
420 3300005439 Ga0070711_100250517 Ga0070711_1002505173 85
421 3300005440 Ga0070705_100008519 Ga0070705_1000085193 85
422 3300005440 Ga0070705_100414441 Ga0070705_1004144412 85
423 3300005441 Ga0070700_100027816 Ga0070700_1000278163 85
424 3300005441 Ga0070700_100140900 Ga0070700_1001409004 85
425 3300005444 Ga0070694_100139566 Ga0070694_1001395662 85
426 3300005444 Ga0070694_100426276 Ga0070694_1004262763 85
427 3300005444 Ga0070694_100618473 Ga0070694_1006184732 85
428 3300005456 Ga0070678_100805798 Ga0070678_1008057982 85
429 3300005456 Ga0070678_101916247 Ga0070678_1019162471 85
430 3300005458 Ga0070681_10000001 Ga0070681_10000001162 85
431 3300005458 Ga0070681_10094117 Ga0070681_100941174 85
432 3300005458 Ga0070681_11245986 Ga0070681_112459862 85
433 3300005459 Ga0068867_100604498 Ga0068867_1006044982 85
434 3300005467 Ga0070706_100326868 Ga0070706_1003268683 85
435 3300005471 Ga0070698_100965601 Ga0070698_1009656012 85
436 3300005530 Ga0070679_100002513 Ga0070679_10000251310 85
437 3300005530 Ga0070679_100198136 Ga0070679_1001981364 85
438 3300005535 Ga0070684_100305627 Ga0070684_1003056273 85
439 3300005536 Ga0070697_100004494 Ga0070697_10000449413 85
440 3300005536 Ga0070697_100226051 Ga0070697_1002260512 85
441 3300005536 Ga0070697_101320195 Ga0070697_1013201952 85
442 3300005539 Ga0068853_100028005 Ga0068853_1000280054 85
443 3300005544 Ga0070686_100007410 Ga0070686_1000074105 85
444 3300005545 Ga0070695_100257651 Ga0070695_1002576512 85
445 3300005546 Ga0070696_100008433 Ga0070696_1000084337 85
446 3300005546 Ga0070696_100093635 Ga0070696_1000936351 85
447 3300005563 Ga0068855_100004637 Ga0068855_1000046379 85
448 3300005577 Ga0068857_100193769 Ga0068857_1001937693 85
449 3300005577 Ga0068857_101464925 Ga0068857_1014649252 85
450 3300005615 Ga0070702_100002197 Ga0070702_1000021973 85
451 3300005615 Ga0070702_100077339 Ga0070702_1000773394 85
452 3300005615 Ga0070702_101897332 Ga0070702_1018973322 85
453 3300005617 Ga0068859_100596615 Ga0068859_1005966152 85
454 3300005718 Ga0068866_10012298 Ga0068866_100122983 85
455 3300005719 Ga0068861_100009213 Ga0068861_1000092134 85
456 3300005719 Ga0068861_102003632 Ga0068861_1020036322 85
457 3300005840 Ga0068870_10341645 Ga0068870_103416452 85
458 3300005841 Ga0068863_100024667 Ga0068863_1000246677 85
459 3300005842 Ga0068858_102348515 Ga0068858_1023485152 85
460 3300005843 Ga0068860_102418809 Ga0068860_1024188092 85
461 3300005844 Ga0068862_100074102 Ga0068862_1000741024 85
462 3300006028 Ga0070717_11387854 Ga0070717_113878542 85
463 3300006038 Ga0075365_10103843 Ga0075365_101038434 85
464 3300006042 Ga0075368_10010084 Ga0075368_100100844 85
465 3300006048 Ga0075363_100034829 Ga0075363_1000348293 85
466 3300006051 Ga0075364_10150137 Ga0075364_101501374 85
467 3300006175 Ga0070712_101566888 Ga0070712_1015668882 85
468 3300006177 Ga0075362_10006044 Ga0075362_100060446 85
469 3300006177 Ga0075362_10133282 Ga0075362_101332822 85
470 3300006178 Ga0075367_10061280 Ga0075367_100612803 85
471 3300006186 Ga0075369_10057250 Ga0075369_100572502 85
472 3300006195 Ga0075366_10039707 Ga0075366_100397074 85
473 3300006237 Ga0097621_100713566 Ga0097621_1007135662 85
474 3300006353 Ga0075370_10043340 Ga0075370_100433404 85
475 3300006358 Ga0068871_100004840 Ga0068871_10000484012 85
476 3300006844 Ga0075428_100118548 Ga0075428_1001185484 85
477 3300006844 Ga0075428_100164836 Ga0075428_1001648364 85
478 3300006844 Ga0075428_100261508 Ga0075428_1002615083 85
479 3300006844 Ga0075428_101855871 Ga0075428_1018558712 85
480 3300006846 Ga0075430_100041067 Ga0075430_1000410676 85
