F484112

General Info

Members Datasets Scaffolds Average Seq Length
869 287 1738 155

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100750911|Ga0070663_1007509112
Length 183
Sequence VRRAFLFSQGGAVFLGRRSLGEGGSPPSVMSPEIEELYQEVILDHSRRPRNFGELRDATVLVHGDNPACGDEIHLAVKFDADGGLEDIKFSGHGCAISQASASLMTMKLKGKSRTEVMEMLRAFHDLVTVDTSEATKTLGDLRAMQGVRKFPQRVKCAMLAWRAVQQAFEQGSGETTVSTEPT

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
209 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
278 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.92
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 6.56
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 26.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100750911 3300005455 Unclassified 833
2 SwRhRL3b_contig_4564459 2162886006 Bacteria 896
3 SwRhRL2b_contig_1312709 2162886007 Unclassified 943
4 JGI24035J26624_1020476 3300002126 Bacteria 697
5 JGI25406J46586_10000706 3300003203 Bacteria 15595
6 JGI25404J52841_10073533 3300003659 Bacteria 714
7 Ga0065704_10007672 3300005289 Bacteria 2302
8 Ga0065704_10116026 3300005289 Bacteria 1861
9 Ga0065704_10132930 3300005289 Bacteria 1606
10 Ga0065704_10235072 3300005289 Bacteria 1031
11 Ga0065704_10488105 3300005289 Bacteria 676
12 Ga0065712_10000944 3300005290 Bacteria 7334
13 Ga0065712_10057772 3300005290 Bacteria 674
14 Ga0065712_10084369 3300005290 Bacteria 2769
15 Ga0065712_10202782 3300005290 Bacteria 1102
16 Ga0065712_10301719 3300005290 Bacteria 859
17 Ga0065712_10452847 3300005290 Unclassified 684
18 Ga0065715_10013929 3300005293 Bacteria 3016
19 Ga0065715_10016165 3300005293 Bacteria 2685
20 Ga0065715_10095103 3300005293 Bacteria 4165
21 Ga0065715_10225061 3300005293 Bacteria 1242
22 Ga0065715_10275928 3300005293 Unclassified 1099
23 Ga0065715_10318050 3300005293 Bacteria 1007
24 Ga0065715_10380532 3300005293 Bacteria 908
25 Ga0065715_10505850 3300005293 Bacteria 776
26 Ga0065715_10561679 3300005293 Unclassified 727
27 Ga0065715_10603983 3300005293 Unclassified 706
28 Ga0065707_10036152 3300005295 Unclassified 1396
29 Ga0065707_10039486 3300005295 Bacteria 2147
30 Ga0065707_10122914 3300005295 Bacteria 2077
31 Ga0065707_10437290 3300005295 Unclassified 814
32 Ga0065707_10634173 3300005295 Bacteria 664
33 Ga0070658_10001934 3300005327 Bacteria 17405
34 Ga0070658_10369107 3300005327 Bacteria 1230
35 Ga0070676_10026606 3300005328 Bacteria 3275
36 Ga0070676_10030013 3300005328 Bacteria 3097
37 Ga0070676_10047334 3300005328 Bacteria 2511
38 Ga0070676_10154881 3300005328 Bacteria 1470
39 Ga0070676_10584166 3300005328 Bacteria 803
40 Ga0070676_11382494 3300005328 Bacteria 539
41 Ga0070683_100036382 3300005329 Unclassified 4504
42 Ga0070683_100487722 3300005329 Bacteria 1177
43 Ga0070690_100006808 3300005330 Bacteria 6502
44 Ga0070690_100077695 3300005330 Bacteria 2167
45 Ga0070690_100616141 3300005330 Unclassified 825
46 Ga0070690_100948880 3300005330 Unclassified 675
47 Ga0070670_100068191 3300005331 Bacteria 3053
48 Ga0070670_100299703 3300005331 Unclassified 1406
49 Ga0070670_100302827 3300005331 Bacteria 1398
50 Ga0070670_100624034 3300005331 Bacteria 966
51 Ga0070670_100639874 3300005331 Unclassified 953
52 Ga0070670_100888924 3300005331 Unclassified 807
53 Ga0068869_100629115 3300005334 Unclassified 909
54 Ga0068869_101155540 3300005334 Unclassified 679
55 Ga0068869_101614589 3300005334 Bacteria 578
56 Ga0070666_10021846 3300005335 Bacteria 4150
57 Ga0070666_10300160 3300005335 Bacteria 1144
58 Ga0070666_10453820 3300005335 Bacteria 926
59 Ga0070666_11232834 3300005335 Unclassified 557
60 Ga0070680_100009226 3300005336 Bacteria 7565
61 Ga0070682_101443961 3300005337 Unclassified 590
62 Ga0068868_100082603 3300005338 Bacteria 2577
63 Ga0068868_100115403 3300005338 Bacteria 2186
64 Ga0068868_100393278 3300005338 Unclassified 1195
65 Ga0068868_101339050 3300005338 Bacteria 666
66 Ga0070660_100065147 3300005339 Bacteria 2836
67 Ga0070660_100159758 3300005339 Bacteria 1816
68 Ga0070660_100369370 3300005339 Bacteria 1183
69 Ga0070689_100024985 3300005340 Bacteria 4485
70 Ga0070689_100085358 3300005340 Bacteria 2482
71 Ga0070689_100163405 3300005340 Bacteria 1801
72 Ga0070689_100294832 3300005340 Bacteria 1349
73 Ga0070687_100179209 3300005343 Unclassified 1268
74 Ga0070687_100180216 3300005343 Bacteria 1265
75 Ga0070687_100243297 3300005343 Bacteria 1114
76 Ga0070661_100006590 3300005344 Bacteria 8007
77 Ga0070661_100109333 3300005344 Bacteria 2063
78 Ga0070661_100153590 3300005344 Unclassified 1741
79 Ga0070661_100969938 3300005344 Bacteria 704
80 Ga0070692_10174286 3300005345 Bacteria 1242
81 Ga0070692_10178137 3300005345 Bacteria 1230
82 Ga0070668_100017340 3300005347 Bacteria 5393
83 Ga0070668_100025666 3300005347 Bacteria 4469
84 Ga0070668_100125767 3300005347 Bacteria 2053
85 Ga0070668_100128404 3300005347 Bacteria 2032
86 Ga0070668_100211093 3300005347 Bacteria 1597
87 Ga0070668_100263647 3300005347 Unclassified 1433
88 Ga0070668_100299733 3300005347 Bacteria 1348
89 Ga0070668_100361444 3300005347 Bacteria 1231
90 Ga0070669_100007644 3300005353 Bacteria 7727
91 Ga0070669_100049917 3300005353 Bacteria 3055
92 Ga0070669_100226438 3300005353 Bacteria 1480
93 Ga0070669_100262095 3300005353 Bacteria 1379
94 Ga0070669_100350563 3300005353 Unclassified 1198
95 Ga0070669_100414481 3300005353 Unclassified 1104
96 Ga0070669_100883765 3300005353 Bacteria 763
97 Ga0070675_100007313 3300005354 Bacteria 8521
98 Ga0070675_100021243 3300005354 Bacteria 5185
99 Ga0070675_100033280 3300005354 Bacteria 4178
100 Ga0070675_100041169 3300005354 Bacteria 3774
101 Ga0070675_100044711 3300005354 Bacteria 3622
102 Ga0070675_100058859 3300005354 Bacteria 3169
103 Ga0070675_100085730 3300005354 Bacteria 2631
104 Ga0070675_100306607 3300005354 Bacteria 1400
105 Ga0070675_100385173 3300005354 Unclassified 1249
106 Ga0070675_100631542 3300005354 Bacteria 973
107 Ga0070675_100686576 3300005354 Bacteria 932
108 Ga0070671_100015320 3300005355 Bacteria 6192
109 Ga0070671_100035808 3300005355 Bacteria 4113
110 Ga0070671_100068250 3300005355 Bacteria 2965
111 Ga0070671_100083222 3300005355 Bacteria 2675
112 Ga0070671_100323433 3300005355 Unclassified 1314
113 Ga0070671_100902545 3300005355 Unclassified 772
114 Ga0070671_100913101 3300005355 Bacteria 767
115 Ga0070674_100012002 3300005356 Bacteria 5304
116 Ga0070674_100020609 3300005356 Bacteria 4217
117 Ga0070674_100083371 3300005356 Bacteria 2289
118 Ga0070674_100461238 3300005356 Bacteria 1051
119 Ga0070674_100891034 3300005356 Unclassified 774
120 Ga0070674_101390063 3300005356 Unclassified 628
121 Ga0070673_100014841 3300005364 Bacteria 5448
122 Ga0070673_100032787 3300005364 Bacteria 3915
123 Ga0070673_100044193 3300005364 Bacteria 3449
124 Ga0070673_100103216 3300005364 Bacteria 2352
125 Ga0070673_100215752 3300005364 Bacteria 1659
126 Ga0070673_100903063 3300005364 Bacteria 819
127 Ga0070688_100005095 3300005365 Bacteria 6888
128 Ga0070688_100047456 3300005365 Bacteria 2664
129 Ga0070688_100074059 3300005365 Unclassified 2185
130 Ga0070688_100083023 3300005365 Bacteria 2078
131 Ga0070688_100140434 3300005365 Bacteria 1640
132 Ga0070688_100222189 3300005365 Unclassified 1332
133 Ga0070659_100379236 3300005366 Bacteria 1191
134 Ga0070667_100018384 3300005367 Bacteria 5797
135 Ga0070667_100105605 3300005367 Bacteria 2437
136 Ga0070667_100118487 3300005367 Bacteria 2301
137 Ga0070667_100726456 3300005367 Unclassified 920
138 Ga0070703_10059807 3300005406 Bacteria 1244
139 Ga0070703_10211224 3300005406 Unclassified 767
140 Ga0070709_10303854 3300005434 Bacteria 1166
141 Ga0070709_10463136 3300005434 Unclassified 957
142 Ga0070714_100027668 3300005435 Bacteria 4697
143 Ga0070713_100043796 3300005436 Bacteria 3661
144 Ga0070713_100733295 3300005436 Unclassified 944
145 Ga0070713_101306854 3300005436 Unclassified 703
146 Ga0070710_10007927 3300005437 Bacteria 5159
147 Ga0070710_10243478 3300005437 Bacteria 1153
148 Ga0070710_10330541 3300005437 Unclassified 1003
149 Ga0070710_10512414 3300005437 Bacteria 823
150 Ga0070710_10601714 3300005437 Bacteria 765
151 Ga0070701_10651593 3300005438 Bacteria 703
152 Ga0070711_100015272 3300005439 Bacteria 4859
153 Ga0070711_100388762 3300005439 Bacteria 1130
154 Ga0070705_100008529 3300005440 Bacteria 5078
