F484115
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 375 | 866 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300006914|Ga0075436_100013879|Ga0075436_1000138792 |
| Length | 96 |
| Sequence | MPACRWRSELPKVLMYCTAACPFCQAAERLLMQKGAAIDKVRVDLDPARRAEMMQKSGGRRTVPQIWIGERHIGGCDDLYELERQGGLDPLLKAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 193 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 237 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 239 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 240 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 241 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 242 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 243 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 244 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 245 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 252 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 304 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 305 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 306 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 330 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 331 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 336 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 345 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 371 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 374 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 375 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.11 |
| Nodule | 0 |
| Rhizoplane | 0.35 |
| Rhizosphere | 93.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10028116 | 3300005295 | Bacteria | 1276 |
| 2 | Ga0065707_10871671 | 3300005295 | Bacteria | 575 |
| 3 | Ga0070676_10103520 | 3300005328 | Bacteria | 1762 |
| 4 | Ga0070676_11251514 | 3300005328 | Bacteria | 565 |
| 5 | Ga0070676_11415428 | 3300005328 | Bacteria | 534 |
| 6 | Ga0070683_100042576 | 3300005329 | Bacteria | 4182 |
| 7 | Ga0070690_100064489 | 3300005330 | Bacteria | 2366 |
| 8 | Ga0070690_100472920 | 3300005330 | Bacteria | 933 |
| 9 | Ga0070690_100687442 | 3300005330 | Bacteria | 785 |
| 10 | Ga0068869_100426532 | 3300005334 | Bacteria | 1095 |
| 11 | Ga0068869_101819970 | 3300005334 | Bacteria | 545 |
| 12 | Ga0070666_10054465 | 3300005335 | Bacteria | 2699 |
| 13 | Ga0070680_100001647 | 3300005336 | Bacteria | 16321 |
| 14 | Ga0070680_100014660 | 3300005336 | Bacteria | 6129 |
| 15 | Ga0070680_100130054 | 3300005336 | Bacteria | 2106 |
| 16 | Ga0070680_100348645 | 3300005336 | Bacteria | 1259 |
| 17 | Ga0070680_100461677 | 3300005336 | Bacteria | 1085 |
| 18 | Ga0070680_100866695 | 3300005336 | Bacteria | 779 |
| 19 | Ga0068868_100398664 | 3300005338 | Unclassified | 1187 |
| 20 | Ga0068868_100932668 | 3300005338 | Bacteria | 791 |
| 21 | Ga0070689_100100857 | 3300005340 | Bacteria | 2284 |
| 22 | Ga0070689_100299742 | 3300005340 | Bacteria | 1338 |
| 23 | Ga0070689_101242183 | 3300005340 | Bacteria | 670 |
| 24 | Ga0070689_101798149 | 3300005340 | Bacteria | 559 |
| 25 | Ga0070691_10082614 | 3300005341 | Bacteria | 1575 |
| 26 | Ga0070687_100028343 | 3300005343 | Bacteria | 2715 |
| 27 | Ga0070687_100246522 | 3300005343 | Bacteria | 1107 |
| 28 | Ga0070687_100608565 | 3300005343 | Bacteria | 752 |
| 29 | Ga0070692_10009924 | 3300005345 | Bacteria | 4313 |
| 30 | Ga0070692_10026413 | 3300005345 | Bacteria | 2870 |
| 31 | Ga0070692_10120828 | 3300005345 | Bacteria | 1461 |
| 32 | Ga0070692_10190452 | 3300005345 | Bacteria | 1195 |
| 33 | Ga0070692_10307961 | 3300005345 | Bacteria | 969 |
| 34 | Ga0070668_100044754 | 3300005347 | Bacteria | 3396 |
| 35 | Ga0070669_100002067 | 3300005353 | Bacteria | 14507 |
| 36 | Ga0070675_100022309 | 3300005354 | Bacteria | 5058 |
| 37 | Ga0070675_100026908 | 3300005354 | Bacteria | 4618 |
| 38 | Ga0070675_101571969 | 3300005354 | Bacteria | 607 |
| 39 | Ga0070671_100120039 | 3300005355 | Bacteria | 2212 |
| 40 | Ga0070674_100068540 | 3300005356 | Bacteria | 2500 |
| 41 | Ga0070674_101073413 | 3300005356 | Bacteria | 710 |
| 42 | Ga0070673_100170665 | 3300005364 | Bacteria | 1856 |
| 43 | Ga0070673_100409789 | 3300005364 | Unclassified | 1213 |
| 44 | Ga0070673_100937721 | 3300005364 | Bacteria | 804 |
| 45 | Ga0070688_100181417 | 3300005365 | Bacteria | 1461 |
| 46 | Ga0070688_100942601 | 3300005365 | Bacteria | 683 |
| 47 | Ga0070667_100581313 | 3300005367 | Bacteria | 1031 |
| 48 | Ga0070703_10011852 | 3300005406 | Bacteria | 2466 |
| 49 | Ga0070709_10706679 | 3300005434 | Bacteria | 785 |
| 50 | Ga0070709_11547529 | 3300005434 | Bacteria | 539 |
| 51 | Ga0070714_100005253 | 3300005435 | Bacteria | 9862 |
| 52 | Ga0070714_100405452 | 3300005435 | Bacteria | 1289 |
| 53 | Ga0070710_10054037 | 3300005437 | Bacteria | 2265 |
| 54 | Ga0070710_10366270 | 3300005437 | Bacteria | 958 |
| 55 | Ga0070701_10120497 | 3300005438 | Bacteria | 1478 |
| 56 | Ga0070701_10469921 | 3300005438 | Bacteria | 811 |
| 57 | Ga0070701_11135196 | 3300005438 | Bacteria | 552 |
| 58 | Ga0070711_100250517 | 3300005439 | Unclassified | 1389 |
| 59 | Ga0070711_100286534 | 3300005439 | Bacteria | 1305 |
| 60 | Ga0070705_100004688 | 3300005440 | Bacteria | 6659 |
| 61 | Ga0070705_100008519 | 3300005440 | Bacteria | 5079 |
| 62 | Ga0070705_100025712 | 3300005440 | Bacteria | 3194 |
| 63 | Ga0070705_100043610 | 3300005440 | Bacteria | 2572 |
| 64 | Ga0070705_100414441 | 3300005440 | Bacteria | 1001 |
| 65 | Ga0070700_100027816 | 3300005441 | Bacteria | 3357 |
| 66 | Ga0070700_100140900 | 3300005441 | Bacteria | 1638 |
| 67 | Ga0070700_101292780 | 3300005441 | Bacteria | 613 |
| 68 | Ga0070694_100006497 | 3300005444 | Bacteria | 7103 |
| 69 | Ga0070694_100049845 | 3300005444 | Bacteria | 2821 |
| 70 | Ga0070694_100139566 | 3300005444 | Bacteria | 1759 |
| 71 | Ga0070694_100276151 | 3300005444 | Bacteria | 1279 |
| 72 | Ga0070694_100426276 | 3300005444 | Bacteria | 1043 |
| 73 | Ga0070694_100618473 | 3300005444 | Bacteria | 874 |
| 74 | Ga0070694_101830984 | 3300005444 | Bacteria | 518 |
| 75 | Ga0070708_100911355 | 3300005445 | Bacteria | 825 |
| 76 | Ga0070708_101215005 | 3300005445 | Bacteria | 705 |
| 77 | Ga0070678_100805798 | 3300005456 | Bacteria | 853 |
| 78 | Ga0070678_101916247 | 3300005456 | Bacteria | 560 |
| 79 | Ga0070662_100383642 | 3300005457 | Bacteria | 1157 |
| 80 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 81 | Ga0070681_10094117 | 3300005458 | Bacteria | 2945 |
| 82 | Ga0070681_10445988 | 3300005458 | Bacteria | 1206 |
| 83 | Ga0070681_11245986 | 3300005458 | Bacteria | 666 |
| 84 | Ga0068867_100022379 | 3300005459 | Bacteria | 4519 |
| 85 | Ga0068867_100604498 | 3300005459 | Bacteria | 957 |
| 86 | Ga0068867_100724918 | 3300005459 | Bacteria | 880 |
| 87 | Ga0070706_100137927 | 3300005467 | Bacteria | 2276 |
| 88 | Ga0070706_100326868 | 3300005467 | Bacteria | 1430 |
| 89 | Ga0070706_100355782 | 3300005467 | Bacteria | 1365 |
| 90 | Ga0070706_100573621 | 3300005467 | Bacteria | 1049 |
| 91 | Ga0070698_100965601 | 3300005471 | Bacteria | 799 |
| 92 | Ga0070699_100351464 | 3300005518 | Bacteria | 1328 |
| 93 | Ga0070679_100002513 | 3300005530 | Bacteria | 16622 |
| 94 | Ga0070679_100198136 | 3300005530 | Bacteria | 1975 |
| 95 | Ga0070684_100305627 | 3300005535 | Bacteria | 1460 |
| 96 | Ga0070697_100004494 | 3300005536 | Bacteria | 10724 |
| 97 | Ga0070697_100053069 | 3300005536 | Bacteria | 3295 |
| 98 | Ga0070697_100057369 | 3300005536 | Bacteria | 3168 |
| 99 | Ga0070697_100226051 | 3300005536 | Bacteria | 1595 |
| 100 | Ga0070697_100364181 | 3300005536 | Bacteria | 1250 |
| 101 | Ga0070697_101320195 | 3300005536 | Bacteria | 644 |
| 102 | Ga0068853_100028005 | 3300005539 | Bacteria | 4739 |
| 103 | Ga0070672_100498263 | 3300005543 | Bacteria | 1053 |
| 104 | Ga0070686_100007410 | 3300005544 | Bacteria | 6121 |
| 105 | Ga0070686_100411030 | 3300005544 | Unclassified | 1031 |
| 106 | Ga0070686_100604058 | 3300005544 | Bacteria | 865 |
| 107 | Ga0070695_100078323 | 3300005545 | Bacteria | 2179 |
| 108 | Ga0070695_100257651 | 3300005545 | Bacteria | 1272 |
| 109 | Ga0070695_100306039 | 3300005545 | Bacteria | 1176 |
| 110 | Ga0070695_100520744 | 3300005545 | Bacteria | 923 |
| 111 | Ga0070696_100002386 | 3300005546 | Bacteria | 12422 |
| 112 | Ga0070696_100008433 | 3300005546 | Bacteria | 6898 |
| 113 | Ga0070696_100093635 | 3300005546 | Bacteria | 2143 |
| 114 | Ga0070696_100118825 | 3300005546 | Bacteria | 1911 |
| 115 | Ga0070696_100343812 | 3300005546 | Bacteria | 1154 |
| 116 | Ga0070696_100433147 | 3300005546 | Bacteria | 1035 |
| 117 | Ga0070693_100454006 | 3300005547 | Bacteria | 900 |
| 118 | Ga0070693_100743420 | 3300005547 | Bacteria | 722 |
| 119 | Ga0070693_101560022 | 3300005547 | Bacteria | 518 |
| 120 | Ga0070704_100211114 | 3300005549 | Bacteria | 1573 |
| 121 | Ga0070704_100246246 | 3300005549 | Bacteria | 1466 |
| 122 | Ga0070704_100381457 | 3300005549 | Bacteria | 1198 |
| 123 | Ga0070704_100427388 | 3300005549 | Bacteria | 1136 |
| 124 | Ga0070704_100743609 | 3300005549 | Bacteria | 873 |
| 125 | Ga0068855_100004637 | 3300005563 | Bacteria | 16776 |
| 126 | Ga0068857_100193769 | 3300005577 | Bacteria | 1851 |
| 127 | Ga0068857_101464925 | 3300005577 | Bacteria | 665 |
| 128 | Ga0068854_100432821 | 3300005578 | Bacteria | 1095 |
| 129 | Ga0070702_100002197 | 3300005615 | Bacteria | 8312 |
| 130 | Ga0070702_100023235 | 3300005615 | Bacteria | 3292 |
| 131 | Ga0070702_100077339 | 3300005615 | Bacteria | 1983 |
| 132 | Ga0070702_100311021 | 3300005615 | Bacteria | 1094 |
| 133 | Ga0070702_100379878 | 3300005615 | Unclassified | 1004 |
| 134 | Ga0070702_101897332 | 3300005615 | Bacteria | 500 |
| 135 | Ga0068859_100596615 | 3300005617 | Bacteria | 1198 |
| 136 | Ga0068866_10012298 | 3300005718 | Bacteria | 3728 |
| 137 | Ga0068866_10506576 | 3300005718 | Bacteria | 800 |
| 138 | Ga0068861_100009213 | 3300005719 | Bacteria | 6810 |
| 139 | Ga0068861_100240491 | 3300005719 | Bacteria | 1539 |
| 140 | Ga0068861_102003632 | 3300005719 | Bacteria | 578 |
| 141 | Ga0068870_10341645 | 3300005840 | Bacteria | 958 |
| 142 | Ga0068863_100024667 | 3300005841 | Bacteria | 5734 |
| 143 | Ga0068858_100053157 | 3300005842 | Bacteria | 3748 |
| 144 | Ga0068858_100737964 | 3300005842 | Bacteria | 959 |
| 145 | Ga0068858_102348515 | 3300005842 | Bacteria | 527 |
| 146 | Ga0068860_100646843 | 3300005843 | Bacteria | 1065 |
| 147 | Ga0068860_102418809 | 3300005843 | Bacteria | 545 |
| 148 | Ga0068862_100074102 | 3300005844 | Bacteria | 2942 |
| 149 | Ga0070717_11387854 | 3300006028 | Unclassified | 638 |
| 150 | Ga0075365_10103843 | 3300006038 | Bacteria | 1948 |
| 151 | Ga0075368_10010084 | 3300006042 | Bacteria | 3410 |
| 152 | Ga0075363_100034829 | 3300006048 | Bacteria | 2630 |
| 153 | Ga0075364_10150137 | 3300006051 | Bacteria | 1570 |
| 154 | Ga0070715_10990523 | 3300006163 | Bacteria | 523 |
| 155 | Ga0070716_100627921 | 3300006173 | Bacteria | 812 |
| 156 | Ga0070716_100631297 | 3300006173 | Bacteria | 810 |
| 157 | Ga0070712_101566888 | 3300006175 | Bacteria | 576 |
| 158 | Ga0075362_10006044 | 3300006177 | Bacteria | 4482 |
| 159 | Ga0075362_10133282 | 3300006177 | Bacteria | 1183 |
| 160 | Ga0075367_10061280 | 3300006178 | Bacteria | 2245 |
| 161 | Ga0075369_10057250 | 3300006186 | Bacteria | 1695 |
| 162 | Ga0075369_10126071 | 3300006186 | Bacteria | 1161 |
| 163 | Ga0075366_10039707 | 3300006195 | Bacteria | 2781 |
| 164 | Ga0075366_10594528 | 3300006195 | Bacteria | 686 |
| 165 | Ga0097621_100713566 | 3300006237 | Bacteria | 924 |
| 166 | Ga0075370_10043340 | 3300006353 | Bacteria | 2543 |
| 167 | Ga0068871_100004840 | 3300006358 | Bacteria | 9410 |
| 168 | Ga0075428_100118548 | 3300006844 | Bacteria | 2882 |
| 169 | Ga0075428_100164836 | 3300006844 | Bacteria | 2404 |
| 170 | Ga0075428_100261508 | 3300006844 | Bacteria | 1863 |
| 171 | Ga0075428_100479135 | 3300006844 | Bacteria | 1332 |
| 172 | Ga0075428_101013708 | 3300006844 | Bacteria | 879 |
| 173 | Ga0075428_101855871 | 3300006844 | Bacteria | 627 |
| 174 | Ga0075430_100000730 | 3300006846 | Bacteria | 25201 |
| 175 | Ga0075430_100009943 | 3300006846 | Bacteria | 8046 |
| 176 | Ga0075430_100033130 | 3300006846 | Bacteria | 4386 |
| 177 | Ga0075430_100041067 | 3300006846 | Bacteria | 3914 |
| 178 | Ga0075430_100659057 | 3300006846 | Bacteria | 863 |
| 179 | Ga0075430_100705892 | 3300006846 | Bacteria | 831 |
| 180 | Ga0075431_100345869 | 3300006847 | Bacteria | 1496 |
| 181 | Ga0075431_100735627 | 3300006847 | Bacteria | 962 |
| 182 | Ga0075431_100943170 | 3300006847 | Bacteria | 831 |
| 183 | Ga0075431_101658512 | 3300006847 | Bacteria | 596 |
| 184 | Ga0075433_10057667 | 3300006852 | Bacteria | 3395 |
| 185 | Ga0075433_11687564 | 3300006852 | Bacteria | 546 |
| 186 | Ga0075434_100000002 | 3300006871 | Bacteria | 135661 |
| 187 | Ga0075434_100007245 | 3300006871 | Bacteria | 10262 |
| 188 | Ga0075434_100362020 | 3300006871 | Bacteria | 1471 |
| 189 | Ga0075429_100121187 | 3300006880 | Bacteria | 2286 |
| 190 | Ga0075429_100159017 | 3300006880 | Bacteria | 1978 |
| 191 | Ga0075429_100284557 | 3300006880 | Bacteria | 1448 |
| 192 | Ga0075429_101514493 | 3300006880 | Bacteria | 583 |
| 193 | Ga0068865_100034667 | 3300006881 | Bacteria | 3388 |
| 194 | Ga0068865_100664788 | 3300006881 | Bacteria | 887 |
| 195 | Ga0075436_100002239 | 3300006914 | Bacteria | 13356 |
| 196 | Ga0075436_100013730 | 3300006914 | Bacteria | 5548 |
| 197 | Ga0075436_100013879 | 3300006914 | Bacteria | 5517 |
| 198 | Ga0075436_100025072 | 3300006914 | Bacteria | 4100 |
| 199 | Ga0075436_100050698 | 3300006914 | Bacteria | 2865 |
| 200 | Ga0075436_100103101 | 3300006914 | Bacteria | 1988 |
| 201 | Ga0075436_100497326 | 3300006914 | Bacteria | 892 |
| 202 | Ga0097620_100596576 | 3300006931 | Bacteria | 1198 |
| 203 | Ga0075435_100006511 | 3300007076 | Bacteria | 8263 |
| 204 | Ga0075435_100017646 | 3300007076 | Bacteria | 5407 |
| 205 | Ga0075435_100021908 | 3300007076 | Bacteria | 4924 |
| 206 | Ga0075435_100024406 | 3300007076 | Bacteria | 4692 |
| 207 | Ga0075435_100055502 | 3300007076 | Bacteria | 3199 |
| 208 | Ga0075435_101431945 | 3300007076 | Bacteria | 606 |
| 209 | Ga0075435_101641423 | 3300007076 | Bacteria | 564 |
| 210 | Ga0105244_10097012 | 3300009036 | Bacteria | 1445 |
| 211 | Ga0105250_10051134 | 3300009092 | Bacteria | 1658 |
| 212 | Ga0105240_10905603 | 3300009093 | Unclassified | 949 |
| 213 | Ga0111539_10011706 | 3300009094 | Bacteria | 11007 |
| 214 | Ga0111539_10017672 | 3300009094 | Bacteria | 8829 |
| 215 | Ga0111539_10059932 | 3300009094 | Bacteria | 4512 |
| 216 | Ga0111539_10076537 | 3300009094 | Bacteria | 3940 |
| 217 | Ga0111539_10077714 | 3300009094 | Bacteria | 3906 |
| 218 | Ga0111539_10110814 | 3300009094 | Bacteria | 3221 |
| 219 | Ga0111539_10486917 | 3300009094 | Bacteria | 1437 |
| 220 | Ga0111539_10543565 | 3300009094 | Bacteria | 1353 |