481 3300006846 Ga0075430_100659057 Ga0075430_1006590572 85
482 3300006846 Ga0075430_100705892 Ga0075430_1007058922 85
483 3300006847 Ga0075431_100735627 Ga0075431_1007356272 85
484 3300006847 Ga0075431_100943170 Ga0075431_1009431702 85
485 3300006847 Ga0075431_101658512 Ga0075431_1016585121 85
486 3300006871 Ga0075434_100000002 Ga0075434_10000000298 85
487 3300006880 Ga0075429_100121187 Ga0075429_1001211873 85
488 3300006880 Ga0075429_100159017 Ga0075429_1001590173 85
489 3300006880 Ga0075429_101514493 Ga0075429_1015144932 85
490 3300006881 Ga0068865_100034667 Ga0068865_1000346674 85
491 3300006914 Ga0075436_100002239 Ga0075436_10000223910 85
492 3300006914 Ga0075436_100013879 Ga0075436_1000138792 85
493 3300006914 Ga0075436_100103101 Ga0075436_1001031013 85
494 3300006931 Ga0097620_100596576 Ga0097620_1005965762 85
495 3300007076 Ga0075435_100006511 Ga0075435_10000651111 85
496 3300007076 Ga0075435_101641423 Ga0075435_1016414232 85
497 3300009092 Ga0105250_10051134 Ga0105250_100511342 85
498 3300009094 Ga0111539_10017672 Ga0111539_100176725 85
499 3300009094 Ga0111539_10059932 Ga0111539_100599323 85
500 3300009094 Ga0111539_10077714 Ga0111539_100777146 85
501 3300009094 Ga0111539_10110814 Ga0111539_101108143 85
502 3300009098 Ga0105245_10000221 Ga0105245_1000022126 85
503 3300009098 Ga0105245_11371883 Ga0105245_113718831 85
504 3300009147 Ga0114129_10003624 Ga0114129_100036244 85
505 3300009147 Ga0114129_10097900 Ga0114129_100979005 85
506 3300009147 Ga0114129_10587238 Ga0114129_105872383 85
507 3300009147 Ga0114129_10832561 Ga0114129_108325612 85
508 3300009147 Ga0114129_11768688 Ga0114129_117686882 85
509 3300009147 Ga0114129_13070298 Ga0114129_130702981 85
510 3300009148 Ga0105243_10000288 Ga0105243_1000028826 85
511 3300009148 Ga0105243_10006310 Ga0105243_100063106 85
512 3300009148 Ga0105243_11016653 Ga0105243_110166531 85
513 3300009174 Ga0105241_10008452 Ga0105241_100084527 85
514 3300009176 Ga0105242_10007197 Ga0105242_100071979 85
515 3300009177 Ga0105248_10076185 Ga0105248_100761855 85
516 3300009177 Ga0105248_10207763 Ga0105248_102077634 85
517 3300009545 Ga0105237_10227743 Ga0105237_102277434 85
518 3300009551 Ga0105238_11111166 Ga0105238_111111662 85
519 3300009553 Ga0105249_10005927 Ga0105249_100059279 85
520 3300009553 Ga0105249_10022286 Ga0105249_100222863 85
521 3300010375 Ga0105239_10012819 Ga0105239_100128194 85
522 3300010375 Ga0105239_10594092 Ga0105239_105940922 85
523 3300010375 Ga0105239_12591736 Ga0105239_125917362 85
524 3300011119 Ga0105246_10207704 Ga0105246_102077043 85
525 3300013100 Ga0157373_10696520 Ga0157373_106965202 85
526 3300013102 Ga0157371_10419793 Ga0157371_104197932 85
527 3300013296 Ga0157374_11960119 Ga0157374_119601192 85
528 3300013297 Ga0157378_10003188 Ga0157378_1000318811 85
529 3300013297 Ga0157378_12000765 Ga0157378_120007652 85
530 3300013306 Ga0163162_10056188 Ga0163162_100561883 85
531 3300013307 Ga0157372_12509286 Ga0157372_125092862 85
532 3300013308 Ga0157375_10468627 Ga0157375_104686272 85
533 3300013308 Ga0157375_11348671 Ga0157375_113486711 85
534 3300014326 Ga0157380_10009333 Ga0157380_100093339 85
535 3300014326 Ga0157380_10098992 Ga0157380_100989923 85
536 3300014326 Ga0157380_11504193 Ga0157380_115041932 85
537 3300014745 Ga0157377_10013623 Ga0157377_100136236 85
538 3300014745 Ga0157377_10264271 Ga0157377_102642713 85
539 3300014745 Ga0157377_10750923 Ga0157377_107509232 85
540 3300014968 Ga0157379_10106150 Ga0157379_101061504 85
541 3300014968 Ga0157379_11828707 Ga0157379_118287072 85
542 3300014969 Ga0157376_10001746 Ga0157376_100017462 85
543 3300014969 Ga0157376_10286919 Ga0157376_102869193 85