155 Ga0070705_100291014 3300005440 Unclassified 1166
156 Ga0070705_100696757 3300005440 Unclassified 797
157 Ga0070700_100279922 3300005441 Bacteria 1209
158 Ga0070700_101436098 3300005441 Unclassified 584
159 Ga0070708_100013946 3300005445 Bacteria 6602
160 Ga0070708_100107386 3300005445 Bacteria 2562
161 Ga0070708_100192928 3300005445 Bacteria 1905
162 Ga0070708_100240387 3300005445 Viruses 1700
163 Ga0070708_100245945 3300005445 Bacteria 1680
164 Ga0070708_100260077 3300005445 Bacteria 1631
165 Ga0070708_100281788 3300005445 Bacteria 1564
166 Ga0070708_100412982 3300005445 Unclassified 1273
167 Ga0070708_100517703 3300005445 Unclassified 1125
168 Ga0070708_100650615 3300005445 Bacteria 993
169 Ga0070708_100868964 3300005445 Bacteria 847
170 Ga0070663_100968263 3300005455 Unclassified 738
171 Ga0070678_100016133 3300005456 Bacteria 4767
172 Ga0070678_100038361 3300005456 Unclassified 3372
173 Ga0070678_100079497 3300005456 Bacteria 2480
174 Ga0070662_100068828 3300005457 Bacteria 2603
175 Ga0070662_100078358 3300005457 Bacteria 2454
176 Ga0070662_100091013 3300005457 Bacteria 2291
177 Ga0070662_100315278 3300005457 Bacteria 1274
178 Ga0070681_10011402 3300005458 Bacteria 8796
179 Ga0068867_100011530 3300005459 Bacteria 6240
180 Ga0068867_100538119 3300005459 Unclassified 1010
181 Ga0068867_101145959 3300005459 Unclassified 712
182 Ga0068867_101405286 3300005459 Bacteria 647
183 Ga0070685_10070089 3300005466 Bacteria 2075
184 Ga0070685_10351668 3300005466 Unclassified 1008
185 Ga0070685_10987316 3300005466 Bacteria 631
186 Ga0070706_100000159 3300005467 Bacteria 86016
187 Ga0070706_100008982 3300005467 Bacteria 9304
188 Ga0070706_100015734 3300005467 Bacteria 6988
189 Ga0070706_100015787 3300005467 Bacteria 6972
190 Ga0070706_100092708 3300005467 Bacteria 2802
191 Ga0070706_100202351 3300005467 Bacteria 1855
192 Ga0070706_100233776 3300005467 Unclassified 1716
193 Ga0070706_100470358 3300005467 Bacteria 1169
194 Ga0070706_100520422 3300005467 Bacteria 1107
195 Ga0070706_100524376 3300005467 Bacteria 1102
196 Ga0070706_100686804 3300005467 Unclassified 950
197 Ga0070706_100793206 3300005467 Unclassified 877
198 Ga0070706_100889576 3300005467 Bacteria 823
199 Ga0070706_101144256 3300005467 Unclassified 716
200 Ga0070706_101272270 3300005467 Unclassified 675
201 Ga0070707_100014143 3300005468 Bacteria 7479
202 Ga0070707_100020719 3300005468 Bacteria 6206
203 Ga0070707_100023257 3300005468 Bacteria 5862
204 Ga0070707_100027470 3300005468 Bacteria 5414
205 Ga0070707_100037179 3300005468 Bacteria 4646
206 Ga0070707_100088366 3300005468 Bacteria 2998
207 Ga0070707_100249339 3300005468 Bacteria 1728
208 Ga0070707_100331124 3300005468 Unclassified 1479
209 Ga0070707_100352386 3300005468 Bacteria 1429
210 Ga0070707_100379262 3300005468 Bacteria 1374
211 Ga0070707_100411427 3300005468 Unclassified 1313
212 Ga0070707_100724120 3300005468 Unclassified 958
213 Ga0070707_100758325 3300005468 Bacteria 934
214 Ga0070707_101594960 3300005468 Unclassified 620
215 Ga0070698_100007308 3300005471 Bacteria 11959
216 Ga0070698_100009997 3300005471 Bacteria 10139
217 Ga0070698_100053435 3300005471 Bacteria 4105
218 Ga0070698_101507072 3300005471 Unclassified 624
219 Ga0070699_100024166 3300005518 Bacteria 5237
220 Ga0070699_100068108 3300005518 Bacteria 3091
221 Ga0070699_100240801 3300005518 Unclassified 1615
222 Ga0070679_100062546 3300005530 Unclassified 3711
223 Ga0070679_100646977 3300005530 Bacteria 1000
224 Ga0070684_100146132 3300005535 Unclassified 2140
225 Ga0070684_101607713 3300005535 Unclassified 613
226 Ga0070697_100006797 3300005536 Bacteria 8876
227 Ga0070697_100014111 3300005536 Bacteria 6275
228 Ga0070697_100020483 3300005536 Bacteria 5234
229 Ga0070697_100055272 3300005536 Bacteria 3227
230 Ga0070697_100084918 3300005536 Bacteria 2611
231 Ga0070697_100127038 3300005536 Unclassified 2136
232 Ga0070697_100130726 3300005536 Bacteria 2105
233 Ga0070697_100196873 3300005536 Unclassified 1712
234 Ga0070697_100321445 3300005536 Bacteria 1333
235 Ga0070697_100355476 3300005536 Bacteria 1266
236 Ga0070672_100094063 3300005543 Bacteria 2422
237 Ga0070672_100112984 3300005543 Bacteria 2216
238 Ga0070672_100119262 3300005543 Bacteria 2158
239 Ga0070672_100424653 3300005543 Unclassified 1142
240 Ga0070672_100563625 3300005543 Bacteria 990
241 Ga0070672_101668987 3300005543 Bacteria 572
242 Ga0070686_100006598 3300005544 Bacteria 6461
243 Ga0070686_100257737 3300005544 Bacteria 1277
244 Ga0070693_100448677 3300005547 Unclassified 905
245 Ga0070665_100019340 3300005548 Bacteria 6834
246 Ga0070665_100123658 3300005548 Bacteria 2589
247 Ga0070665_100146907 3300005548 Bacteria 2361
248 Ga0070665_100446340 3300005548 Bacteria 1303
249 Ga0070665_100730410 3300005548 Bacteria 1003
250 Ga0070665_101174215 3300005548 Unclassified 779
251 Ga0070704_100813954 3300005549 Unclassified 835
252 Ga0070704_101024901 3300005549 Bacteria 747
253 Ga0068855_100002563 3300005563 Bacteria 22398
254 Ga0070664_100003779 3300005564 Bacteria 12215
255 Ga0070664_100085540 3300005564 Bacteria 2724
256 Ga0070664_100142750 3300005564 Bacteria 2109
257 Ga0068857_100233581 3300005577 Bacteria 1682
258 Ga0068857_100598842 3300005577 Unclassified 1042
259 Ga0068857_101327731 3300005577 Bacteria 698
260 Ga0068854_101115880 3300005578 Bacteria 703
261 Ga0068856_100080567 3300005614 Unclassified 3229
262 Ga0068856_100560134 3300005614 Bacteria 1164
263 Ga0068852_100404783 3300005616 Bacteria 1343
264 Ga0068852_100575045 3300005616 Bacteria 1129
265 Ga0068852_101167692 3300005616 Unclassified 791
266 Ga0068866_10708985 3300005718 Unclassified 691
267 Ga0068861_100228780 3300005719 Bacteria 1576
268 Ga0068863_100383588 3300005841 Bacteria 1372
269 Ga0068863_101453731 3300005841 Unclassified 694
270 Ga0068863_101882289 3300005841 Unclassified 608
271 Ga0068858_100068574 3300005842 Bacteria 3287
272 Ga0068858_100741048 3300005842 Bacteria 957
273 Ga0068858_101170031 3300005842 Bacteria 756
274 Ga0068860_100640713 3300005843 Unclassified 1070
275 Ga0068862_100061519 3300005844 Bacteria 3228
276 Ga0068862_100917128 3300005844 Bacteria 862
277 Ga0068862_101939713 3300005844 Bacteria 599
278 Ga0081455_10001104 3300005937 Bacteria 33930
279 Ga0081455_10002110 3300005937 Bacteria 23690
280 Ga0081455_10002139 3300005937 Bacteria 23553
281 Ga0081455_10013418 3300005937 Bacteria 8100
282 Ga0081455_10022398 3300005937 Bacteria 5906
283 Ga0081455_10135800 3300005937 Bacteria 1917
284 Ga0081455_10474329 3300005937 Archaea 848
285 Ga0081455_10899347 3300005937 Unclassified 551
286 Ga0081540_1000057 3300005983 Bacteria 121566
287 Ga0081540_1014620 3300005983 Bacteria 5017
288 Ga0081540_1038975 3300005983 Unclassified 2496
289 Ga0081540_1111194 3300005983 Bacteria 1158
290 Ga0081540_1119699 3300005983 Bacteria 1095
291 Ga0081539_10001105 3300005985 Bacteria 48997
292 Ga0081539_10016410 3300005985 Bacteria 5291
293 Ga0081539_10019215 3300005985 Unclassified 4688
294 Ga0070717_10000583 3300006028 Bacteria 23277
295 Ga0070717_10009959 3300006028 Bacteria 7151
296 Ga0070717_10018592 3300006028 Bacteria 5430
297 Ga0070717_10021709 3300006028 Bacteria 5063
298 Ga0070717_10061248 3300006028 Bacteria 3118
299 Ga0070717_10127547 3300006028 Bacteria 2185
300 Ga0070717_10205455 3300006028 Unclassified 1727
301 Ga0070717_10355857 3300006028 Bacteria 1310
302 Ga0070717_10481475 3300006028 Bacteria 1121
303 Ga0070717_10982021 3300006028 Unclassified 769
304 Ga0075368_10007832 3300006042 Bacteria 3786
305 Ga0075364_10469433 3300006051 Bacteria 860
306 Ga0070715_10020035 3300006163 Bacteria 2574
307 Ga0070715_10092456 3300006163 Bacteria 1395
308 Ga0070715_10299898 3300006163 Unclassified 859
309 Ga0070716_100006342 3300006173 Bacteria 5774
310 Ga0070716_100049830 3300006173 Bacteria 2374
311 Ga0070716_100338293 3300006173 Bacteria 1061
312 Ga0070716_100777498 3300006173 Bacteria 739
313 Ga0070712_100029814 3300006175 Bacteria 3661
314 Ga0070712_100075213 3300006175 Bacteria 2428
315 Ga0070712_100091371 3300006175 Bacteria 2230
316 Ga0070712_100174987 3300006175 Bacteria 1668
317 Ga0070712_100651778 3300006175 Bacteria 895
318 Ga0070712_100805397 3300006175 Bacteria 806
319 Ga0075367_10042419 3300006178 Bacteria 2662
320 Ga0075366_10130773 3300006195 Bacteria 1515