| 221 | Ga0111539_11302360 | 3300009094 | Bacteria | 843 |
| 222 | Ga0105245_10000221 | 3300009098 | Bacteria | 54253 |
| 223 | Ga0105245_11371883 | 3300009098 | Unclassified | 757 |
| 224 | Ga0105245_12826722 | 3300009098 | Bacteria | 538 |
| 225 | Ga0114129_10003624 | 3300009147 | Bacteria | 21726 |
| 226 | Ga0114129_10097900 | 3300009147 | Bacteria | 4061 |
| 227 | Ga0114129_10248304 | 3300009147 | Bacteria | 2390 |
| 228 | Ga0114129_10373163 | 3300009147 | Bacteria | 1885 |
| 229 | Ga0114129_10587238 | 3300009147 | Bacteria | 1445 |
| 230 | Ga0114129_10832561 | 3300009147 | Bacteria | 1175 |
| 231 | Ga0114129_11768688 | 3300009147 | Bacteria | 752 |
| 232 | Ga0114129_12217238 | 3300009147 | Bacteria | 661 |
| 233 | Ga0114129_13070298 | 3300009147 | Bacteria | 547 |
| 234 | Ga0105243_10000288 | 3300009148 | Bacteria | 55680 |
| 235 | Ga0105243_10006310 | 3300009148 | Bacteria | 9162 |
| 236 | Ga0105243_11016653 | 3300009148 | Bacteria | 832 |
| 237 | Ga0105241_10008452 | 3300009174 | Bacteria | 7567 |
| 238 | Ga0105241_10283579 | 3300009174 | Unclassified | 1415 |
| 239 | Ga0105242_10007197 | 3300009176 | Bacteria | 8582 |
| 240 | Ga0105242_10415247 | 3300009176 | Bacteria | 1259 |
| 241 | Ga0105248_10076185 | 3300009177 | Bacteria | 3770 |
| 242 | Ga0105248_10207763 | 3300009177 | Bacteria | 2206 |
| 243 | Ga0105237_10227743 | 3300009545 | Bacteria | 1865 |
| 244 | Ga0105238_11111166 | 3300009551 | Unclassified | 813 |
| 245 | Ga0105249_10005927 | 3300009553 | Bacteria | 10589 |
| 246 | Ga0105249_10022286 | 3300009553 | Bacteria | 5674 |
| 247 | Ga0105239_10012819 | 3300010375 | Bacteria | 9327 |
| 248 | Ga0105239_10594092 | 3300010375 | Bacteria | 1262 |
| 249 | Ga0105239_12591736 | 3300010375 | Bacteria | 591 |
| 250 | Ga0105246_10207704 | 3300011119 | Bacteria | 1526 |
| 251 | Ga0157373_10696520 | 3300013100 | Bacteria | 744 |
| 252 | Ga0157371_10419793 | 3300013102 | Bacteria | 981 |
| 253 | Ga0157370_10003517 | 3300013104 | Bacteria | 18362 |
| 254 | Ga0157374_11960119 | 3300013296 | Unclassified | 612 |
| 255 | Ga0157378_10003188 | 3300013297 | Bacteria | 14572 |
| 256 | Ga0157378_12000765 | 3300013297 | Bacteria | 629 |
| 257 | Ga0163162_10056188 | 3300013306 | Bacteria | 3965 |
| 258 | Ga0157372_10309715 | 3300013307 | Bacteria | 1838 |
| 259 | Ga0157372_12509286 | 3300013307 | Unclassified | 592 |
| 260 | Ga0157375_10468627 | 3300013308 | Bacteria | 1425 |
| 261 | Ga0157375_11348671 | 3300013308 | Bacteria | 839 |
| 262 | Ga0157380_10009333 | 3300014326 | Bacteria | 7026 |
| 263 | Ga0157380_10098992 | 3300014326 | Bacteria | 2424 |
| 264 | Ga0157380_11504193 | 3300014326 | Bacteria | 726 |
| 265 | Ga0157377_10013623 | 3300014745 | Bacteria | 4120 |
| 266 | Ga0157377_10264271 | 3300014745 | Bacteria | 1121 |
| 267 | Ga0157377_10750923 | 3300014745 | Bacteria | 714 |
| 268 | Ga0157377_11461920 | 3300014745 | Bacteria | 542 |
| 269 | Ga0157379_10106150 | 3300014968 | Bacteria | 2521 |
| 270 | Ga0157379_11828707 | 3300014968 | Unclassified | 597 |
| 271 | Ga0157376_10001746 | 3300014969 | Bacteria | 14461 |
| 272 | Ga0157376_10286919 | 3300014969 | Bacteria | 1553 |
| 273 | Ga0163161_10467650 | 3300017792 | Bacteria | 1022 |
| 274 | Ga0213874_10005372 | 3300021377 | Bacteria | 2981 |
| 275 | Ga0213874_10013425 | 3300021377 | Bacteria | 2122 |
| 276 | Ga0213874_10299369 | 3300021377 | Unclassified | 605 |
| 277 | Ga0213876_10001256 | 3300021384 | Bacteria | 16010 |
| 278 | Ga0213876_10036599 | 3300021384 | Bacteria | 2589 |
| 279 | Ga0207697_10144651 | 3300025315 | Bacteria | 1032 |
| 280 | Ga0207713_1061471 | 3300025735 | Bacteria | 1429 |
| 281 | Ga0207682_10418066 | 3300025893 | Bacteria | 634 |
| 282 | Ga0207692_10057561 | 3300025898 | Bacteria | 1999 |
| 283 | Ga0207692_10506127 | 3300025898 | Unclassified | 767 |
| 284 | Ga0207642_10003522 | 3300025899 | Bacteria | 4954 |
| 285 | Ga0207688_10675278 | 3300025901 | Bacteria | 653 |
| 286 | Ga0207699_11076180 | 3300025906 | Bacteria | 595 |
| 287 | Ga0207645_10118144 | 3300025907 | Bacteria | 1720 |
| 288 | Ga0207643_10244328 | 3300025908 | Bacteria | 1104 |
| 289 | Ga0207684_10220114 | 3300025910 | Bacteria | 1638 |
| 290 | Ga0207684_10567981 | 3300025910 | Bacteria | 970 |
| 291 | Ga0207684_10770131 | 3300025910 | Bacteria | 815 |
| 292 | Ga0207707_10000011 | 3300025912 | Bacteria | 282857 |
| 293 | Ga0207695_10958872 | 3300025913 | Unclassified | 735 |
| 294 | Ga0207693_10329762 | 3300025915 | Bacteria | 1195 |
| 295 | Ga0207663_10272808 | 3300025916 | Bacteria | 1253 |
| 296 | Ga0207663_10313118 | 3300025916 | Bacteria | 1177 |
| 297 | Ga0207663_10397729 | 3300025916 | Bacteria | 1053 |
| 298 | Ga0207660_10000737 | 3300025917 | Bacteria | 21749 |
| 299 | Ga0207660_10030384 | 3300025917 | Bacteria | 3713 |
| 300 | Ga0207660_10195231 | 3300025917 | Bacteria | 1578 |
| 301 | Ga0207660_10262698 | 3300025917 | Bacteria | 1365 |
| 302 | Ga0207660_10340980 | 3300025917 | Bacteria | 1199 |
| 303 | Ga0207660_11449484 | 3300025917 | Bacteria | 556 |
| 304 | Ga0207662_10019308 | 3300025918 | Bacteria | 3877 |
| 305 | Ga0207662_10068058 | 3300025918 | Bacteria | 2149 |
| 306 | Ga0207662_10097379 | 3300025918 | Bacteria | 1818 |
| 307 | Ga0207662_11070407 | 3300025918 | Bacteria | 573 |
| 308 | Ga0207652_10000089 | 3300025921 | Bacteria | 99680 |
| 309 | Ga0207646_10457410 | 3300025922 | Bacteria | 1151 |
| 310 | Ga0207681_10053432 | 3300025923 | Bacteria | 2742 |
| 311 | Ga0207659_10124321 | 3300025926 | Bacteria | 1981 |
| 312 | Ga0207664_10228422 | 3300025929 | Bacteria | 1617 |
| 313 | Ga0207664_10454001 | 3300025929 | Unclassified | 1144 |
| 314 | Ga0207706_10999899 | 3300025933 | Bacteria | 703 |
| 315 | Ga0207706_11089290 | 3300025933 | Bacteria | 668 |
| 316 | Ga0207709_10001207 | 3300025935 | Bacteria | 18567 |
| 317 | Ga0207670_10169816 | 3300025936 | Bacteria | 1634 |
| 318 | Ga0207669_10165317 | 3300025937 | Bacteria | 1568 |
| 319 | Ga0207704_10024843 | 3300025938 | Bacteria | 3259 |
| 320 | Ga0207704_10165512 | 3300025938 | Bacteria | 1579 |
| 321 | Ga0207704_11758919 | 3300025938 | Bacteria | 533 |
| 322 | Ga0207665_10263842 | 3300025939 | Bacteria | 1277 |
| 323 | Ga0207665_10876608 | 3300025939 | Bacteria | 711 |
| 324 | Ga0207665_11342615 | 3300025939 | Unclassified | 570 |
| 325 | Ga0207691_10174066 | 3300025940 | Bacteria | 1883 |
| 326 | Ga0207711_10073423 | 3300025941 | Bacteria | 2973 |
| 327 | Ga0207689_10323681 | 3300025942 | Bacteria | 1280 |
| 328 | Ga0207689_10505762 | 3300025942 | Bacteria | 1012 |
| 329 | Ga0207661_10052438 | 3300025944 | Bacteria | 3259 |
| 330 | Ga0207667_10005674 | 3300025949 | Bacteria | 15217 |
| 331 | Ga0207651_10474454 | 3300025960 | Bacteria | 1077 |
| 332 | Ga0207651_10790595 | 3300025960 | Bacteria | 841 |
| 333 | Ga0207668_10480330 | 3300025972 | Bacteria | 1066 |
| 334 | Ga0207658_10730508 | 3300025986 | Unclassified | 896 |
| 335 | Ga0207677_10747720 | 3300026023 | Bacteria | 871 |
| 336 | Ga0207703_10331808 | 3300026035 | Bacteria | 1395 |
| 337 | Ga0207703_10831526 | 3300026035 | Bacteria | 882 |
| 338 | Ga0207708_10001100 | 3300026075 | Bacteria | 20249 |
| 339 | Ga0207708_10136147 | 3300026075 | Bacteria | 1924 |
| 340 | Ga0207708_10257433 | 3300026075 | Bacteria | 1408 |
| 341 | Ga0207708_10486535 | 3300026075 | Bacteria | 1032 |
| 342 | Ga0207708_11869509 | 3300026075 | Unclassified | 526 |
| 343 | Ga0207641_10085726 | 3300026088 | Bacteria | 2745 |
| 344 | Ga0207641_11211641 | 3300026088 | Bacteria | 755 |
| 345 | Ga0207648_10000362 | 3300026089 | Bacteria | 50094 |
| 346 | Ga0207648_11464088 | 3300026089 | Bacteria | 642 |
| 347 | Ga0207676_12368148 | 3300026095 | Bacteria | 528 |
| 348 | Ga0207674_10399198 | 3300026116 | Bacteria | 1329 |
| 349 | Ga0207675_100005714 | 3300026118 | Bacteria | 11903 |
| 350 | Ga0207675_100122055 | 3300026118 | Bacteria | 2466 |
| 351 | Ga0207675_100529425 | 3300026118 | Bacteria | 1176 |
| 352 | Ga0207675_101338940 | 3300026118 | Bacteria | 737 |
| 353 | Ga0209969_1001335 | 3300027360 | Bacteria | 3395 |
| 354 | Ga0209967_1003252 | 3300027364 | Bacteria | 2139 |
| 355 | Ga0209967_1014672 | 3300027364 | Bacteria | 1117 |
| 356 | Ga0209967_1032935 | 3300027364 | Bacteria | 778 |
| 357 | Ga0209996_1003376 | 3300027395 | Bacteria | 2007 |
| 358 | Ga0209996_1005223 | 3300027395 | Bacteria | 1663 |
| 359 | Ga0210000_1001500 | 3300027462 | Bacteria | 3289 |
| 360 | Ga0210000_1009972 | 3300027462 | Bacteria | 1403 |
| 361 | Ga0210000_1024580 | 3300027462 | Bacteria | 930 |
| 362 | Ga0209968_1008614 | 3300027526 | Bacteria | 1556 |
| 363 | Ga0209999_1001417 | 3300027543 | Bacteria | 4110 |
| 364 | Ga0209999_1009079 | 3300027543 | Bacteria | 1797 |
| 365 | Ga0209999_1033388 | 3300027543 | Bacteria | 957 |
| 366 | Ga0209971_1000991 | 3300027682 | Bacteria | 7301 |
| 367 | Ga0209966_1001526 | 3300027695 | Bacteria | 4028 |
| 368 | Ga0209966_1171794 | 3300027695 | Bacteria | 508 |
| 369 | Ga0209998_10009393 | 3300027717 | Bacteria | 2030 |
| 370 | Ga0209813_10002903 | 3300027866 | Bacteria | 3966 |
| 371 | Ga0209974_10021299 | 3300027876 | Bacteria | 2146 |
| 372 | Ga0209974_10208343 | 3300027876 | Bacteria | 724 |
| 373 | Ga0207428_10153594 | 3300027907 | Bacteria | 1751 |
| 374 | Ga0207428_10178931 | 3300027907 | Bacteria | 1603 |
| 375 | Ga0207428_10187015 | 3300027907 | Bacteria | 1562 |
| 376 | Ga0207428_10244406 | 3300027907 | Bacteria | 1340 |
| 377 | Ga0207428_10305724 | 3300027907 | Bacteria | 1176 |
| 378 | Ga0268265_10067183 | 3300028380 | Bacteria | 2774 |
| 379 | Ga0268265_10130052 | 3300028380 | Bacteria | 2090 |
| 380 | Ga0268265_10447727 | 3300028380 | Bacteria | 1205 |
| 381 | Ga0268265_10845328 | 3300028380 | Bacteria | 895 |
| 382 | Ga0268264_11316250 | 3300028381 | Bacteria | 733 |
| 383 | Ga0307515_10453965 | 3300028794 | Bacteria | 897 |
| 384 | Ga0265328_10051733 | 3300031239 | Bacteria | 1508 |
| 385 | Ga0265328_10222646 | 3300031239 | Unclassified | 719 |
| 386 | Ga0265331_10003722 | 3300031250 | Bacteria | 9693 |
| 387 | Ga0265331_10004122 | 3300031250 | Bacteria | 9123 |
| 388 | Ga0265327_10000451 | 3300031251 | Bacteria | 73966 |
| 389 | Ga0265327_10002955 | 3300031251 | Bacteria | 16994 |
| 390 | Ga0265327_10034803 | 3300031251 | Bacteria | 2790 |
| 391 | Ga0265327_10119036 | 3300031251 | Bacteria | 1253 |
| 392 | Ga0265327_10257525 | 3300031251 | Bacteria | 775 |
| 393 | Ga0265316_10000490 | 3300031344 | Bacteria | 44853 |
| 394 | Ga0265316_11043032 | 3300031344 | Unclassified | 568 |
| 395 | Ga0307408_100076693 | 3300031548 | Bacteria | 2487 |
| 396 | Ga0307408_100107514 | 3300031548 | Bacteria | 2136 |
| 397 | Ga0307408_100187661 | 3300031548 | Bacteria | 1663 |
| 398 | Ga0307408_100543101 | 3300031548 | Bacteria | 1024 |
| 399 | Ga0307408_100567143 | 3300031548 | Bacteria | 1004 |
| 400 | Ga0307408_101269024 | 3300031548 | Bacteria | 689 |
| 401 | Ga0316576_10016154 | 3300031727 | Bacteria | 5032 |
| 402 | Ga0316578_10048061 | 3300031728 | Bacteria | 2491 |
| 403 | Ga0307516_10164543 | 3300031730 | Bacteria | 1965 |
| 404 | Ga0307405_10318514 | 3300031731 | Bacteria | 1187 |
| 405 | Ga0307405_10411127 | 3300031731 | Bacteria | 1062 |
| 406 | Ga0307405_11603465 | 3300031731 | Bacteria | 574 |
| 407 | Ga0316577_10021920 | 3300031733 | Bacteria | 3545 |
| 408 | Ga0307410_10525666 | 3300031852 | Bacteria | 977 |
| 409 | Ga0307410_12005519 | 3300031852 | Bacteria | 516 |
| 410 | Ga0307406_10525460 | 3300031901 | Bacteria | 964 |
| 411 | Ga0307406_11273274 | 3300031901 | Bacteria | 641 |
| 412 | Ga0307407_10214433 | 3300031903 | Bacteria | 1298 |
| 413 | Ga0307407_10406707 | 3300031903 | Bacteria | 978 |
| 414 | Ga0307407_11046527 | 3300031903 | Bacteria | 632 |
| 415 | Ga0307412_10725979 | 3300031911 | Bacteria | 855 |
| 416 | Ga0307412_11189004 | 3300031911 | Bacteria | 682 |
| 417 | Ga0307412_11939303 | 3300031911 | Bacteria | 544 |
| 418 | Ga0307416_100033663 | 3300032002 | Bacteria | 3888 |
| 419 | Ga0307416_100096838 | 3300032002 | Bacteria | 2553 |
| 420 | Ga0307416_100232215 | 3300032002 | Bacteria | 1779 |
| 421 | Ga0307416_100291683 | 3300032002 | Bacteria | 1615 |
| 422 | Ga0307416_100320812 | 3300032002 | Bacteria | 1551 |
| 423 | Ga0307416_100409182 | 3300032002 | Bacteria | 1397 |
| 424 | Ga0307416_102647614 | 3300032002 | Bacteria | 599 |
| 425 | Ga0307416_102818127 | 3300032002 | Bacteria | 581 |
| 426 | Ga0307416_102862261 | 3300032002 | Unclassified | 577 |
| 427 | Ga0307416_103120224 | 3300032002 | Bacteria | 554 |
| 428 | Ga0307411_10034549 | 3300032005 | Bacteria | 3148 |
| 429 | Ga0307411_10056564 | 3300032005 | Bacteria | 2586 |
| 430 | Ga0307411_10122118 | 3300032005 | Bacteria | 1887 |
| 431 | Ga0307411_10161476 | 3300032005 | Bacteria | 1679 |
| 432 | Ga0307411_10643556 | 3300032005 | Bacteria | 917 |
| 433 | Ga0307411_10656028 | 3300032005 | Bacteria | 909 |
| 434 | Ga0307415_100312981 | 3300032126 | Bacteria | 1306 |
| 435 | Ga0307415_100880296 | 3300032126 | Bacteria | 824 |
| 436 | Ga0307415_100892409 | 3300032126 | Bacteria | 819 |
| 437 | Ga0373930_0032470 | 3300034816 | Bacteria | 1080 |
| 438 | Ga0373930_0043553 | 3300034816 | Bacteria | 963 |
| 439 | Ga0373930_0152478 | 3300034816 | Bacteria | 580 |
| 440 | Ga0373948_0023578 | 3300034817 | Bacteria | 1195 |
| 441 | Ga0373950_0048983 | 3300034818 | Bacteria | 826 |
| 442 | Ga0373959_0026709 | 3300034820 | Bacteria | 1142 |
| 443 | Ga0373926_0000464 | 3300035083 | Bacteria | 10647 |
| 444 | Ga0373928_0006357 | 3300035084 | Bacteria | 2273 |
| 445 | Ga0373928_0109765 | 3300035084 | Unclassified | 729 |
| 446 | Ga0373929_0062317 | 3300035085 | Bacteria | 876 |
| 447 | Ga0373929_0066936 | 3300035085 | Bacteria | 852 |
| 448 | Ga0373934_0060537 | 3300035086 | Bacteria | 1508 |
| 449 | Ga0373940_0000708 | 3300035088 | Bacteria | 5403 |
| 450 | Ga0373940_0039661 | 3300035088 | Bacteria | 1290 |
| 451 | Ga0373944_0020582 | 3300035089 | Bacteria | 1902 |
| 452 | Ga0373949_0030698 | 3300035090 | Bacteria | 1278 |
| 453 | Ga0373951_0005230 | 3300035091 | Bacteria | 3027 |
| 454 | Ga0373951_0154554 | 3300035091 | Bacteria | 645 |
| 455 | Ga0373952_0058187 | 3300035092 | Bacteria | 938 |
| 456 | Ga0373923_0050934 | 3300035111 | Bacteria | 1736 |
| 457 | Ga0373932_0009214 | 3300035112 | Bacteria | 2370 |
| 458 | Ga0373932_0018277 | 3300035112 | Bacteria | 1810 |
| 459 | Ga0373932_0063356 | 3300035112 | Bacteria | 1129 |
| 460 | Ga0373936_0002795 | 3300035113 | Bacteria | 6505 |
| 461 | Ga0373936_0034261 | 3300035113 | Bacteria | 2016 |
| 462 | Ga0373936_0140469 | 3300035113 | Bacteria | 1043 |
| 463 | Ga0373936_0181788 | 3300035113 | Bacteria | 923 |
| 464 | Ga0373936_0358828 | 3300035113 | Bacteria | 665 |
| 465 | Ga0373939_0090529 | 3300035114 | Unclassified | 1033 |
| 466 | Ga0373939_0303079 | 3300035114 | Bacteria | 637 |
| 467 | Ga0373941_0114359 | 3300035115 | Bacteria | 955 |