544 3300021377 Ga0213874_10005372 Ga0213874_100053724 85
545 3300021377 Ga0213874_10013425 Ga0213874_100134253 85
546 3300021377 Ga0213874_10299369 Ga0213874_102993692 85
547 3300021384 Ga0213876_10001256 Ga0213876_100012565 85
548 3300021384 Ga0213876_10036599 Ga0213876_100365993 85
549 3300025315 Ga0207697_10144651 Ga0207697_101446512 85
550 3300025893 Ga0207682_10418066 Ga0207682_104180662 85
551 3300025898 Ga0207692_10506127 Ga0207692_105061272 85
552 3300025899 Ga0207642_10003522 Ga0207642_100035225 85
553 3300025907 Ga0207645_10118144 Ga0207645_101181443 85
554 3300025908 Ga0207643_10244328 Ga0207643_102443282 85
555 3300025910 Ga0207684_10220114 Ga0207684_102201143 85
556 3300025910 Ga0207684_10567981 Ga0207684_105679811 85
557 3300025910 Ga0207684_10770131 Ga0207684_107701312 85
558 3300025912 Ga0207707_10000011 Ga0207707_10000011279 85
559 3300025915 Ga0207693_10329762 Ga0207693_103297623 85
560 3300025916 Ga0207663_10397729 Ga0207663_103977292 85
561 3300025917 Ga0207660_10000737 Ga0207660_1000073728 85
562 3300025917 Ga0207660_10030384 Ga0207660_100303843 85
563 3300025917 Ga0207660_11449484 Ga0207660_114494842 85
564 3300025918 Ga0207662_10019308 Ga0207662_100193083 85
565 3300025918 Ga0207662_10068058 Ga0207662_100680583 85
566 3300025921 Ga0207652_10000089 Ga0207652_1000008931 85
567 3300025922 Ga0207646_10457410 Ga0207646_104574103 85
568 3300025923 Ga0207681_10053432 Ga0207681_100534323 85
569 3300025926 Ga0207659_10124321 Ga0207659_101243213 85
570 3300025933 Ga0207706_10999899 Ga0207706_109998992 85
571 3300025935 Ga0207709_10001207 Ga0207709_100012075 85
572 3300025937 Ga0207669_10165317 Ga0207669_101653172 85
573 3300025938 Ga0207704_10024843 Ga0207704_100248434 85
574 3300025938 Ga0207704_10165512 Ga0207704_101655123 85
575 3300025939 Ga0207665_10263842 Ga0207665_102638422 85
576 3300025939 Ga0207665_11342615 Ga0207665_113426151 85
577 3300025940 Ga0207691_10174066 Ga0207691_101740664 85
578 3300025941 Ga0207711_10073423 Ga0207711_100734233 85
579 3300025944 Ga0207661_10052438 Ga0207661_100524384 85
580 3300025949 Ga0207667_10005674 Ga0207667_100056748 85
581 3300025960 Ga0207651_10474454 Ga0207651_104744543 85
582 3300025960 Ga0207651_10790595 Ga0207651_107905952 85
583 3300026023 Ga0207677_10747720 Ga0207677_107477202 85
584 3300026035 Ga0207703_10331808 Ga0207703_103318081 85
585 3300026075 Ga0207708_10001100 Ga0207708_1000110010 85
586 3300026075 Ga0207708_10257433 Ga0207708_102574332 85
587 3300026075 Ga0207708_10486535 Ga0207708_104865353 85
588 3300026088 Ga0207641_10085726 Ga0207641_100857264 85
589 3300026088 Ga0207641_11211641 Ga0207641_112116412 85
590 3300026089 Ga0207648_10000362 Ga0207648_1000036210 85
591 3300026089 Ga0207648_11464088 Ga0207648_114640882 85
592 3300026095 Ga0207676_12368148 Ga0207676_123681482 85
593 3300026116 Ga0207674_10399198 Ga0207674_103991982 85
594 3300026118 Ga0207675_100005714 Ga0207675_10000571410 85
595 3300026118 Ga0207675_100122055 Ga0207675_1001220553 85
596 3300026118 Ga0207675_101338940 Ga0207675_1013389402 85
597 3300027364 Ga0209967_1003252 Ga0209967_10032523 85
598 3300027364 Ga0209967_1014672 Ga0209967_10146722 85
599 3300027395 Ga0209996_1005223 Ga0209996_10052233 85
600 3300027462 Ga0210000_1001500 Ga0210000_10015002 85
601 3300027462 Ga0210000_1009972 Ga0210000_10099722 85
602 3300027526 Ga0209968_1008614 Ga0209968_10086142 85
603 3300027543 Ga0209999_1001417 Ga0209999_10014174 85
604 3300027695 Ga0209966_1171794 Ga0209966_11717942 85
605 3300027866 Ga0209813_10002903 Ga0209813_100029035 85
606 3300027876 Ga0209974_10208343 Ga0209974_102083431 85