321 Ga0097621_100018011 3300006237 Bacteria 5383
322 Ga0097621_100408409 3300006237 Bacteria 1217
323 Ga0097621_100943745 3300006237 Bacteria 805
324 Ga0068871_100074726 3300006358 Bacteria 2796
325 Ga0068871_100110291 3300006358 Bacteria 2314
326 Ga0068871_100169104 3300006358 Bacteria 1873
327 Ga0068871_100204586 3300006358 Unclassified 1706
328 Ga0068871_100667212 3300006358 Bacteria 950
329 Ga0068871_100718684 3300006358 Bacteria 916
330 Ga0068871_101244961 3300006358 Unclassified 699
331 Ga0075428_100083385 3300006844 Bacteria 3488
332 Ga0075428_100374477 3300006844 Bacteria 1527
333 Ga0075428_100710160 3300006844 Bacteria 1071
334 Ga0075428_100891917 3300006844 Bacteria 943
335 Ga0075428_101023166 3300006844 Bacteria 874
336 Ga0075428_101142969 3300006844 Bacteria 822
337 Ga0075428_101291249 3300006844 Bacteria 768
338 Ga0075430_100257641 3300006846 Bacteria 1445
339 Ga0075431_100324215 3300006847 Bacteria 1552
340 Ga0075433_10010205 3300006852 Bacteria 7532
341 Ga0075433_10332226 3300006852 Bacteria 1344
342 Ga0075434_100485303 3300006871 Unclassified 1257
343 Ga0075434_100506758 3300006871 Bacteria 1228
344 Ga0075429_100009169 3300006880 Bacteria 8591
345 Ga0075429_100823347 3300006880 Bacteria 813
346 Ga0068865_100022865 3300006881 Bacteria 4086
347 Ga0075436_100025890 3300006914 Bacteria 4038
348 Ga0075436_100050425 3300006914 Bacteria 2872
349 Ga0075436_100249432 3300006914 Unclassified 1264
350 Ga0075436_100413032 3300006914 Unclassified 979
351 Ga0075436_100580122 3300006914 Unclassified 825
352 Ga0075435_100011509 3300007076 Bacteria 6513
353 Ga0075435_100106908 3300007076 Bacteria 2323
354 Ga0075435_100492454 3300007076 Bacteria 1059
355 Ga0099795_10053563 3300007788 Bacteria 1477
356 Ga0105251_10119671 3300009011 Unclassified 1196
357 Ga0105240_10000043 3300009093 Bacteria 254256
358 Ga0105240_10361783 3300009093 Bacteria 1643
359 Ga0105240_10831299 3300009093 Bacteria 998
360 Ga0111539_10069389 3300009094 Bacteria 4162
361 Ga0111539_10073318 3300009094 Bacteria 4036
362 Ga0111539_10343660 3300009094 Bacteria 1737
363 Ga0111539_11912006 3300009094 Unclassified 688
364 Ga0105245_10219590 3300009098 Unclassified 1833
365 Ga0105245_10249656 3300009098 Bacteria 1723
366 Ga0105245_10811597 3300009098 Unclassified 974
367 Ga0114129_10035303 3300009147 Bacteria 7063
368 Ga0114129_10062193 3300009147 Bacteria 5216
369 Ga0114129_10203100 3300009147 Bacteria 2683
370 Ga0114129_10878266 3300009147 Unclassified 1138
371 Ga0114129_10982987 3300009147 Bacteria 1064
372 Ga0105241_10119084 3300009174 Bacteria 2123
373 Ga0105241_10322112 3300009174 Unclassified 1333
374 Ga0105241_10896261 3300009174 Bacteria 823
375 Ga0105242_10055470 3300009176 Bacteria 3241
376 Ga0105242_10381269 3300009176 Bacteria 1311
377 Ga0105248_10603497 3300009177 Bacteria 1238
378 Ga0105248_11011481 3300009177 Bacteria 939
379 Ga0105237_10004059 3300009545 Bacteria 17082
380 Ga0105237_10300508 3300009545 Unclassified 1608
381 Ga0105249_11254017 3300009553 Bacteria 813
382 Ga0105249_11330340 3300009553 Bacteria 790
383 Ga0099796_10162084 3300010159 Unclassified 887
384 Ga0105239_10120779 3300010375 Bacteria 2910
385 Ga0105239_10355492 3300010375 Bacteria 1654
386 Ga0105239_10760588 3300010375 Bacteria 1109
387 Ga0105239_12346636 3300010375 Archaea 621
388 Ga0105246_10066189 3300011119 Bacteria 2529
389 Ga0105246_10974874 3300011119 Unclassified 766
390 Ga0105246_11573093 3300011119 Unclassified 620
391 Ga0105246_11634779 3300011119 Unclassified 610
392 Ga0105246_12415820 3300011119 Unclassified 516
393 Ga0157371_10097202 3300013102 Bacteria 2087
394 Ga0157369_11368173 3300013105 Bacteria 721
395 Ga0157374_10019276 3300013296 Bacteria 6036
396 Ga0157374_10026651 3300013296 Bacteria 5203
397 Ga0157374_10090098 3300013296 Bacteria 2923
398 Ga0157374_10102841 3300013296 Unclassified 2740
399 Ga0157374_10406215 3300013296 Bacteria 1359
400 Ga0157374_10406438 3300013296 Bacteria 1359
401 Ga0157374_10456812 3300013296 Bacteria 1279
402 Ga0157374_11015194 3300013296 Unclassified 849
403 Ga0157378_10050307 3300013297 Unclassified 3708
404 Ga0157378_10075070 3300013297 Bacteria 3043
405 Ga0157378_10120928 3300013297 Archaea 2414
406 Ga0157378_10190983 3300013297 Bacteria 1932
407 Ga0157378_10283353 3300013297 Bacteria 1598
408 Ga0157378_10324482 3300013297 Bacteria 1496
409 Ga0157378_12120546 3300013297 Unclassified 613
410 Ga0157378_12507614 3300013297 Unclassified 568
411 Ga0163162_10011143 3300013306 Bacteria 8759
412 Ga0163162_10057100 3300013306 Bacteria 3931
413 Ga0163162_10068582 3300013306 Bacteria 3598
414 Ga0163162_10087899 3300013306 Bacteria 3187
415 Ga0163162_10128346 3300013306 Bacteria 2643
416 Ga0163162_10203592 3300013306 Bacteria 2108
417 Ga0163162_10299640 3300013306 Bacteria 1739
418 Ga0163162_10314628 3300013306 Unclassified 1698
419 Ga0163162_10423918 3300013306 Bacteria 1463
420 Ga0163162_10633861 3300013306 Unclassified 1193
421 Ga0163162_11498133 3300013306 Unclassified 768
422 Ga0163162_11744015 3300013306 Unclassified 711
423 Ga0157372_10112644 3300013307 Unclassified 3117
424 Ga0157372_11150788 3300013307 Bacteria 897
425 Ga0157372_11522895 3300013307 Unclassified 770
426 Ga0157375_10002077 3300013308 Bacteria 17327
427 Ga0157375_10022656 3300013308 Bacteria 5783
428 Ga0157375_10073103 3300013308 Bacteria 3447
429 Ga0157375_10206536 3300013308 Bacteria 2121
430 Ga0157375_10321205 3300013308 Bacteria 1713
431 Ga0157375_10348513 3300013308 Bacteria 1647
432 Ga0157375_11186035 3300013308 Bacteria 895
433 Ga0157375_11669569 3300013308 Unclassified 754
434 Ga0163163_10105369 3300014325 Unclassified 2845
435 Ga0163163_10232751 3300014325 Bacteria 1892
436 Ga0163163_10597410 3300014325 Bacteria 1167
437 Ga0163163_10803652 3300014325 Unclassified 1004
438 Ga0163163_11409797 3300014325 Bacteria 758
439 Ga0157380_10759774 3300014326 Bacteria 982
440 Ga0182008_10032965 3300014497 Bacteria 2600
441 Ga0157377_10447443 3300014745 Unclassified 891
442 Ga0157376_10029748 3300014969 Unclassified 4354
443 Ga0157376_10031875 3300014969 Bacteria 4226
444 Ga0157376_10036547 3300014969 Bacteria 3980
445 Ga0157376_10038415 3300014969 Bacteria 3895
446 Ga0157376_10093101 3300014969 Bacteria 2615
447 Ga0157376_10174557 3300014969 Unclassified 1959
448 Ga0163161_10020404 3300017792 Bacteria 4651
449 Ga0163161_10343889 3300017792 Unclassified 1184
450 Ga0163161_11353114 3300017792 Bacteria 620
451 Ga0197907_10089931 3300020069 Unclassified 547
452 Ga0213874_10023377 3300021377 Bacteria 1724
453 Ga0207666_1002495 3300025271 Bacteria 2221
454 Ga0207666_1006235 3300025271 Bacteria 1543
455 Ga0207697_10002099 3300025315 Bacteria 10469
456 Ga0207697_10003867 3300025315 Bacteria 7303
457 Ga0207697_10003938 3300025315 Bacteria 7223
458 Ga0207697_10005256 3300025315 Bacteria 6034
459 Ga0207697_10006080 3300025315 Bacteria 5517
460 Ga0207697_10011892 3300025315 Bacteria 3668
461 Ga0207697_10155976 3300025315 Unclassified 994
462 Ga0207697_10171745 3300025315 Unclassified 948
463 Ga0207653_10204095 3300025885 Bacteria 746
464 Ga0207692_10141740 3300025898 Bacteria 1368
465 Ga0207692_10263262 3300025898 Bacteria 1037
466 Ga0207692_10570539 3300025898 Bacteria 725
467 Ga0207692_10965249 3300025898 Unclassified 562
468 Ga0207688_10024254 3300025901 Bacteria 3326
469 Ga0207688_10031979 3300025901 Unclassified 2907
470 Ga0207688_10148409 3300025901 Bacteria 1384
471 Ga0207688_10165636 3300025901 Bacteria 1312
472 Ga0207680_10009556 3300025903 Bacteria 4815
473 Ga0207680_10014417 3300025903 Bacteria 4090
474 Ga0207680_10140761 3300025903 Bacteria 1599
475 Ga0207680_10305989 3300025903 Bacteria 1109
476 Ga0207680_10367411 3300025903 Bacteria 1012
477 Ga0207680_11091404 3300025903 Unclassified 571
478 Ga0207685_10009257 3300025905 Bacteria 2853
479 Ga0207685_10113774 3300025905 Bacteria 1177
480 Ga0207645_10007873 3300025907 Bacteria 7493
481 Ga0207645_10010760 3300025907 Bacteria 6271
482 Ga0207645_10015606 3300025907 Bacteria 5041
483 Ga0207645_10231427 3300025907 Unclassified 1220
484 Ga0207645_10295936 3300025907 Unclassified 1077
485 Ga0207645_10422188 3300025907 Unclassified 898
486 Ga0207705_10034266 3300025909 Bacteria 3630
487 Ga0207705_10141135 3300025909 Bacteria 1799
488 Ga0207684_10000208 3300025910 Bacteria 91185