| 468 | Ga0373941_0151384 | 3300035115 | Bacteria | 851 |
| 469 | Ga0373945_0001048 | 3300035116 | Bacteria | 8289 |
| 470 | Ga0373945_0279154 | 3300035116 | Bacteria | 711 |
| 471 | Ga0373945_0509761 | 3300035116 | Bacteria | 537 |
| 472 | Ga0373953_0021168 | 3300035117 | Bacteria | 2437 |
| 473 | Ga0373953_0201610 | 3300035117 | Bacteria | 860 |
| 474 | Ga0373954_0011161 | 3300035118 | Bacteria | 3977 |
| 475 | Ga0373954_0341182 | 3300035118 | Bacteria | 740 |
| 476 | Ga0373956_0025350 | 3300035119 | Bacteria | 2562 |
| 477 | Ga0373960_0004813 | 3300035121 | Bacteria | 3110 |
| 478 | Ga0373960_0018656 | 3300035121 | Bacteria | 1813 |
| 479 | Ga0373960_0254437 | 3300035121 | Bacteria | 639 |
| 480 | Ga0373943_0010748 | 3300035170 | Bacteria | 4107 |
| 481 | Ga0373943_0017103 | 3300035170 | Bacteria | 3316 |
| 482 | Ga0373943_0574066 | 3300035170 | Bacteria | 663 |
| 483 | Ga0373946_0298177 | 3300035171 | Bacteria | 796 |
| 484 | Ga0373946_0495805 | 3300035171 | Bacteria | 626 |
| 485 | Ga0373955_0031742 | 3300035172 | Bacteria | 2768 |
| 486 | Ga0373955_0185381 | 3300035172 | Bacteria | 1236 |
| 487 | Ga0373955_0732922 | 3300035172 | Unclassified | 607 |
| 488 | Ga0373942_0004365 | 3300035207 | Bacteria | 3285 |
| 489 | Ga0373961_0071384 | 3300035241 | Bacteria | 1074 |
| 490 | Ga0373961_0129669 | 3300035241 | Bacteria | 843 |
| 491 | Ga0373961_0133896 | 3300035241 | Bacteria | 832 |
| 492 | Ga0373961_0300507 | 3300035241 | Bacteria | 594 |
| 493 | Ga0373962_0028594 | 3300035242 | Bacteria | 1513 |
| 494 | Ga0373962_0065057 | 3300035242 | Bacteria | 1078 |
| 495 | Ga0373962_0065905 | 3300035242 | Bacteria | 1073 |
| 496 | Ga0316574_0330547 | 3300035398 | Bacteria | 966 |
| 497 | Ga0373924_0003642 | 3300035410 | Bacteria | 5314 |
| 498 | Ga0373924_0094514 | 3300035410 | Bacteria | 1281 |
| 499 | Ga0373924_0224116 | 3300035410 | Bacteria | 831 |
| 500 | Ga0373924_0405028 | 3300035410 | Bacteria | 610 |
| 501 | Ga0373931_0000307 | 3300035691 | Bacteria | 20644 |
| 502 | Ga0373931_0006244 | 3300035691 | Bacteria | 5558 |
| 503 | Ga0373931_0335253 | 3300035691 | Bacteria | 943 |
| 504 | Ga0373931_0448778 | 3300035691 | Bacteria | 824 |
| 505 | Ga0373931_0536838 | 3300035691 | Bacteria | 758 |
| 506 | Ga0373931_0666747 | 3300035691 | Bacteria | 684 |
| 507 | Ga0373935_0011866 | 3300035692 | Bacteria | 5235 |
| 508 | Ga0373935_0062741 | 3300035692 | Bacteria | 2381 |
| 509 | Ga0373935_0099751 | 3300035692 | Bacteria | 1912 |
| 510 | Ga0373927_0004060 | 3300035695 | Bacteria | 10339 |
| 511 | Ga0373927_0123300 | 3300035695 | Bacteria | 1691 |
| 512 | Ga0373933_0013854 | 3300035724 | Bacteria | 4473 |
| 513 | Ga0373947_0006433 | 3300035725 | Bacteria | 6825 |
| 514 | Ga0373947_0009590 | 3300035725 | Bacteria | 5555 |
| 515 | Ga0373947_0939040 | 3300035725 | Bacteria | 590 |
| 516 | Ga0373937_0006625 | 3300036401 | Bacteria | 10000 |
| 517 | Ga0373937_0074297 | 3300036401 | Bacteria | 3137 |
| 518 | Ga0373937_0120336 | 3300036401 | Bacteria | 2446 |
| 519 | Ga0316584_0044808 | 3300036712 | Bacteria | 3300 |
| 520 | Ga0373925_0037020 | 3300037068 | Bacteria | 3600 |
| 521 | Ga0373925_0038703 | 3300037068 | Bacteria | 3527 |
| 522 | Ga0373925_0042408 | 3300037068 | Bacteria | 3375 |
| 523 | Ga0373925_0651787 | 3300037068 | Bacteria | 868 |
| 524 | Ga0400483_086891 | 3300039062 | Bacteria | 3269 |
| 525 | Ga0400483_151143 | 3300039062 | Bacteria | 268199 |
| 526 | Ga0400483_174877 | 3300039062 | Bacteria | 1393 |
| 527 | Ga0436365_0295636 | 3300039437 | Bacteria | 653 |
| 528 | Ga0436365_0665212 | 3300039437 | Bacteria | 526 |
| 529 | Ga0436365_0981941 | 3300039437 | Bacteria | 54107 |
| 530 | Ga0436365_1621958 | 3300039437 | Bacteria | 3062 |
| 531 | Ga0436360_0520014 | 3300039438 | Bacteria | 1949 |
| 532 | Ga0436360_1127633 | 3300039438 | Bacteria | 553 |
| 533 | Ga0436361_0438991 | 3300039447 | Bacteria | 100787 |
| 534 | Ga0436363_0005179 | 3300039450 | Bacteria | 2122 |
| 535 | Ga0436363_0954949 | 3300039450 | Bacteria | 5294 |
| 536 | Ga0436363_1020652 | 3300039450 | Unclassified | 605 |
| 537 | Ga0436363_1155895 | 3300039450 | Bacteria | 501 |
| 538 | Ga0436362_0323154 | 3300039453 | Bacteria | 1813 |
| 539 | Ga0439453_0033402 | 3300041408 | Bacteria | 983 |
| 540 | Ga0451807_1790131 | 3300041486 | Bacteria | 806 |
| 541 | Ga0451839_0103274 | 3300041496 | Bacteria | 503 |
| 542 | Ga0451849_1374968 | 3300041505 | Bacteria | 703 |
| 543 | Ga0439441_000435 | 3300042001 | Bacteria | 4439 |
| 544 | Ga0439441_129826 | 3300042001 | Bacteria | 583 |
| 545 | Ga0439443_000936 | 3300042003 | Bacteria | 2971 |
| 546 | Ga0439443_017168 | 3300042003 | Bacteria | 1111 |
| 547 | Ga0439451_024285 | 3300042009 | Bacteria | 1221 |
| 548 | Ga0439462_0139409 | 3300042015 | Bacteria | 679 |
| 549 | Ga0450910_106578 | 3300042147 | Bacteria | 506 |
| 550 | Ga0439446_0051165 | 3300042156 | Bacteria | 1234 |
| 551 | Ga0439446_0084409 | 3300042156 | Bacteria | 987 |
| 552 | Ga0439435_0000533 | 3300042436 | Bacteria | 6085 |
| 553 | Ga0439435_0004325 | 3300042436 | Bacteria | 3047 |
| 554 | Ga0439444_0001431 | 3300042437 | Bacteria | 3096 |
| 555 | Ga0439444_0005867 | 3300042437 | Bacteria | 1835 |
| 556 | Ga0439464_0134296 | 3300042439 | Bacteria | 767 |
| 557 | Ga0439460_0000168 | 3300042461 | Bacteria | 12269 |
| 558 | Ga0439460_0017553 | 3300042461 | Bacteria | 1918 |
| 559 | Ga0451577_0001239 | 3300042876 | Bacteria | 35327 |
| 560 | Ga0451577_0035786 | 3300042876 | Bacteria | 4472 |
| 561 | Ga0451577_0043111 | 3300042876 | Bacteria | 4042 |
| 562 | Ga0451577_0708124 | 3300042876 | Bacteria | 912 |
| 563 | Ga0453683_0622793 | 3300044673 | Bacteria | 705 |
| 564 | Ga0466964_0607517 | 3300044706 | Bacteria | 600 |
| 565 | Ga0453684_0000694 | 3300044712 | Bacteria | 119688 |
| 566 | Ga0453684_0070950 | 3300044712 | Bacteria | 4408 |
| 567 | Ga0453684_0088552 | 3300044712 | Bacteria | 3833 |
| 568 | Ga0453684_0800201 | 3300044712 | Bacteria | 1017 |
| 569 | Ga0466957_0497286 | 3300044842 | Bacteria | 845 |
| 570 | Ga0466960_0532896 | 3300044901 | Bacteria | 691 |
| 571 | Ga0451576_0000909 | 3300045051 | Bacteria | 56035 |
| 572 | Ga0451576_0001279 | 3300045051 | Bacteria | 43839 |
| 573 | Ga0451576_0001966 | 3300045051 | Bacteria | 32695 |
| 574 | Ga0451576_0002087 | 3300045051 | Bacteria | 31196 |
| 575 | Ga0451576_0019385 | 3300045051 | Bacteria | 7426 |
| 576 | Ga0451576_0025603 | 3300045051 | Bacteria | 6354 |
| 577 | Ga0451576_0076559 | 3300045051 | Bacteria | 3481 |
| 578 | Ga0451576_0121672 | 3300045051 | Bacteria | 2717 |
| 579 | Ga0451576_0271418 | 3300045051 | Bacteria | 1773 |
| 580 | Ga0451576_1121199 | 3300045051 | Bacteria | 823 |
| 581 | Ga0451576_1908921 | 3300045051 | Unclassified | 613 |
| 582 | Ga0466958_0806492 | 3300045836 | Bacteria | 612 |
| 583 | Ga0466967_0018731 | 3300045976 | Bacteria | 5544 |
| 584 | Ga0466967_0218491 | 3300045976 | Bacteria | 1810 |
| 585 | Ga0466967_1410853 | 3300045976 | Bacteria | 694 |
| 586 | Ga0495592_0000306 | 3300046454 | Bacteria | 41265 |
| 587 | Ga0495629_0765326 | 3300046459 | Bacteria | 638 |
| 588 | Ga0495651_0566299 | 3300046462 | Bacteria | 720 |
| 589 | Ga0495580_0005769 | 3300046472 | Bacteria | 10165 |
| 590 | Ga0495582_0015381 | 3300046473 | Bacteria | 4203 |
| 591 | Ga0495662_0014882 | 3300046476 | Bacteria | 3780 |
| 592 | Ga0495662_0659047 | 3300046476 | Bacteria | 511 |
| 593 | Ga0495584_0392948 | 3300046491 | Bacteria | 705 |
| 594 | Ga0495608_0000439 | 3300046511 | Bacteria | 29042 |
| 595 | Ga0495608_0165747 | 3300046511 | Bacteria | 1403 |
| 596 | Ga0495618_0208052 | 3300046514 | Bacteria | 1237 |
| 597 | Ga0495628_0001253 | 3300046516 | Bacteria | 23229 |
| 598 | Ga0495628_0256099 | 3300046516 | Bacteria | 1305 |
| 599 | Ga0495630_0003035 | 3300046517 | Bacteria | 11651 |
| 600 | Ga0495630_0005926 | 3300046517 | Bacteria | 8641 |
| 601 | Ga0495630_0131061 | 3300046517 | Bacteria | 1904 |
| 602 | Ga0495630_0311486 | 3300046517 | Bacteria | 1203 |
| 603 | Ga0495666_0031317 | 3300046526 | Bacteria | 2606 |
| 604 | Ga0495666_0149015 | 3300046526 | Bacteria | 1088 |
| 605 | Ga0495642_0036413 | 3300046528 | Bacteria | 1989 |
| 606 | Ga0495652_0068067 | 3300046529 | Bacteria | 2984 |
| 607 | Ga0495652_1136903 | 3300046529 | Bacteria | 506 |
| 608 | Ga0495640_0000418 | 3300046533 | Bacteria | 30693 |
| 609 | Ga0495640_0280960 | 3300046533 | Bacteria | 1037 |
| 610 | Ga0495640_0295934 | 3300046533 | Bacteria | 1006 |
| 611 | Ga0495586_0001224 | 3300046535 | Bacteria | 14424 |
| 612 | Ga0495586_0001587 | 3300046535 | Bacteria | 12505 |
| 613 | Ga0495587_0120979 | 3300046536 | Bacteria | 1499 |
| 614 | Ga0495621_0017526 | 3300046539 | Bacteria | 2316 |
| 615 | Ga0495621_0021150 | 3300046539 | Bacteria | 2142 |
| 616 | Ga0495621_0314817 | 3300046539 | Bacteria | 651 |
| 617 | Ga0495621_0510295 | 3300046539 | Bacteria | 519 |
| 618 | Ga0495667_0010719 | 3300046559 | Bacteria | 6198 |
| 619 | Ga0495667_0250774 | 3300046559 | Bacteria | 1126 |
| 620 | Ga0495667_0528568 | 3300046559 | Bacteria | 738 |
| 621 | Ga0495656_0024863 | 3300046615 | Bacteria | 2370 |
| 622 | Ga0495634_0003074 | 3300046642 | Bacteria | 13580 |
| 623 | Ga0495634_0377511 | 3300046642 | Bacteria | 845 |
| 624 | Ga0495635_0028372 | 3300046663 | Bacteria | 3890 |
| 625 | Ga0495635_0061769 | 3300046663 | Bacteria | 2573 |
| 626 | Ga0495588_0057101 | 3300046674 | Bacteria | 2016 |
| 627 | Ga0495657_0249489 | 3300046675 | Bacteria | 1069 |
| 628 | Ga0495599_0015851 | 3300046678 | Bacteria | 4679 |
| 629 | Ga0495599_0092952 | 3300046678 | Bacteria | 1882 |
| 630 | Ga0495647_0000374 | 3300046681 | Bacteria | 12660 |
| 631 | Ga0495647_0251175 | 3300046681 | Bacteria | 787 |
| 632 | Ga0495658_0001390 | 3300046683 | Bacteria | 12703 |
| 633 | Ga0495658_0002491 | 3300046683 | Bacteria | 9263 |
| 634 | Ga0495669_0041437 | 3300046684 | Bacteria | 2045 |
| 635 | Ga0495613_0003181 | 3300046689 | Bacteria | 12293 |
| 636 | Ga0495624_0045756 | 3300046690 | Bacteria | 2784 |
| 637 | Ga0495624_0075287 | 3300046690 | Bacteria | 2096 |
| 638 | Ga0495600_0010182 | 3300046809 | Bacteria | 5827 |
| 639 | Ga0495600_0202265 | 3300046809 | Bacteria | 1275 |
| 640 | Ga0495581_0103252 | 3300047315 | Bacteria | 1656 |
| 641 | Ga0495581_0298821 | 3300047315 | Bacteria | 941 |
| 642 | Ga0495604_0001668 | 3300047317 | Bacteria | 18261 |
| 643 | Ga0495604_0639811 | 3300047317 | Bacteria | 679 |
| 644 | Ga0495636_0008982 | 3300047318 | Bacteria | 3932 |
| 645 | Ga0495674_0280489 | 3300047319 | Bacteria | 1365 |
| 646 | Ga0495674_0285853 | 3300047319 | Bacteria | 1350 |
| 647 | Ga0495676_0060550 | 3300047321 | Bacteria | 2966 |
| 648 | Ga0495680_0003157 | 3300047322 | Bacteria | 16416 |
| 649 | Ga0495680_0043168 | 3300047322 | Bacteria | 3572 |
| 650 | Ga0495675_0129817 | 3300047444 | Bacteria | 1567 |
| 651 | Ga0495684_0801372 | 3300047471 | Bacteria | 615 |
| 652 | Ga0495593_0246809 | 3300047673 | Bacteria | 894 |
| 653 | Ga0495602_0271182 | 3300048088 | Bacteria | 1254 |
| 654 | Ga0495614_0408506 | 3300048089 | Bacteria | 639 |
| 655 | Ga0496106_0340692 | 3300048909 | Bacteria | 1204 |
| 656 | Ga0496108_1442762 | 3300048911 | Unclassified | 574 |
| 657 | Ga0496121_0011858 | 3300048924 | Bacteria | 9598 |
| 658 | Ga0496121_0041821 | 3300048924 | Bacteria | 3998 |
| 659 | Ga0501296_003303 | 3300049519 | Bacteria | 1716 |
| 660 | Ga0501296_021179 | 3300049519 | Bacteria | 832 |
| 661 | Ga0501297_051530 | 3300049520 | Bacteria | 607 |
| 662 | Ga0501299_171738 | 3300049522 | Bacteria | 561 |
| 663 | Ga0501031_0106389 | 3300049568 | Bacteria | 1831 |
| 664 | Ga0501031_0843241 | 3300049568 | Bacteria | 587 |
| 665 | Ga0501032_0935075 | 3300049569 | Bacteria | 545 |
| 666 | Ga0501033_0000364 | 3300049570 | Bacteria | 43293 |
| 667 | Ga0501033_0000897 | 3300049570 | Bacteria | 27231 |
| 668 | Ga0501033_0005748 | 3300049570 | Bacteria | 9772 |
| 669 | Ga0501033_0290772 | 3300049570 | Bacteria | 1152 |
| 670 | Ga0501033_0619462 | 3300049570 | Bacteria | 741 |
| 671 | Ga0501036_0000974 | 3300049572 | Bacteria | 21624 |
| 672 | Ga0501036_0003934 | 3300049572 | Bacteria | 11933 |
| 673 | Ga0501036_0100839 | 3300049572 | Bacteria | 2442 |
| 674 | Ga0501036_0182819 | 3300049572 | Bacteria | 1765 |
| 675 | Ga0501036_1475469 | 3300049572 | Bacteria | 550 |
| 676 | Ga0501037_0077406 | 3300049573 | Bacteria | 2413 |
| 677 | Ga0501037_0578017 | 3300049573 | Bacteria | 756 |
| 678 | Ga0501038_0000189 | 3300049574 | Bacteria | 53371 |
| 679 | Ga0501038_0119876 | 3300049574 | Bacteria | 2171 |
| 680 | Ga0501038_0290282 | 3300049574 | Bacteria | 1286 |
| 681 | Ga0501038_0308845 | 3300049574 | Bacteria | 1239 |
| 682 | Ga0501038_0431277 | 3300049574 | Bacteria | 1016 |
| 683 | Ga0501039_0000247 | 3300049575 | Bacteria | 39539 |
| 684 | Ga0501039_0045851 | 3300049575 | Bacteria | 3378 |
| 685 | Ga0501039_0048437 | 3300049575 | Bacteria | 3285 |
| 686 | Ga0501039_0049647 | 3300049575 | Bacteria | 3244 |
| 687 | Ga0501039_0186776 | 3300049575 | Bacteria | 1630 |
| 688 | Ga0501039_0428170 | 3300049575 | Bacteria | 1039 |
| 689 | Ga0501039_1139179 | 3300049575 | Bacteria | 604 |
| 690 | Ga0501039_1269065 | 3300049575 | Bacteria | 569 |
| 691 | Ga0501040_0000229 | 3300049576 | Bacteria | 32741 |
| 692 | Ga0501040_0010067 | 3300049576 | Bacteria | 6177 |
| 693 | Ga0501040_0012950 | 3300049576 | Bacteria | 5482 |
| 694 | Ga0501040_0363040 | 3300049576 | Bacteria | 1038 |
| 695 | Ga0501041_0000032 | 3300049577 | Bacteria | 44999 |
| 696 | Ga0501041_0023023 | 3300049577 | Bacteria | 3733 |
| 697 | Ga0501041_0081874 | 3300049577 | Bacteria | 1988 |
| 698 | Ga0501041_0194884 | 3300049577 | Bacteria | 1269 |
| 699 | Ga0501041_0467832 | 3300049577 | Bacteria | 801 |
| 700 | Ga0501041_0926351 | 3300049577 | Bacteria | 560 |
| 701 | Ga0501042_0002212 | 3300049578 | Bacteria | 11860 |
| 702 | Ga0501042_0025550 | 3300049578 | Bacteria | 4149 |
| 703 | Ga0501042_0614759 | 3300049578 | Bacteria | 790 |
| 704 | Ga0501042_0998199 | 3300049578 | Bacteria | 610 |
| 705 | Ga0501043_0110342 | 3300049579 | Bacteria | 2160 |
| 706 | Ga0501043_0305142 | 3300049579 | Bacteria | 1216 |
| 707 | Ga0501043_0364372 | 3300049579 | Bacteria | 1096 |
| 708 | Ga0501043_0466224 | 3300049579 | Bacteria | 947 |
| 709 | Ga0501046_0000156 | 3300049580 | Bacteria | 70512 |
| 710 | Ga0501046_0035383 | 3300049580 | Bacteria | 4025 |
| 711 | Ga0501046_0103451 | 3300049580 | Bacteria | 2183 |
| 712 | Ga0501046_0141756 | 3300049580 | Bacteria | 1818 |
| 713 | Ga0501047_0315703 | 3300049581 | Bacteria | 1403 |
| 714 | Ga0501047_0377969 | 3300049581 | Bacteria | 1251 |
| 715 | Ga0501048_0002226 | 3300049582 | Bacteria | 14775 |
| 716 | Ga0501048_0008280 | 3300049582 | Bacteria | 7867 |
| 717 | Ga0501048_0123418 | 3300049582 | Bacteria | 1831 |
| 718 | Ga0501048_0903584 | 3300049582 | Bacteria | 635 |
| 719 | Ga0501068_0015765 | 3300049584 | Bacteria | 4347 |