607 3300027907 Ga0207428_10178931 Ga0207428_101789313 85
608 3300027907 Ga0207428_10187015 Ga0207428_101870152 85
609 3300027907 Ga0207428_10244406 Ga0207428_102444063 85
610 3300027907 Ga0207428_10305724 Ga0207428_103057242 85
611 3300028380 Ga0268265_10067183 Ga0268265_100671833 85
612 3300028380 Ga0268265_10130052 Ga0268265_101300523 85
613 3300028380 Ga0268265_10447727 Ga0268265_104477272 85
614 3300028380 Ga0268265_10845328 Ga0268265_108453282 85
615 3300028381 Ga0268264_11316250 Ga0268264_113162502 85
616 3300028794 Ga0307515_10453965 Ga0307515_104539652 85
617 3300031251 Ga0265327_10000451 Ga0265327_1000045121 85
618 3300031251 Ga0265327_10002955 Ga0265327_1000295513 85
619 3300031251 Ga0265327_10119036 Ga0265327_101190362 85
620 3300031344 Ga0265316_10000490 Ga0265316_100004908 85
621 3300031548 Ga0307408_100107514 Ga0307408_1001075142 85
622 3300031548 Ga0307408_101269024 Ga0307408_1012690242 85
623 3300031727 Ga0316576_10016154 Ga0316576_100161546 85
624 3300031728 Ga0316578_10048061 Ga0316578_100480613 85
625 3300031731 Ga0307405_10411127 Ga0307405_104111272 85
626 3300031733 Ga0316577_10021920 Ga0316577_100219203 85
627 3300031852 Ga0307410_10525666 Ga0307410_105256663 85
628 3300031852 Ga0307410_12005519 Ga0307410_120055192 85
629 3300031901 Ga0307406_10525460 Ga0307406_105254602 85
630 3300031903 Ga0307407_10214433 Ga0307407_102144334 85
631 3300031903 Ga0307407_10406707 Ga0307407_104067073 85
632 3300031903 Ga0307407_11046527 Ga0307407_110465272 85
633 3300031911 Ga0307412_11189004 Ga0307412_111890042 85
634 3300032002 Ga0307416_100033663 Ga0307416_1000336633 85
635 3300032002 Ga0307416_100096838 Ga0307416_1000968383 85
636 3300032002 Ga0307416_100291683 Ga0307416_1002916833 85
637 3300032002 Ga0307416_100320812 Ga0307416_1003208123 85
638 3300032002 Ga0307416_102647614 Ga0307416_1026476142 85
639 3300032002 Ga0307416_103120224 Ga0307416_1031202242 85
640 3300032005 Ga0307411_10034549 Ga0307411_100345491 85
641 3300032005 Ga0307411_10056564 Ga0307411_100565642 85
642 3300032005 Ga0307411_10122118 Ga0307411_101221184 85
643 3300032005 Ga0307411_10643556 Ga0307411_106435562 85
644 3300032126 Ga0307415_100312981 Ga0307415_1003129813 85
645 3300032126 Ga0307415_100892409 Ga0307415_1008924093 85
646 3300034816 Ga0373930_0032470 Ga0373930_0032470_481_738 85
647 3300034816 Ga0373930_0043553 Ga0373930_0043553_537_794 85
648 3300034817 Ga0373948_0023578 Ga0373948_0023578_766_1023 85
649 3300034818 Ga0373950_0048983 Ga0373950_0048983_387_644 85
650 3300034820 Ga0373959_0026709 Ga0373959_0026709_264_521 85
651 3300035083 Ga0373926_0000464 Ga0373926_0000464_3515_3772 85
652 3300035084 Ga0373928_0006357 Ga0373928_0006357_613_870 85
653 3300035084 Ga0373928_0109765 Ga0373928_0109765_441_698 85
654 3300035085 Ga0373929_0066936 Ga0373929_0066936_156_419 85
655 3300035088 Ga0373940_0000708 Ga0373940_0000708_3003_3260 85
656 3300035088 Ga0373940_0039661 Ga0373940_0039661_964_1221 85
657 3300035089 Ga0373944_0020582 Ga0373944_0020582_1374_1631 85
658 3300035090 Ga0373949_0030698 Ga0373949_0030698_557_814 85
659 3300035091 Ga0373951_0005230 Ga0373951_0005230_2344_2601 85
660 3300035091 Ga0373951_0154554 Ga0373951_0154554_99_356 85
661 3300035092 Ga0373952_0058187 Ga0373952_0058187_36_293 85
662 3300035111 Ga0373923_0050934 Ga0373923_0050934_1263_1520 85
663 3300035112 Ga0373932_0018277 Ga0373932_0018277_200_457 85
664 3300035112 Ga0373932_0063356 Ga0373932_0063356_537_794 85
665 3300035113 Ga0373936_0002795 Ga0373936_0002795_1297_1554 85
666 3300035113 Ga0373936_0034261 Ga0373936_0034261_127_384 85
667 3300035113 Ga0373936_0358828 Ga0373936_0358828_213_476 85
668 3300035114 Ga0373939_0090529 Ga0373939_0090529_495_752 85
669 3300035114 Ga0373939_0303079 Ga0373939_0303079_41_298 85
670 3300035115 Ga0373941_0151384 Ga0373941_0151384_506_763 85
671 3300035116 Ga0373945_0001048 Ga0373945_0001048_5466_5723 85
672 3300035116 Ga0373945_0279154 Ga0373945_0279154_17_274 85
673 3300035117 Ga0373953_0201610 Ga0373953_0201610_222_485 85
674 3300035118 Ga0373954_0341182 Ga0373954_0341182_136_396 85
675 3300035121 Ga0373960_0004813 Ga0373960_0004813_1768_2031 85
676 3300035121 Ga0373960_0018656 Ga0373960_0018656_835_1092 85
677 3300035170 Ga0373943_0010748 Ga0373943_0010748_2272_2529 85
678 3300035170 Ga0373943_0017103 Ga0373943_0017103_2928_3185 85
679 3300035171 Ga0373946_0298177 Ga0373946_0298177_77_334 85
680 3300035172 Ga0373955_0185381 Ga0373955_0185381_16_273 85
681 3300035207 Ga0373942_0004365 Ga0373942_0004365_1495_1752 85
682 3300035241 Ga0373961_0071384 Ga0373961_0071384_475_732 85
683 3300035241 Ga0373961_0129669 Ga0373961_0129669_452_715 85
684 3300035241 Ga0373961_0133896 Ga0373961_0133896_520_777 85
685 3300035242 Ga0373962_0028594 Ga0373962_0028594_54_311 85
686 3300035242 Ga0373962_0065057 Ga0373962_0065057_322_579 85
687 3300035410 Ga0373924_0094514 Ga0373924_0094514_528_785 85
688 3300035410 Ga0373924_0224116 Ga0373924_0224116_496_759 85
689 3300035410 Ga0373924_0405028 Ga0373924_0405028_135_398 85
690 3300035691 Ga0373931_0000307 Ga0373931_0000307_3668_3925 85
691 3300035691 Ga0373931_0006244 Ga0373931_0006244_5068_5331 85
692 3300035691 Ga0373931_0335253 Ga0373931_0335253_45_311 85
693 3300035691 Ga0373931_0666747 Ga0373931_0666747_394_651 85
694 3300035692 Ga0373935_0011866 Ga0373935_0011866_4741_5004 85
695 3300035692 Ga0373935_0099751 Ga0373935_0099751_739_996 85
696 3300035695 Ga0373927_0004060 Ga0373927_0004060_8518_8775 85
697 3300035695 Ga0373927_0123300 Ga0373927_0123300_1360_1623 85
698 3300035725 Ga0373947_0006433 Ga0373947_0006433_3526_3783 85
699 3300035725 Ga0373947_0009590 Ga0373947_0009590_3043_3300 85
700 3300036401 Ga0373937_0006625 Ga0373937_0006625_2571_2834 85
701 3300036401 Ga0373937_0074297 Ga0373937_0074297_549_809 85
702 3300037068 Ga0373925_0037020 Ga0373925_0037020_1886_2143 85
703 3300037068 Ga0373925_0038703 Ga0373925_0038703_1367_1630 85
704 3300037068 Ga0373925_0042408 Ga0373925_0042408_1661_1918 85
705 3300037068 Ga0373925_0651787 Ga0373925_0651787_375_638 85
706 3300039437 Ga0436365_0295636 Ga0436365_0295636_319_582 85
707 3300039437 Ga0436365_0665212 Ga0436365_0665212_64_327 85
708 3300039437 Ga0436365_0981941 Ga0436365_0981941_18833_19117 85
709 3300039437 Ga0436365_1621958 Ga0436365_1621958_2038_2301 85
710 3300039450 Ga0436363_0005179 Ga0436363_0005179_1007_1291 85
711 3300039450 Ga0436363_0954949 Ga0436363_0954949_1691_1975 85
712 3300039450 Ga0436363_1020652 Ga0436363_1020652_155_421 85
713 3300039450 Ga0436363_1155895 Ga0436363_1155895_225_488 85
714 3300039453 Ga0436362_0323154 Ga0436362_0323154_712_996 85
715 3300041408 Ga0439453_0033402 Ga0439453_0033402_348_608 85
716 3300041486 Ga0451807_1790131 Ga0451807_1790131_485_748 85
717 3300041496 Ga0451839_0103274 Ga0451839_0103274_218_481 85
718 3300041505 Ga0451849_1374968 Ga0451849_1374968_386_646 85
719 3300042003 Ga0439443_017168 Ga0439443_017168_740_1000 85
720 3300042015 Ga0439462_0139409 Ga0439462_0139409_378_647 85
721 3300042147 Ga0450910_106578 Ga0450910_106578_228_488 85
722 3300042156 Ga0439446_0084409 Ga0439446_0084409_561_821 85
723 3300042436 Ga0439435_0004325 Ga0439435_0004325_374_634 85
724 3300042437 Ga0439444_0005867 Ga0439444_0005867_806_1066 85
725 3300042461 Ga0439460_0017553 Ga0439460_0017553_1555_1815 85
726 3300042876 Ga0451577_0043111 Ga0451577_0043111_1591_1848 85
727 3300044706 Ga0466964_0607517 Ga0466964_0607517_86_352 85
728 3300044712 Ga0453684_0800201 Ga0453684_0800201_84_341 85
729 3300044842 Ga0466957_0497286 Ga0466957_0497286_165_431 85
730 3300044901 Ga0466960_0532896 Ga0466960_0532896_330_593 85
731 3300045051 Ga0451576_0019385 Ga0451576_0019385_1024_1281 85
732 3300045051 Ga0451576_0025603 Ga0451576_0025603_4229_4486 85
733 3300045051 Ga0451576_0121672 Ga0451576_0121672_592_849 85
734 3300045836 Ga0466958_0806492 Ga0466958_0806492_175_441 85
735 3300045976 Ga0466967_0018731 Ga0466967_0018731_2290_2556 85
736 3300045976 Ga0466967_0218491 Ga0466967_0218491_318_581 85
737 3300046454 Ga0495592_0000306 Ga0495592_0000306_33227_33490 85
738 3300046472 Ga0495580_0005769 Ga0495580_0005769_1264_1521 85
739 3300046473 Ga0495582_0015381 Ga0495582_0015381_3728_3985 85
740 3300046491 Ga0495584_0392948 Ga0495584_0392948_243_506 85
741 3300046517 Ga0495630_0131061 Ga0495630_0131061_948_1205 85
742 3300046526 Ga0495666_0031317 Ga0495666_0031317_739_996 85
743 3300046526 Ga0495666_0149015 Ga0495666_0149015_783_1046 85
744 3300046528 Ga0495642_0036413 Ga0495642_0036413_898_1161 85
745 3300046529 Ga0495652_1136903 Ga0495652_1136903_90_350 85
746 3300046533 Ga0495640_0280960 Ga0495640_0280960_591_851 85
747 3300046535 Ga0495586_0001224 Ga0495586_0001224_7139_7396 85
748 3300046536 Ga0495587_0120979 Ga0495587_0120979_382_645 85
749 3300046559 Ga0495667_0528568 Ga0495667_0528568_429_689 85
750 3300046615 Ga0495656_0024863 Ga0495656_0024863_459_716 85
751 3300046663 Ga0495635_0028372 Ga0495635_0028372_2662_2925 85
752 3300046674 Ga0495588_0057101 Ga0495588_0057101_15_272 85
753 3300046675 Ga0495657_0249489 Ga0495657_0249489_447_710 85
754 3300046681 Ga0495647_0000374 Ga0495647_0000374_4264_4521 85
755 3300046683 Ga0495658_0002491 Ga0495658_0002491_2315_2572 85
756 3300047315 Ga0495581_0103252 Ga0495581_0103252_1201_1458 85
757 3300047317 Ga0495604_0001668 Ga0495604_0001668_6579_6842 85
758 3300047318 Ga0495636_0008982 Ga0495636_0008982_2565_2828 85
759 3300047321 Ga0495676_0060550 Ga0495676_0060550_802_1059 85
760 3300047322 Ga0495680_0003157 Ga0495680_0003157_5489_5752 85
761 3300047673 Ga0495593_0246809 Ga0495593_0246809_520_783 85
762 3300048909 Ga0496106_0340692 Ga0496106_0340692_246_503 85
763 3300048911 Ga0496108_1442762 Ga0496108_1442762_138_395 85
764 3300049519 Ga0501296_003303 Ga0501296_003303_423_686 85
765 3300049519 Ga0501296_021179 Ga0501296_021179_527_787 85
766 3300049568 Ga0501031_0106389 Ga0501031_0106389_993_1253 85
767 3300049569 Ga0501032_0935075 Ga0501032_0935075_224_484 85
768 3300049570 Ga0501033_0005748 Ga0501033_0005748_7910_8170 85
769 3300049572 Ga0501036_0000974 Ga0501036_0000974_1298_1558 85
770 3300049572 Ga0501036_0182819 Ga0501036_0182819_156_413 85
771 3300049573 Ga0501037_0077406 Ga0501037_0077406_1211_1471 85
772 3300049574 Ga0501038_0000189 Ga0501038_0000189_45296_45556 85
773 3300049575 Ga0501039_0000247 Ga0501039_0000247_31645_31905 85
774 3300049575 Ga0501039_0186776 Ga0501039_0186776_373_630 85
775 3300049575 Ga0501039_1269065 Ga0501039_1269065_66_323 85
776 3300049576 Ga0501040_0000229 Ga0501040_0000229_12475_12735 85
777 3300049577 Ga0501041_0000032 Ga0501041_0000032_18083_18343 85
778 3300049577 Ga0501041_0926351 Ga0501041_0926351_11_268 85
779 3300049578 Ga0501042_0002212 Ga0501042_0002212_6463_6723 85
780 3300049578 Ga0501042_0998199 Ga0501042_0998199_337_600 85
781 3300049579 Ga0501043_0110342 Ga0501043_0110342_1631_1891 85