489 Ga0207684_10000740 3300025910 Bacteria 38281
490 Ga0207684_10030772 3300025910 Bacteria 4568
491 Ga0207684_10137754 3300025910 Bacteria 2097
492 Ga0207684_10153260 3300025910 Bacteria 1983
493 Ga0207684_10215800 3300025910 Bacteria 1655
494 Ga0207684_10303063 3300025910 Bacteria 1378
495 Ga0207684_10360268 3300025910 Bacteria 1251
496 Ga0207684_10414260 3300025910 Bacteria 1158
497 Ga0207684_10440922 3300025910 Bacteria 1118
498 Ga0207684_10788229 3300025910 Unclassified 804
499 Ga0207707_10157182 3300025912 Bacteria 1988
500 Ga0207695_10001084 3300025913 Bacteria 47544
501 Ga0207695_10572916 3300025913 Bacteria 1010
502 Ga0207671_10004227 3300025914 Bacteria 13834
503 Ga0207671_10558356 3300025914 Unclassified 913
504 Ga0207693_10006991 3300025915 Bacteria 9320
505 Ga0207693_10024138 3300025915 Bacteria 4828
506 Ga0207693_10028449 3300025915 Bacteria 4416
507 Ga0207693_10028637 3300025915 Bacteria 4402
508 Ga0207693_10033463 3300025915 Bacteria 4056
509 Ga0207693_10094136 3300025915 Bacteria 2348
510 Ga0207693_10107824 3300025915 Bacteria 2185
511 Ga0207693_10147792 3300025915 Bacteria 1848
512 Ga0207693_10241850 3300025915 Unclassified 1417
513 Ga0207663_10066062 3300025916 Unclassified 2314
514 Ga0207663_10181758 3300025916 Bacteria 1503
515 Ga0207662_10006286 3300025918 Bacteria 6398
516 Ga0207662_10183140 3300025918 Bacteria 1349
517 Ga0207657_10081448 3300025919 Bacteria 2719
518 Ga0207657_10340873 3300025919 Bacteria 1183
519 Ga0207649_10011145 3300025920 Bacteria 4948
520 Ga0207649_10060201 3300025920 Bacteria 2385
521 Ga0207652_10013132 3300025921 Bacteria 6705
522 Ga0207646_10004132 3300025922 Bacteria 15944
523 Ga0207646_10008309 3300025922 Bacteria 10418
524 Ga0207646_10024176 3300025922 Bacteria 5569
525 Ga0207646_10057230 3300025922 Bacteria 3483
526 Ga0207646_10180881 3300025922 Unclassified 1904
527 Ga0207646_10207376 3300025922 Bacteria 1770
528 Ga0207646_10208800 3300025922 Unclassified 1763
529 Ga0207646_10283344 3300025922 Bacteria 1497
530 Ga0207646_10690459 3300025922 Unclassified 913
531 Ga0207646_11388867 3300025922 Bacteria 611
532 Ga0207681_10014639 3300025923 Bacteria 4882
533 Ga0207681_10043645 3300025923 Bacteria 3002
534 Ga0207681_10089142 3300025923 Bacteria 2198
535 Ga0207681_10133889 3300025923 Bacteria 1836
536 Ga0207681_10475365 3300025923 Bacteria 1020
537 Ga0207681_10514486 3300025923 Bacteria 982
538 Ga0207681_10632240 3300025923 Bacteria 886
539 Ga0207694_10377280 3300025924 Unclassified 1177
540 Ga0207694_10646043 3300025924 Bacteria 891
541 Ga0207650_10079952 3300025925 Bacteria 2477
542 Ga0207650_10301610 3300025925 Bacteria 1308
543 Ga0207650_10425435 3300025925 Bacteria 1102
544 Ga0207659_10010936 3300025926 Bacteria 5715
545 Ga0207659_10089003 3300025926 Bacteria 2301
546 Ga0207659_10209598 3300025926 Bacteria 1561
547 Ga0207659_10289300 3300025926 Unclassified 1342
548 Ga0207659_10331958 3300025926 Bacteria 1257
549 Ga0207659_10363531 3300025926 Bacteria 1203
550 Ga0207659_10754171 3300025926 Unclassified 835
551 Ga0207687_10576268 3300025927 Unclassified 946
552 Ga0207687_10629434 3300025927 Bacteria 906
553 Ga0207687_10832417 3300025927 Unclassified 788
554 Ga0207700_10000591 3300025928 Bacteria 21156
555 Ga0207700_10237217 3300025928 Bacteria 1553
556 Ga0207664_10003718 3300025929 Bacteria 10236
557 Ga0207664_10394321 3300025929 Unclassified 1230
558 Ga0207664_10621643 3300025929 Unclassified 970
559 Ga0207644_10064468 3300025931 Bacteria 2662
560 Ga0207644_10070613 3300025931 Bacteria 2553
561 Ga0207644_10099529 3300025931 Bacteria 2182
562 Ga0207644_10225941 3300025931 Bacteria 1486
563 Ga0207644_10268220 3300025931 Bacteria 1367
564 Ga0207644_10312927 3300025931 Unclassified 1268
565 Ga0207644_11006732 3300025931 Unclassified 699
566 Ga0207690_10491144 3300025932 Bacteria 992
567 Ga0207690_10559851 3300025932 Bacteria 930
568 Ga0207690_10608911 3300025932 Bacteria 892
569 Ga0207706_10000319 3300025933 Bacteria 52048
570 Ga0207706_10069387 3300025933 Bacteria 3100
571 Ga0207706_10082679 3300025933 Bacteria 2823
572 Ga0207706_10097416 3300025933 Bacteria 2587
573 Ga0207706_10348437 3300025933 Bacteria 1288
574 Ga0207670_10033381 3300025936 Bacteria 3316
575 Ga0207670_10093579 3300025936 Bacteria 2130
576 Ga0207670_10147068 3300025936 Bacteria 1744
577 Ga0207670_10222976 3300025936 Bacteria 1444
578 Ga0207670_10446648 3300025936 Unclassified 1042
579 Ga0207669_10025044 3300025937 Bacteria 3217
580 Ga0207669_10506468 3300025937 Bacteria 967
581 Ga0207704_10067572 3300025938 Bacteria 2249
582 Ga0207704_10447147 3300025938 Bacteria 1030
583 Ga0207704_11638560 3300025938 Bacteria 553
584 Ga0207665_10004517 3300025939 Bacteria 9227
585 Ga0207665_10227289 3300025939 Unclassified 1370
586 Ga0207665_10276067 3300025939 Bacteria 1249
587 Ga0207665_10382794 3300025939 Unclassified 1068
588 Ga0207665_10392876 3300025939 Unclassified 1055
589 Ga0207665_10666232 3300025939 Bacteria 816
590 Ga0207665_10911474 3300025939 Unclassified 697
591 Ga0207665_11009782 3300025939 Bacteria 662
592 Ga0207691_10000755 3300025940 Bacteria 31945
593 Ga0207691_10036169 3300025940 Bacteria 4575
594 Ga0207691_10165579 3300025940 Bacteria 1937
595 Ga0207691_10213764 3300025940 Bacteria 1674
596 Ga0207691_10256104 3300025940 Bacteria 1509
597 Ga0207691_10416897 3300025940 Unclassified 1144
598 Ga0207691_10869330 3300025940 Unclassified 756
599 Ga0207691_11396694 3300025940 Bacteria 575
600 Ga0207711_10598998 3300025941 Bacteria 1028
601 Ga0207689_10510384 3300025942 Unclassified 1008
602 Ga0207661_10005051 3300025944 Bacteria 9259
603 Ga0207661_10145646 3300025944 Bacteria 2043
604 Ga0207661_10882091 3300025944 Bacteria 824
605 Ga0207679_10037791 3300025945 Bacteria 3435
606 Ga0207679_10058243 3300025945 Bacteria 2861
607 Ga0207679_10573801 3300025945 Unclassified 1014
608 Ga0207679_10858486 3300025945 Bacteria 829
609 Ga0207679_10941133 3300025945 Unclassified 791
610 Ga0207667_10097258 3300025949 Bacteria 3039
611 Ga0207667_10319951 3300025949 Unclassified 1584
612 Ga0207667_11164029 3300025949 Bacteria 752
613 Ga0207651_10041037 3300025960 Bacteria 3068
614 Ga0207651_10047324 3300025960 Unclassified 2899
615 Ga0207651_10061750 3300025960 Bacteria 2608
616 Ga0207651_10100818 3300025960 Bacteria 2141
617 Ga0207651_10134547 3300025960 Bacteria 1899
618 Ga0207668_10128990 3300025972 Unclassified 1928
619 Ga0207668_10226678 3300025972 Unclassified 1504
620 Ga0207668_10249681 3300025972 Bacteria 1440
621 Ga0207668_10342268 3300025972 Bacteria 1248
622 Ga0207668_10578235 3300025972 Bacteria 976
623 Ga0207658_10165662 3300025986 Bacteria 1815
624 Ga0207658_10331319 3300025986 Bacteria 1320
625 Ga0207677_10092870 3300026023 Bacteria 2198
626 Ga0207677_10114132 3300026023 Unclassified 2018
627 Ga0207677_10143011 3300026023 Bacteria 1834
628 Ga0207677_10169294 3300026023 Bacteria 1706
629 Ga0207677_10600199 3300026023 Unclassified 966
630 Ga0207677_10908157 3300026023 Unclassified 794
631 Ga0207703_10563021 3300026035 Unclassified 1075
632 Ga0207703_10931423 3300026035 Unclassified 832
633 Ga0207678_10038441 3300026067 Bacteria 4157
634 Ga0207678_10658965 3300026067 Unclassified 920
635 Ga0207678_11173716 3300026067 Bacteria 680
636 Ga0207708_10510540 3300026075 Bacteria 1009
637 Ga0207702_10310685 3300026078 Unclassified 1499
638 Ga0207641_10797050 3300026088 Bacteria 934
639 Ga0207648_10020404 3300026089 Bacteria 5967
640 Ga0207648_10567675 3300026089 Unclassified 1044
641 Ga0207648_10964309 3300026089 Unclassified 798
642 Ga0207674_10192520 3300026116 Bacteria 1989
643 Ga0207675_100400683 3300026118 Bacteria 1352
644 Ga0207683_10011524 3300026121 Bacteria 7548
645 Ga0207683_10011820 3300026121 Bacteria 7448
646 Ga0207683_10035810 3300026121 Bacteria 4317
647 Ga0207683_10070982 3300026121 Bacteria 3078
648 Ga0207683_10110697 3300026121 Unclassified 2458
649 Ga0207698_10742173 3300026142 Bacteria 980
650 Ga0207698_11032372 3300026142 Bacteria 833
651 Ga0209974_10096553 3300027876 Bacteria 1029
652 Ga0209974_10140081 3300027876 Bacteria 867
653 Ga0209974_10175667 3300027876 Bacteria 782
654 Ga0268266_10033613 3300028379 Unclassified 4359
655 Ga0268266_10064117 3300028379 Bacteria 3173
656 Ga0268266_10181484 3300028379 Bacteria 1917