| 720 | Ga0501068_0408253 | 3300049584 | Bacteria | 876 |
| 721 | Ga0501070_0035376 | 3300049586 | Bacteria | 4174 |
| 722 | Ga0501071_0002557 | 3300049587 | Bacteria | 11093 |
| 723 | Ga0501071_0020882 | 3300049587 | Bacteria | 4555 |
| 724 | Ga0501071_1113973 | 3300049587 | Bacteria | 610 |
| 725 | Ga0501072_0001593 | 3300049588 | Bacteria | 16962 |
| 726 | Ga0501072_0008225 | 3300049588 | Bacteria | 7923 |
| 727 | Ga0501072_0180004 | 3300049588 | Bacteria | 1686 |
| 728 | Ga0501072_0721374 | 3300049588 | Bacteria | 783 |
| 729 | Ga0501072_0758442 | 3300049588 | Bacteria | 761 |
| 730 | Ga0501072_0766609 | 3300049588 | Bacteria | 756 |
| 731 | Ga0501074_0045233 | 3300049590 | Bacteria | 3185 |
| 732 | Ga0501074_0170602 | 3300049590 | Bacteria | 1553 |
| 733 | Ga0501074_0249181 | 3300049590 | Bacteria | 1263 |
| 734 | Ga0501074_0367302 | 3300049590 | Bacteria | 1021 |
| 735 | Ga0501075_0000053 | 3300049591 | Bacteria | 49110 |
| 736 | Ga0501075_0000179 | 3300049591 | Bacteria | 32841 |
| 737 | Ga0501075_0070543 | 3300049591 | Bacteria | 2640 |
| 738 | Ga0501075_0738232 | 3300049591 | Bacteria | 750 |
| 739 | Ga0501075_0764436 | 3300049591 | Bacteria | 735 |
| 740 | Ga0501076_0001036 | 3300049592 | Bacteria | 18262 |
| 741 | Ga0501076_0002539 | 3300049592 | Bacteria | 12558 |
| 742 | Ga0501076_0373052 | 3300049592 | Bacteria | 1172 |
| 743 | Ga0501076_0759579 | 3300049592 | Bacteria | 800 |
| 744 | Ga0501077_0000086 | 3300049593 | Bacteria | 46652 |
| 745 | Ga0501077_0016526 | 3300049593 | Bacteria | 4650 |
| 746 | Ga0501209_101302 | 3300049656 | Bacteria | 845 |
| 747 | Ga0501217_061056 | 3300049661 | Bacteria | 1007 |
| 748 | Ga0501233_189627 | 3300049668 | Bacteria | 593 |
| 749 | Ga0501235_045511 | 3300049669 | Bacteria | 1010 |
| 750 | Ga0501236_050158 | 3300049670 | Bacteria | 715 |
| 751 | Ga0501249_111244 | 3300049679 | Bacteria | 662 |
| 752 | Ga0501221_026409 | 3300049704 | Bacteria | 1181 |
| 753 | Ga0501225_0161326 | 3300049705 | Bacteria | 690 |
| 754 | Ga0501079_0000208 | 3300049741 | Bacteria | 34357 |
| 755 | Ga0501079_0021705 | 3300049741 | Bacteria | 4914 |
| 756 | Ga0501079_0624157 | 3300049741 | Bacteria | 848 |
| 757 | Ga0501080_0012555 | 3300049742 | Bacteria | 7768 |
| 758 | Ga0501080_0083308 | 3300049742 | Bacteria | 2971 |
| 759 | Ga0501080_0097910 | 3300049742 | Bacteria | 2723 |
| 760 | Ga0501081_0000127 | 3300049743 | Bacteria | 33437 |
| 761 | Ga0501081_0020455 | 3300049743 | Bacteria | 4411 |
| 762 | Ga0501283_059842 | 3300049779 | Bacteria | 687 |
| 763 | Ga0501035_0000199 | 3300049822 | Bacteria | 73522 |
| 764 | Ga0501035_0008469 | 3300049822 | Bacteria | 9580 |
| 765 | Ga0501035_0409561 | 3300049822 | Bacteria | 1127 |
| 766 | Ga0501035_0465516 | 3300049822 | Bacteria | 1044 |
| 767 | Ga0501044_0064530 | 3300049823 | Bacteria | 3738 |
| 768 | Ga0501044_0078329 | 3300049823 | Bacteria | 3349 |
| 769 | Ga0501044_0131650 | 3300049823 | Bacteria | 2495 |
| 770 | Ga0501044_0233246 | 3300049823 | Bacteria | 1787 |
| 771 | Ga0501045_0000372 | 3300049824 | Bacteria | 26953 |
| 772 | Ga0501045_0075506 | 3300049824 | Bacteria | 2482 |
| 773 | Ga0501045_0107427 | 3300049824 | Bacteria | 2068 |
| 774 | Ga0501045_0132815 | 3300049824 | Bacteria | 1851 |
| 775 | Ga0501212_065447 | 3300049851 | Bacteria | 636 |
| 776 | nmdc:mga03683_149651_c1 | 3300050489 | Bacteria | 1053 |
| 777 | nmdc:mga03683_58400_c1 | 3300050489 | Bacteria | 1626 |
| 778 | nmdc:mga03n38_3825_c1 | 3300050490 | Bacteria | 4892 |
| 779 | nmdc:mga00v17_104175_c1 | 3300050491 | Bacteria | 1794 |
| 780 | nmdc:mga0yw44_142269_c1 | 3300050492 | Bacteria | 1560 |
| 781 | nmdc:mga0k408_49291_c1 | 3300050493 | Bacteria | 2438 |
| 782 | nmdc:mga06z11_498652_c1 | 3300050494 | Bacteria | 738 |
| 783 | nmdc:mga04h51_2135_c1 | 3300050495 | Bacteria | 4633 |
| 784 | nmdc:mga07m45_1893_c1 | 3300050496 | Bacteria | 9652 |
| 785 | nmdc:mga07m45_64752_c1 | 3300050496 | Bacteria | 1585 |
| 786 | nmdc:mga05p37_1445139_c1 | 3300050507 | Bacteria | 689 |
| 787 | nmdc:mga05p37_1475_c1 | 3300050507 | Bacteria | 27330 |
| 788 | nmdc:mga05p37_1835823_c1 | 3300050507 | Bacteria | 583 |
| 789 | nmdc:mga05p37_208988_c1 | 3300050507 | Bacteria | 2360 |
| 790 | nmdc:mga05p37_306457_c1 | 3300050507 | Bacteria | 1884 |
| 791 | nmdc:mga05p37_347132_c1 | 3300050507 | Bacteria | 1748 |
| 792 | nmdc:mga05p37_71309_c1 | 3300050507 | Bacteria | 4273 |
| 793 | nmdc:mga05p37_769363_c1 | 3300050507 | Bacteria | 1058 |
| 794 | nmdc:mga05p37_863354_c1 | 3300050507 | Bacteria | 981 |
| 795 | nmdc:mga09592_103350_c1 | 3300050508 | Bacteria | 2441 |
| 796 | nmdc:mga09592_1566_c1 | 3300050508 | Bacteria | 18396 |
| 797 | nmdc:mga09592_257724_c1 | 3300050508 | Bacteria | 1512 |
| 798 | nmdc:mga09592_646716_c1 | 3300050508 | Bacteria | 903 |
| 799 | nmdc:mga09592_6982_c1 | 3300050508 | Bacteria | 9183 |
| 800 | nmdc:mga0qj67_1051459_c1 | 3300050509 | Bacteria | 637 |
| 801 | nmdc:mga0qj67_11625_c1 | 3300050509 | Bacteria | 6602 |
| 802 | nmdc:mga0qj67_128777_c1 | 3300050509 | Bacteria | 2049 |
| 803 | nmdc:mga0qj67_1451309_c1 | 3300050509 | Bacteria | 529 |
| 804 | nmdc:mga0qj67_1485354_c1 | 3300050509 | Bacteria | 522 |
| 805 | nmdc:mga0qj67_196433_c1 | 3300050509 | Bacteria | 1640 |
| 806 | nmdc:mga0qj67_308145_c1 | 3300050509 | Bacteria | 1282 |
| 807 | nmdc:mga0qj67_408299_c1 | 3300050509 | Bacteria | 1096 |
| 808 | nmdc:mga0qj67_62102_c1 | 3300050509 | Bacteria | 2969 |
| 809 | nmdc:mga06r32_1127658_c1 | 3300050510 | Bacteria | 733 |
| 810 | nmdc:mga06r32_1166086_c1 | 3300050510 | Bacteria | 718 |
| 811 | nmdc:mga06r32_1383553_c1 | 3300050510 | Bacteria | 646 |
| 812 | nmdc:mga06r32_192855_c1 | 3300050510 | Bacteria | 2024 |
| 813 | nmdc:mga06r32_59746_c1 | 3300050510 | Bacteria | 3668 |
| 814 | nmdc:mga08y16_119157_c1 | 3300050511 | Bacteria | 2747 |
| 815 | nmdc:mga08y16_14684_c1 | 3300050511 | Bacteria | 8234 |
| 816 | nmdc:mga08y16_379628_c1 | 3300050511 | Bacteria | 1449 |
| 817 | nmdc:mga08y16_394757_c1 | 3300050511 | Bacteria | 1417 |
| 818 | nmdc:mga08y16_396805_c1 | 3300050511 | Bacteria | 1412 |
| 819 | nmdc:mga08y16_43170_c1 | 3300050511 | Bacteria | 4724 |
| 820 | nmdc:mga08y16_5848_c1 | 3300050511 | Bacteria | 12887 |
| 821 | nmdc:mga08y16_9319_c1 | 3300050511 | Bacteria | 10297 |
| 822 | nmdc:mga0n895_1315640_c1 | 3300050512 | Bacteria | 693 |
| 823 | nmdc:mga0n895_134457_c1 | 3300050512 | Bacteria | 2499 |
| 824 | nmdc:mga0n895_3063_c1 | 3300050512 | Bacteria | 13289 |
| 825 | nmdc:mga0n895_4921_c1 | 3300050512 | Bacteria | 11077 |
| 826 | nmdc:mga0n895_529_c1 | 3300050512 | Bacteria | 26051 |
| 827 | nmdc:mga0rr50_1174228_c1 | 3300050513 | Bacteria | 652 |
| 828 | nmdc:mga0rr50_1273963_c1 | 3300050513 | Bacteria | 624 |
| 829 | nmdc:mga0rr50_128_c1 | 3300050513 | Bacteria | 41482 |
| 830 | nmdc:mga0rr50_165129_c1 | 3300050513 | Bacteria | 1800 |
| 831 | nmdc:mga0rr50_205455_c1 | 3300050513 | Bacteria | 1621 |
| 832 | nmdc:mga0rr50_376479_c1 | 3300050513 | Bacteria | 1197 |
| 833 | nmdc:mga0rr50_4412_c1 | 3300050513 | Bacteria | 8270 |
| 834 | nmdc:mga08x19_109576_c1 | 3300050514 | Bacteria | 1841 |
| 835 | nmdc:mga08x19_12231_c2 | 3300050514 | Bacteria | 4036 |
| 836 | nmdc:mga08x19_15014_c1 | 3300050514 | Bacteria | 4704 |
| 837 | nmdc:mga08x19_15549_c1 | 3300050514 | Bacteria | 4632 |
| 838 | nmdc:mga08x19_27559_c1 | 3300050514 | Bacteria | 3553 |
| 839 | nmdc:mga08x19_42965_c1 | 3300050514 | Bacteria | 2883 |
| 840 | nmdc:mga08x19_434_c1 | 3300050514 | Bacteria | 28646 |
| 841 | nmdc:mga08x19_463096_c1 | 3300050514 | Bacteria | 893 |
| 842 | nmdc:mga08x19_484770_c1 | 3300050514 | Unclassified | 872 |
| 843 | nmdc:mga0a205_160_c1 | 3300050515 | Bacteria | 44269 |
| 844 | nmdc:mga0a205_289330_c1 | 3300050515 | Bacteria | 1513 |
| 845 | nmdc:mga0a205_49483_c1 | 3300050515 | Bacteria | 4057 |
| 846 | nmdc:mga0sz30_111980_c1 | 3300050516 | Bacteria | 1197 |
| 847 | Ga0495601_0018876 | 3300053077 | Bacteria | 4201 |
| 848 | Ga0495601_0058240 | 3300053077 | Bacteria | 2448 |
| 849 | Ga0495612_0365206 | 3300053078 | Bacteria | 653 |
| 850 | Ga0495595_0197920 | 3300053084 | Bacteria | 1000 |
| 851 | Ga0495619_0024756 | 3300053085 | Bacteria | 3851 |
| 852 | Ga0495619_0908250 | 3300053085 | Bacteria | 592 |
| 853 | Ga0500595_001363 | 3300053119 | Bacteria | 13145 |
| 854 | Ga0500568_0139805 | 3300053139 | Unclassified | 898 |
| 855 | Ga0501084_0003487 | 3300054114 | Bacteria | 12782 |
| 856 | Ga0501084_0068009 | 3300054114 | Bacteria | 2982 |
| 857 | Ga0501084_0330355 | 3300054114 | Bacteria | 1288 |
| 858 | Ga0500661_053594 | 3300055283 | Bacteria | 722 |
| 859 | Ga0590077_099849 | 3300059426 | Bacteria | 678 |
| 860 | Ga0590077_169523 | 3300059426 | Bacteria | 525 |
| 861 | Ga0501082_0003275 | 3300060353 | Bacteria | 14136 |
| 862 | Ga0501082_0006747 | 3300060353 | Bacteria | 9925 |
| 863 | Ga0501082_0804227 | 3300060353 | Bacteria | 822 |
| 864 | Ga0530510_0000087 | 3300061734 | Bacteria | 49212 |
| 865 | Ga0530510_0000160 | 3300061734 | Bacteria | 40364 |
| 866 | Ga0530510_0496633 | 3300061734 | Bacteria | 925 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005578 | Ga0068854_100432821 | Ga0068854_1004328212 | 78 |
| 2 | 3300006852 | Ga0075433_11687564 | Ga0075433_116875642 | 79 |
| 3 | 3300007076 | Ga0075435_100017646 | Ga0075435_1000176466 | 79 |
| 4 | 3300009094 | Ga0111539_10543565 | Ga0111539_105435651 | 79 |
| 5 | 3300031911 | Ga0307412_11939303 | Ga0307412_119393032 | 79 |
| 6 | 3300035113 | Ga0373936_0140469 | Ga0373936_0140469_240_482 | 79 |
| 7 | 3300005329 | Ga0070683_100042576 | Ga0070683_1000425762 | 80 |
| 8 | 3300005330 | Ga0070690_100472920 | Ga0070690_1004729202 | 80 |
| 9 | 3300005334 | Ga0068869_100426532 | Ga0068869_1004265322 | 80 |
| 10 | 3300005334 | Ga0068869_101819970 | Ga0068869_1018199702 | 80 |
| 11 | 3300005336 | Ga0070680_100130054 | Ga0070680_1001300543 | 80 |
| 12 | 3300005338 | Ga0068868_100932668 | Ga0068868_1009326682 | 80 |
| 13 | 3300005340 | Ga0070689_100100857 | Ga0070689_1001008573 | 80 |
| 14 | 3300005340 | Ga0070689_100299742 | Ga0070689_1002997422 | 80 |
| 15 | 3300005340 | Ga0070689_101242183 | Ga0070689_1012421831 | 80 |
| 16 | 3300005341 | Ga0070691_10082614 | Ga0070691_100826142 | 80 |
| 17 | 3300005343 | Ga0070687_100246522 | Ga0070687_1002465223 | 80 |
| 18 | 3300005343 | Ga0070687_100608565 | Ga0070687_1006085652 | 80 |
| 19 | 3300005345 | Ga0070692_10190452 | Ga0070692_101904522 | 80 |
| 20 | 3300005345 | Ga0070692_10307961 | Ga0070692_103079611 | 80 |
| 21 | 3300005347 | Ga0070668_100044754 | Ga0070668_1000447541 | 80 |
| 22 | 3300005356 | Ga0070674_101073413 | Ga0070674_1010734132 | 80 |
| 23 | 3300005364 | Ga0070673_100937721 | Ga0070673_1009377212 | 80 |
| 24 | 3300005434 | Ga0070709_10706679 | Ga0070709_107066792 | 80 |
| 25 | 3300005434 | Ga0070709_11547529 | Ga0070709_115475292 | 80 |
| 26 | 3300005435 | Ga0070714_100405452 | Ga0070714_1004054522 | 80 |
| 27 | 3300005437 | Ga0070710_10054037 | Ga0070710_100540373 | 80 |
| 28 | 3300005437 | Ga0070710_10366270 | Ga0070710_103662702 | 80 |
| 29 | 3300005438 | Ga0070701_10120497 | Ga0070701_101204972 | 80 |
| 30 | 3300005438 | Ga0070701_10469921 | Ga0070701_104699212 | 80 |
| 31 | 3300005439 | Ga0070711_100286534 | Ga0070711_1002865342 | 80 |
| 32 | 3300005440 | Ga0070705_100004688 | Ga0070705_1000046885 | 80 |
| 33 | 3300005440 | Ga0070705_100025712 | Ga0070705_1000257125 | 80 |
| 34 | 3300005440 | Ga0070705_100043610 | Ga0070705_1000436103 | 80 |
| 35 | 3300005441 | Ga0070700_101292780 | Ga0070700_1012927802 | 80 |
| 36 | 3300005444 | Ga0070694_100006497 | Ga0070694_1000064976 | 80 |
| 37 | 3300005444 | Ga0070694_100049845 | Ga0070694_1000498453 | 80 |
| 38 | 3300005444 | Ga0070694_100276151 | Ga0070694_1002761512 | 80 |
| 39 | 3300005444 | Ga0070694_101830984 | Ga0070694_1018309841 | 80 |
| 40 | 3300005445 | Ga0070708_101215005 | Ga0070708_1012150052 | 80 |
| 41 | 3300005467 | Ga0070706_100573621 | Ga0070706_1005736213 | 80 |
| 42 | 3300005518 | Ga0070699_100351464 | Ga0070699_1003514641 | 80 |
| 43 | 3300005536 | Ga0070697_100057369 | Ga0070697_1000573695 | 80 |
| 44 | 3300005543 | Ga0070672_100498263 | Ga0070672_1004982632 | 80 |
| 45 | 3300005544 | Ga0070686_100411030 | Ga0070686_1004110302 | 80 |
| 46 | 3300005544 | Ga0070686_100604058 | Ga0070686_1006040581 | 80 |
| 47 | 3300005545 | Ga0070695_100078323 | Ga0070695_1000783232 | 80 |
| 48 | 3300005545 | Ga0070695_100306039 | Ga0070695_1003060392 | 80 |
| 49 | 3300005545 | Ga0070695_100520744 | Ga0070695_1005207442 | 80 |
| 50 | 3300005546 | Ga0070696_100002386 | Ga0070696_10000238615 | 80 |
| 51 | 3300005546 | Ga0070696_100433147 | Ga0070696_1004331472 | 80 |
| 52 | 3300005547 | Ga0070693_100454006 | Ga0070693_1004540062 | 80 |
| 53 | 3300005547 | Ga0070693_100743420 | Ga0070693_1007434202 | 80 |
| 54 | 3300005547 | Ga0070693_101560022 | Ga0070693_1015600222 | 80 |
| 55 | 3300005549 | Ga0070704_100246246 | Ga0070704_1002462463 | 80 |
| 56 | 3300005549 | Ga0070704_100381457 | Ga0070704_1003814572 | 80 |
| 57 | 3300005549 | Ga0070704_100427388 | Ga0070704_1004273883 | 80 |
| 58 | 3300005549 | Ga0070704_100743609 | Ga0070704_1007436092 | 80 |
| 59 | 3300005615 | Ga0070702_100023235 | Ga0070702_1000232353 | 80 |
| 60 | 3300005615 | Ga0070702_100311021 | Ga0070702_1003110212 | 80 |
| 61 | 3300005718 | Ga0068866_10506576 | Ga0068866_105065762 | 80 |
| 62 | 3300005719 | Ga0068861_100240491 | Ga0068861_1002404912 | 80 |
| 63 | 3300005842 | Ga0068858_100053157 | Ga0068858_1000531572 | 80 |
| 64 | 3300005842 | Ga0068858_100737964 | Ga0068858_1007379642 | 80 |
| 65 | 3300005843 | Ga0068860_100646843 | Ga0068860_1006468433 | 80 |
| 66 | 3300006173 | Ga0070716_100627921 | Ga0070716_1006279212 | 80 |
| 67 | 3300006173 | Ga0070716_100631297 | Ga0070716_1006312972 | 80 |
| 68 | 3300006846 | Ga0075430_100033130 | Ga0075430_1000331304 | 80 |
| 69 | 3300006871 | Ga0075434_100007245 | Ga0075434_1000072457 | 80 |
| 70 | 3300006880 | Ga0075429_100284557 | Ga0075429_1002845573 | 80 |
| 71 | 3300006881 | Ga0068865_100664788 | Ga0068865_1006647882 | 80 |
| 72 | 3300006914 | Ga0075436_100013730 | Ga0075436_1000137303 | 80 |
| 73 | 3300006914 | Ga0075436_100050698 | Ga0075436_1000506983 | 80 |
| 74 | 3300007076 | Ga0075435_100021908 | Ga0075435_1000219086 | 80 |
| 75 | 3300007076 | Ga0075435_100055502 | Ga0075435_1000555024 | 80 |
| 76 | 3300007076 | Ga0075435_101431945 | Ga0075435_1014319452 | 80 |
| 77 | 3300009094 | Ga0111539_10011706 | Ga0111539_100117065 | 80 |
| 78 | 3300009094 | Ga0111539_10076537 | Ga0111539_100765373 | 80 |
| 79 | 3300009094 | Ga0111539_11302360 | Ga0111539_113023602 | 80 |
| 80 | 3300009098 | Ga0105245_12826722 | Ga0105245_128267222 | 80 |
| 81 | 3300009147 | Ga0114129_10248304 | Ga0114129_102483043 | 80 |
| 82 | 3300009147 | Ga0114129_10373163 | Ga0114129_103731633 | 80 |
| 83 | 3300009147 | Ga0114129_12217238 | Ga0114129_122172382 | 80 |