782 3300049580 Ga0501046_0000156 Ga0501046_0000156_22408_22668 85
783 3300049581 Ga0501047_0315703 Ga0501047_0315703_107_367 85
784 3300049582 Ga0501048_0002226 Ga0501048_0002226_6434_6694 85
785 3300049582 Ga0501048_0123418 Ga0501048_0123418_814_1083 85
786 3300049582 Ga0501048_0903584 Ga0501048_0903584_110_370 85
787 3300049584 Ga0501068_0015765 Ga0501068_0015765_2749_3009 85
788 3300049586 Ga0501070_0035376 Ga0501070_0035376_2735_2995 85
789 3300049587 Ga0501071_0002557 Ga0501071_0002557_760_1020 85
790 3300049587 Ga0501071_1113973 Ga0501071_1113973_86_349 85
791 3300049588 Ga0501072_0001593 Ga0501072_0001593_12686_12946 85
792 3300049588 Ga0501072_0721374 Ga0501072_0721374_283_540 85
793 3300049588 Ga0501072_0766609 Ga0501072_0766609_402_665 85
794 3300049590 Ga0501074_0045233 Ga0501074_0045233_2032_2292 85
795 3300049590 Ga0501074_0249181 Ga0501074_0249181_255_518 85
796 3300049590 Ga0501074_0367302 Ga0501074_0367302_619_885 85
797 3300049591 Ga0501075_0000053 Ga0501075_0000053_47719_47979 85
798 3300049591 Ga0501075_0738232 Ga0501075_0738232_222_485 85
799 3300049592 Ga0501076_0001036 Ga0501076_0001036_12247_12507 85
800 3300049593 Ga0501077_0000086 Ga0501077_0000086_11198_11458 85
801 3300049668 Ga0501233_189627 Ga0501233_189627_178_441 85
802 3300049670 Ga0501236_050158 Ga0501236_050158_273_545 85
803 3300049679 Ga0501249_111244 Ga0501249_111244_112_369 85
804 3300049704 Ga0501221_026409 Ga0501221_026409_135_407 85
805 3300049705 Ga0501225_0161326 Ga0501225_0161326_216_488 85
806 3300049741 Ga0501079_0624157 Ga0501079_0624157_160_417 85
807 3300049742 Ga0501080_0097910 Ga0501080_0097910_567_827 85
808 3300049743 Ga0501081_0000127 Ga0501081_0000127_13156_13416 85
809 3300049822 Ga0501035_0008469 Ga0501035_0008469_3108_3368 85
810 3300049823 Ga0501044_0233246 Ga0501044_0233246_906_1166 85
811 3300049824 Ga0501045_0000372 Ga0501045_0000372_22237_22497 85
812 3300050489 nmdc:mga03683_149651_c1 nmdc:mga03683_149651_c1_525_797 85
813 3300050489 nmdc:mga03683_58400_c1 nmdc:mga03683_58400_c1_524_790 85
814 3300050490 nmdc:mga03n38_3825_c1 nmdc:mga03n38_3825_c1_525_791 85
815 3300050491 nmdc:mga00v17_104175_c1 nmdc:mga00v17_104175_c1_133_399 85
816 3300050492 nmdc:mga0yw44_142269_c1 nmdc:mga0yw44_142269_c1_28_294 85
817 3300050493 nmdc:mga0k408_49291_c1 nmdc:mga0k408_49291_c1_2040_2306 85
818 3300050494 nmdc:mga06z11_498652_c1 nmdc:mga06z11_498652_c1_340_606 85
819 3300050495 nmdc:mga04h51_2135_c1 nmdc:mga04h51_2135_c1_2872_3138 85
820 3300050496 nmdc:mga07m45_1893_c1 nmdc:mga07m45_1893_c1_8863_9129 85
821 3300050496 nmdc:mga07m45_64752_c1 nmdc:mga07m45_64752_c1_269_535 85
822 3300050507 nmdc:mga05p37_1445139_c1 nmdc:mga05p37_1445139_c1_249_506 85
823 3300050507 nmdc:mga05p37_1475_c1 nmdc:mga05p37_1475_c1_19325_19582 85
824 3300050507 nmdc:mga05p37_208988_c1 nmdc:mga05p37_208988_c1_130_393 85
825 3300050507 nmdc:mga05p37_71309_c1 nmdc:mga05p37_71309_c1_3278_3538 85
826 3300050507 nmdc:mga05p37_769363_c1 nmdc:mga05p37_769363_c1_367_636 85
827 3300050508 nmdc:mga09592_1566_c1 nmdc:mga09592_1566_c1_7948_8205 85
828 3300050508 nmdc:mga09592_257724_c1 nmdc:mga09592_257724_c1_995_1255 85
829 3300050508 nmdc:mga09592_646716_c1 nmdc:mga09592_646716_c1_109_372 85
830 3300050508 nmdc:mga09592_6982_c1 nmdc:mga09592_6982_c1_3467_3727 85
831 3300050509 nmdc:mga0qj67_1051459_c1 nmdc:mga0qj67_1051459_c1_220_492 85
832 3300050509 nmdc:mga0qj67_1451309_c1 nmdc:mga0qj67_1451309_c1_138_407 85
833 3300050509 nmdc:mga0qj67_196433_c1 nmdc:mga0qj67_196433_c1_295_555 85
834 3300050509 nmdc:mga0qj67_308145_c1 nmdc:mga0qj67_308145_c1_720_977 85
835 3300050509 nmdc:mga0qj67_408299_c1 nmdc:mga0qj67_408299_c1_155_424 85
836 3300050510 nmdc:mga06r32_1127658_c1 nmdc:mga06r32_1127658_c1_178_447 85
837 3300050510 nmdc:mga06r32_1166086_c1 nmdc:mga06r32_1166086_c1_224_481 85
838 3300050510 nmdc:mga06r32_59746_c1 nmdc:mga06r32_59746_c1_1108_1368 85
839 3300050511 nmdc:mga08y16_119157_c1 nmdc:mga08y16_119157_c1_1711_1980 85
840 3300050511 nmdc:mga08y16_14684_c1 nmdc:mga08y16_14684_c1_7587_7844 85
841 3300050511 nmdc:mga08y16_394757_c1 nmdc:mga08y16_394757_c1_479_754 85
842 3300050511 nmdc:mga08y16_43170_c1 nmdc:mga08y16_43170_c1_3624_3893 85
843 3300050511 nmdc:mga08y16_9319_c1 nmdc:mga08y16_9319_c1_7771_8028 85
844 3300050512 nmdc:mga0n895_1315640_c1 nmdc:mga0n895_1315640_c1_264_521 85
845 3300050512 nmdc:mga0n895_3063_c1 nmdc:mga0n895_3063_c1_5663_5926 85
846 3300050512 nmdc:mga0n895_4921_c1 nmdc:mga0n895_4921_c1_2914_3171 85
847 3300050512 nmdc:mga0n895_529_c1 nmdc:mga0n895_529_c1_2182_2445 85
848 3300050513 nmdc:mga0rr50_1174228_c1 nmdc:mga0rr50_1174228_c1_135_398 85
849 3300050513 nmdc:mga0rr50_128_c1 nmdc:mga0rr50_128_c1_10064_10321 85
850 3300050513 nmdc:mga0rr50_205455_c1 nmdc:mga0rr50_205455_c1_591_854 85
851 3300050513 nmdc:mga0rr50_4412_c1 nmdc:mga0rr50_4412_c1_7627_7890 85
852 3300050514 nmdc:mga08x19_109576_c1 nmdc:mga08x19_109576_c1_435_698 85
853 3300050514 nmdc:mga08x19_15014_c1 nmdc:mga08x19_15014_c1_3989_4252 85
854 3300050514 nmdc:mga08x19_15549_c1 nmdc:mga08x19_15549_c1_1039_1302 85
855 3300050514 nmdc:mga08x19_27559_c1 nmdc:mga08x19_27559_c1_2349_2609 85
856 3300050514 nmdc:mga08x19_42965_c1 nmdc:mga08x19_42965_c1_1640_1903 85
857 3300050514 nmdc:mga08x19_434_c1 nmdc:mga08x19_434_c1_4359_4616 85
858 3300050514 nmdc:mga08x19_484770_c1 nmdc:mga08x19_484770_c1_263_520 85
859 3300050515 nmdc:mga0a205_160_c1 nmdc:mga0a205_160_c1_18800_19057 85
860 3300050515 nmdc:mga0a205_289330_c1 nmdc:mga0a205_289330_c1_1141_1398 85
861 3300050516 nmdc:mga0sz30_111980_c1 nmdc:mga0sz30_111980_c1_511_777 85
862 3300053085 Ga0495619_0024756 Ga0495619_0024756_2740_3003 85
863 3300054114 Ga0501084_0003487 Ga0501084_0003487_10824_11084 85
864 3300054114 Ga0501084_0330355 Ga0501084_0330355_228_491 85
865 3300059426 Ga0590077_099849 Ga0590077_099849_214_471 85
866 3300059426 Ga0590077_169523 Ga0590077_169523_28_285 85
867 3300060353 Ga0501082_0003275 Ga0501082_0003275_9626_9886 85
868 3300061734 Ga0530510_0000087 Ga0530510_0000087_3171_3431 85
869 iso_pu_bacteria 2891633521 2891636160 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

13

73

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mja-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a75i 0.9655 2 81
3qmx-assembly1.cif.gz_A x-ray crystal structure of synechocystis sp. pcc 6803 glutaredoxin a 0.9651 2 81
4mjc-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a - p84r 0.9648 2 81
4mje-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-r27l 0.9647 2 82
4tr0-assembly2.cif.gz_B crystal structure of gssg-bound cgrx2 0.9626 1 82
ID Description Score Start End Superfamily
af_B6SN61_11_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9568 4 83 3.40.30.10
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9504 1 82 3.40.30.10
af_Q54GP8_1_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9445 2 83 3.40.30.10
af_B6TEC7_84_191_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9434 2 83 3.40.30.10
af_A4HRD2_90_192_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9417 3 83 3.40.30.10

Feature Viewer

pLDDT pTM Quality
96.28 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map