657 Ga0268266_10202602 3300028379 Bacteria 1816
658 Ga0268266_10286567 3300028379 Unclassified 1533
659 Ga0268266_10699683 3300028379 Unclassified 977
660 Ga0268266_10700535 3300028379 Unclassified 976
661 Ga0268265_10093856 3300028380 Bacteria 2405
662 Ga0268264_10299243 3300028381 Bacteria 1514
663 Ga0268264_10872290 3300028381 Bacteria 902
664 Ga0268264_12001924 3300028381 Unclassified 588
665 Ga0268264_12243714 3300028381 Unclassified 553
666 Ga0316576_10108790 3300031727 Bacteria 2077
667 Ga0316593_10107590 3300032168 Bacteria 994
668 Ga0373958_0030460 3300034819 Bacteria 1055
669 Ga0373928_0089950 3300035084 Unclassified 787
670 Ga0373940_0021483 3300035088 Bacteria 1650
671 Ga0373952_0100436 3300035092 Unclassified 763
672 Ga0373936_0315040 3300035113 Unclassified 708
673 Ga0373939_0187759 3300035114 Bacteria 775
674 Ga0373945_0067675 3300035116 Bacteria 1345
675 Ga0373943_0018840 3300035170 Unclassified 3173
676 Ga0373943_0044583 3300035170 Bacteria 2159
677 Ga0373943_0070077 3300035170 Bacteria 1773
678 Ga0373943_0090231 3300035170 Unclassified 1586
679 Ga0373946_0010703 3300035171 Bacteria 3405
680 Ga0373946_0019211 3300035171 Unclassified 2632
681 Ga0373946_0200457 3300035171 Bacteria 956
682 Ga0373955_0156605 3300035172 Unclassified 1342
683 Ga0373955_0178040 3300035172 Viruses 1261
684 Ga0373955_0406413 3300035172 Bacteria 828
685 Ga0373942_0158412 3300035207 Unclassified 731
686 Ga0373931_0119110 3300035691 Bacteria 1507
687 Ga0373931_0250238 3300035691 Bacteria 1077
688 Ga0373931_0578567 3300035691 Archaea 732
689 Ga0373935_0064959 3300035692 Bacteria 2341
690 Ga0373935_0377188 3300035692 Bacteria 1015
691 Ga0373935_0452111 3300035692 Bacteria 928
692 Ga0373927_0123317 3300035695 Unclassified 1691
693 Ga0373927_0225964 3300035695 Bacteria 1230
694 Ga0373927_0266784 3300035695 Unclassified 1126
695 Ga0373933_0509422 3300035724 Bacteria 789
696 Ga0373933_1025779 3300035724 Bacteria 543
697 Ga0373947_0036291 3300035725 Bacteria 2923
698 Ga0373947_0057534 3300035725 Bacteria 2353
699 Ga0373947_0107175 3300035725 Bacteria 1762
700 Ga0373947_0110674 3300035725 Bacteria 1735
701 Ga0373947_0329970 3300035725 Unclassified 1021
702 Ga0373947_0455715 3300035725 Unclassified 866
703 Ga0373947_0731509 3300035725 Unclassified 675
704 Ga0373937_0042304 3300036401 Bacteria 4156
705 Ga0373937_0279538 3300036401 Bacteria 1576
706 Ga0373937_1052856 3300036401 Bacteria 762
707 Ga0373937_1450149 3300036401 Unclassified 634
708 Ga0373925_0026753 3300037068 Bacteria 4223
709 Ga0373925_0369618 3300037068 Unclassified 1167
710 Ga0373925_0510263 3300037068 Unclassified 987
711 Ga0395900_0011491 3300037418 Bacteria 9064
712 Ga0395900_0058044 3300037418 Bacteria 3984
713 Ga0395900_0072849 3300037418 Bacteria 3531
714 Ga0395900_1452085 3300037418 Unclassified 598
715 Ga0395898_0011791 3300037466 Bacteria 9062
716 Ga0395898_0099131 3300037466 Bacteria 2798
717 Ga0395898_1049029 3300037466 Bacteria 750
718 Ga0395905_0014347 3300037471 Bacteria 7571
719 Ga0395901_0015822 3300038443 Bacteria 7687
720 Ga0395901_0088299 3300038443 Bacteria 3243
721 Ga0395901_0142063 3300038443 Unclassified 2523
722 Ga0395901_0309580 3300038443 Bacteria 1636
723 Ga0395901_1150789 3300038443 Unclassified 744
724 Ga0436363_0267184 3300039450 Bacteria 825
725 Ga0436363_1238186 3300039450 Bacteria 1756
726 Ga0451802_0863359 3300041460 Unclassified 552
727 Ga0451802_2196682 3300041460 Unclassified 760
728 Ga0451804_0879523 3300041463 Unclassified 1063
729 Ga0451853_3042968 3300041512 Bacteria 859
730 Ga0439455_0002551 3300042012 Bacteria 3333
731 Ga0439455_0006406 3300042012 Bacteria 2442
732 Ga0439460_0045158 3300042461 Bacteria 1306
733 Ga0451576_0475849 3300045051 Bacteria 1312
734 Ga0495638_0081240 3300046460 Bacteria 1968
735 Ga0495580_0043124 3300046472 Unclassified 3212
736 Ga0495662_0069679 3300046476 Bacteria 1704
737 Ga0495584_0570414 3300046491 Unclassified 577
738 Ga0495608_0531947 3300046511 Bacteria 710
739 Ga0495628_0050039 3300046516 Bacteria 3306
740 Ga0495630_0317251 3300046517 Bacteria 1191
741 Ga0495666_0237207 3300046526 Unclassified 833
742 Ga0495642_0091125 3300046528 Bacteria 1291
743 Ga0495652_0359642 3300046529 Bacteria 1040
744 Ga0495640_0184648 3300046533 Unclassified 1328
745 Ga0495645_0029956 3300046543 Bacteria 3964
746 Ga0495667_0440163 3300046559 Bacteria 819
747 Ga0495635_0068706 3300046663 Bacteria 2430
748 Ga0495599_0161345 3300046678 Bacteria 1385
749 Ga0495599_0217672 3300046678 Bacteria 1169
750 Ga0495623_0006311 3300046679 Bacteria 7707
751 Ga0495646_0058413 3300046680 Bacteria 2306
752 Ga0495647_0400201 3300046681 Unclassified 631
753 Ga0495658_0629599 3300046683 Unclassified 687
754 Ga0495669_0091057 3300046684 Bacteria 1408
755 Ga0495604_0171860 3300047317 Bacteria 1523
756 Ga0495672_0006214 3300047320 Bacteria 9313
757 Ga0495676_1045709 3300047321 Unclassified 520
758 Ga0495675_0026242 3300047444 Unclassified 3715
759 Ga0495684_0036139 3300047471 Unclassified 3788
760 Ga0495602_0029117 3300048088 Bacteria 5271
761 Ga0495614_0115275 3300048089 Bacteria 1182
762 Ga0496100_0074357 3300048903 Bacteria 2276
763 Ga0496101_0054819 3300048904 Bacteria 2878
764 Ga0496101_0408303 3300048904 Unclassified 1070
765 Ga0496102_0696909 3300048905 Bacteria 939
766 Ga0496102_1552336 3300048905 Unclassified 580
767 Ga0496103_0286996 3300048906 Unclassified 1059
768 Ga0496104_0016892 3300048907 Bacteria 6637
769 Ga0496104_0035068 3300048907 Bacteria 4683
770 Ga0496104_0127977 3300048907 Bacteria 2439
771 Ga0496104_0146196 3300048907 Bacteria 2270
772 Ga0496104_0322126 3300048907 Bacteria 1459
773 Ga0496104_0559137 3300048907 Unclassified 1055
774 Ga0496104_1505414 3300048907 Unclassified 576
775 Ga0496105_0041691 3300048908 Bacteria 3783
776 Ga0496105_0230590 3300048908 Unclassified 1505
777 Ga0496105_0315524 3300048908 Bacteria 1254
778 Ga0496105_0318634 3300048908 Unclassified 1247
779 Ga0496105_0820124 3300048908 Bacteria 706
780 Ga0496106_0049744 3300048909 Bacteria 3158
781 Ga0496106_0142657 3300048909 Bacteria 1885
782 Ga0496106_0644158 3300048909 Bacteria 847
783 Ga0496106_1069046 3300048909 Unclassified 633
784 Ga0496107_1069982 3300048910 Bacteria 583
785 Ga0496108_0003452 3300048911 Bacteria 12679
786 Ga0496108_0153486 3300048911 Bacteria 1988
787 Ga0496108_0180716 3300048911 Bacteria 1827
788 Ga0496108_0265715 3300048911 Bacteria 1493
789 Ga0496108_0541928 3300048911 Unclassified 1015
790 Ga0496108_0819853 3300048911 Unclassified 802
791 Ga0496109_0062924 3300048912 Unclassified 3393
792 Ga0496109_0112637 3300048912 Unclassified 2530
793 Ga0496109_0269523 3300048912 Bacteria 1604
794 Ga0496109_0286947 3300048912 Bacteria 1551
795 Ga0496109_0322424 3300048912 Bacteria 1458
796 Ga0496109_0724478 3300048912 Unclassified 932
797 Ga0496110_0247049 3300048913 Bacteria 1624
798 Ga0496112_0021562 3300048915 Bacteria 6128
799 Ga0496112_0022287 3300048915 Bacteria 6035
800 Ga0496112_0235656 3300048915 Unclassified 1784
801 Ga0496112_1138414 3300048915 Bacteria 698
802 Ga0496112_1161398 3300048915 Unclassified 689
803 Ga0496112_1183879 3300048915 Unclassified 681
804 Ga0496113_0080549 3300048916 Bacteria 2494
805 Ga0496113_0138782 3300048916 Bacteria 1912
806 Ga0496113_0156209 3300048916 Unclassified 1802
807 Ga0496113_0495197 3300048916 Unclassified 981
808 Ga0496113_0624925 3300048916 Unclassified 862
809 Ga0496113_1000699 3300048916 Unclassified 658
810 Ga0496114_0013929 3300048917 Bacteria 6447
811 Ga0496115_0039345 3300048918 Bacteria 3755
812 Ga0496115_0134517 3300048918 Bacteria 2038
813 Ga0496115_0213799 3300048918 Bacteria 1592
814 Ga0496115_0222068 3300048918 Bacteria 1559
815 Ga0496115_0549071 3300048918 Bacteria 924
816 Ga0501036_0356250 3300049572 Bacteria 1222
817 Ga0501036_1020183 3300049572 Bacteria 677
818 Ga0501076_0216148 3300049592 Bacteria 1567
819 Ga0501079_0401573 3300049741 Bacteria 1075
820 Ga0501080_0805377 3300049742 Bacteria 824
821 Ga0501081_0081063 3300049743 Bacteria 2273
822 nmdc:mga03n38_226136_c1 3300050490 Bacteria 979
823 nmdc:mga00v17_230123_c1 3300050491 Bacteria 1201
824 nmdc:mga0k408_87437_c1 3300050493 Bacteria 1237
825 nmdc:mga06z11_18012_c1 3300050494 Bacteria 3218
826 nmdc:mga06z11_218692_c1 3300050494 Bacteria 1112