| 84 | 3300009176 | Ga0105242_10415247 | Ga0105242_104152472 | 80 |
| 85 | 3300013307 | Ga0157372_10309715 | Ga0157372_103097153 | 80 |
| 86 | 3300014745 | Ga0157377_11461920 | Ga0157377_114619201 | 80 |
| 87 | 3300025898 | Ga0207692_10057561 | Ga0207692_100575613 | 80 |
| 88 | 3300025906 | Ga0207699_11076180 | Ga0207699_110761802 | 80 |
| 89 | 3300025916 | Ga0207663_10272808 | Ga0207663_102728082 | 80 |
| 90 | 3300025916 | Ga0207663_10313118 | Ga0207663_103131181 | 80 |
| 91 | 3300025917 | Ga0207660_10262698 | Ga0207660_102626983 | 80 |
| 92 | 3300025918 | Ga0207662_10097379 | Ga0207662_100973792 | 80 |
| 93 | 3300025918 | Ga0207662_11070407 | Ga0207662_110704071 | 80 |
| 94 | 3300025929 | Ga0207664_10228422 | Ga0207664_102284223 | 80 |
| 95 | 3300025936 | Ga0207670_10169816 | Ga0207670_101698163 | 80 |
| 96 | 3300025938 | Ga0207704_11758919 | Ga0207704_117589191 | 80 |
| 97 | 3300025939 | Ga0207665_10876608 | Ga0207665_108766082 | 80 |
| 98 | 3300025942 | Ga0207689_10323681 | Ga0207689_103236812 | 80 |
| 99 | 3300025942 | Ga0207689_10505762 | Ga0207689_105057622 | 80 |
| 100 | 3300025972 | Ga0207668_10480330 | Ga0207668_104803302 | 80 |
| 101 | 3300025986 | Ga0207658_10730508 | Ga0207658_107305082 | 80 |
| 102 | 3300026035 | Ga0207703_10831526 | Ga0207703_108315262 | 80 |
| 103 | 3300026075 | Ga0207708_10136147 | Ga0207708_101361473 | 80 |
| 104 | 3300026075 | Ga0207708_11869509 | Ga0207708_118695092 | 80 |
| 105 | 3300026118 | Ga0207675_100529425 | Ga0207675_1005294252 | 80 |
| 106 | 3300027360 | Ga0209969_1001335 | Ga0209969_10013354 | 80 |
| 107 | 3300027364 | Ga0209967_1032935 | Ga0209967_10329352 | 80 |
| 108 | 3300027395 | Ga0209996_1003376 | Ga0209996_10033763 | 80 |
| 109 | 3300027462 | Ga0210000_1024580 | Ga0210000_10245802 | 80 |
| 110 | 3300027543 | Ga0209999_1009079 | Ga0209999_10090793 | 80 |
| 111 | 3300027543 | Ga0209999_1033388 | Ga0209999_10333882 | 80 |
| 112 | 3300027682 | Ga0209971_1000991 | Ga0209971_10009915 | 80 |
| 113 | 3300027695 | Ga0209966_1001526 | Ga0209966_10015266 | 80 |
| 114 | 3300027717 | Ga0209998_10009393 | Ga0209998_100093933 | 80 |
| 115 | 3300027876 | Ga0209974_10021299 | Ga0209974_100212992 | 80 |
| 116 | 3300027907 | Ga0207428_10153594 | Ga0207428_101535943 | 80 |
| 117 | 3300031250 | Ga0265331_10004122 | Ga0265331_100041221 | 80 |
| 118 | 3300031548 | Ga0307408_100076693 | Ga0307408_1000766933 | 80 |
| 119 | 3300031548 | Ga0307408_100187661 | Ga0307408_1001876613 | 80 |
| 120 | 3300031731 | Ga0307405_10318514 | Ga0307405_103185143 | 80 |
| 121 | 3300031731 | Ga0307405_11603465 | Ga0307405_116034651 | 80 |
| 122 | 3300031901 | Ga0307406_11273274 | Ga0307406_112732742 | 80 |
| 123 | 3300031911 | Ga0307412_10725979 | Ga0307412_107259792 | 80 |
| 124 | 3300032002 | Ga0307416_100232215 | Ga0307416_1002322153 | 80 |
| 125 | 3300032002 | Ga0307416_102818127 | Ga0307416_1028181271 | 80 |
| 126 | 3300032005 | Ga0307411_10161476 | Ga0307411_101614763 | 80 |
| 127 | 3300034816 | Ga0373930_0152478 | Ga0373930_0152478_300_548 | 80 |
| 128 | 3300035085 | Ga0373929_0062317 | Ga0373929_0062317_13_264 | 80 |
| 129 | 3300035086 | Ga0373934_0060537 | Ga0373934_0060537_570_815 | 80 |
| 130 | 3300035113 | Ga0373936_0181788 | Ga0373936_0181788_421_669 | 80 |
| 131 | 3300035116 | Ga0373945_0509761 | Ga0373945_0509761_186_431 | 80 |
| 132 | 3300035117 | Ga0373953_0021168 | Ga0373953_0021168_919_1164 | 80 |
| 133 | 3300035118 | Ga0373954_0011161 | Ga0373954_0011161_379_624 | 80 |
| 134 | 3300035119 | Ga0373956_0025350 | Ga0373956_0025350_1536_1781 | 80 |
| 135 | 3300035121 | Ga0373960_0254437 | Ga0373960_0254437_163_408 | 80 |
| 136 | 3300035170 | Ga0373943_0574066 | Ga0373943_0574066_186_431 | 80 |
| 137 | 3300035171 | Ga0373946_0495805 | Ga0373946_0495805_14_262 | 80 |
| 138 | 3300035172 | Ga0373955_0031742 | Ga0373955_0031742_570_815 | 80 |
| 139 | 3300035241 | Ga0373961_0300507 | Ga0373961_0300507_295_543 | 80 |
| 140 | 3300035242 | Ga0373962_0065905 | Ga0373962_0065905_336_584 | 80 |
| 141 | 3300035398 | Ga0316574_0330547 | Ga0316574_0330547_570_815 | 80 |
| 142 | 3300035410 | Ga0373924_0003642 | Ga0373924_0003642_3656_3901 | 80 |
| 143 | 3300035692 | Ga0373935_0062741 | Ga0373935_0062741_731_976 | 80 |
| 144 | 3300035724 | Ga0373933_0013854 | Ga0373933_0013854_1364_1609 | 80 |
| 145 | 3300035725 | Ga0373947_0939040 | Ga0373947_0939040_125_370 | 80 |
| 146 | 3300036401 | Ga0373937_0120336 | Ga0373937_0120336_976_1221 | 80 |
| 147 | 3300036712 | Ga0316584_0044808 | Ga0316584_0044808_713_958 | 80 |
| 148 | 3300039438 | Ga0436360_0520014 | Ga0436360_0520014_919_1167 | 80 |
| 149 | 3300039438 | Ga0436360_1127633 | Ga0436360_1127633_189_437 | 80 |
| 150 | 3300042001 | Ga0439441_000435 | Ga0439441_000435_1141_1386 | 80 |
| 151 | 3300042001 | Ga0439441_129826 | Ga0439441_129826_79_327 | 80 |
| 152 | 3300042003 | Ga0439443_000936 | Ga0439443_000936_146_391 | 80 |
| 153 | 3300042009 | Ga0439451_024285 | Ga0439451_024285_779_1024 | 80 |
| 154 | 3300042436 | Ga0439435_0000533 | Ga0439435_0000533_2121_2366 | 80 |
| 155 | 3300042437 | Ga0439444_0001431 | Ga0439444_0001431_1378_1623 | 80 |
| 156 | 3300042439 | Ga0439464_0134296 | Ga0439464_0134296_346_591 | 80 |
| 157 | 3300042461 | Ga0439460_0000168 | Ga0439460_0000168_7385_7630 | 80 |
| 158 | 3300045051 | Ga0451576_0076559 | Ga0451576_0076559_2381_2632 | 80 |
| 159 | 3300045976 | Ga0466967_1410853 | Ga0466967_1410853_171_416 | 80 |
| 160 | 3300046459 | Ga0495629_0765326 | Ga0495629_0765326_327_575 | 80 |
| 161 | 3300046462 | Ga0495651_0566299 | Ga0495651_0566299_288_533 | 80 |
| 162 | 3300046476 | Ga0495662_0014882 | Ga0495662_0014882_339_587 | 80 |
| 163 | 3300046476 | Ga0495662_0659047 | Ga0495662_0659047_49_294 | 80 |
| 164 | 3300046511 | Ga0495608_0000439 | Ga0495608_0000439_13204_13452 | 80 |
| 165 | 3300046511 | Ga0495608_0165747 | Ga0495608_0165747_778_1023 | 80 |
| 166 | 3300046514 | Ga0495618_0208052 | Ga0495618_0208052_283_531 | 80 |
| 167 | 3300046516 | Ga0495628_0001253 | Ga0495628_0001253_21158_21406 | 80 |
| 168 | 3300046516 | Ga0495628_0256099 | Ga0495628_0256099_430_675 | 80 |
| 169 | 3300046517 | Ga0495630_0003035 | Ga0495630_0003035_2904_3152 | 80 |
| 170 | 3300046517 | Ga0495630_0005926 | Ga0495630_0005926_2069_2317 | 80 |
| 171 | 3300046517 | Ga0495630_0311486 | Ga0495630_0311486_778_1023 | 80 |
| 172 | 3300046529 | Ga0495652_0068067 | Ga0495652_0068067_653_898 | 80 |
| 173 | 3300046533 | Ga0495640_0000418 | Ga0495640_0000418_23862_24110 | 80 |
| 174 | 3300046533 | Ga0495640_0295934 | Ga0495640_0295934_156_401 | 80 |
| 175 | 3300046535 | Ga0495586_0001587 | Ga0495586_0001587_694_942 | 80 |
| 176 | 3300046539 | Ga0495621_0017526 | Ga0495621_0017526_161_409 | 80 |
| 177 | 3300046539 | Ga0495621_0510295 | Ga0495621_0510295_149_394 | 80 |
| 178 | 3300046559 | Ga0495667_0010719 | Ga0495667_0010719_5259_5507 | 80 |
| 179 | 3300046559 | Ga0495667_0250774 | Ga0495667_0250774_783_1028 | 80 |
| 180 | 3300046642 | Ga0495634_0003074 | Ga0495634_0003074_5378_5626 | 80 |
| 181 | 3300046642 | Ga0495634_0377511 | Ga0495634_0377511_399_647 | 80 |
| 182 | 3300046663 | Ga0495635_0061769 | Ga0495635_0061769_285_530 | 80 |
| 183 | 3300046678 | Ga0495599_0015851 | Ga0495599_0015851_1085_1333 | 80 |
| 184 | 3300046678 | Ga0495599_0092952 | Ga0495599_0092952_1524_1772 | 80 |
| 185 | 3300046681 | Ga0495647_0251175 | Ga0495647_0251175_219_467 | 80 |
| 186 | 3300046683 | Ga0495658_0001390 | Ga0495658_0001390_6461_6709 | 80 |
| 187 | 3300046684 | Ga0495669_0041437 | Ga0495669_0041437_767_1015 | 80 |
| 188 | 3300046689 | Ga0495613_0003181 | Ga0495613_0003181_6787_7035 | 80 |
| 189 | 3300046690 | Ga0495624_0045756 | Ga0495624_0045756_2396_2644 | 80 |
| 190 | 3300046690 | Ga0495624_0075287 | Ga0495624_0075287_1111_1359 | 80 |
| 191 | 3300046809 | Ga0495600_0010182 | Ga0495600_0010182_92_340 | 80 |
| 192 | 3300046809 | Ga0495600_0202265 | Ga0495600_0202265_792_1037 | 80 |
| 193 | 3300047315 | Ga0495581_0298821 | Ga0495581_0298821_454_702 | 80 |
| 194 | 3300047317 | Ga0495604_0639811 | Ga0495604_0639811_320_565 | 80 |
| 195 | 3300047319 | Ga0495674_0280489 | Ga0495674_0280489_1035_1280 | 80 |
| 196 | 3300047319 | Ga0495674_0285853 | Ga0495674_0285853_11_259 | 80 |
| 197 | 3300047322 | Ga0495680_0043168 | Ga0495680_0043168_2457_2702 | 80 |
| 198 | 3300047444 | Ga0495675_0129817 | Ga0495675_0129817_1110_1358 | 80 |
| 199 | 3300047471 | Ga0495684_0801372 | Ga0495684_0801372_290_538 | 80 |
| 200 | 3300048088 | Ga0495602_0271182 | Ga0495602_0271182_743_988 | 80 |
| 201 | 3300048089 | Ga0495614_0408506 | Ga0495614_0408506_92_340 | 80 |
| 202 | 3300049520 | Ga0501297_051530 | Ga0501297_051530_233_487 | 80 |
| 203 | 3300049522 | Ga0501299_171738 | Ga0501299_171738_65_310 | 80 |
| 204 | 3300049570 | Ga0501033_0619462 | Ga0501033_0619462_189_434 | 80 |
| 205 | 3300049572 | Ga0501036_0100839 | Ga0501036_0100839_2055_2300 | 80 |
| 206 | 3300049572 | Ga0501036_1475469 | Ga0501036_1475469_210_455 | 80 |
| 207 | 3300049574 | Ga0501038_0290282 | Ga0501038_0290282_478_723 | 80 |
| 208 | 3300049574 | Ga0501038_0431277 | Ga0501038_0431277_415_660 | 80 |
| 209 | 3300049575 | Ga0501039_0045851 | Ga0501039_0045851_739_984 | 80 |
| 210 | 3300049575 | Ga0501039_0048437 | Ga0501039_0048437_1904_2149 | 80 |
| 211 | 3300049575 | Ga0501039_0428170 | Ga0501039_0428170_376_618 | 80 |
| 212 | 3300049576 | Ga0501040_0012950 | Ga0501040_0012950_44_289 | 80 |
| 213 | 3300049576 | Ga0501040_0363040 | Ga0501040_0363040_425_670 | 80 |
| 214 | 3300049577 | Ga0501041_0023023 | Ga0501041_0023023_944_1189 | 80 |
| 215 | 3300049577 | Ga0501041_0081874 | Ga0501041_0081874_1432_1677 | 80 |
| 216 | 3300049577 | Ga0501041_0467832 | Ga0501041_0467832_52_294 | 80 |
| 217 | 3300049578 | Ga0501042_0025550 | Ga0501042_0025550_2840_3085 | 80 |
| 218 | 3300049578 | Ga0501042_0614759 | Ga0501042_0614759_320_565 | 80 |
| 219 | 3300049579 | Ga0501043_0305142 | Ga0501043_0305142_783_1028 | 80 |
| 220 | 3300049580 | Ga0501046_0103451 | Ga0501046_0103451_1704_1949 | 80 |
| 221 | 3300049580 | Ga0501046_0141756 | Ga0501046_0141756_174_419 | 80 |
| 222 | 3300049582 | Ga0501048_0008280 | Ga0501048_0008280_3526_3771 | 80 |
| 223 | 3300049584 | Ga0501068_0408253 | Ga0501068_0408253_603_845 | 80 |
| 224 | 3300049587 | Ga0501071_0020882 | Ga0501071_0020882_2763_3008 | 80 |
| 225 | 3300049588 | Ga0501072_0008225 | Ga0501072_0008225_4989_5234 | 80 |
| 226 | 3300049588 | Ga0501072_0758442 | Ga0501072_0758442_169_411 | 80 |
| 227 | 3300049590 | Ga0501074_0170602 | Ga0501074_0170602_939_1184 | 80 |
| 228 | 3300049591 | Ga0501075_0000179 | Ga0501075_0000179_24947_25192 | 80 |
| 229 | 3300049591 | Ga0501075_0070543 | Ga0501075_0070543_1097_1342 | 80 |
| 230 | 3300049591 | Ga0501075_0764436 | Ga0501075_0764436_416_658 | 80 |
| 231 | 3300049592 | Ga0501076_0002539 | Ga0501076_0002539_7082_7327 | 80 |
| 232 | 3300049592 | Ga0501076_0759579 | Ga0501076_0759579_158_400 | 80 |
| 233 | 3300049593 | Ga0501077_0016526 | Ga0501077_0016526_3909_4154 | 80 |
| 234 | 3300049656 | Ga0501209_101302 | Ga0501209_101302_87_332 | 80 |
| 235 | 3300049661 | Ga0501217_061056 | Ga0501217_061056_611_856 | 80 |
| 236 | 3300049669 | Ga0501235_045511 | Ga0501235_045511_476_721 | 80 |
| 237 | 3300049741 | Ga0501079_0000208 | Ga0501079_0000208_13842_14087 | 80 |
| 238 | 3300049741 | Ga0501079_0021705 | Ga0501079_0021705_2575_2820 | 80 |
| 239 | 3300049742 | Ga0501080_0083308 | Ga0501080_0083308_1559_1804 | 80 |
| 240 | 3300049743 | Ga0501081_0020455 | Ga0501081_0020455_3758_4003 | 80 |
| 241 | 3300049779 | Ga0501283_059842 | Ga0501283_059842_191_436 | 80 |
| 242 | 3300049822 | Ga0501035_0465516 | Ga0501035_0465516_117_362 | 80 |
| 243 | 3300049824 | Ga0501045_0075506 | Ga0501045_0075506_486_731 | 80 |
| 244 | 3300049824 | Ga0501045_0132815 | Ga0501045_0132815_1061_1306 | 80 |
| 245 | 3300049851 | Ga0501212_065447 | Ga0501212_065447_74_319 | 80 |
| 246 | 3300050507 | nmdc:mga05p37_1835823_c1 | nmdc:mga05p37_1835823_c1_309_554 | 80 |
| 247 | 3300050507 | nmdc:mga05p37_306457_c1 | nmdc:mga05p37_306457_c1_1159_1407 | 80 |
| 248 | 3300050507 | nmdc:mga05p37_347132_c1 | nmdc:mga05p37_347132_c1_1006_1254 | 80 |
| 249 | 3300050508 | nmdc:mga09592_103350_c1 | nmdc:mga09592_103350_c1_12_260 | 80 |
| 250 | 3300050509 | nmdc:mga0qj67_128777_c1 | nmdc:mga0qj67_128777_c1_1791_2036 | 80 |
| 251 | 3300050511 | nmdc:mga08y16_379628_c1 | nmdc:mga08y16_379628_c1_738_986 | 80 |
| 252 | 3300050511 | nmdc:mga08y16_5848_c1 | nmdc:mga08y16_5848_c1_3527_3775 | 80 |
| 253 | 3300050513 | nmdc:mga0rr50_1273963_c1 | nmdc:mga0rr50_1273963_c1_261_506 | 80 |
| 254 | 3300053077 | Ga0495601_0018876 | Ga0495601_0018876_2811_3059 | 80 |
| 255 | 3300053077 | Ga0495601_0058240 | Ga0495601_0058240_1303_1551 | 80 |
| 256 | 3300053078 | Ga0495612_0365206 | Ga0495612_0365206_168_416 | 80 |
| 257 | 3300053084 | Ga0495595_0197920 | Ga0495595_0197920_237_485 | 80 |
| 258 | 3300053085 | Ga0495619_0908250 | Ga0495619_0908250_128_373 | 80 |
| 259 | 3300054114 | Ga0501084_0068009 | Ga0501084_0068009_2687_2932 | 80 |
| 260 | 3300060353 | Ga0501082_0006747 | Ga0501082_0006747_6944_7189 | 80 |
| 261 | 3300060353 | Ga0501082_0804227 | Ga0501082_0804227_162_407 | 80 |
| 262 | 3300061734 | Ga0530510_0000160 | Ga0530510_0000160_11435_11680 | 80 |
| 263 | 3300061734 | Ga0530510_0496633 | Ga0530510_0496633_351_596 | 80 |
| 264 | iso_pu_bacteria | 8002745576 | 8002746986 | 80 |
| 265 | 3300005459 | Ga0068867_100022379 | Ga0068867_1000223794 | 82 |
| 266 | 3300006844 | Ga0075428_100479135 | Ga0075428_1004791351 | 82 |
| 267 | 3300006846 | Ga0075430_100000730 | Ga0075430_1000007303 | 82 |
| 268 | 3300025901 | Ga0207688_10675278 | Ga0207688_106752781 | 82 |
| 269 | 3300025917 | Ga0207660_10195231 | Ga0207660_101952311 | 82 |
| 270 | 3300035691 | Ga0373931_0448778 | Ga0373931_0448778_107_358 | 82 |
| 271 | 3300042156 | Ga0439446_0051165 | Ga0439446_0051165_28_288 | 82 |
| 272 | 3300049570 | Ga0501033_0290772 | Ga0501033_0290772_731_991 | 82 |
| 273 | 3300049576 | Ga0501040_0010067 | Ga0501040_0010067_374_634 | 82 |
| 274 | 3300049577 | Ga0501041_0194884 | Ga0501041_0194884_173_433 | 82 |
| 275 | 3300049588 | Ga0501072_0180004 | Ga0501072_0180004_1019_1279 | 82 |
| 276 | 3300049822 | Ga0501035_0409561 | Ga0501035_0409561_356_616 | 82 |
| 277 | 3300050509 | nmdc:mga0qj67_1485354_c1 | nmdc:mga0qj67_1485354_c1_11_271 | 82 |
| 278 | 3300050509 | nmdc:mga0qj67_62102_c1 | nmdc:mga0qj67_62102_c1_134_394 | 82 |
| 279 | 3300050510 | nmdc:mga06r32_192855_c1 | nmdc:mga06r32_192855_c1_1347_1607 | 82 |
| 280 | 3300053139 | Ga0500568_0139805 | Ga0500568_0139805_457_708 | 82 |
| 281 | 3300005457 | Ga0070662_100383642 | Ga0070662_1003836421 | 83 |
| 282 | 3300005458 | Ga0070681_10445988 | Ga0070681_104459881 | 83 |
| 283 | 3300005467 | Ga0070706_100355782 | Ga0070706_1003557823 | 83 |
| 284 | 3300009174 | Ga0105241_10283579 | Ga0105241_102835792 | 83 |
| 285 | 3300025913 | Ga0207695_10958872 | Ga0207695_109588721 | 83 |