827 nmdc:mga04h51_13460_c1 3300050495 Bacteria 2316
828 nmdc:mga05p37_20802_c1 3300050507 Bacteria 7941
829 nmdc:mga05p37_266697_c1 3300050507 Bacteria 2047
830 nmdc:mga05p37_350641_c1 3300050507 Archaea 1738
831 nmdc:mga05p37_457891_c1 3300050507 Bacteria 1475
832 nmdc:mga05p37_72683_c1 3300050507 Bacteria 4232
833 nmdc:mga09592_3647_c1 3300050508 Bacteria 12411
834 nmdc:mga09592_877308_c1 3300050508 Bacteria 755
835 nmdc:mga0qj67_263074_c1 3300050509 Bacteria 1399
836 nmdc:mga06r32_1017868_c1 3300050510 Bacteria 780
837 nmdc:mga06r32_211724_c1 3300050510 Bacteria 1926
838 nmdc:mga08y16_1087376_c1 3300050511 Bacteria 775
839 nmdc:mga08y16_150788_c1 3300050511 Bacteria 2416
840 nmdc:mga08y16_1657503_c1 3300050511 Unclassified 596
841 nmdc:mga08y16_17803_c1 3300050511 Bacteria 7484
842 nmdc:mga0n895_1225647_c1 3300050512 Unclassified 723
843 nmdc:mga0n895_1938515_c1 3300050512 Bacteria 548
844 nmdc:mga0n895_310127_c1 3300050512 Bacteria 1599
845 nmdc:mga0rr50_193852_c1 3300050513 Unclassified 1666
846 nmdc:mga0rr50_490833_c1 3300050513 Bacteria 1043
847 nmdc:mga0rr50_672050_c1 3300050513 Bacteria 884
848 nmdc:mga08x19_205404_c1 3300050514 Bacteria 1351
849 nmdc:mga08x19_299740_c1 3300050514 Bacteria 1116
850 nmdc:mga08x19_425247_c1 3300050514 Unclassified 933
851 nmdc:mga08x19_779750_c1 3300050514 Unclassified 679
852 nmdc:mga08x19_8060_c1 3300050514 Bacteria 6257
853 nmdc:mga0a205_1366366_c1 3300050515 Unclassified 556
854 nmdc:mga0a205_1576551_c1 3300050515 Unclassified 505
855 nmdc:mga0a205_282133_c1 3300050515 Bacteria 1536
856 nmdc:mga0a205_54716_c1 3300050515 Bacteria 3853
857 Ga0495601_0725679 3300053077 Bacteria 633
858 Ga0495612_0009591 3300053078 Bacteria 3921
859 Ga0500610_0141542 3300053079 Unclassified 1214
860 Ga0500556_0042505 3300053104 Bacteria 1608
861 Ga0500627_0078339 3300053158 Bacteria 1471
862 Ga0587066_012382 3300059490 Bacteria 1272
863 Ga0587073_0018867 3300059492 Bacteria 1295
864 Ga0587082_018130 3300059504 Bacteria 1117
865 Ga0587067_021711 3300059640 Bacteria 1110
866 Ga0587072_030703 3300059643 Bacteria 1003
867 Ga0587079_030593 3300059647 Bacteria 1032
868 Ga0501082_0715075 3300060353 Bacteria 877
869 2787506932 2786546548 Bacteria 4745694
870 Ga0070663_100750911
871 SwRhRL3b_contig_4564459
872 SwRhRL2b_contig_1312709
873 JGI24035J26624_1020476
874 JGI25406J46586_10000706
875 JGI25404J52841_10073533
876 Ga0065704_10007672
877 Ga0065704_10116026
878 Ga0065704_10132930
879 Ga0065704_10235072
880 Ga0065704_10488105
881 Ga0065712_10000944
882 Ga0065712_10057772
883 Ga0065712_10084369
884 Ga0065712_10202782
885 Ga0065712_10301719
886 Ga0065712_10452847
887 Ga0065715_10013929
888 Ga0065715_10016165
889 Ga0065715_10095103
890 Ga0065715_10225061
891 Ga0065715_10275928
892 Ga0065715_10318050
893 Ga0065715_10380532
894 Ga0065715_10505850
895 Ga0065715_10561679
896 Ga0065715_10603983
897 Ga0065707_10036152
898 Ga0065707_10039486
899 Ga0065707_10122914
900 Ga0065707_10437290
901 Ga0065707_10634173
902 Ga0070658_10001934
903 Ga0070658_10369107
904 Ga0070676_10026606
905 Ga0070676_10030013
906 Ga0070676_10047334
907 Ga0070676_10154881
908 Ga0070676_10584166
909 Ga0070676_11382494
910 Ga0070683_100036382
911 Ga0070683_100487722
912 Ga0070690_100006808
913 Ga0070690_100077695
914 Ga0070690_100616141
915 Ga0070690_100948880
916 Ga0070670_100068191
917 Ga0070670_100299703
918 Ga0070670_100302827
919 Ga0070670_100624034
920 Ga0070670_100639874
921 Ga0070670_100888924
922 Ga0068869_100629115
923 Ga0068869_101155540
924 Ga0068869_101614589
925 Ga0070666_10021846
926 Ga0070666_10300160
927 Ga0070666_10453820
928 Ga0070666_11232834
929 Ga0070680_100009226
930 Ga0070682_101443961
931 Ga0068868_100082603
932 Ga0068868_100115403
933 Ga0068868_100393278
934 Ga0068868_101339050
935 Ga0070660_100065147
936 Ga0070660_100159758
937 Ga0070660_100369370
938 Ga0070689_100024985
939 Ga0070689_100085358
940 Ga0070689_100163405
941 Ga0070689_100294832
942 Ga0070687_100179209
943 Ga0070687_100180216
944 Ga0070687_100243297
945 Ga0070661_100006590
946 Ga0070661_100109333
947 Ga0070661_100153590
948 Ga0070661_100969938
949 Ga0070692_10174286
950 Ga0070692_10178137
951 Ga0070668_100017340
952 Ga0070668_100025666
953 Ga0070668_100125767
954 Ga0070668_100128404
955 Ga0070668_100211093
956 Ga0070668_100263647
957 Ga0070668_100299733
958 Ga0070668_100361444
959 Ga0070669_100007644
960 Ga0070669_100049917
961 Ga0070669_100226438
962 Ga0070669_100262095
963 Ga0070669_100350563
964 Ga0070669_100414481
965 Ga0070669_100883765
966 Ga0070675_100007313
967 Ga0070675_100021243
968 Ga0070675_100033280
969 Ga0070675_100041169
970 Ga0070675_100044711
971 Ga0070675_100058859
972 Ga0070675_100085730
973 Ga0070675_100306607
974 Ga0070675_100385173
975 Ga0070675_100631542
976 Ga0070675_100686576
977 Ga0070671_100015320
978 Ga0070671_100035808
979 Ga0070671_100068250
980 Ga0070671_100083222
981 Ga0070671_100323433
982 Ga0070671_100902545
983 Ga0070671_100913101
984 Ga0070674_100012002
985 Ga0070674_100020609
986 Ga0070674_100083371
987 Ga0070674_100461238
988 Ga0070674_100891034
989 Ga0070674_101390063
990 Ga0070673_100014841
991 Ga0070673_100032787
992 Ga0070673_100044193
993 Ga0070673_100103216
994 Ga0070673_100215752
995 Ga0070673_100903063
996 Ga0070688_100005095
997 Ga0070688_100047456
998 Ga0070688_100074059
999 Ga0070688_100083023
1000 Ga0070688_100140434
1001 Ga0070688_100222189
1002 Ga0070659_100379236
1003 Ga0070667_100018384
1004 Ga0070667_100105605
1005 Ga0070667_100118487
1006 Ga0070667_100726456
1007 Ga0070703_10059807
1008 Ga0070703_10211224
1009 Ga0070709_10303854
1010 Ga0070709_10463136
1011 Ga0070714_100027668
1012 Ga0070713_100043796
1013 Ga0070713_100733295
1014 Ga0070713_101306854
1015 Ga0070710_10007927
1016 Ga0070710_10243478
1017 Ga0070710_10330541
1018 Ga0070710_10512414
1019 Ga0070710_10601714
1020 Ga0070701_10651593
1021 Ga0070711_100015272
1022 Ga0070711_100388762
1023 Ga0070705_100008529
1024 Ga0070705_100291014
1025 Ga0070705_100696757
1026 Ga0070700_100279922
1027 Ga0070700_101436098
1028 Ga0070708_100013946
1029 Ga0070708_100107386
1030 Ga0070708_100192928
1031 Ga0070708_100240387
1032 Ga0070708_100245945
1033 Ga0070708_100260077
1034 Ga0070708_100281788
1035 Ga0070708_100412982
1036 Ga0070708_100517703
1037 Ga0070708_100650615
1038 Ga0070708_100868964
1039 Ga0070663_100968263
1040 Ga0070678_100016133
1041 Ga0070678_100038361
1042 Ga0070678_100079497
1043 Ga0070662_100068828
1044 Ga0070662_100078358
1045 Ga0070662_100091013
1046 Ga0070662_100315278
1047 Ga0070681_10011402
1048 Ga0068867_100011530
1049 Ga0068867_100538119
1050 Ga0068867_101145959
1051 Ga0068867_101405286
1052 Ga0070685_10070089
1053 Ga0070685_10351668
1054 Ga0070685_10987316
1055 Ga0070706_100000159
1056 Ga0070706_100008982
1057 Ga0070706_100015734
1058 Ga0070706_100015787
1059 Ga0070706_100092708
1060 Ga0070706_100202351
1061 Ga0070706_100233776
1062 Ga0070706_100470358
1063 Ga0070706_100520422
1064 Ga0070706_100524376
1065 Ga0070706_100686804
1066 Ga0070706_100793206
1067 Ga0070706_100889576
1068 Ga0070706_101144256
1069 Ga0070706_101272270
1070 Ga0070707_100014143
1071 Ga0070707_100020719
1072 Ga0070707_100023257
1073 Ga0070707_100027470
1074 Ga0070707_100037179
1075 Ga0070707_100088366
1076 Ga0070707_100249339
1077 Ga0070707_100331124
1078 Ga0070707_100352386
1079 Ga0070707_100379262
1080 Ga0070707_100411427
1081 Ga0070707_100724120
1082 Ga0070707_100758325
1083 Ga0070707_101594960
1084 Ga0070698_100007308
1085 Ga0070698_100009997
1086 Ga0070698_100053435
1087 Ga0070698_101507072
1088 Ga0070699_100024166
1089 Ga0070699_100068108
1090 Ga0070699_100240801
1091 Ga0070679_100062546
1092 Ga0070679_100646977
1093 Ga0070684_100146132
1094 Ga0070684_101607713
1095 Ga0070697_100006797
1096 Ga0070697_100014111
1097 Ga0070697_100020483
1098 Ga0070697_100055272
1099 Ga0070697_100084918
1100 Ga0070697_100127038
1101 Ga0070697_100130726
1102 Ga0070697_100196873
1103 Ga0070697_100321445
1104 Ga0070697_100355476
1105 Ga0070672_100094063
1106 Ga0070672_100112984
1107 Ga0070672_100119262
1108 Ga0070672_100424653
1109 Ga0070672_100563625
1110 Ga0070672_101668987
1111 Ga0070686_100006598
1112 Ga0070686_100257737
1113 Ga0070693_100448677
1114 Ga0070665_100019340
1115 Ga0070665_100123658
1116 Ga0070665_100146907
1117 Ga0070665_100446340
1118 Ga0070665_100730410
1119 Ga0070665_101174215
1120 Ga0070704_100813954
1121 Ga0070704_101024901
1122 Ga0068855_100002563
1123 Ga0070664_100003779
1124 Ga0070664_100085540
1125 Ga0070664_100142750
1126 Ga0068857_100233581
1127 Ga0068857_100598842
1128 Ga0068857_101327731
1129 Ga0068854_101115880
1130 Ga0068856_100080567
1131 Ga0068856_100560134
1132 Ga0068852_100404783
1133 Ga0068852_100575045
1134 Ga0068852_101167692
1135 Ga0068866_10708985
1136 Ga0068861_100228780
1137 Ga0068863_100383588
1138 Ga0068863_101453731
1139 Ga0068863_101882289
1140 Ga0068858_100068574
1141 Ga0068858_100741048
1142 Ga0068858_101170031
1143 Ga0068860_100640713
1144 Ga0068862_100061519
1145 Ga0068862_100917128
1146 Ga0068862_101939713
1147 Ga0081455_10001104
1148 Ga0081455_10002110
1149 Ga0081455_10002139
1150 Ga0081455_10013418
1151 Ga0081455_10022398
1152 Ga0081455_10135800
1153 Ga0081455_10474329
1154 Ga0081455_10899347
1155 Ga0081540_1000057
1156 Ga0081540_1014620
1157 Ga0081540_1038975
1158 Ga0081540_1111194
1159 Ga0081540_1119699
1160 Ga0081539_10001105
1161 Ga0081539_10016410
1162 Ga0081539_10019215
1163 Ga0070717_10000583
1164 Ga0070717_10009959
1165 Ga0070717_10018592
1166 Ga0070717_10021709
1167 Ga0070717_10061248
1168 Ga0070717_10127547
1169 Ga0070717_10205455
1170 Ga0070717_10355857
1171 Ga0070717_10481475
1172 Ga0070717_10982021
1173 Ga0075368_10007832
1174 Ga0075364_10469433
1175 Ga0070715_10020035
1176 Ga0070715_10092456
1177 Ga0070715_10299898
1178 Ga0070716_100006342
1179 Ga0070716_100049830
1180 Ga0070716_100338293
1181 Ga0070716_100777498
1182 Ga0070712_100029814
1183 Ga0070712_100075213
1184 Ga0070712_100091371
1185 Ga0070712_100174987
1186 Ga0070712_100651778
1187 Ga0070712_100805397
1188 Ga0075367_10042419
1189 Ga0075366_10130773
1190 Ga0097621_100018011
1191 Ga0097621_100408409
1192 Ga0097621_100943745
1193 Ga0068871_100074726
1194 Ga0068871_100110291
1195 Ga0068871_100169104
1196 Ga0068871_100204586
1197 Ga0068871_100667212
1198 Ga0068871_100718684
1199 Ga0068871_101244961
1200 Ga0075428_100083385
1201 Ga0075428_100374477
1202 Ga0075428_100710160
1203 Ga0075428_100891917
1204 Ga0075428_101023166
1205 Ga0075428_101142969
1206 Ga0075428_101291249
1207 Ga0075430_100257641
1208 Ga0075431_100324215
1209 Ga0075433_10010205
1210 Ga0075433_10332226
1211 Ga0075434_100485303
1212 Ga0075434_100506758
1213 Ga0075429_100009169
1214 Ga0075429_100823347
1215 Ga0068865_100022865
1216 Ga0075436_100025890
1217 Ga0075436_100050425
1218 Ga0075436_100249432
1219 Ga0075436_100413032
1220 Ga0075436_100580122
1221 Ga0075435_100011509
1222 Ga0075435_100106908
1223 Ga0075435_100492454
1224 Ga0099795_10053563
1225 Ga0105251_10119671
1226 Ga0105240_10000043
1227 Ga0105240_10361783
1228 Ga0105240_10831299
1229 Ga0111539_10069389
1230 Ga0111539_10073318
1231 Ga0111539_10343660
1232 Ga0111539_11912006
1233 Ga0105245_10219590
1234 Ga0105245_10249656
1235 Ga0105245_10811597
1236 Ga0114129_10035303
1237 Ga0114129_10062193
1238 Ga0114129_10203100
1239 Ga0114129_10878266
1240 Ga0114129_10982987
1241 Ga0105241_10119084
1242 Ga0105241_10322112
1243 Ga0105241_10896261
1244 Ga0105242_10055470
1245 Ga0105242_10381269
1246 Ga0105248_10603497
1247 Ga0105248_11011481
1248 Ga0105237_10004059
1249 Ga0105237_10300508
1250 Ga0105249_11254017
1251 Ga0105249_11330340
1252 Ga0099796_10162084
1253 Ga0105239_10120779
1254 Ga0105239_10355492
1255 Ga0105239_10760588
1256 Ga0105239_12346636
1257 Ga0105246_10066189
1258 Ga0105246_10974874
1259 Ga0105246_11573093
1260 Ga0105246_11634779
1261 Ga0105246_12415820
1262 Ga0157371_10097202
1263 Ga0157369_11368173
1264 Ga0157374_10019276
1265 Ga0157374_10026651
1266 Ga0157374_10090098
1267 Ga0157374_10102841
1268 Ga0157374_10406215
1269 Ga0157374_10406438
1270 Ga0157374_10456812
1271 Ga0157374_11015194
1272 Ga0157378_10050307
1273 Ga0157378_10075070
1274 Ga0157378_10120928
1275 Ga0157378_10190983
1276 Ga0157378_10283353
1277 Ga0157378_10324482
1278 Ga0157378_12120546
1279 Ga0157378_12507614
1280 Ga0163162_10011143
1281 Ga0163162_10057100
1282 Ga0163162_10068582
1283 Ga0163162_10087899
1284 Ga0163162_10128346
1285 Ga0163162_10203592
1286 Ga0163162_10299640
1287 Ga0163162_10314628
1288 Ga0163162_10423918
1289 Ga0163162_10633861
1290 Ga0163162_11498133
1291 Ga0163162_11744015
1292 Ga0157372_10112644
1293 Ga0157372_11150788
1294 Ga0157372_11522895
1295 Ga0157375_10002077
1296 Ga0157375_10022656
1297 Ga0157375_10073103
1298 Ga0157375_10206536
1299 Ga0157375_10321205
1300 Ga0157375_10348513
1301 Ga0157375_11186035
1302 Ga0157375_11669569
1303 Ga0163163_10105369
1304 Ga0163163_10232751
1305 Ga0163163_10597410
1306 Ga0163163_10803652
1307 Ga0163163_11409797
1308 Ga0157380_10759774
1309 Ga0182008_10032965
1310 Ga0157377_10447443
1311 Ga0157376_10029748
1312 Ga0157376_10031875
1313 Ga0157376_10036547
1314 Ga0157376_10038415
1315 Ga0157376_10093101
1316 Ga0157376_10174557
1317 Ga0163161_10020404
1318 Ga0163161_10343889
1319 Ga0163161_11353114
1320 Ga0197907_10089931
1321 Ga0213874_10023377
1322 Ga0207666_1002495
1323 Ga0207666_1006235
1324 Ga0207697_10002099
1325 Ga0207697_10003867
1326 Ga0207697_10003938
1327 Ga0207697_10005256
1328 Ga0207697_10006080
1329 Ga0207697_10011892
1330 Ga0207697_10155976
1331 Ga0207697_10171745
1332 Ga0207653_10204095
1333 Ga0207692_10141740
1334 Ga0207692_10263262
1335 Ga0207692_10570539
1336 Ga0207692_10965249
1337 Ga0207688_10024254
1338 Ga0207688_10031979
1339 Ga0207688_10148409
1340 Ga0207688_10165636
1341 Ga0207680_10009556
1342 Ga0207680_10014417
1343 Ga0207680_10140761
1344 Ga0207680_10305989
1345 Ga0207680_10367411
1346 Ga0207680_11091404
1347 Ga0207685_10009257
1348 Ga0207685_10113774
1349 Ga0207645_10007873
1350 Ga0207645_10010760
1351 Ga0207645_10015606
1352 Ga0207645_10231427
1353 Ga0207645_10295936
1354 Ga0207645_10422188
1355 Ga0207705_10034266
1356 Ga0207705_10141135
1357 Ga0207684_10000208
1358 Ga0207684_10000740
1359 Ga0207684_10030772
1360 Ga0207684_10137754
1361 Ga0207684_10153260
1362 Ga0207684_10215800
1363 Ga0207684_10303063
1364 Ga0207684_10360268
1365 Ga0207684_10414260
1366 Ga0207684_10440922
1367 Ga0207684_10788229
1368 Ga0207707_10157182
1369 Ga0207695_10001084
1370 Ga0207695_10572916
1371 Ga0207671_10004227
1372 Ga0207671_10558356
1373 Ga0207693_10006991
1374 Ga0207693_10024138
1375 Ga0207693_10028449
1376 Ga0207693_10028637
1377 Ga0207693_10033463
1378 Ga0207693_10094136
1379 Ga0207693_10107824
1380 Ga0207693_10147792
1381 Ga0207693_10241850
1382 Ga0207663_10066062
1383 Ga0207663_10181758
1384 Ga0207662_10006286
1385 Ga0207662_10183140
1386 Ga0207657_10081448
1387 Ga0207657_10340873
1388 Ga0207649_10011145
1389 Ga0207649_10060201
1390 Ga0207652_10013132
1391 Ga0207646_10004132
1392 Ga0207646_10008309
1393 Ga0207646_10024176
1394 Ga0207646_10057230
1395 Ga0207646_10180881
1396 Ga0207646_10207376
1397 Ga0207646_10208800
1398 Ga0207646_10283344
1399 Ga0207646_10690459
1400 Ga0207646_11388867
1401 Ga0207681_10014639
1402 Ga0207681_10043645
1403 Ga0207681_10089142
1404 Ga0207681_10133889
1405 Ga0207681_10475365
1406 Ga0207681_10514486
1407 Ga0207681_10632240
1408 Ga0207694_10377280
1409 Ga0207694_10646043
1410 Ga0207650_10079952
1411 Ga0207650_10301610
1412 Ga0207650_10425435
1413 Ga0207659_10010936
1414 Ga0207659_10089003
1415 Ga0207659_10209598
1416 Ga0207659_10289300
1417 Ga0207659_10331958
1418 Ga0207659_10363531
1419 Ga0207659_10754171
1420 Ga0207687_10576268
1421 Ga0207687_10629434
1422 Ga0207687_10832417
1423 Ga0207700_10000591
1424 Ga0207700_10237217
1425 Ga0207664_10003718
1426 Ga0207664_10394321
1427 Ga0207664_10621643
1428 Ga0207644_10064468
1429 Ga0207644_10070613
1430 Ga0207644_10099529
1431 Ga0207644_10225941
1432 Ga0207644_10268220
1433 Ga0207644_10312927
1434 Ga0207644_11006732
1435 Ga0207690_10491144
1436 Ga0207690_10559851
1437 Ga0207690_10608911
1438 Ga0207706_10000319
1439 Ga0207706_10069387
1440 Ga0207706_10082679
1441 Ga0207706_10097416
1442 Ga0207706_10348437
1443 Ga0207670_10033381
1444 Ga0207670_10093579
1445 Ga0207670_10147068
1446 Ga0207670_10222976
1447 Ga0207670_10446648
1448 Ga0207669_10025044
1449 Ga0207669_10506468
1450 Ga0207704_10067572
1451 Ga0207704_10447147
1452 Ga0207704_11638560
1453 Ga0207665_10004517
1454 Ga0207665_10227289
1455 Ga0207665_10276067
1456 Ga0207665_10382794
1457 Ga0207665_10392876