| 286 | 3300025929 | Ga0207664_10454001 | Ga0207664_104540011 | 83 |
| 287 | 3300025933 | Ga0207706_11089290 | Ga0207706_110892902 | 83 |
| 288 | 3300048924 | Ga0496121_0011858 | Ga0496121_0011858_7573_7836 | 83 |
| 289 | 3300049570 | Ga0501033_0000364 | Ga0501033_0000364_38308_38562 | 83 |
| 290 | 3300049572 | Ga0501036_0003934 | Ga0501036_0003934_5885_6139 | 83 |
| 291 | 3300049575 | Ga0501039_0049647 | Ga0501039_0049647_1492_1746 | 83 |
| 292 | 3300049580 | Ga0501046_0035383 | Ga0501046_0035383_628_882 | 83 |
| 293 | 3300049824 | Ga0501045_0107427 | Ga0501045_0107427_744_998 | 83 |
| 294 | 3300050513 | nmdc:mga0rr50_165129_c1 | nmdc:mga0rr50_165129_c1_457_708 | 83 |
| 295 | iso_pu_bacteria | 639633007 | 639787967 | 83 |
| 296 | 3300005336 | Ga0070680_100866695 | Ga0070680_1008666952 | 84 |
| 297 | 3300005435 | Ga0070714_100005253 | Ga0070714_1000052538 | 84 |
| 298 | 3300005445 | Ga0070708_100911355 | Ga0070708_1009113552 | 84 |
| 299 | 3300005459 | Ga0068867_100724918 | Ga0068867_1007249182 | 84 |
| 300 | 3300005467 | Ga0070706_100137927 | Ga0070706_1001379274 | 84 |
| 301 | 3300005536 | Ga0070697_100053069 | Ga0070697_1000530694 | 84 |
| 302 | 3300005536 | Ga0070697_100364181 | Ga0070697_1003641813 | 84 |
| 303 | 3300005546 | Ga0070696_100118825 | Ga0070696_1001188253 | 84 |
| 304 | 3300005546 | Ga0070696_100343812 | Ga0070696_1003438122 | 84 |
| 305 | 3300005549 | Ga0070704_100211114 | Ga0070704_1002111142 | 84 |
| 306 | 3300005615 | Ga0070702_100379878 | Ga0070702_1003798782 | 84 |
| 307 | 3300006163 | Ga0070715_10990523 | Ga0070715_109905232 | 84 |
| 308 | 3300006186 | Ga0075369_10126071 | Ga0075369_101260712 | 84 |
| 309 | 3300006195 | Ga0075366_10594528 | Ga0075366_105945282 | 84 |
| 310 | 3300006844 | Ga0075428_101013708 | Ga0075428_1010137082 | 84 |
| 311 | 3300006846 | Ga0075430_100009943 | Ga0075430_1000099435 | 84 |
| 312 | 3300006847 | Ga0075431_100345869 | Ga0075431_1003458692 | 84 |
| 313 | 3300006852 | Ga0075433_10057667 | Ga0075433_100576672 | 84 |
| 314 | 3300006871 | Ga0075434_100362020 | Ga0075434_1003620202 | 84 |
| 315 | 3300006914 | Ga0075436_100025072 | Ga0075436_1000250723 | 84 |
| 316 | 3300006914 | Ga0075436_100497326 | Ga0075436_1004973262 | 84 |
| 317 | 3300007076 | Ga0075435_100024406 | Ga0075435_1000244066 | 84 |
| 318 | 3300009036 | Ga0105244_10097012 | Ga0105244_100970123 | 84 |
| 319 | 3300009093 | Ga0105240_10905603 | Ga0105240_109056032 | 84 |
| 320 | 3300009094 | Ga0111539_10486917 | Ga0111539_104869173 | 84 |
| 321 | 3300013104 | Ga0157370_10003517 | Ga0157370_100035177 | 84 |
| 322 | 3300017792 | Ga0163161_10467650 | Ga0163161_104676502 | 84 |
| 323 | 3300025735 | Ga0207713_1061471 | Ga0207713_10614712 | 84 |
| 324 | 3300025917 | Ga0207660_10340980 | Ga0207660_103409802 | 84 |
| 325 | 3300031239 | Ga0265328_10051733 | Ga0265328_100517332 | 84 |
| 326 | 3300031239 | Ga0265328_10222646 | Ga0265328_102226462 | 84 |
| 327 | 3300031250 | Ga0265331_10003722 | Ga0265331_100037225 | 84 |
| 328 | 3300031251 | Ga0265327_10034803 | Ga0265327_100348032 | 84 |
| 329 | 3300031251 | Ga0265327_10257525 | Ga0265327_102575252 | 84 |
| 330 | 3300031344 | Ga0265316_11043032 | Ga0265316_110430321 | 84 |
| 331 | 3300031548 | Ga0307408_100543101 | Ga0307408_1005431011 | 84 |
| 332 | 3300031548 | Ga0307408_100567143 | Ga0307408_1005671432 | 84 |
| 333 | 3300031730 | Ga0307516_10164543 | Ga0307516_101645432 | 84 |
| 334 | 3300032002 | Ga0307416_100409182 | Ga0307416_1004091823 | 84 |
| 335 | 3300032002 | Ga0307416_102862261 | Ga0307416_1028622612 | 84 |
| 336 | 3300032005 | Ga0307411_10656028 | Ga0307411_106560282 | 84 |
| 337 | 3300032126 | Ga0307415_100880296 | Ga0307415_1008802962 | 84 |
| 338 | 3300035112 | Ga0373932_0009214 | Ga0373932_0009214_684_944 | 84 |
| 339 | 3300035115 | Ga0373941_0114359 | Ga0373941_0114359_361_621 | 84 |
| 340 | 3300035172 | Ga0373955_0732922 | Ga0373955_0732922_304_561 | 84 |
| 341 | 3300035691 | Ga0373931_0536838 | Ga0373931_0536838_248_508 | 84 |
| 342 | 3300039062 | Ga0400483_086891 | Ga0400483_086891_1718_1972 | 84 |
| 343 | 3300039062 | Ga0400483_151143 | Ga0400483_151143_132048_132305 | 84 |
| 344 | 3300039062 | Ga0400483_174877 | Ga0400483_174877_1114_1368 | 84 |
| 345 | 3300039447 | Ga0436361_0438991 | Ga0436361_0438991_48157_48468 | 84 |
| 346 | 3300042876 | Ga0451577_0001239 | Ga0451577_0001239_18124_18381 | 84 |
| 347 | 3300042876 | Ga0451577_0035786 | Ga0451577_0035786_3969_4226 | 84 |
| 348 | 3300042876 | Ga0451577_0708124 | Ga0451577_0708124_462_719 | 84 |
| 349 | 3300044673 | Ga0453683_0622793 | Ga0453683_0622793_349_606 | 84 |
| 350 | 3300044712 | Ga0453684_0000694 | Ga0453684_0000694_101770_102027 | 84 |
| 351 | 3300044712 | Ga0453684_0070950 | Ga0453684_0070950_448_705 | 84 |
| 352 | 3300044712 | Ga0453684_0088552 | Ga0453684_0088552_3564_3821 | 84 |
| 353 | 3300045051 | Ga0451576_0000909 | Ga0451576_0000909_14163_14420 | 84 |
| 354 | 3300045051 | Ga0451576_0001279 | Ga0451576_0001279_26966_27223 | 84 |
| 355 | 3300045051 | Ga0451576_0001966 | Ga0451576_0001966_16963_17220 | 84 |
| 356 | 3300045051 | Ga0451576_0002087 | Ga0451576_0002087_12759_13016 | 84 |
| 357 | 3300045051 | Ga0451576_0271418 | Ga0451576_0271418_559_816 | 84 |
| 358 | 3300045051 | Ga0451576_1121199 | Ga0451576_1121199_371_634 | 84 |
| 359 | 3300045051 | Ga0451576_1908921 | Ga0451576_1908921_20_277 | 84 |
| 360 | 3300046539 | Ga0495621_0021150 | Ga0495621_0021150_1223_1480 | 84 |
| 361 | 3300046539 | Ga0495621_0314817 | Ga0495621_0314817_14_274 | 84 |
| 362 | 3300048924 | Ga0496121_0041821 | Ga0496121_0041821_3541_3798 | 84 |
| 363 | 3300049568 | Ga0501031_0843241 | Ga0501031_0843241_106_363 | 84 |
| 364 | 3300049570 | Ga0501033_0000897 | Ga0501033_0000897_19881_20180 | 84 |
| 365 | 3300049573 | Ga0501037_0578017 | Ga0501037_0578017_42_341 | 84 |
| 366 | 3300049574 | Ga0501038_0119876 | Ga0501038_0119876_1224_1523 | 84 |
| 367 | 3300049574 | Ga0501038_0308845 | Ga0501038_0308845_582_881 | 84 |
| 368 | 3300049575 | Ga0501039_1139179 | Ga0501039_1139179_183_437 | 84 |
| 369 | 3300049579 | Ga0501043_0364372 | Ga0501043_0364372_126_425 | 84 |
| 370 | 3300049579 | Ga0501043_0466224 | Ga0501043_0466224_598_897 | 84 |
| 371 | 3300049581 | Ga0501047_0377969 | Ga0501047_0377969_633_890 | 84 |
| 372 | 3300049592 | Ga0501076_0373052 | Ga0501076_0373052_18_275 | 84 |
| 373 | 3300049742 | Ga0501080_0012555 | Ga0501080_0012555_3773_4030 | 84 |
| 374 | 3300049822 | Ga0501035_0000199 | Ga0501035_0000199_58618_58917 | 84 |
| 375 | 3300049823 | Ga0501044_0064530 | Ga0501044_0064530_1251_1550 | 84 |
| 376 | 3300049823 | Ga0501044_0078329 | Ga0501044_0078329_761_1060 | 84 |
| 377 | 3300049823 | Ga0501044_0131650 | Ga0501044_0131650_1149_1403 | 84 |
| 378 | 3300050507 | nmdc:mga05p37_863354_c1 | nmdc:mga05p37_863354_c1_170_430 | 84 |
| 379 | 3300050509 | nmdc:mga0qj67_11625_c1 | nmdc:mga0qj67_11625_c1_5967_6245 | 84 |
| 380 | 3300050510 | nmdc:mga06r32_1383553_c1 | nmdc:mga06r32_1383553_c1_17_295 | 84 |
| 381 | 3300050511 | nmdc:mga08y16_396805_c1 | nmdc:mga08y16_396805_c1_352_612 | 84 |
| 382 | 3300050512 | nmdc:mga0n895_134457_c1 | nmdc:mga0n895_134457_c1_2052_2312 | 84 |
| 383 | 3300050513 | nmdc:mga0rr50_376479_c1 | nmdc:mga0rr50_376479_c1_401_661 | 84 |
| 384 | 3300050514 | nmdc:mga08x19_12231_c2 | nmdc:mga08x19_12231_c2_2183_2443 | 84 |
| 385 | 3300050514 | nmdc:mga08x19_463096_c1 | nmdc:mga08x19_463096_c1_337_597 | 84 |
| 386 | 3300050515 | nmdc:mga0a205_49483_c1 | nmdc:mga0a205_49483_c1_2891_3151 | 84 |
| 387 | 3300053119 | Ga0500595_001363 | Ga0500595_001363_8660_8917 | 84 |
| 388 | 3300055283 | Ga0500661_053594 | Ga0500661_053594_188_445 | 84 |
| 389 | 3300005295 | Ga0065707_10028116 | Ga0065707_100281162 | 85 |
| 390 | 3300005295 | Ga0065707_10871671 | Ga0065707_108716712 | 85 |
| 391 | 3300005328 | Ga0070676_10103520 | Ga0070676_101035203 | 85 |
| 392 | 3300005328 | Ga0070676_11251514 | Ga0070676_112515141 | 85 |
| 393 | 3300005328 | Ga0070676_11415428 | Ga0070676_114154282 | 85 |
| 394 | 3300005330 | Ga0070690_100064489 | Ga0070690_1000644893 | 85 |
| 395 | 3300005330 | Ga0070690_100687442 | Ga0070690_1006874422 | 85 |
| 396 | 3300005335 | Ga0070666_10054465 | Ga0070666_100544654 | 85 |
| 397 | 3300005336 | Ga0070680_100001647 | Ga0070680_10000164711 | 85 |
| 398 | 3300005336 | Ga0070680_100014660 | Ga0070680_1000146604 | 85 |
| 399 | 3300005336 | Ga0070680_100348645 | Ga0070680_1003486452 | 85 |
| 400 | 3300005336 | Ga0070680_100461677 | Ga0070680_1004616771 | 85 |
| 401 | 3300005338 | Ga0068868_100398664 | Ga0068868_1003986642 | 85 |
| 402 | 3300005340 | Ga0070689_101798149 | Ga0070689_1017981492 | 85 |
| 403 | 3300005343 | Ga0070687_100028343 | Ga0070687_1000283434 | 85 |
| 404 | 3300005345 | Ga0070692_10009924 | Ga0070692_100099246 | 85 |
| 405 | 3300005345 | Ga0070692_10026413 | Ga0070692_100264134 | 85 |
| 406 | 3300005345 | Ga0070692_10120828 | Ga0070692_101208283 | 85 |
| 407 | 3300005353 | Ga0070669_100002067 | Ga0070669_10000206718 | 85 |
| 408 | 3300005354 | Ga0070675_100022309 | Ga0070675_1000223094 | 85 |
| 409 | 3300005354 | Ga0070675_100026908 | Ga0070675_1000269082 | 85 |
| 410 | 3300005354 | Ga0070675_101571969 | Ga0070675_1015719691 | 85 |
| 411 | 3300005355 | Ga0070671_100120039 | Ga0070671_1001200393 | 85 |
| 412 | 3300005356 | Ga0070674_100068540 | Ga0070674_1000685402 | 85 |
| 413 | 3300005364 | Ga0070673_100170665 | Ga0070673_1001706653 | 85 |
| 414 | 3300005364 | Ga0070673_100409789 | Ga0070673_1004097892 | 85 |
| 415 | 3300005365 | Ga0070688_100181417 | Ga0070688_1001814172 | 85 |
| 416 | 3300005365 | Ga0070688_100942601 | Ga0070688_1009426011 | 85 |
| 417 | 3300005367 | Ga0070667_100581313 | Ga0070667_1005813132 | 85 |
| 418 | 3300005406 | Ga0070703_10011852 | Ga0070703_100118524 | 85 |
| 419 | 3300005438 | Ga0070701_11135196 | Ga0070701_111351962 | 85 |
| 420 | 3300005439 | Ga0070711_100250517 | Ga0070711_1002505173 | 85 |
| 421 | 3300005440 | Ga0070705_100008519 | Ga0070705_1000085193 | 85 |
| 422 | 3300005440 | Ga0070705_100414441 | Ga0070705_1004144412 | 85 |
| 423 | 3300005441 | Ga0070700_100027816 | Ga0070700_1000278163 | 85 |
| 424 | 3300005441 | Ga0070700_100140900 | Ga0070700_1001409004 | 85 |
| 425 | 3300005444 | Ga0070694_100139566 | Ga0070694_1001395662 | 85 |
| 426 | 3300005444 | Ga0070694_100426276 | Ga0070694_1004262763 | 85 |
| 427 | 3300005444 | Ga0070694_100618473 | Ga0070694_1006184732 | 85 |
| 428 | 3300005456 | Ga0070678_100805798 | Ga0070678_1008057982 | 85 |
| 429 | 3300005456 | Ga0070678_101916247 | Ga0070678_1019162471 | 85 |
| 430 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001162 | 85 |
| 431 | 3300005458 | Ga0070681_10094117 | Ga0070681_100941174 | 85 |
| 432 | 3300005458 | Ga0070681_11245986 | Ga0070681_112459862 | 85 |
| 433 | 3300005459 | Ga0068867_100604498 | Ga0068867_1006044982 | 85 |
| 434 | 3300005467 | Ga0070706_100326868 | Ga0070706_1003268683 | 85 |
| 435 | 3300005471 | Ga0070698_100965601 | Ga0070698_1009656012 | 85 |
| 436 | 3300005530 | Ga0070679_100002513 | Ga0070679_10000251310 | 85 |
| 437 | 3300005530 | Ga0070679_100198136 | Ga0070679_1001981364 | 85 |
| 438 | 3300005535 | Ga0070684_100305627 | Ga0070684_1003056273 | 85 |
| 439 | 3300005536 | Ga0070697_100004494 | Ga0070697_10000449413 | 85 |
| 440 | 3300005536 | Ga0070697_100226051 | Ga0070697_1002260512 | 85 |
| 441 | 3300005536 | Ga0070697_101320195 | Ga0070697_1013201952 | 85 |
| 442 | 3300005539 | Ga0068853_100028005 | Ga0068853_1000280054 | 85 |
| 443 | 3300005544 | Ga0070686_100007410 | Ga0070686_1000074105 | 85 |
| 444 | 3300005545 | Ga0070695_100257651 | Ga0070695_1002576512 | 85 |
| 445 | 3300005546 | Ga0070696_100008433 | Ga0070696_1000084337 | 85 |
| 446 | 3300005546 | Ga0070696_100093635 | Ga0070696_1000936351 | 85 |
| 447 | 3300005563 | Ga0068855_100004637 | Ga0068855_1000046379 | 85 |
| 448 | 3300005577 | Ga0068857_100193769 | Ga0068857_1001937693 | 85 |
| 449 | 3300005577 | Ga0068857_101464925 | Ga0068857_1014649252 | 85 |
| 450 | 3300005615 | Ga0070702_100002197 | Ga0070702_1000021973 | 85 |
| 451 | 3300005615 | Ga0070702_100077339 | Ga0070702_1000773394 | 85 |
| 452 | 3300005615 | Ga0070702_101897332 | Ga0070702_1018973322 | 85 |
| 453 | 3300005617 | Ga0068859_100596615 | Ga0068859_1005966152 | 85 |
| 454 | 3300005718 | Ga0068866_10012298 | Ga0068866_100122983 | 85 |
| 455 | 3300005719 | Ga0068861_100009213 | Ga0068861_1000092134 | 85 |
| 456 | 3300005719 | Ga0068861_102003632 | Ga0068861_1020036322 | 85 |
| 457 | 3300005840 | Ga0068870_10341645 | Ga0068870_103416452 | 85 |
| 458 | 3300005841 | Ga0068863_100024667 | Ga0068863_1000246677 | 85 |
| 459 | 3300005842 | Ga0068858_102348515 | Ga0068858_1023485152 | 85 |
| 460 | 3300005843 | Ga0068860_102418809 | Ga0068860_1024188092 | 85 |
| 461 | 3300005844 | Ga0068862_100074102 | Ga0068862_1000741024 | 85 |
| 462 | 3300006028 | Ga0070717_11387854 | Ga0070717_113878542 | 85 |
| 463 | 3300006038 | Ga0075365_10103843 | Ga0075365_101038434 | 85 |
| 464 | 3300006042 | Ga0075368_10010084 | Ga0075368_100100844 | 85 |
| 465 | 3300006048 | Ga0075363_100034829 | Ga0075363_1000348293 | 85 |
| 466 | 3300006051 | Ga0075364_10150137 | Ga0075364_101501374 | 85 |
| 467 | 3300006175 | Ga0070712_101566888 | Ga0070712_1015668882 | 85 |
| 468 | 3300006177 | Ga0075362_10006044 | Ga0075362_100060446 | 85 |
| 469 | 3300006177 | Ga0075362_10133282 | Ga0075362_101332822 | 85 |
| 470 | 3300006178 | Ga0075367_10061280 | Ga0075367_100612803 | 85 |
| 471 | 3300006186 | Ga0075369_10057250 | Ga0075369_100572502 | 85 |
| 472 | 3300006195 | Ga0075366_10039707 | Ga0075366_100397074 | 85 |
| 473 | 3300006237 | Ga0097621_100713566 | Ga0097621_1007135662 | 85 |
| 474 | 3300006353 | Ga0075370_10043340 | Ga0075370_100433404 | 85 |
| 475 | 3300006358 | Ga0068871_100004840 | Ga0068871_10000484012 | 85 |
| 476 | 3300006844 | Ga0075428_100118548 | Ga0075428_1001185484 | 85 |
| 477 | 3300006844 | Ga0075428_100164836 | Ga0075428_1001648364 | 85 |
| 478 | 3300006844 | Ga0075428_100261508 | Ga0075428_1002615083 | 85 |
| 479 | 3300006844 | Ga0075428_101855871 | Ga0075428_1018558712 | 85 |
| 480 | 3300006846 | Ga0075430_100041067 | Ga0075430_1000410676 | 85 |
| 481 | 3300006846 | Ga0075430_100659057 | Ga0075430_1006590572 | 85 |
| 482 | 3300006846 | Ga0075430_100705892 | Ga0075430_1007058922 | 85 |
| 483 | 3300006847 | Ga0075431_100735627 | Ga0075431_1007356272 | 85 |
| 484 | 3300006847 | Ga0075431_100943170 | Ga0075431_1009431702 | 85 |
| 485 | 3300006847 | Ga0075431_101658512 | Ga0075431_1016585121 | 85 |
| 486 | 3300006871 | Ga0075434_100000002 | Ga0075434_10000000298 | 85 |
| 487 | 3300006880 | Ga0075429_100121187 | Ga0075429_1001211873 | 85 |
| 488 | 3300006880 | Ga0075429_100159017 | Ga0075429_1001590173 | 85 |
| 489 | 3300006880 | Ga0075429_101514493 | Ga0075429_1015144932 | 85 |
| 490 | 3300006881 | Ga0068865_100034667 | Ga0068865_1000346674 | 85 |