1458 Ga0207665_10666232
1459 Ga0207665_10911474
1460 Ga0207665_11009782
1461 Ga0207691_10000755
1462 Ga0207691_10036169
1463 Ga0207691_10165579
1464 Ga0207691_10213764
1465 Ga0207691_10256104
1466 Ga0207691_10416897
1467 Ga0207691_10869330
1468 Ga0207691_11396694
1469 Ga0207711_10598998
1470 Ga0207689_10510384
1471 Ga0207661_10005051
1472 Ga0207661_10145646
1473 Ga0207661_10882091
1474 Ga0207679_10037791
1475 Ga0207679_10058243
1476 Ga0207679_10573801
1477 Ga0207679_10858486
1478 Ga0207679_10941133
1479 Ga0207667_10097258
1480 Ga0207667_10319951
1481 Ga0207667_11164029
1482 Ga0207651_10041037
1483 Ga0207651_10047324
1484 Ga0207651_10061750
1485 Ga0207651_10100818
1486 Ga0207651_10134547
1487 Ga0207668_10128990
1488 Ga0207668_10226678
1489 Ga0207668_10249681
1490 Ga0207668_10342268
1491 Ga0207668_10578235
1492 Ga0207658_10165662
1493 Ga0207658_10331319
1494 Ga0207677_10092870
1495 Ga0207677_10114132
1496 Ga0207677_10143011
1497 Ga0207677_10169294
1498 Ga0207677_10600199
1499 Ga0207677_10908157
1500 Ga0207703_10563021
1501 Ga0207703_10931423
1502 Ga0207678_10038441
1503 Ga0207678_10658965
1504 Ga0207678_11173716
1505 Ga0207708_10510540
1506 Ga0207702_10310685
1507 Ga0207641_10797050
1508 Ga0207648_10020404
1509 Ga0207648_10567675
1510 Ga0207648_10964309
1511 Ga0207674_10192520
1512 Ga0207675_100400683
1513 Ga0207683_10011524
1514 Ga0207683_10011820
1515 Ga0207683_10035810
1516 Ga0207683_10070982
1517 Ga0207683_10110697
1518 Ga0207698_10742173
1519 Ga0207698_11032372
1520 Ga0209974_10096553
1521 Ga0209974_10140081
1522 Ga0209974_10175667
1523 Ga0268266_10033613
1524 Ga0268266_10064117
1525 Ga0268266_10181484
1526 Ga0268266_10202602
1527 Ga0268266_10286567
1528 Ga0268266_10699683
1529 Ga0268266_10700535
1530 Ga0268265_10093856
1531 Ga0268264_10299243
1532 Ga0268264_10872290
1533 Ga0268264_12001924
1534 Ga0268264_12243714
1535 Ga0316576_10108790
1536 Ga0316593_10107590
1537 Ga0373958_0030460
1538 Ga0373928_0089950
1539 Ga0373940_0021483
1540 Ga0373952_0100436
1541 Ga0373936_0315040
1542 Ga0373939_0187759
1543 Ga0373945_0067675
1544 Ga0373943_0018840
1545 Ga0373943_0044583
1546 Ga0373943_0070077
1547 Ga0373943_0090231
1548 Ga0373946_0010703
1549 Ga0373946_0019211
1550 Ga0373946_0200457
1551 Ga0373955_0156605
1552 Ga0373955_0178040
1553 Ga0373955_0406413
1554 Ga0373942_0158412
1555 Ga0373931_0119110
1556 Ga0373931_0250238
1557 Ga0373931_0578567
1558 Ga0373935_0064959
1559 Ga0373935_0377188
1560 Ga0373935_0452111
1561 Ga0373927_0123317
1562 Ga0373927_0225964
1563 Ga0373927_0266784
1564 Ga0373933_0509422
1565 Ga0373933_1025779
1566 Ga0373947_0036291
1567 Ga0373947_0057534
1568 Ga0373947_0107175
1569 Ga0373947_0110674
1570 Ga0373947_0329970
1571 Ga0373947_0455715
1572 Ga0373947_0731509
1573 Ga0373937_0042304
1574 Ga0373937_0279538
1575 Ga0373937_1052856
1576 Ga0373937_1450149
1577 Ga0373925_0026753
1578 Ga0373925_0369618
1579 Ga0373925_0510263
1580 Ga0395900_0011491
1581 Ga0395900_0058044
1582 Ga0395900_0072849
1583 Ga0395900_1452085
1584 Ga0395898_0011791
1585 Ga0395898_0099131
1586 Ga0395898_1049029
1587 Ga0395905_0014347
1588 Ga0395901_0015822
1589 Ga0395901_0088299
1590 Ga0395901_0142063
1591 Ga0395901_0309580
1592 Ga0395901_1150789
1593 Ga0436363_0267184
1594 Ga0436363_1238186
1595 Ga0451802_0863359
1596 Ga0451802_2196682
1597 Ga0451804_0879523
1598 Ga0451853_3042968
1599 Ga0439455_0002551
1600 Ga0439455_0006406
1601 Ga0439460_0045158
1602 Ga0451576_0475849
1603 Ga0495638_0081240
1604 Ga0495580_0043124
1605 Ga0495662_0069679
1606 Ga0495584_0570414
1607 Ga0495608_0531947
1608 Ga0495628_0050039
1609 Ga0495630_0317251
1610 Ga0495666_0237207
1611 Ga0495642_0091125
1612 Ga0495652_0359642
1613 Ga0495640_0184648
1614 Ga0495645_0029956
1615 Ga0495667_0440163
1616 Ga0495635_0068706
1617 Ga0495599_0161345
1618 Ga0495599_0217672
1619 Ga0495623_0006311
1620 Ga0495646_0058413
1621 Ga0495647_0400201
1622 Ga0495658_0629599
1623 Ga0495669_0091057
1624 Ga0495604_0171860
1625 Ga0495672_0006214
1626 Ga0495676_1045709
1627 Ga0495675_0026242
1628 Ga0495684_0036139
1629 Ga0495602_0029117
1630 Ga0495614_0115275
1631 Ga0496100_0074357
1632 Ga0496101_0054819
1633 Ga0496101_0408303
1634 Ga0496102_0696909
1635 Ga0496102_1552336
1636 Ga0496103_0286996
1637 Ga0496104_0016892
1638 Ga0496104_0035068
1639 Ga0496104_0127977
1640 Ga0496104_0146196
1641 Ga0496104_0322126
1642 Ga0496104_0559137
1643 Ga0496104_1505414
1644 Ga0496105_0041691
1645 Ga0496105_0230590
1646 Ga0496105_0315524
1647 Ga0496105_0318634
1648 Ga0496105_0820124
1649 Ga0496106_0049744
1650 Ga0496106_0142657
1651 Ga0496106_0644158
1652 Ga0496106_1069046
1653 Ga0496107_1069982
1654 Ga0496108_0003452
1655 Ga0496108_0153486
1656 Ga0496108_0180716
1657 Ga0496108_0265715
1658 Ga0496108_0541928
1659 Ga0496108_0819853
1660 Ga0496109_0062924
1661 Ga0496109_0112637
1662 Ga0496109_0269523
1663 Ga0496109_0286947
1664 Ga0496109_0322424
1665 Ga0496109_0724478
1666 Ga0496110_0247049
1667 Ga0496112_0021562
1668 Ga0496112_0022287
1669 Ga0496112_0235656
1670 Ga0496112_1138414
1671 Ga0496112_1161398
1672 Ga0496112_1183879
1673 Ga0496113_0080549
1674 Ga0496113_0138782
1675 Ga0496113_0156209
1676 Ga0496113_0495197
1677 Ga0496113_0624925
1678 Ga0496113_1000699
1679 Ga0496114_0013929
1680 Ga0496115_0039345
1681 Ga0496115_0134517
1682 Ga0496115_0213799
1683 Ga0496115_0222068
1684 Ga0496115_0549071
1685 Ga0501036_0356250
1686 Ga0501036_1020183
1687 Ga0501076_0216148
1688 Ga0501079_0401573
1689 Ga0501080_0805377
1690 Ga0501081_0081063
1691 nmdc:mga03n38_226136_c1
1692 nmdc:mga00v17_230123_c1
1693 nmdc:mga0k408_87437_c1
1694 nmdc:mga06z11_18012_c1
1695 nmdc:mga06z11_218692_c1
1696 nmdc:mga04h51_13460_c1
1697 nmdc:mga05p37_20802_c1
1698 nmdc:mga05p37_266697_c1
1699 nmdc:mga05p37_350641_c1
1700 nmdc:mga05p37_457891_c1
1701 nmdc:mga05p37_72683_c1
1702 nmdc:mga09592_3647_c1
1703 nmdc:mga09592_877308_c1
1704 nmdc:mga0qj67_263074_c1
1705 nmdc:mga06r32_1017868_c1
1706 nmdc:mga06r32_211724_c1
1707 nmdc:mga08y16_1087376_c1
1708 nmdc:mga08y16_150788_c1
1709 nmdc:mga08y16_1657503_c1
1710 nmdc:mga08y16_17803_c1
1711 nmdc:mga0n895_1225647_c1
1712 nmdc:mga0n895_1938515_c1
1713 nmdc:mga0n895_310127_c1
1714 nmdc:mga0rr50_193852_c1
1715 nmdc:mga0rr50_490833_c1
1716 nmdc:mga0rr50_672050_c1
1717 nmdc:mga08x19_205404_c1
1718 nmdc:mga08x19_299740_c1
1719 nmdc:mga08x19_425247_c1
1720 nmdc:mga08x19_779750_c1
1721 nmdc:mga08x19_8060_c1
1722 nmdc:mga0a205_1366366_c1
1723 nmdc:mga0a205_1576551_c1
1724 nmdc:mga0a205_282133_c1
1725 nmdc:mga0a205_54716_c1
1726 Ga0495601_0725679
1727 Ga0495612_0009591
1728 Ga0500610_0141542
1729 Ga0500556_0042505
1730 Ga0500627_0078339
1731 Ga0587066_012382
1732 Ga0587073_0018867
1733 Ga0587082_018130
1734 Ga0587067_021711
1735 Ga0587072_030703
1736 Ga0587079_030593
1737 Ga0501082_0715075
1738 2787506932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

37

176

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.846 2 133
6a6f-assembly1.cif.gz_B crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 0.8459 6 132
4cdl-assembly1.cif.gz_A crystal structure of retro-aldolase ra110.4-6 complexed with inhibitor 1-(6-methoxy-2-naphthalenyl)-1,3-butanedione 0.8346 40 64
5uft-assembly1.cif.gz_A crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus 0.8318 5 133
1su0-assembly1.cif.gz_B crystal structure of a hypothetical protein at 2.3 a resolution 0.8205 6 134
ID Description Score Start End Superfamily
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8553 4 135 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8502 4 132 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8163 5 131 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.7987 4 132 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.7678 5 131 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2V5KWA8-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9007 30 146 GO:0005506
GO:0016226
GO:0051536
AF-A0A2V5YHZ1-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.8997 6 146 GO:0005506
GO:0016226
GO:0051536
AF-A0A6A5LCQ5-F1-model_v4 deleted 0.8981 9 133
AF-A0A2V5ZGS3-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.8956 1 149 GO:0005506
GO:0016226
GO:0051536
AF-A0A538NY57-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.8931 1 147 GO:0005506
GO:0016226
GO:0051536

Map