| 491 | 3300006914 | Ga0075436_100002239 | Ga0075436_10000223910 | 85 |
| 492 | 3300006914 | Ga0075436_100013879 | Ga0075436_1000138792 | 85 |
| 493 | 3300006914 | Ga0075436_100103101 | Ga0075436_1001031013 | 85 |
| 494 | 3300006931 | Ga0097620_100596576 | Ga0097620_1005965762 | 85 |
| 495 | 3300007076 | Ga0075435_100006511 | Ga0075435_10000651111 | 85 |
| 496 | 3300007076 | Ga0075435_101641423 | Ga0075435_1016414232 | 85 |
| 497 | 3300009092 | Ga0105250_10051134 | Ga0105250_100511342 | 85 |
| 498 | 3300009094 | Ga0111539_10017672 | Ga0111539_100176725 | 85 |
| 499 | 3300009094 | Ga0111539_10059932 | Ga0111539_100599323 | 85 |
| 500 | 3300009094 | Ga0111539_10077714 | Ga0111539_100777146 | 85 |
| 501 | 3300009094 | Ga0111539_10110814 | Ga0111539_101108143 | 85 |
| 502 | 3300009098 | Ga0105245_10000221 | Ga0105245_1000022126 | 85 |
| 503 | 3300009098 | Ga0105245_11371883 | Ga0105245_113718831 | 85 |
| 504 | 3300009147 | Ga0114129_10003624 | Ga0114129_100036244 | 85 |
| 505 | 3300009147 | Ga0114129_10097900 | Ga0114129_100979005 | 85 |
| 506 | 3300009147 | Ga0114129_10587238 | Ga0114129_105872383 | 85 |
| 507 | 3300009147 | Ga0114129_10832561 | Ga0114129_108325612 | 85 |
| 508 | 3300009147 | Ga0114129_11768688 | Ga0114129_117686882 | 85 |
| 509 | 3300009147 | Ga0114129_13070298 | Ga0114129_130702981 | 85 |
| 510 | 3300009148 | Ga0105243_10000288 | Ga0105243_1000028826 | 85 |
| 511 | 3300009148 | Ga0105243_10006310 | Ga0105243_100063106 | 85 |
| 512 | 3300009148 | Ga0105243_11016653 | Ga0105243_110166531 | 85 |
| 513 | 3300009174 | Ga0105241_10008452 | Ga0105241_100084527 | 85 |
| 514 | 3300009176 | Ga0105242_10007197 | Ga0105242_100071979 | 85 |
| 515 | 3300009177 | Ga0105248_10076185 | Ga0105248_100761855 | 85 |
| 516 | 3300009177 | Ga0105248_10207763 | Ga0105248_102077634 | 85 |
| 517 | 3300009545 | Ga0105237_10227743 | Ga0105237_102277434 | 85 |
| 518 | 3300009551 | Ga0105238_11111166 | Ga0105238_111111662 | 85 |
| 519 | 3300009553 | Ga0105249_10005927 | Ga0105249_100059279 | 85 |
| 520 | 3300009553 | Ga0105249_10022286 | Ga0105249_100222863 | 85 |
| 521 | 3300010375 | Ga0105239_10012819 | Ga0105239_100128194 | 85 |
| 522 | 3300010375 | Ga0105239_10594092 | Ga0105239_105940922 | 85 |
| 523 | 3300010375 | Ga0105239_12591736 | Ga0105239_125917362 | 85 |
| 524 | 3300011119 | Ga0105246_10207704 | Ga0105246_102077043 | 85 |
| 525 | 3300013100 | Ga0157373_10696520 | Ga0157373_106965202 | 85 |
| 526 | 3300013102 | Ga0157371_10419793 | Ga0157371_104197932 | 85 |
| 527 | 3300013296 | Ga0157374_11960119 | Ga0157374_119601192 | 85 |
| 528 | 3300013297 | Ga0157378_10003188 | Ga0157378_1000318811 | 85 |
| 529 | 3300013297 | Ga0157378_12000765 | Ga0157378_120007652 | 85 |
| 530 | 3300013306 | Ga0163162_10056188 | Ga0163162_100561883 | 85 |
| 531 | 3300013307 | Ga0157372_12509286 | Ga0157372_125092862 | 85 |
| 532 | 3300013308 | Ga0157375_10468627 | Ga0157375_104686272 | 85 |
| 533 | 3300013308 | Ga0157375_11348671 | Ga0157375_113486711 | 85 |
| 534 | 3300014326 | Ga0157380_10009333 | Ga0157380_100093339 | 85 |
| 535 | 3300014326 | Ga0157380_10098992 | Ga0157380_100989923 | 85 |
| 536 | 3300014326 | Ga0157380_11504193 | Ga0157380_115041932 | 85 |
| 537 | 3300014745 | Ga0157377_10013623 | Ga0157377_100136236 | 85 |
| 538 | 3300014745 | Ga0157377_10264271 | Ga0157377_102642713 | 85 |
| 539 | 3300014745 | Ga0157377_10750923 | Ga0157377_107509232 | 85 |
| 540 | 3300014968 | Ga0157379_10106150 | Ga0157379_101061504 | 85 |
| 541 | 3300014968 | Ga0157379_11828707 | Ga0157379_118287072 | 85 |
| 542 | 3300014969 | Ga0157376_10001746 | Ga0157376_100017462 | 85 |
| 543 | 3300014969 | Ga0157376_10286919 | Ga0157376_102869193 | 85 |
| 544 | 3300021377 | Ga0213874_10005372 | Ga0213874_100053724 | 85 |
| 545 | 3300021377 | Ga0213874_10013425 | Ga0213874_100134253 | 85 |
| 546 | 3300021377 | Ga0213874_10299369 | Ga0213874_102993692 | 85 |
| 547 | 3300021384 | Ga0213876_10001256 | Ga0213876_100012565 | 85 |
| 548 | 3300021384 | Ga0213876_10036599 | Ga0213876_100365993 | 85 |
| 549 | 3300025315 | Ga0207697_10144651 | Ga0207697_101446512 | 85 |
| 550 | 3300025893 | Ga0207682_10418066 | Ga0207682_104180662 | 85 |
| 551 | 3300025898 | Ga0207692_10506127 | Ga0207692_105061272 | 85 |
| 552 | 3300025899 | Ga0207642_10003522 | Ga0207642_100035225 | 85 |
| 553 | 3300025907 | Ga0207645_10118144 | Ga0207645_101181443 | 85 |
| 554 | 3300025908 | Ga0207643_10244328 | Ga0207643_102443282 | 85 |
| 555 | 3300025910 | Ga0207684_10220114 | Ga0207684_102201143 | 85 |
| 556 | 3300025910 | Ga0207684_10567981 | Ga0207684_105679811 | 85 |
| 557 | 3300025910 | Ga0207684_10770131 | Ga0207684_107701312 | 85 |
| 558 | 3300025912 | Ga0207707_10000011 | Ga0207707_10000011279 | 85 |
| 559 | 3300025915 | Ga0207693_10329762 | Ga0207693_103297623 | 85 |
| 560 | 3300025916 | Ga0207663_10397729 | Ga0207663_103977292 | 85 |
| 561 | 3300025917 | Ga0207660_10000737 | Ga0207660_1000073728 | 85 |
| 562 | 3300025917 | Ga0207660_10030384 | Ga0207660_100303843 | 85 |
| 563 | 3300025917 | Ga0207660_11449484 | Ga0207660_114494842 | 85 |
| 564 | 3300025918 | Ga0207662_10019308 | Ga0207662_100193083 | 85 |
| 565 | 3300025918 | Ga0207662_10068058 | Ga0207662_100680583 | 85 |
| 566 | 3300025921 | Ga0207652_10000089 | Ga0207652_1000008931 | 85 |
| 567 | 3300025922 | Ga0207646_10457410 | Ga0207646_104574103 | 85 |
| 568 | 3300025923 | Ga0207681_10053432 | Ga0207681_100534323 | 85 |
| 569 | 3300025926 | Ga0207659_10124321 | Ga0207659_101243213 | 85 |
| 570 | 3300025933 | Ga0207706_10999899 | Ga0207706_109998992 | 85 |
| 571 | 3300025935 | Ga0207709_10001207 | Ga0207709_100012075 | 85 |
| 572 | 3300025937 | Ga0207669_10165317 | Ga0207669_101653172 | 85 |
| 573 | 3300025938 | Ga0207704_10024843 | Ga0207704_100248434 | 85 |
| 574 | 3300025938 | Ga0207704_10165512 | Ga0207704_101655123 | 85 |
| 575 | 3300025939 | Ga0207665_10263842 | Ga0207665_102638422 | 85 |
| 576 | 3300025939 | Ga0207665_11342615 | Ga0207665_113426151 | 85 |
| 577 | 3300025940 | Ga0207691_10174066 | Ga0207691_101740664 | 85 |
| 578 | 3300025941 | Ga0207711_10073423 | Ga0207711_100734233 | 85 |
| 579 | 3300025944 | Ga0207661_10052438 | Ga0207661_100524384 | 85 |
| 580 | 3300025949 | Ga0207667_10005674 | Ga0207667_100056748 | 85 |
| 581 | 3300025960 | Ga0207651_10474454 | Ga0207651_104744543 | 85 |
| 582 | 3300025960 | Ga0207651_10790595 | Ga0207651_107905952 | 85 |
| 583 | 3300026023 | Ga0207677_10747720 | Ga0207677_107477202 | 85 |
| 584 | 3300026035 | Ga0207703_10331808 | Ga0207703_103318081 | 85 |
| 585 | 3300026075 | Ga0207708_10001100 | Ga0207708_1000110010 | 85 |
| 586 | 3300026075 | Ga0207708_10257433 | Ga0207708_102574332 | 85 |
| 587 | 3300026075 | Ga0207708_10486535 | Ga0207708_104865353 | 85 |
| 588 | 3300026088 | Ga0207641_10085726 | Ga0207641_100857264 | 85 |
| 589 | 3300026088 | Ga0207641_11211641 | Ga0207641_112116412 | 85 |
| 590 | 3300026089 | Ga0207648_10000362 | Ga0207648_1000036210 | 85 |
| 591 | 3300026089 | Ga0207648_11464088 | Ga0207648_114640882 | 85 |
| 592 | 3300026095 | Ga0207676_12368148 | Ga0207676_123681482 | 85 |
| 593 | 3300026116 | Ga0207674_10399198 | Ga0207674_103991982 | 85 |
| 594 | 3300026118 | Ga0207675_100005714 | Ga0207675_10000571410 | 85 |
| 595 | 3300026118 | Ga0207675_100122055 | Ga0207675_1001220553 | 85 |
| 596 | 3300026118 | Ga0207675_101338940 | Ga0207675_1013389402 | 85 |
| 597 | 3300027364 | Ga0209967_1003252 | Ga0209967_10032523 | 85 |
| 598 | 3300027364 | Ga0209967_1014672 | Ga0209967_10146722 | 85 |
| 599 | 3300027395 | Ga0209996_1005223 | Ga0209996_10052233 | 85 |
| 600 | 3300027462 | Ga0210000_1001500 | Ga0210000_10015002 | 85 |
| 601 | 3300027462 | Ga0210000_1009972 | Ga0210000_10099722 | 85 |
| 602 | 3300027526 | Ga0209968_1008614 | Ga0209968_10086142 | 85 |
| 603 | 3300027543 | Ga0209999_1001417 | Ga0209999_10014174 | 85 |
| 604 | 3300027695 | Ga0209966_1171794 | Ga0209966_11717942 | 85 |
| 605 | 3300027866 | Ga0209813_10002903 | Ga0209813_100029035 | 85 |
| 606 | 3300027876 | Ga0209974_10208343 | Ga0209974_102083431 | 85 |
| 607 | 3300027907 | Ga0207428_10178931 | Ga0207428_101789313 | 85 |
| 608 | 3300027907 | Ga0207428_10187015 | Ga0207428_101870152 | 85 |
| 609 | 3300027907 | Ga0207428_10244406 | Ga0207428_102444063 | 85 |
| 610 | 3300027907 | Ga0207428_10305724 | Ga0207428_103057242 | 85 |
| 611 | 3300028380 | Ga0268265_10067183 | Ga0268265_100671833 | 85 |
| 612 | 3300028380 | Ga0268265_10130052 | Ga0268265_101300523 | 85 |
| 613 | 3300028380 | Ga0268265_10447727 | Ga0268265_104477272 | 85 |
| 614 | 3300028380 | Ga0268265_10845328 | Ga0268265_108453282 | 85 |
| 615 | 3300028381 | Ga0268264_11316250 | Ga0268264_113162502 | 85 |
| 616 | 3300028794 | Ga0307515_10453965 | Ga0307515_104539652 | 85 |
| 617 | 3300031251 | Ga0265327_10000451 | Ga0265327_1000045121 | 85 |
| 618 | 3300031251 | Ga0265327_10002955 | Ga0265327_1000295513 | 85 |
| 619 | 3300031251 | Ga0265327_10119036 | Ga0265327_101190362 | 85 |
| 620 | 3300031344 | Ga0265316_10000490 | Ga0265316_100004908 | 85 |
| 621 | 3300031548 | Ga0307408_100107514 | Ga0307408_1001075142 | 85 |
| 622 | 3300031548 | Ga0307408_101269024 | Ga0307408_1012690242 | 85 |
| 623 | 3300031727 | Ga0316576_10016154 | Ga0316576_100161546 | 85 |
| 624 | 3300031728 | Ga0316578_10048061 | Ga0316578_100480613 | 85 |
| 625 | 3300031731 | Ga0307405_10411127 | Ga0307405_104111272 | 85 |
| 626 | 3300031733 | Ga0316577_10021920 | Ga0316577_100219203 | 85 |
| 627 | 3300031852 | Ga0307410_10525666 | Ga0307410_105256663 | 85 |
| 628 | 3300031852 | Ga0307410_12005519 | Ga0307410_120055192 | 85 |
| 629 | 3300031901 | Ga0307406_10525460 | Ga0307406_105254602 | 85 |
| 630 | 3300031903 | Ga0307407_10214433 | Ga0307407_102144334 | 85 |
| 631 | 3300031903 | Ga0307407_10406707 | Ga0307407_104067073 | 85 |
| 632 | 3300031903 | Ga0307407_11046527 | Ga0307407_110465272 | 85 |
| 633 | 3300031911 | Ga0307412_11189004 | Ga0307412_111890042 | 85 |
| 634 | 3300032002 | Ga0307416_100033663 | Ga0307416_1000336633 | 85 |
| 635 | 3300032002 | Ga0307416_100096838 | Ga0307416_1000968383 | 85 |
| 636 | 3300032002 | Ga0307416_100291683 | Ga0307416_1002916833 | 85 |
| 637 | 3300032002 | Ga0307416_100320812 | Ga0307416_1003208123 | 85 |
| 638 | 3300032002 | Ga0307416_102647614 | Ga0307416_1026476142 | 85 |
| 639 | 3300032002 | Ga0307416_103120224 | Ga0307416_1031202242 | 85 |
| 640 | 3300032005 | Ga0307411_10034549 | Ga0307411_100345491 | 85 |
| 641 | 3300032005 | Ga0307411_10056564 | Ga0307411_100565642 | 85 |
| 642 | 3300032005 | Ga0307411_10122118 | Ga0307411_101221184 | 85 |
| 643 | 3300032005 | Ga0307411_10643556 | Ga0307411_106435562 | 85 |
| 644 | 3300032126 | Ga0307415_100312981 | Ga0307415_1003129813 | 85 |
| 645 | 3300032126 | Ga0307415_100892409 | Ga0307415_1008924093 | 85 |
| 646 | 3300034816 | Ga0373930_0032470 | Ga0373930_0032470_481_738 | 85 |
| 647 | 3300034816 | Ga0373930_0043553 | Ga0373930_0043553_537_794 | 85 |
| 648 | 3300034817 | Ga0373948_0023578 | Ga0373948_0023578_766_1023 | 85 |
| 649 | 3300034818 | Ga0373950_0048983 | Ga0373950_0048983_387_644 | 85 |
| 650 | 3300034820 | Ga0373959_0026709 | Ga0373959_0026709_264_521 | 85 |
| 651 | 3300035083 | Ga0373926_0000464 | Ga0373926_0000464_3515_3772 | 85 |
| 652 | 3300035084 | Ga0373928_0006357 | Ga0373928_0006357_613_870 | 85 |
| 653 | 3300035084 | Ga0373928_0109765 | Ga0373928_0109765_441_698 | 85 |
| 654 | 3300035085 | Ga0373929_0066936 | Ga0373929_0066936_156_419 | 85 |
| 655 | 3300035088 | Ga0373940_0000708 | Ga0373940_0000708_3003_3260 | 85 |
| 656 | 3300035088 | Ga0373940_0039661 | Ga0373940_0039661_964_1221 | 85 |
| 657 | 3300035089 | Ga0373944_0020582 | Ga0373944_0020582_1374_1631 | 85 |
| 658 | 3300035090 | Ga0373949_0030698 | Ga0373949_0030698_557_814 | 85 |
| 659 | 3300035091 | Ga0373951_0005230 | Ga0373951_0005230_2344_2601 | 85 |
| 660 | 3300035091 | Ga0373951_0154554 | Ga0373951_0154554_99_356 | 85 |
| 661 | 3300035092 | Ga0373952_0058187 | Ga0373952_0058187_36_293 | 85 |
| 662 | 3300035111 | Ga0373923_0050934 | Ga0373923_0050934_1263_1520 | 85 |
| 663 | 3300035112 | Ga0373932_0018277 | Ga0373932_0018277_200_457 | 85 |
| 664 | 3300035112 | Ga0373932_0063356 | Ga0373932_0063356_537_794 | 85 |
| 665 | 3300035113 | Ga0373936_0002795 | Ga0373936_0002795_1297_1554 | 85 |
| 666 | 3300035113 | Ga0373936_0034261 | Ga0373936_0034261_127_384 | 85 |
| 667 | 3300035113 | Ga0373936_0358828 | Ga0373936_0358828_213_476 | 85 |
| 668 | 3300035114 | Ga0373939_0090529 | Ga0373939_0090529_495_752 | 85 |
| 669 | 3300035114 | Ga0373939_0303079 | Ga0373939_0303079_41_298 | 85 |
| 670 | 3300035115 | Ga0373941_0151384 | Ga0373941_0151384_506_763 | 85 |
| 671 | 3300035116 | Ga0373945_0001048 | Ga0373945_0001048_5466_5723 | 85 |
| 672 | 3300035116 | Ga0373945_0279154 | Ga0373945_0279154_17_274 | 85 |
| 673 | 3300035117 | Ga0373953_0201610 | Ga0373953_0201610_222_485 | 85 |
| 674 | 3300035118 | Ga0373954_0341182 | Ga0373954_0341182_136_396 | 85 |
| 675 | 3300035121 | Ga0373960_0004813 | Ga0373960_0004813_1768_2031 | 85 |
| 676 | 3300035121 | Ga0373960_0018656 | Ga0373960_0018656_835_1092 | 85 |
| 677 | 3300035170 | Ga0373943_0010748 | Ga0373943_0010748_2272_2529 | 85 |
| 678 | 3300035170 | Ga0373943_0017103 | Ga0373943_0017103_2928_3185 | 85 |
| 679 | 3300035171 | Ga0373946_0298177 | Ga0373946_0298177_77_334 | 85 |
| 680 | 3300035172 | Ga0373955_0185381 | Ga0373955_0185381_16_273 | 85 |
| 681 | 3300035207 | Ga0373942_0004365 | Ga0373942_0004365_1495_1752 | 85 |
| 682 | 3300035241 | Ga0373961_0071384 | Ga0373961_0071384_475_732 | 85 |
| 683 | 3300035241 | Ga0373961_0129669 | Ga0373961_0129669_452_715 | 85 |
| 684 | 3300035241 | Ga0373961_0133896 | Ga0373961_0133896_520_777 | 85 |
| 685 | 3300035242 | Ga0373962_0028594 | Ga0373962_0028594_54_311 | 85 |
| 686 | 3300035242 | Ga0373962_0065057 | Ga0373962_0065057_322_579 | 85 |
| 687 | 3300035410 | Ga0373924_0094514 | Ga0373924_0094514_528_785 | 85 |
| 688 | 3300035410 | Ga0373924_0224116 | Ga0373924_0224116_496_759 | 85 |
| 689 | 3300035410 | Ga0373924_0405028 | Ga0373924_0405028_135_398 | 85 |
| 690 | 3300035691 | Ga0373931_0000307 | Ga0373931_0000307_3668_3925 | 85 |
| 691 | 3300035691 | Ga0373931_0006244 | Ga0373931_0006244_5068_5331 | 85 |
| 692 | 3300035691 | Ga0373931_0335253 | Ga0373931_0335253_45_311 | 85 |
| 693 | 3300035691 | Ga0373931_0666747 | Ga0373931_0666747_394_651 | 85 |
| 694 | 3300035692 | Ga0373935_0011866 | Ga0373935_0011866_4741_5004 | 85 |
| 695 | 3300035692 | Ga0373935_0099751 | Ga0373935_0099751_739_996 | 85 |
| 696 | 3300035695 | Ga0373927_0004060 | Ga0373927_0004060_8518_8775 | 85 |
| 697 | 3300035695 | Ga0373927_0123300 | Ga0373927_0123300_1360_1623 | 85 |
| 698 | 3300035725 | Ga0373947_0006433 | Ga0373947_0006433_3526_3783 | 85 |
| 699 | 3300035725 | Ga0373947_0009590 | Ga0373947_0009590_3043_3300 | 85 |
| 700 | 3300036401 | Ga0373937_0006625 | Ga0373937_0006625_2571_2834 | 85 |
| 701 | 3300036401 | Ga0373937_0074297 | Ga0373937_0074297_549_809 | 85 |
| 702 | 3300037068 | Ga0373925_0037020 | Ga0373925_0037020_1886_2143 | 85 |
| 703 | 3300037068 | Ga0373925_0038703 | Ga0373925_0038703_1367_1630 | 85 |
| 704 | 3300037068 | Ga0373925_0042408 | Ga0373925_0042408_1661_1918 | 85 |
| 705 | 3300037068 | Ga0373925_0651787 | Ga0373925_0651787_375_638 | 85 |
| 706 | 3300039437 | Ga0436365_0295636 | Ga0436365_0295636_319_582 | 85 |
| 707 | 3300039437 | Ga0436365_0665212 | Ga0436365_0665212_64_327 | 85 |
| 708 | 3300039437 | Ga0436365_0981941 | Ga0436365_0981941_18833_19117 | 85 |
| 709 | 3300039437 | Ga0436365_1621958 | Ga0436365_1621958_2038_2301 | 85 |
| 710 | 3300039450 | Ga0436363_0005179 | Ga0436363_0005179_1007_1291 | 85 |
| 711 | 3300039450 | Ga0436363_0954949 | Ga0436363_0954949_1691_1975 | 85 |
| 712 | 3300039450 | Ga0436363_1020652 | Ga0436363_1020652_155_421 | 85 |
| 713 | 3300039450 | Ga0436363_1155895 | Ga0436363_1155895_225_488 | 85 |
| 714 | 3300039453 | Ga0436362_0323154 | Ga0436362_0323154_712_996 | 85 |
| 715 | 3300041408 | Ga0439453_0033402 | Ga0439453_0033402_348_608 | 85 |
| 716 | 3300041486 | Ga0451807_1790131 | Ga0451807_1790131_485_748 | 85 |
| 717 | 3300041496 | Ga0451839_0103274 | Ga0451839_0103274_218_481 | 85 |
| 718 | 3300041505 | Ga0451849_1374968 | Ga0451849_1374968_386_646 | 85 |
| 719 | 3300042003 | Ga0439443_017168 | Ga0439443_017168_740_1000 | 85 |
| 720 | 3300042015 | Ga0439462_0139409 | Ga0439462_0139409_378_647 | 85 |
| 721 | 3300042147 | Ga0450910_106578 | Ga0450910_106578_228_488 | 85 |
| 722 | 3300042156 | Ga0439446_0084409 | Ga0439446_0084409_561_821 | 85 |
| 723 | 3300042436 | Ga0439435_0004325 | Ga0439435_0004325_374_634 | 85 |
| 724 | 3300042437 | Ga0439444_0005867 | Ga0439444_0005867_806_1066 | 85 |
| 725 | 3300042461 | Ga0439460_0017553 | Ga0439460_0017553_1555_1815 | 85 |
| 726 | 3300042876 | Ga0451577_0043111 | Ga0451577_0043111_1591_1848 | 85 |
| 727 | 3300044706 | Ga0466964_0607517 | Ga0466964_0607517_86_352 | 85 |
| 728 | 3300044712 | Ga0453684_0800201 | Ga0453684_0800201_84_341 | 85 |
| 729 | 3300044842 | Ga0466957_0497286 | Ga0466957_0497286_165_431 | 85 |
| 730 | 3300044901 | Ga0466960_0532896 | Ga0466960_0532896_330_593 | 85 |
| 731 | 3300045051 | Ga0451576_0019385 | Ga0451576_0019385_1024_1281 | 85 |
| 732 | 3300045051 | Ga0451576_0025603 | Ga0451576_0025603_4229_4486 | 85 |
| 733 | 3300045051 | Ga0451576_0121672 | Ga0451576_0121672_592_849 | 85 |
| 734 | 3300045836 | Ga0466958_0806492 | Ga0466958_0806492_175_441 | 85 |
| 735 | 3300045976 | Ga0466967_0018731 | Ga0466967_0018731_2290_2556 | 85 |
| 736 | 3300045976 | Ga0466967_0218491 | Ga0466967_0218491_318_581 | 85 |
| 737 | 3300046454 | Ga0495592_0000306 | Ga0495592_0000306_33227_33490 | 85 |
| 738 | 3300046472 | Ga0495580_0005769 | Ga0495580_0005769_1264_1521 | 85 |
| 739 | 3300046473 | Ga0495582_0015381 | Ga0495582_0015381_3728_3985 | 85 |
| 740 | 3300046491 | Ga0495584_0392948 | Ga0495584_0392948_243_506 | 85 |
| 741 | 3300046517 | Ga0495630_0131061 | Ga0495630_0131061_948_1205 | 85 |
| 742 | 3300046526 | Ga0495666_0031317 | Ga0495666_0031317_739_996 | 85 |
| 743 | 3300046526 | Ga0495666_0149015 | Ga0495666_0149015_783_1046 | 85 |
| 744 | 3300046528 | Ga0495642_0036413 | Ga0495642_0036413_898_1161 | 85 |
| 745 | 3300046529 | Ga0495652_1136903 | Ga0495652_1136903_90_350 | 85 |
| 746 | 3300046533 | Ga0495640_0280960 | Ga0495640_0280960_591_851 | 85 |
| 747 | 3300046535 | Ga0495586_0001224 | Ga0495586_0001224_7139_7396 | 85 |
| 748 | 3300046536 | Ga0495587_0120979 | Ga0495587_0120979_382_645 | 85 |
| 749 | 3300046559 | Ga0495667_0528568 | Ga0495667_0528568_429_689 | 85 |
| 750 | 3300046615 | Ga0495656_0024863 | Ga0495656_0024863_459_716 | 85 |
| 751 | 3300046663 | Ga0495635_0028372 | Ga0495635_0028372_2662_2925 | 85 |
| 752 | 3300046674 | Ga0495588_0057101 | Ga0495588_0057101_15_272 | 85 |
| 753 | 3300046675 | Ga0495657_0249489 | Ga0495657_0249489_447_710 | 85 |
| 754 | 3300046681 | Ga0495647_0000374 | Ga0495647_0000374_4264_4521 | 85 |
| 755 | 3300046683 | Ga0495658_0002491 | Ga0495658_0002491_2315_2572 | 85 |
| 756 | 3300047315 | Ga0495581_0103252 | Ga0495581_0103252_1201_1458 | 85 |
| 757 | 3300047317 | Ga0495604_0001668 | Ga0495604_0001668_6579_6842 | 85 |
| 758 | 3300047318 | Ga0495636_0008982 | Ga0495636_0008982_2565_2828 | 85 |
| 759 | 3300047321 | Ga0495676_0060550 | Ga0495676_0060550_802_1059 | 85 |
| 760 | 3300047322 | Ga0495680_0003157 | Ga0495680_0003157_5489_5752 | 85 |
| 761 | 3300047673 | Ga0495593_0246809 | Ga0495593_0246809_520_783 | 85 |
| 762 | 3300048909 | Ga0496106_0340692 | Ga0496106_0340692_246_503 | 85 |
| 763 | 3300048911 | Ga0496108_1442762 | Ga0496108_1442762_138_395 | 85 |
| 764 | 3300049519 | Ga0501296_003303 | Ga0501296_003303_423_686 | 85 |
| 765 | 3300049519 | Ga0501296_021179 | Ga0501296_021179_527_787 | 85 |
| 766 | 3300049568 | Ga0501031_0106389 | Ga0501031_0106389_993_1253 | 85 |
| 767 | 3300049569 | Ga0501032_0935075 | Ga0501032_0935075_224_484 | 85 |
| 768 | 3300049570 | Ga0501033_0005748 | Ga0501033_0005748_7910_8170 | 85 |
| 769 | 3300049572 | Ga0501036_0000974 | Ga0501036_0000974_1298_1558 | 85 |
| 770 | 3300049572 | Ga0501036_0182819 | Ga0501036_0182819_156_413 | 85 |
| 771 | 3300049573 | Ga0501037_0077406 | Ga0501037_0077406_1211_1471 | 85 |
| 772 | 3300049574 | Ga0501038_0000189 | Ga0501038_0000189_45296_45556 | 85 |
| 773 | 3300049575 | Ga0501039_0000247 | Ga0501039_0000247_31645_31905 | 85 |
| 774 | 3300049575 | Ga0501039_0186776 | Ga0501039_0186776_373_630 | 85 |
| 775 | 3300049575 | Ga0501039_1269065 | Ga0501039_1269065_66_323 | 85 |
| 776 | 3300049576 | Ga0501040_0000229 | Ga0501040_0000229_12475_12735 | 85 |
| 777 | 3300049577 | Ga0501041_0000032 | Ga0501041_0000032_18083_18343 | 85 |
| 778 | 3300049577 | Ga0501041_0926351 | Ga0501041_0926351_11_268 | 85 |
| 779 | 3300049578 | Ga0501042_0002212 | Ga0501042_0002212_6463_6723 | 85 |
| 780 | 3300049578 | Ga0501042_0998199 | Ga0501042_0998199_337_600 | 85 |
| 781 | 3300049579 | Ga0501043_0110342 | Ga0501043_0110342_1631_1891 | 85 |
| 782 | 3300049580 | Ga0501046_0000156 | Ga0501046_0000156_22408_22668 | 85 |
| 783 | 3300049581 | Ga0501047_0315703 | Ga0501047_0315703_107_367 | 85 |
| 784 | 3300049582 | Ga0501048_0002226 | Ga0501048_0002226_6434_6694 | 85 |
| 785 | 3300049582 | Ga0501048_0123418 | Ga0501048_0123418_814_1083 | 85 |
| 786 | 3300049582 | Ga0501048_0903584 | Ga0501048_0903584_110_370 | 85 |
| 787 | 3300049584 | Ga0501068_0015765 | Ga0501068_0015765_2749_3009 | 85 |
| 788 | 3300049586 | Ga0501070_0035376 | Ga0501070_0035376_2735_2995 | 85 |
| 789 | 3300049587 | Ga0501071_0002557 | Ga0501071_0002557_760_1020 | 85 |
| 790 | 3300049587 | Ga0501071_1113973 | Ga0501071_1113973_86_349 | 85 |
| 791 | 3300049588 | Ga0501072_0001593 | Ga0501072_0001593_12686_12946 | 85 |
| 792 | 3300049588 | Ga0501072_0721374 | Ga0501072_0721374_283_540 | 85 |
| 793 | 3300049588 | Ga0501072_0766609 | Ga0501072_0766609_402_665 | 85 |
| 794 | 3300049590 | Ga0501074_0045233 | Ga0501074_0045233_2032_2292 | 85 |
| 795 | 3300049590 | Ga0501074_0249181 | Ga0501074_0249181_255_518 | 85 |
| 796 | 3300049590 | Ga0501074_0367302 | Ga0501074_0367302_619_885 | 85 |
| 797 | 3300049591 | Ga0501075_0000053 | Ga0501075_0000053_47719_47979 | 85 |
| 798 | 3300049591 | Ga0501075_0738232 | Ga0501075_0738232_222_485 | 85 |
| 799 | 3300049592 | Ga0501076_0001036 | Ga0501076_0001036_12247_12507 | 85 |
| 800 | 3300049593 | Ga0501077_0000086 | Ga0501077_0000086_11198_11458 | 85 |
| 801 | 3300049668 | Ga0501233_189627 | Ga0501233_189627_178_441 | 85 |
| 802 | 3300049670 | Ga0501236_050158 | Ga0501236_050158_273_545 | 85 |
| 803 | 3300049679 | Ga0501249_111244 | Ga0501249_111244_112_369 | 85 |
| 804 | 3300049704 | Ga0501221_026409 | Ga0501221_026409_135_407 | 85 |
| 805 | 3300049705 | Ga0501225_0161326 | Ga0501225_0161326_216_488 | 85 |
| 806 | 3300049741 | Ga0501079_0624157 | Ga0501079_0624157_160_417 | 85 |
| 807 | 3300049742 | Ga0501080_0097910 | Ga0501080_0097910_567_827 | 85 |
| 808 | 3300049743 | Ga0501081_0000127 | Ga0501081_0000127_13156_13416 | 85 |
| 809 | 3300049822 | Ga0501035_0008469 | Ga0501035_0008469_3108_3368 | 85 |
| 810 | 3300049823 | Ga0501044_0233246 | Ga0501044_0233246_906_1166 | 85 |
| 811 | 3300049824 | Ga0501045_0000372 | Ga0501045_0000372_22237_22497 | 85 |
| 812 | 3300050489 | nmdc:mga03683_149651_c1 | nmdc:mga03683_149651_c1_525_797 | 85 |
| 813 | 3300050489 | nmdc:mga03683_58400_c1 | nmdc:mga03683_58400_c1_524_790 | 85 |
| 814 | 3300050490 | nmdc:mga03n38_3825_c1 | nmdc:mga03n38_3825_c1_525_791 | 85 |
| 815 | 3300050491 | nmdc:mga00v17_104175_c1 | nmdc:mga00v17_104175_c1_133_399 | 85 |
| 816 | 3300050492 | nmdc:mga0yw44_142269_c1 | nmdc:mga0yw44_142269_c1_28_294 | 85 |
| 817 | 3300050493 | nmdc:mga0k408_49291_c1 | nmdc:mga0k408_49291_c1_2040_2306 | 85 |
| 818 | 3300050494 | nmdc:mga06z11_498652_c1 | nmdc:mga06z11_498652_c1_340_606 | 85 |
| 819 | 3300050495 | nmdc:mga04h51_2135_c1 | nmdc:mga04h51_2135_c1_2872_3138 | 85 |
| 820 | 3300050496 | nmdc:mga07m45_1893_c1 | nmdc:mga07m45_1893_c1_8863_9129 | 85 |
| 821 | 3300050496 | nmdc:mga07m45_64752_c1 | nmdc:mga07m45_64752_c1_269_535 | 85 |
| 822 | 3300050507 | nmdc:mga05p37_1445139_c1 | nmdc:mga05p37_1445139_c1_249_506 | 85 |
| 823 | 3300050507 | nmdc:mga05p37_1475_c1 | nmdc:mga05p37_1475_c1_19325_19582 | 85 |
| 824 | 3300050507 | nmdc:mga05p37_208988_c1 | nmdc:mga05p37_208988_c1_130_393 | 85 |
| 825 | 3300050507 | nmdc:mga05p37_71309_c1 | nmdc:mga05p37_71309_c1_3278_3538 | 85 |
| 826 | 3300050507 | nmdc:mga05p37_769363_c1 | nmdc:mga05p37_769363_c1_367_636 | 85 |
| 827 | 3300050508 | nmdc:mga09592_1566_c1 | nmdc:mga09592_1566_c1_7948_8205 | 85 |
| 828 | 3300050508 | nmdc:mga09592_257724_c1 | nmdc:mga09592_257724_c1_995_1255 | 85 |
| 829 | 3300050508 | nmdc:mga09592_646716_c1 | nmdc:mga09592_646716_c1_109_372 | 85 |
| 830 | 3300050508 | nmdc:mga09592_6982_c1 | nmdc:mga09592_6982_c1_3467_3727 | 85 |
| 831 | 3300050509 | nmdc:mga0qj67_1051459_c1 | nmdc:mga0qj67_1051459_c1_220_492 | 85 |
| 832 | 3300050509 | nmdc:mga0qj67_1451309_c1 | nmdc:mga0qj67_1451309_c1_138_407 | 85 |
| 833 | 3300050509 | nmdc:mga0qj67_196433_c1 | nmdc:mga0qj67_196433_c1_295_555 | 85 |
| 834 | 3300050509 | nmdc:mga0qj67_308145_c1 | nmdc:mga0qj67_308145_c1_720_977 | 85 |
| 835 | 3300050509 | nmdc:mga0qj67_408299_c1 | nmdc:mga0qj67_408299_c1_155_424 | 85 |
| 836 | 3300050510 | nmdc:mga06r32_1127658_c1 | nmdc:mga06r32_1127658_c1_178_447 | 85 |
| 837 | 3300050510 | nmdc:mga06r32_1166086_c1 | nmdc:mga06r32_1166086_c1_224_481 | 85 |
| 838 | 3300050510 | nmdc:mga06r32_59746_c1 | nmdc:mga06r32_59746_c1_1108_1368 | 85 |
| 839 | 3300050511 | nmdc:mga08y16_119157_c1 | nmdc:mga08y16_119157_c1_1711_1980 | 85 |
| 840 | 3300050511 | nmdc:mga08y16_14684_c1 | nmdc:mga08y16_14684_c1_7587_7844 | 85 |
| 841 | 3300050511 | nmdc:mga08y16_394757_c1 | nmdc:mga08y16_394757_c1_479_754 | 85 |
| 842 | 3300050511 | nmdc:mga08y16_43170_c1 | nmdc:mga08y16_43170_c1_3624_3893 | 85 |
| 843 | 3300050511 | nmdc:mga08y16_9319_c1 | nmdc:mga08y16_9319_c1_7771_8028 | 85 |
| 844 | 3300050512 | nmdc:mga0n895_1315640_c1 | nmdc:mga0n895_1315640_c1_264_521 | 85 |
| 845 | 3300050512 | nmdc:mga0n895_3063_c1 | nmdc:mga0n895_3063_c1_5663_5926 | 85 |
| 846 | 3300050512 | nmdc:mga0n895_4921_c1 | nmdc:mga0n895_4921_c1_2914_3171 | 85 |
| 847 | 3300050512 | nmdc:mga0n895_529_c1 | nmdc:mga0n895_529_c1_2182_2445 | 85 |
| 848 | 3300050513 | nmdc:mga0rr50_1174228_c1 | nmdc:mga0rr50_1174228_c1_135_398 | 85 |
| 849 | 3300050513 | nmdc:mga0rr50_128_c1 | nmdc:mga0rr50_128_c1_10064_10321 | 85 |
| 850 | 3300050513 | nmdc:mga0rr50_205455_c1 | nmdc:mga0rr50_205455_c1_591_854 | 85 |
| 851 | 3300050513 | nmdc:mga0rr50_4412_c1 | nmdc:mga0rr50_4412_c1_7627_7890 | 85 |
| 852 | 3300050514 | nmdc:mga08x19_109576_c1 | nmdc:mga08x19_109576_c1_435_698 | 85 |
| 853 | 3300050514 | nmdc:mga08x19_15014_c1 | nmdc:mga08x19_15014_c1_3989_4252 | 85 |
| 854 | 3300050514 | nmdc:mga08x19_15549_c1 | nmdc:mga08x19_15549_c1_1039_1302 | 85 |
| 855 | 3300050514 | nmdc:mga08x19_27559_c1 | nmdc:mga08x19_27559_c1_2349_2609 | 85 |
| 856 | 3300050514 | nmdc:mga08x19_42965_c1 | nmdc:mga08x19_42965_c1_1640_1903 | 85 |
| 857 | 3300050514 | nmdc:mga08x19_434_c1 | nmdc:mga08x19_434_c1_4359_4616 | 85 |
| 858 | 3300050514 | nmdc:mga08x19_484770_c1 | nmdc:mga08x19_484770_c1_263_520 | 85 |
| 859 | 3300050515 | nmdc:mga0a205_160_c1 | nmdc:mga0a205_160_c1_18800_19057 | 85 |
| 860 | 3300050515 | nmdc:mga0a205_289330_c1 | nmdc:mga0a205_289330_c1_1141_1398 | 85 |
| 861 | 3300050516 | nmdc:mga0sz30_111980_c1 | nmdc:mga0sz30_111980_c1_511_777 | 85 |
| 862 | 3300053085 | Ga0495619_0024756 | Ga0495619_0024756_2740_3003 | 85 |
| 863 | 3300054114 | Ga0501084_0003487 | Ga0501084_0003487_10824_11084 | 85 |
| 864 | 3300054114 | Ga0501084_0330355 | Ga0501084_0330355_228_491 | 85 |
| 865 | 3300059426 | Ga0590077_099849 | Ga0590077_099849_214_471 | 85 |
| 866 | 3300059426 | Ga0590077_169523 | Ga0590077_169523_28_285 | 85 |
| 867 | 3300060353 | Ga0501082_0003275 | Ga0501082_0003275_9626_9886 | 85 |
| 868 | 3300061734 | Ga0530510_0000087 | Ga0530510_0000087_3171_3431 | 85 |
| 869 | iso_pu_bacteria | 2891633521 | 2891636160 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mja-assembly1.cif.gz_A | synechocystis sp. pcc 6803 glutaredoxin a-a75i | 0.9655 | 2 | 81 |
| 3qmx-assembly1.cif.gz_A | x-ray crystal structure of synechocystis sp. pcc 6803 glutaredoxin a | 0.9651 | 2 | 81 |
| 4mjc-assembly1.cif.gz_A | synechocystis sp. pcc 6803 glutaredoxin a - p84r | 0.9648 | 2 | 81 |
| 4mje-assembly1.cif.gz_A | synechocystis sp. pcc 6803 glutaredoxin a-r27l | 0.9647 | 2 | 82 |
| 4tr0-assembly2.cif.gz_B | crystal structure of gssg-bound cgrx2 | 0.9626 | 1 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6SN61_11_124_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9568 | 4 | 83 | 3.40.30.10 |
| 4tr0B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9504 | 1 | 82 | 3.40.30.10 |
| af_Q54GP8_1_99_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9445 | 2 | 83 | 3.40.30.10 |
| af_B6TEC7_84_191_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9434 | 2 | 83 | 3.40.30.10 |
| af_A4HRD2_90_192_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9417 | 3 | 83 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A5C5V8-F1-model_v4 | Glutaredoxin | 0.9974 | 1 | 81 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
| AF-A0A1Z7WWC2-F1-model_v4 | Glutaredoxin | 0.9971 | 1 | 81 |
GO:0005737
GO:0015035 GO:0015038 GO:0045454 |
| AF-A0A1N7LM38-F1-model_v4 | Glutaredoxin | 0.997 | 1 | 82 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
| AF-A0A831RHL9-F1-model_v4 | Glutaredoxin | 0.997 | 3 | 83 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
| AF-A0A4Q5VH39-F1-model_v4 | Glutaredoxin | 0.9967 | 1 | 84 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar