F483954
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 864 | 386 | 1728 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10002642|Ga0316576_100026427 |
| Length | 191 |
| Sequence | MTPVEPEPAATGSSPSPGAAWSGGVPRVGVGVDVHPLEARRPCWVAGLEWVDEPAGCAGHSDGDVAAHAACDALLSAAGLGDLGAVVGVDRPEWAGASGLALLTEVARVVRAAGFTIGNVAVQVVGNRPKIGRRRDEAQRAMRGAIGAPVSVSGTTTDGLGLTGRGEGLAAVATAIVWQVGRHEPTRADPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 91 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 144 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 148 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 149 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 162 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 163 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 166 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 167 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 192 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 198 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 199 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 200 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 205 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 206 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 207 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 280 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 281 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 282 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 330 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 331 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 335 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 336 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 337 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 338 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 339 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 340 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 341 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 342 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 343 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 344 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 345 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 346 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 347 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 348 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 349 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 350 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 351 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 352 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 353 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 354 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 355 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 356 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 357 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 358 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 359 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 360 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 361 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 362 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 363 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 364 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 365 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 366 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 367 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 368 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 369 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 370 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 371 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 372 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 373 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 374 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 375 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 376 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 377 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 378 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 379 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 380 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 381 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 382 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 383 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 384 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 385 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 386 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.06 |
| Metatranscriptomes | 0.93 |
| Isolates | 6.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.04 |
| Nodule | 1.5 |
| Rhizoplane | 3.24 |
| Rhizosphere | 89.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316576_10002642 | 3300031727 | Bacteria | 10232 |
| 2 | rootL2_10080448 | 3300003322 | Bacteria | 1391 |
| 3 | JGI25160J50197_1007531 | 3300003354 | Bacteria | 4248 |
| 4 | JGI25160J50197_1032024 | 3300003354 | Bacteria | 1342 |
| 5 | Ga0070658_10830260 | 3300005327 | Bacteria | 803 |
| 6 | Ga0070658_11357014 | 3300005327 | Bacteria | 617 |
| 7 | Ga0070676_10041165 | 3300005328 | Bacteria | 2677 |
| 8 | Ga0070683_100033689 | 3300005329 | Bacteria | 4671 |
| 9 | Ga0070683_100988027 | 3300005329 | Bacteria | 808 |
| 10 | Ga0068869_100323220 | 3300005334 | Bacteria | 1252 |
| 11 | Ga0068869_100832360 | 3300005334 | Bacteria | 795 |
| 12 | Ga0070680_100000378 | 3300005336 | Bacteria | 30108 |
| 13 | Ga0070680_100045649 | 3300005336 | Bacteria | 3563 |
| 14 | Ga0070680_100449082 | 3300005336 | Bacteria | 1101 |
| 15 | Ga0070682_100156247 | 3300005337 | Bacteria | 1570 |
| 16 | Ga0068868_100034712 | 3300005338 | Bacteria | 3895 |
| 17 | Ga0068868_101567650 | 3300005338 | Bacteria | 618 |
| 18 | Ga0070660_100223051 | 3300005339 | Bacteria | 1532 |
| 19 | Ga0070691_10667791 | 3300005341 | Bacteria | 620 |
| 20 | Ga0070692_10638090 | 3300005345 | Bacteria | 709 |
| 21 | Ga0070692_10952638 | 3300005345 | Bacteria | 597 |
| 22 | Ga0070668_100003731 | 3300005347 | Bacteria | 11233 |
| 23 | Ga0070668_100535101 | 3300005347 | Bacteria | 1018 |
| 24 | Ga0070675_100111557 | 3300005354 | Bacteria | 2314 |
| 25 | Ga0070671_100023038 | 3300005355 | Bacteria | 5090 |
| 26 | Ga0070671_101587299 | 3300005355 | Bacteria | 580 |
| 27 | Ga0070674_100373407 | 3300005356 | Bacteria | 1158 |
| 28 | Ga0070667_100941687 | 3300005367 | Bacteria | 805 |
| 29 | Ga0070709_10000441 | 3300005434 | Bacteria | 25152 |
| 30 | Ga0070709_10139223 | 3300005434 | Bacteria | 1665 |
| 31 | Ga0070714_100140905 | 3300005435 | Bacteria | 2164 |
| 32 | Ga0070714_100263272 | 3300005435 | Bacteria | 1597 |
| 33 | Ga0070713_100024518 | 3300005436 | Bacteria | 4700 |
| 34 | Ga0070713_100056965 | 3300005436 | Bacteria | 3252 |
| 35 | Ga0070713_100109446 | 3300005436 | Bacteria | 2407 |
| 36 | Ga0070713_100136995 | 3300005436 | Bacteria | 2164 |
| 37 | Ga0070710_10000167 | 3300005437 | Bacteria | 30282 |
| 38 | Ga0070711_100001149 | 3300005439 | Bacteria | 14217 |
| 39 | Ga0070711_100056367 | 3300005439 | Bacteria | 2717 |
| 40 | Ga0070711_100793247 | 3300005439 | Bacteria | 803 |
| 41 | Ga0070705_100060528 | 3300005440 | Bacteria | 2246 |
| 42 | Ga0070705_100309896 | 3300005440 | Bacteria | 1135 |
| 43 | Ga0070700_100046916 | 3300005441 | Bacteria | 2671 |
| 44 | Ga0070700_100416559 | 3300005441 | Bacteria | 1014 |
| 45 | Ga0070708_100059757 | 3300005445 | Bacteria | 3399 |
| 46 | Ga0070708_100067253 | 3300005445 | Bacteria | 3217 |
| 47 | Ga0070708_100918408 | 3300005445 | Bacteria | 822 |
| 48 | Ga0070681_10000248 | 3300005458 | Bacteria | 42924 |
| 49 | Ga0070685_10013217 | 3300005466 | Bacteria | 4349 |
| 50 | Ga0070706_100004020 | 3300005467 | Bacteria | 14287 |
| 51 | Ga0070706_100008150 | 3300005467 | Bacteria | 9773 |
| 52 | Ga0070706_100101329 | 3300005467 | Bacteria | 2676 |
| 53 | Ga0070706_100135209 | 3300005467 | Bacteria | 2301 |
| 54 | Ga0070706_100365372 | 3300005467 | Bacteria | 1344 |
| 55 | Ga0070706_100619557 | 3300005467 | Bacteria | 1005 |
| 56 | Ga0070706_100708518 | 3300005467 | Bacteria | 933 |
| 57 | Ga0070707_100000293 | 3300005468 | Bacteria | 49051 |
| 58 | Ga0070707_100005742 | 3300005468 | Bacteria | 11572 |
| 59 | Ga0070707_100010098 | 3300005468 | Bacteria | 8786 |
| 60 | Ga0070707_100017292 | 3300005468 | Bacteria | 6779 |
| 61 | Ga0070707_100623338 | 3300005468 | Bacteria | 1041 |
| 62 | Ga0070698_100000106 | 3300005471 | Bacteria | 69519 |
| 63 | Ga0070698_100007047 | 3300005471 | Bacteria | 12176 |
| 64 | Ga0070698_100018347 | 3300005471 | Bacteria | 7367 |
| 65 | Ga0070698_100019863 | 3300005471 | Bacteria | 7048 |
| 66 | Ga0070698_100727356 | 3300005471 | Bacteria | 935 |
| 67 | Ga0070679_100000157 | 3300005530 | Bacteria | 55087 |
| 68 | Ga0070679_100378751 | 3300005530 | Bacteria | 1362 |
| 69 | Ga0070684_100014045 | 3300005535 | Bacteria | 6475 |
| 70 | Ga0070684_100037584 | 3300005535 | Bacteria | 4155 |
| 71 | Ga0070684_100131557 | 3300005535 | Bacteria | 2257 |
| 72 | Ga0070684_100781987 | 3300005535 | Bacteria | 892 |
| 73 | Ga0070697_100132679 | 3300005536 | Bacteria | 2090 |
| 74 | Ga0070693_100133834 | 3300005547 | Bacteria | 1553 |
| 75 | Ga0070665_100003592 | 3300005548 | Bacteria | 16420 |
| 76 | Ga0070665_100345281 | 3300005548 | Bacteria | 1493 |
| 77 | Ga0068855_100045667 | 3300005563 | Bacteria | 5181 |
| 78 | Ga0068855_100656538 | 3300005563 | Bacteria | 1126 |
| 79 | Ga0068855_100909594 | 3300005563 | Bacteria | 929 |
| 80 | Ga0070664_100230859 | 3300005564 | Bacteria | 1659 |
| 81 | Ga0070664_100530887 | 3300005564 | Bacteria | 1087 |
| 82 | Ga0068857_100101178 | 3300005577 | Bacteria | 2586 |
| 83 | Ga0068857_100634179 | 3300005577 | Bacteria | 1012 |
| 84 | Ga0068857_101146938 | 3300005577 | Bacteria | 751 |
| 85 | Ga0068854_100035390 | 3300005578 | Bacteria | 3495 |
| 86 | Ga0068856_100066806 | 3300005614 | Bacteria | 3553 |
| 87 | Ga0068856_100927479 | 3300005614 | Bacteria | 889 |
| 88 | Ga0068852_101473416 | 3300005616 | Bacteria | 703 |
| 89 | Ga0068859_100000014 | 3300005617 | Bacteria | 280955 |
| 90 | Ga0068859_100440453 | 3300005617 | Bacteria | 1399 |
| 91 | Ga0068864_100411244 | 3300005618 | Bacteria | 1287 |
| 92 | Ga0068861_100208166 | 3300005719 | Bacteria | 1646 |
| 93 | Ga0068861_100742113 | 3300005719 | Bacteria | 916 |
| 94 | Ga0068870_10245700 | 3300005840 | Bacteria | 1107 |
| 95 | Ga0068870_10330077 | 3300005840 | Bacteria | 972 |
| 96 | Ga0068863_100001561 | 3300005841 | Bacteria | 22636 |
| 97 | Ga0068863_100518828 | 3300005841 | Bacteria | 1175 |
| 98 | Ga0068863_100660614 | 3300005841 | Bacteria | 1037 |
| 99 | Ga0068858_100000988 | 3300005842 | Bacteria | 29336 |
| 100 | Ga0068858_100098622 | 3300005842 | Bacteria | 2724 |
| 101 | Ga0068858_100128337 | 3300005842 | Bacteria | 2376 |
| 102 | Ga0068858_100999291 | 3300005842 | Bacteria | 820 |
| 103 | Ga0068860_100220675 | 3300005843 | Bacteria | 1841 |
| 104 | Ga0068862_100000026 | 3300005844 | Bacteria | 194499 |
| 105 | Ga0068862_100273324 | 3300005844 | Bacteria | 1546 |
| 106 | Ga0081455_10340559 | 3300005937 | Bacteria | 1061 |
| 107 | Ga0081455_10622525 | 3300005937 | Bacteria | 700 |
| 108 | Ga0081540_1001613 | 3300005983 | Bacteria | 19226 |
| 109 | Ga0081540_1018566 | 3300005983 | Bacteria | 4260 |
| 110 | Ga0081540_1053918 | 3300005983 | Bacteria | 1968 |
| 111 | Ga0070717_10019735 | 3300006028 | Bacteria | 5291 |
| 112 | Ga0070717_10026460 | 3300006028 | Bacteria | 4627 |
| 113 | Ga0070717_10030210 | 3300006028 | Bacteria | 4353 |
| 114 | Ga0070717_10147018 | 3300006028 | Bacteria | 2036 |
| 115 | Ga0070717_10434658 | 3300006028 | Bacteria | 1181 |
| 116 | Ga0070717_10678247 | 3300006028 | Bacteria | 936 |
| 117 | Ga0070715_10041187 | 3300006163 | Bacteria | 1934 |
| 118 | Ga0070715_10060863 | 3300006163 | Bacteria | 1657 |
| 119 | Ga0070716_100047672 | 3300006173 | Bacteria | 2418 |
| 120 | Ga0070716_100177436 | 3300006173 | Bacteria | 1396 |
| 121 | Ga0070712_100030922 | 3300006175 | Bacteria | 3603 |
| 122 | Ga0070712_100074524 | 3300006175 | Bacteria | 2438 |
| 123 | Ga0070712_100231617 | 3300006175 | Bacteria | 1467 |
| 124 | Ga0070712_100240806 | 3300006175 | Bacteria | 1441 |
| 125 | Ga0070712_100644711 | 3300006175 | Bacteria | 899 |
| 126 | Ga0097621_100307456 | 3300006237 | Bacteria | 1402 |
| 127 | Ga0097621_100832032 | 3300006237 | Bacteria | 857 |
| 128 | Ga0075370_10513327 | 3300006353 | Bacteria | 724 |
| 129 | Ga0068871_100070094 | 3300006358 | Bacteria | 2881 |
| 130 | Ga0075428_100034513 | 3300006844 | Bacteria | 5579 |
| 131 | Ga0075428_100118780 | 3300006844 | Bacteria | 2879 |
| 132 | Ga0075428_100119380 | 3300006844 | Bacteria | 2871 |
| 133 | Ga0075428_100754583 | 3300006844 | Bacteria | 1035 |
| 134 | Ga0075430_100001268 | 3300006846 | Bacteria | 20341 |
| 135 | Ga0075433_10033010 | 3300006852 | Bacteria | 4436 |
| 136 | Ga0075434_100072963 | 3300006871 | Bacteria | 3424 |
| 137 | Ga0075434_100083829 | 3300006871 | Bacteria | 3186 |
| 138 | Ga0075434_100235372 | 3300006871 | Bacteria | 1851 |
| 139 | Ga0075429_100056417 | 3300006880 | Bacteria | 3419 |
| 140 | Ga0075429_100347609 | 3300006880 | Bacteria | 1298 |
| 141 | Ga0075436_100011256 | 3300006914 | Bacteria | 6136 |
| 142 | Ga0097620_100000014 | 3300006931 | Bacteria | 280955 |
| 143 | Ga0097620_100440501 | 3300006931 | Bacteria | 1399 |
| 144 | Ga0097620_101893390 | 3300006931 | Bacteria | 659 |
| 145 | Ga0075435_100083841 | 3300007076 | Bacteria | 2621 |
| 146 | Ga0075435_101007016 | 3300007076 | Bacteria | 727 |
| 147 | Ga0105240_10788943 | 3300009093 | Bacteria | 1030 |
| 148 | Ga0105240_11732384 | 3300009093 | Bacteria | 652 |
| 149 | Ga0111539_10015815 | 3300009094 | Bacteria | 9372 |
| 150 | Ga0105245_10179266 | 3300009098 | Bacteria | 2023 |
| 151 | Ga0105245_10260627 | 3300009098 | Bacteria | 1687 |
| 152 | Ga0105247_10002241 | 3300009101 | Bacteria | 13301 |
| 153 | Ga0105247_10252732 | 3300009101 | Bacteria | 1205 |
| 154 | Ga0114129_10011093 | 3300009147 | Bacteria | 12838 |
| 155 | Ga0114129_10369545 | 3300009147 | Bacteria | 1896 |
| 156 | Ga0114129_10416511 | 3300009147 | Bacteria | 1768 |
| 157 | Ga0114129_11413429 | 3300009147 | Bacteria | 858 |
| 158 | Ga0105241_10285913 | 3300009174 | Bacteria | 1410 |
| 159 | Ga0105242_10026296 | 3300009176 | Bacteria | 4612 |
| 160 | Ga0105248_10000023 | 3300009177 | Bacteria | 264241 |
| 161 | Ga0105249_10959429 | 3300009553 | Bacteria | 923 |
| 162 | Ga0105239_10031946 | 3300010375 | Bacteria | 5784 |
| 163 | Ga0157371_10741787 | 3300013102 | Bacteria | 737 |
| 164 | Ga0157370_10054444 | 3300013104 | Bacteria | 3814 |
| 165 | Ga0157369_10134948 | 3300013105 | Bacteria | 2613 |
| 166 | Ga0157369_11350249 | 3300013105 | Bacteria | 726 |
| 167 | Ga0157374_10035799 | 3300013296 | Bacteria | 4543 |
| 168 | Ga0157378_11451665 | 3300013297 | Bacteria | 730 |
| 169 | Ga0157372_10212112 | 3300013307 | Bacteria | 2244 |
| 170 | Ga0157372_10425825 | 3300013307 | Bacteria | 1547 |
| 171 | Ga0157372_10510965 | 3300013307 | Bacteria | 1401 |
| 172 | Ga0157372_10726498 | 3300013307 | Bacteria | 1155 |
| 173 | Ga0163163_10014092 | 3300014325 | Bacteria | 7341 |
| 174 | Ga0163163_10075078 | 3300014325 | Bacteria | 3374 |
| 175 | Ga0157379_10000591 | 3300014968 | Bacteria | 29342 |
| 176 | Ga0157379_10013216 | 3300014968 | Bacteria | 7230 |
| 177 | Ga0157379_10266661 | 3300014968 | Bacteria | 1557 |
| 178 | Ga0157376_10055825 | 3300014969 | Bacteria | 3297 |
| 179 | Ga0206356_11141531 | 3300020070 | Bacteria | 1167 |
| 180 | Ga0206353_10914106 | 3300020082 | Bacteria | 1304 |
| 181 | Ga0224712_10086688 | 3300022467 | Bacteria | 1303 |
| 182 | Ga0224572_1030548 | 3300024225 | Bacteria | 1029 |
| 183 | Ga0207426_1006879 | 3300025302 | Bacteria | 4850 |
| 184 | Ga0207426_1023061 | 3300025302 | Bacteria | 2128 |
| 185 | Ga0207426_1085890 | 3300025302 | Bacteria | 843 |
| 186 | Ga0207692_10824581 | 3300025898 | Bacteria | 607 |
| 187 | Ga0207710_10000063 | 3300025900 | Bacteria | 163065 |
| 188 | Ga0207685_10114534 | 3300025905 | Bacteria | 1174 |
| 189 | Ga0207699_10002656 | 3300025906 | Bacteria | 8440 |
| 190 | Ga0207699_10071582 | 3300025906 | Bacteria | 2121 |
| 191 | Ga0207705_10000348 | 3300025909 | Bacteria | 41776 |
| 192 | Ga0207705_10293472 | 3300025909 | Bacteria | 1246 |
| 193 | Ga0207705_11029655 | 3300025909 | Bacteria | 636 |
| 194 | Ga0207705_11207974 | 3300025909 | Bacteria | 580 |
| 195 | Ga0207684_10000571 | 3300025910 | Bacteria | 44831 |
| 196 | Ga0207684_10007405 | 3300025910 | Bacteria | 9884 |
| 197 | Ga0207684_10014224 | 3300025910 | Bacteria | 6868 |
| 198 | Ga0207684_10019030 | 3300025910 | Bacteria | 5874 |
| 199 | Ga0207684_10115821 | 3300025910 | Bacteria | 2296 |
| 200 | Ga0207684_10217467 | 3300025910 | Bacteria | 1649 |
| 201 | Ga0207654_10063304 | 3300025911 | Bacteria | 2170 |
| 202 | Ga0207707_10000447 | 3300025912 | Bacteria | 42935 |
| 203 | Ga0207671_10116320 | 3300025914 | Bacteria | 2039 |
| 204 | Ga0207671_10578103 | 3300025914 | Bacteria | 896 |
| 205 | Ga0207693_10050689 | 3300025915 | Bacteria | 3259 |
| 206 | Ga0207693_10068335 | 3300025915 | Bacteria | 2781 |
| 207 | Ga0207693_10146872 | 3300025915 | Bacteria | 1854 |
| 208 | Ga0207693_10280689 | 3300025915 | Bacteria | 1305 |
| 209 | Ga0207693_10414351 | 3300025915 | Bacteria | 1053 |
| 210 | Ga0207663_10001400 | 3300025916 | Bacteria | 11181 |
| 211 | Ga0207663_10077291 | 3300025916 | Bacteria | 2166 |
| 212 | Ga0207663_10679173 | 3300025916 | Bacteria | 814 |
| 213 | Ga0207660_10000102 | 3300025917 | Bacteria | 47733 |
| 214 | Ga0207660_10032415 | 3300025917 | Bacteria | 3607 |
| 215 | Ga0207660_10593741 | 3300025917 | Bacteria | 902 |
| 216 | Ga0207660_11035537 | 3300025917 | Bacteria | 669 |
| 217 | Ga0207657_10045026 | 3300025919 | Bacteria | 3876 |
| 218 | Ga0207649_11061553 | 3300025920 | Bacteria | 638 |
| 219 | Ga0207652_10000182 | 3300025921 | Bacteria | 66390 |
| 220 | Ga0207652_11277800 | 3300025921 | Bacteria | 636 |
| 221 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 222 | Ga0207646_10001770 | 3300025922 | Bacteria | 26156 |
| 223 | Ga0207646_10010918 | 3300025922 | Bacteria | 8823 |
| 224 | Ga0207646_10011667 | 3300025922 | Bacteria | 8497 |
| 225 | Ga0207646_10036233 | 3300025922 | Bacteria | 4454 |
| 226 | Ga0207659_10156377 | 3300025926 | Bacteria | 1785 |
| 227 | Ga0207687_10212399 | 3300025927 | Bacteria | 1519 |
| 228 | Ga0207700_10020409 | 3300025928 | Bacteria | 4500 |
| 229 | Ga0207700_10043799 | 3300025928 | Bacteria | 3290 |
| 230 | Ga0207700_10049497 | 3300025928 | Bacteria | 3126 |
| 231 | Ga0207700_10196509 | 3300025928 | Bacteria | 1697 |
| 232 | Ga0207700_10545446 | 3300025928 | Bacteria | 1029 |
| 233 | Ga0207700_10559077 | 3300025928 | Bacteria | 1016 |
| 234 | Ga0207664_10006510 | 3300025929 | Bacteria | 8038 |
| 235 | Ga0207664_10016910 | 3300025929 | Bacteria | 5334 |
| 236 | Ga0207664_10024264 | 3300025929 | Bacteria | 4556 |
| 237 | Ga0207664_10082736 | 3300025929 | Bacteria | 2615 |
| 238 | Ga0207664_10263843 | 3300025929 | Bacteria | 1507 |
| 239 | Ga0207664_10275815 | 3300025929 | Bacteria | 1474 |
| 240 | Ga0207664_10321133 | 3300025929 | Bacteria | 1366 |
| 241 | Ga0207664_10719683 | 3300025929 | Bacteria | 898 |
| 242 | Ga0207644_10039981 | 3300025931 | Bacteria | 3312 |
| 243 | Ga0207690_10093644 | 3300025932 | Bacteria | 2129 |
| 244 | Ga0207690_10799248 | 3300025932 | Bacteria | 779 |
| 245 | Ga0207669_10336888 | 3300025937 | Bacteria | 1160 |
| 246 | Ga0207665_10005907 | 3300025939 | Bacteria | 8148 |
| 247 | Ga0207665_10056110 | 3300025939 | Bacteria | 2659 |
| 248 | Ga0207711_10008340 | 3300025941 | Bacteria | 8672 |
| 249 | Ga0207689_10024235 | 3300025942 | Bacteria | 5092 |
| 250 | Ga0207689_10750024 | 3300025942 | Bacteria | 824 |
| 251 | Ga0207689_11297907 | 3300025942 | Bacteria | 612 |
| 252 | Ga0207661_10024459 | 3300025944 | Bacteria | 4579 |
| 253 | Ga0207661_10065601 | 3300025944 | Bacteria | 2948 |
| 254 | Ga0207661_10141014 | 3300025944 | Bacteria | 2074 |
| 255 | Ga0207679_10217579 | 3300025945 | Bacteria | 1605 |
| 256 | Ga0207679_11057190 | 3300025945 | Bacteria | 744 |
| 257 | Ga0207667_10531724 | 3300025949 | Bacteria | 1190 |
| 258 | Ga0207667_10848359 | 3300025949 | Bacteria | 908 |
| 259 | Ga0207667_10989708 | 3300025949 | Bacteria | 829 |
| 260 | Ga0207712_10011761 | 3300025961 | Bacteria | 5579 |
| 261 | Ga0207712_10483478 | 3300025961 | Bacteria | 1056 |
| 262 | Ga0207668_10008602 | 3300025972 | Bacteria | 6093 |
| 263 | Ga0207668_10017092 | 3300025972 | Bacteria | 4539 |
| 264 | Ga0207668_10058268 | 3300025972 | Bacteria | 2699 |
| 265 | Ga0207668_10341457 | 3300025972 | Bacteria | 1249 |
| 266 | Ga0207640_10510809 | 3300025981 | Bacteria | 1002 |
| 267 | Ga0207658_10077365 | 3300025986 | Bacteria | 2538 |
| 268 | Ga0207677_10189568 | 3300026023 | Bacteria | 1625 |
| 269 | Ga0207677_10246824 | 3300026023 | Bacteria | 1447 |
| 270 | Ga0207703_10000177 | 3300026035 | Bacteria | 74044 |
| 271 | Ga0207703_10092098 | 3300026035 | Bacteria | 2551 |
| 272 | Ga0207678_10402313 | 3300026067 | Bacteria | 1186 |
| 273 | Ga0207678_11039196 | 3300026067 | Bacteria | 725 |
| 274 | Ga0207708_10046225 | 3300026075 | Bacteria | 3315 |
| 275 | Ga0207708_10428322 | 3300026075 | Bacteria | 1098 |
| 276 | Ga0207702_10008591 | 3300026078 | Bacteria | 8612 |
| 277 | Ga0207702_10073374 | 3300026078 | Bacteria | 2950 |
| 278 | Ga0207641_10001246 | 3300026088 | Bacteria | 25381 |
| 279 | Ga0207641_10489966 | 3300026088 | Bacteria | 1192 |
| 280 | Ga0207641_11844219 | 3300026088 | Bacteria | 606 |
| 281 | Ga0207676_10020765 | 3300026095 | Bacteria | 4809 |
| 282 | Ga0207676_10124276 | 3300026095 | Bacteria | 2182 |
| 283 | Ga0207674_10093078 | 3300026116 | Bacteria | 3003 |
| 284 | Ga0207674_10421863 | 3300026116 | Bacteria | 1289 |
| 285 | Ga0207674_10461013 | 3300026116 | Bacteria | 1228 |
| 286 | Ga0207675_100440936 | 3300026118 | Bacteria | 1289 |
| 287 | Ga0207683_10046419 | 3300026121 | Bacteria | 3801 |
| 288 | Ga0207683_10613999 | 3300026121 | Bacteria | 1007 |
| 289 | Ga0207683_11229930 | 3300026121 | Bacteria | 694 |
| 290 | Ga0207698_10005031 | 3300026142 | Bacteria | 8107 |
| 291 | Ga0207698_10199535 | 3300026142 | Bacteria | 1790 |
| 292 | Ga0207698_10992746 | 3300026142 | Bacteria | 850 |
| 293 | Ga0207428_10080588 | 3300027907 | Bacteria | 2543 |
| 294 | Ga0207428_10147382 | 3300027907 | Bacteria | 1793 |
| 295 | Ga0268266_10010672 | 3300028379 | Bacteria | 8006 |
| 296 | Ga0268266_11405046 | 3300028379 | Bacteria | 673 |
| 297 | Ga0268265_10000167 | 3300028380 | Bacteria | 80076 |
| 298 | Ga0268265_10222941 | 3300028380 | Bacteria | 1651 |
| 299 | Ga0268265_10526864 | 3300028380 | Bacteria | 1118 |
| 300 | Ga0268265_11177587 | 3300028380 | Bacteria | 763 |
| 301 | Ga0268265_11560763 | 3300028380 | Bacteria | 665 |
| 302 | Ga0268264_10189272 | 3300028381 | Bacteria | 1875 |
| 303 | Ga0265336_10014847 | 3300028666 | Bacteria | 2573 |
| 304 | Ga0265338_10001588 | 3300028800 | Bacteria | 36478 |
| 305 | Ga0307511_10000924 | 3300030521 | Bacteria | 31060 |
| 306 | Ga0316181_1259639 | 3300030744 | Bacteria | 2042 |
| 307 | Ga0316182_1047903 | 3300030745 | Bacteria | 882 |
| 308 | Ga0307509_10080166 | 3300031507 | Bacteria | 3377 |
| 309 | Ga0307408_100102913 | 3300031548 | Bacteria | 2179 |
| 310 | Ga0307508_10008805 | 3300031616 | Bacteria | 9311 |
| 311 | Ga0316578_10086854 | 3300031728 | Bacteria | 1865 |
| 312 | Ga0307516_10312573 | 3300031730 | Bacteria | 1244 |
| 313 | Ga0307405_10021951 | 3300031731 | Bacteria | 3599 |
| 314 | Ga0307405_10092100 | 3300031731 | Bacteria | 2010 |
| 315 | Ga0307413_11261712 | 3300031824 | Bacteria | 645 |
| 316 | Ga0307410_10002324 | 3300031852 | Bacteria | 9141 |
| 317 | Ga0307406_10013416 | 3300031901 | Bacteria | 4693 |
| 318 | Ga0307406_10129409 | 3300031901 | Bacteria | 1769 |
| 319 | Ga0307406_10170601 | 3300031901 | Bacteria | 1574 |
| 320 | Ga0307406_10329638 | 3300031901 | Bacteria | 1184 |
| 321 | Ga0307407_10016132 | 3300031903 | Bacteria | 3711 |
| 322 | Ga0307412_10117616 | 3300031911 | Bacteria | 1908 |
| 323 | Ga0307409_100002175 | 3300031995 | Bacteria | 10114 |
| 324 | Ga0307409_100214905 | 3300031995 | Bacteria | 1731 |
| 325 | Ga0307409_100830985 | 3300031995 | Bacteria | 933 |
| 326 | Ga0307416_100001592 | 3300032002 | Bacteria | 12462 |
| 327 | Ga0307416_100816414 | 3300032002 | Bacteria | 1029 |
| 328 | Ga0307416_100890291 | 3300032002 | Bacteria | 990 |
| 329 | Ga0307414_10142211 | 3300032004 | Bacteria | 1880 |
| 330 | Ga0307411_10542842 | 3300032005 | Bacteria | 990 |
| 331 | Ga0307415_100163451 | 3300032126 | Bacteria | 1728 |
| 332 | Ga0307415_100196679 | 3300032126 | Bacteria | 1596 |
| 333 | Ga0307415_100248294 | 3300032126 | Bacteria | 1444 |
| 334 | Ga0316583_10031368 | 3300032133 | Bacteria | 1892 |
| 335 | Ga0316585_10031802 | 3300032137 | Bacteria | 1660 |
| 336 | Ga0316593_10033826 | 3300032168 | Bacteria | 1675 |
| 337 | Ga0316596_1059218 | 3300033541 | Bacteria | 1021 |
| 338 | Ga0373948_0045068 | 3300034817 | Bacteria | 933 |
| 339 | Ga0373950_0019988 | 3300034818 | Bacteria | 1174 |
| 340 | Ga0373938_0001351 | 3300034957 | Bacteria | 3933 |
| 341 | Ga0373938_0024287 | 3300034957 | Bacteria | 1252 |
| 342 | Ga0373926_0138080 | 3300035083 | Bacteria | 925 |
| 343 | Ga0373934_0005701 | 3300035086 | Bacteria | 4610 |
| 344 | Ga0373934_0021260 | 3300035086 | Bacteria | 2498 |
| 345 | Ga0373934_0045353 | 3300035086 | Bacteria | 1738 |
| 346 | Ga0373934_0080975 | 3300035086 | Bacteria | 1304 |
| 347 | Ga0373934_0148505 | 3300035086 | Bacteria | 959 |
| 348 | Ga0373940_0012484 | 3300035088 | Bacteria | 2035 |
| 349 | Ga0373940_0019963 | 3300035088 | Bacteria | 1698 |
| 350 | Ga0373949_0109638 | 3300035090 | Bacteria | 765 |
| 351 | Ga0373923_0010543 | 3300035111 | Bacteria | 3365 |
| 352 | Ga0373923_0048506 | 3300035111 | Bacteria | 1773 |
| 353 | Ga0373932_0034341 | 3300035112 | Bacteria | 1428 |
| 354 | Ga0373936_0057934 | 3300035113 | Bacteria | 1576 |
| 355 | Ga0373936_0060812 | 3300035113 | Bacteria | 1541 |
| 356 | Ga0373939_0147077 | 3300035114 | Bacteria | 854 |
| 357 | Ga0373945_0070583 | 3300035116 | Bacteria | 1321 |
| 358 | Ga0373945_0086228 | 3300035116 | Bacteria | 1210 |
| 359 | Ga0373945_0370729 | 3300035116 | Bacteria | 623 |
| 360 | Ga0373953_0030538 | 3300035117 | Bacteria | 2090 |
| 361 | Ga0373953_0075136 | 3300035117 | Bacteria | 1398 |
| 362 | Ga0373954_0025119 | 3300035118 | Bacteria | 2722 |
| 363 | Ga0373954_0029298 | 3300035118 | Bacteria | 2534 |
| 364 | Ga0373954_0420087 | 3300035118 | Bacteria | 661 |
| 365 | Ga0373956_0016570 | 3300035119 | Bacteria | 3096 |
| 366 | Ga0373957_0003290 | 3300035120 | Bacteria | 4758 |
| 367 | Ga0373957_0043046 | 3300035120 | Bacteria | 1705 |
| 368 | Ga0373943_0138393 | 3300035170 | Bacteria | 1309 |
| 369 | Ga0373943_0215829 | 3300035170 | Bacteria | 1067 |
| 370 | Ga0373943_0358612 | 3300035170 | Bacteria | 836 |
| 371 | Ga0373955_0001996 | 3300035172 | Bacteria | 8807 |
| 372 | Ga0373955_0028116 | 3300035172 | Bacteria | 2913 |
| 373 | Ga0373955_0051109 | 3300035172 | Bacteria | 2250 |
| 374 | Ga0373955_0174813 | 3300035172 | Bacteria | 1272 |
| 375 | Ga0373942_0004639 | 3300035207 | Bacteria | 3185 |
| 376 | Ga0373962_0007476 | 3300035242 | Bacteria | 2677 |
| 377 | Ga0373924_0001561 | 3300035410 | Bacteria | 7480 |
| 378 | Ga0373924_0004802 | 3300035410 | Bacteria | 4748 |
| 379 | Ga0373924_0013989 | 3300035410 | Bacteria | 3024 |
| 380 | Ga0373924_0015890 | 3300035410 | Bacteria | 2867 |
| 381 | Ga0373935_0027621 | 3300035692 | Bacteria | 3508 |
| 382 | Ga0373935_0073817 | 3300035692 | Bacteria | 2204 |
| 383 | Ga0373935_0097858 | 3300035692 | Bacteria | 1930 |
| 384 | Ga0373935_0244850 | 3300035692 | Bacteria | 1253 |
| 385 | Ga0373935_0428118 | 3300035692 | Bacteria | 953 |
| 386 | Ga0373927_0097232 | 3300035695 | Bacteria | 1914 |
| 387 | Ga0373927_0272400 | 3300035695 | Bacteria | 1113 |
| 388 | Ga0373927_0412279 | 3300035695 | Bacteria | 891 |
| 389 | Ga0373933_0030947 | 3300035724 | Bacteria | 3101 |
| 390 | Ga0373933_0053445 | 3300035724 | Bacteria | 2419 |
| 391 | Ga0373933_0095274 | 3300035724 | Bacteria | 1841 |
| 392 | Ga0373947_0068874 | 3300035725 | Bacteria | 2165 |
| 393 | Ga0373947_0112435 | 3300035725 | Bacteria | 1722 |
| 394 | Ga0373947_0116750 | 3300035725 | Bacteria | 1692 |
| 395 | Ga0373947_0162064 | 3300035725 | Bacteria | 1447 |
| 396 | Ga0373947_0846423 | 3300035725 | Bacteria | 624 |
| 397 | Ga0373937_0003111 | 3300036401 | Bacteria | 13875 |
| 398 | Ga0373937_0035586 | 3300036401 | Bacteria | 4533 |
| 399 | Ga0373937_0038368 | 3300036401 | Bacteria | 4364 |
| 400 | Ga0373937_0104665 | 3300036401 | Bacteria | 2629 |
| 401 | Ga0373937_0153395 | 3300036401 | Bacteria | 2158 |
| 402 | Ga0373937_0409504 | 3300036401 | Bacteria | 1286 |
| 403 | Ga0372808_010553 | 3300036459 | Bacteria | 1301 |
| 404 | Ga0316584_0597659 | 3300036712 | Bacteria | 765 |
| 405 | Ga0373925_0022330 | 3300037068 | Bacteria | 4615 |
| 406 | Ga0373925_0075923 | 3300037068 | Bacteria | 2547 |
| 407 | Ga0373925_0097651 | 3300037068 | Bacteria | 2253 |
| 408 | Ga0373925_0163570 | 3300037068 | Bacteria | 1754 |
| 409 | Ga0373925_0482750 | 3300037068 | Bacteria | 1016 |
| 410 | Ga0373925_0565430 | 3300037068 | Bacteria | 935 |
| 411 | Ga0395905_0216764 | 3300037471 | Bacteria | 1792 |
| 412 | Ga0436364_0138124 | 3300037853 | Bacteria | 7843 |
| 413 | Ga0436364_0442522 | 3300037853 | Bacteria | 713 |
| 414 | Ga0436365_1035924 | 3300039437 | Bacteria | 1013 |
| 415 | Ga0439436_0004676 | 3300041404 | Bacteria | 4199 |
| 416 | Ga0439438_007646 | 3300041405 | Bacteria | 3670 |
| 417 | Ga0439439_0002938 | 3300041406 | Bacteria | 3701 |
| 418 | Ga0451845_0546170 | 3300041501 | Bacteria | 1171 |
| 419 | Ga0451853_1630264 | 3300041512 | Bacteria | 1477 |
| 420 | Ga0439448_0155724 | 3300042005 | Bacteria | 794 |
| 421 | Ga0439449_0003010 | 3300042007 | Bacteria | 6575 |
| 422 | Ga0439450_064216 | 3300042008 | Unclassified | 892 |
| 423 | Ga0439457_002873 | 3300042014 | Bacteria | 4799 |
| 424 | Ga0450906_037508 | 3300042145 | Bacteria | 855 |
| 425 | Ga0450907_021556 | 3300042146 | Bacteria | 1084 |
| 426 | Ga0439464_0195325 | 3300042439 | Bacteria | 644 |
| 427 | Ga0466969_0034210 | 3300044656 | Bacteria | 2575 |
| 428 | Ga0466972_0351811 | 3300044658 | Bacteria | 689 |
| 429 | Ga0466965_0084407 | 3300044683 | Bacteria | 1609 |
| 430 | Ga0466965_0627195 | 3300044683 | Bacteria | 612 |
| 431 | Ga0466966_0008603 | 3300044684 | Bacteria | 6757 |
| 432 | Ga0466966_0058021 | 3300044684 | Bacteria | 2447 |
| 433 | Ga0466966_0148381 | 3300044684 | Bacteria | 1431 |
| 434 | Ga0466961_0103869 | 3300044693 | Bacteria | 1789 |
| 435 | Ga0466961_0213071 | 3300044693 | Bacteria | 1192 |
| 436 | Ga0466961_0230460 | 3300044693 | Bacteria | 1140 |
| 437 | Ga0466961_0929049 | 3300044693 | Bacteria | 518 |
| 438 | Ga0466963_0020181 | 3300044694 | Bacteria | 4189 |
| 439 | Ga0466963_0232742 | 3300044694 | Bacteria | 1291 |
| 440 | Ga0466963_1035374 | 3300044694 | Bacteria | 578 |
| 441 | Ga0466971_0129872 | 3300044719 | Bacteria | 1169 |
| 442 | Ga0466971_0135183 | 3300044719 | Bacteria | 1146 |
| 443 | Ga0466971_0164182 | 3300044719 | Bacteria | 1040 |
| 444 | Ga0466970_0029810 | 3300044765 | Bacteria | 2876 |
| 445 | Ga0466957_0057195 | 3300044842 | Bacteria | 2386 |
| 446 | Ga0466957_0071149 | 3300044842 | Bacteria | 2151 |
| 447 | Ga0466957_0102417 | 3300044842 | Bacteria | 1806 |
| 448 | Ga0466959_0052176 | 3300045049 | Bacteria | 2996 |
| 449 | Ga0466959_0167846 | 3300045049 | Bacteria | 1540 |
| 450 | Ga0466959_0178549 | 3300045049 | Bacteria | 1486 |
| 451 | Ga0466958_0024286 | 3300045836 | Bacteria | 3566 |
| 452 | Ga0466958_0237509 | 3300045836 | Bacteria | 1164 |
| 453 | Ga0466967_0045855 | 3300045976 | Bacteria | 3802 |
| 454 | Ga0466967_0059629 | 3300045976 | Bacteria | 3379 |
| 455 | Ga0466967_0263618 | 3300045976 | Bacteria | 1649 |
| 456 | Ga0466967_0451821 | 3300045976 | Bacteria | 1256 |
| 457 | Ga0466967_0481497 | 3300045976 | Bacteria | 1216 |
| 458 | Ga0466967_0514767 | 3300045976 | Bacteria | 1175 |
| 459 | Ga0495592_0020623 | 3300046454 | Bacteria | 5015 |
| 460 | Ga0495592_0040596 | 3300046454 | Bacteria | 3491 |
| 461 | Ga0495592_0080032 | 3300046454 | Bacteria | 2364 |
| 462 | Ga0495629_0010288 | 3300046459 | Bacteria | 6813 |
| 463 | Ga0495629_0016085 | 3300046459 | Bacteria | 5374 |
| 464 | Ga0495629_0234605 | 3300046459 | Bacteria | 1264 |
| 465 | Ga0495629_0291550 | 3300046459 | Bacteria | 1118 |
| 466 | Ga0495629_0538606 | 3300046459 | Bacteria | 784 |
| 467 | Ga0495641_0022020 | 3300046461 | Bacteria | 3197 |
| 468 | Ga0495641_0040560 | 3300046461 | Bacteria | 2164 |
| 469 | Ga0495641_0100960 | 3300046461 | Bacteria | 1287 |
| 470 | Ga0495641_0164049 | 3300046461 | Bacteria | 994 |
| 471 | Ga0495651_0013776 | 3300046462 | Bacteria | 6252 |
| 472 | Ga0495651_0023559 | 3300046462 | Bacteria | 4786 |
| 473 | Ga0495651_0045682 | 3300046462 | Bacteria | 3392 |
| 474 | Ga0495651_0413952 | 3300046462 | Bacteria | 877 |
| 475 | Ga0495653_0004085 | 3300046463 | Bacteria | 11805 |
| 476 | Ga0495653_0099959 | 3300046463 | Bacteria | 2103 |
| 477 | Ga0495653_0118950 | 3300046463 | Bacteria | 1886 |
| 478 | Ga0495653_0148784 | 3300046463 | Bacteria | 1638 |
| 479 | Ga0495653_0206246 | 3300046463 | Bacteria | 1330 |
| 480 | Ga0495580_0006356 | 3300046472 | Bacteria | 9639 |
| 481 | Ga0495580_0381264 | 3300046472 | Bacteria | 952 |
| 482 | Ga0495582_0023230 | 3300046473 | Bacteria | 3392 |
| 483 | Ga0495582_0052440 | 3300046473 | Bacteria | 2249 |
| 484 | Ga0495582_0113679 | 3300046473 | Bacteria | 1521 |
| 485 | Ga0495639_0080775 | 3300046475 | Bacteria | 1514 |
| 486 | Ga0495639_0136912 | 3300046475 | Bacteria | 1175 |
| 487 | Ga0495662_0007495 | 3300046476 | Bacteria | 5393 |
| 488 | Ga0495662_0030488 | 3300046476 | Bacteria | 2603 |
| 489 | Ga0495662_0065763 | 3300046476 | Bacteria | 1752 |
| 490 | Ga0495662_0072679 | 3300046476 | Bacteria | 1668 |
| 491 | Ga0495664_0005749 | 3300046477 | Bacteria | 6829 |
| 492 | Ga0495664_0072442 | 3300046477 | Bacteria | 2058 |
| 493 | Ga0495664_0085246 | 3300046477 | Bacteria | 1896 |
| 494 | Ga0495664_0097076 | 3300046477 | Bacteria | 1773 |
| 495 | Ga0495664_0167894 | 3300046477 | Bacteria | 1331 |
| 496 | Ga0495664_0420121 | 3300046477 | Bacteria | 802 |
| 497 | Ga0495608_0009299 | 3300046511 | Bacteria | 6872 |
| 498 | Ga0495608_0012696 | 3300046511 | Bacteria | 5844 |
| 499 | Ga0495608_0020023 | 3300046511 | Bacteria | 4600 |
| 500 | Ga0495608_0020654 | 3300046511 | Bacteria | 4524 |
| 501 | Ga0495608_0043589 | 3300046511 | Bacteria | 2997 |
| 502 | Ga0495608_0050023 | 3300046511 | Bacteria | 2773 |
| 503 | Ga0495608_0136905 | 3300046511 | Bacteria | 1564 |
| 504 | Ga0495618_0023383 | 3300046514 | Bacteria | 3820 |
| 505 | Ga0495618_0085902 | 3300046514 | Bacteria | 2011 |
| 506 | Ga0495618_0306198 | 3300046514 | Bacteria | 986 |
| 507 | Ga0495628_0009159 | 3300046516 | Bacteria | 8462 |
| 508 | Ga0495628_0035809 | 3300046516 | Bacteria | 3987 |
| 509 | Ga0495628_0049060 | 3300046516 | Bacteria | 3343 |
| 510 | Ga0495628_0066341 | 3300046516 | Bacteria | 2821 |
| 511 | Ga0495628_0106678 | 3300046516 | Bacteria | 2157 |
| 512 | Ga0495628_0194282 | 3300046516 | Bacteria | 1531 |
| 513 | Ga0495628_0324487 | 3300046516 | Bacteria | 1135 |
| 514 | Ga0495630_0013860 | 3300046517 | Bacteria | 5863 |
| 515 | Ga0495630_0030486 | 3300046517 | Bacteria | 4012 |
| 516 | Ga0495630_0072980 | 3300046517 | Bacteria | 2584 |
| 517 | Ga0495630_0105333 | 3300046517 | Bacteria | 2135 |
| 518 | Ga0495630_0280641 | 3300046517 | Bacteria | 1272 |
| 519 | Ga0495630_0405390 | 3300046517 | Bacteria | 1045 |
| 520 | Ga0495632_0093457 | 3300046519 | Bacteria | 1423 |
| 521 | Ga0495666_0341109 | 3300046526 | Bacteria | 675 |
| 522 | Ga0495666_0390748 | 3300046526 | Bacteria | 625 |
| 523 | Ga0495652_0003756 | 3300046529 | Bacteria | 14860 |
| 524 | Ga0495652_0063661 | 3300046529 | Bacteria | 3104 |
| 525 | Ga0495652_0144893 | 3300046529 | Bacteria | 1863 |
| 526 | Ga0495652_0185972 | 3300046529 | Bacteria | 1589 |
| 527 | Ga0495652_0273393 | 3300046529 | Bacteria | 1240 |
| 528 | Ga0495652_0611303 | 3300046529 | Bacteria | 742 |
| 529 | Ga0495665_0003104 | 3300046531 | Bacteria | 8989 |
| 530 | Ga0495665_0004214 | 3300046531 | Bacteria | 7765 |
| 531 | Ga0495665_0027326 | 3300046531 | Bacteria | 3063 |
| 532 | Ga0495640_0008144 | 3300046533 | Bacteria | 8232 |
| 533 | Ga0495640_0047578 | 3300046533 | Bacteria | 2967 |
| 534 | Ga0495640_0156121 | 3300046533 | Bacteria | 1464 |
| 535 | Ga0495640_0162392 | 3300046533 | Bacteria | 1430 |
| 536 | Ga0495586_0049948 | 3300046535 | Bacteria | 2262 |
| 537 | Ga0495586_0105587 | 3300046535 | Bacteria | 1566 |
| 538 | Ga0495586_0157718 | 3300046535 | Bacteria | 1279 |
| 539 | Ga0495586_0166583 | 3300046535 | Bacteria | 1244 |
| 540 | Ga0495586_0503546 | 3300046535 | Bacteria | 699 |
| 541 | Ga0495586_0679398 | 3300046535 | Bacteria | 595 |
| 542 | Ga0495587_0002579 | 3300046536 | Bacteria | 12116 |
| 543 | Ga0495587_0018810 | 3300046536 | Bacteria | 4282 |
| 544 | Ga0495587_0033300 | 3300046536 | Bacteria | 3111 |
| 545 | Ga0495587_0033817 | 3300046536 | Bacteria | 3084 |
| 546 | Ga0495587_0040481 | 3300046536 | Bacteria | 2785 |
| 547 | Ga0495597_0113877 | 3300046542 | Bacteria | 1132 |
| 548 | Ga0495645_0013643 | 3300046543 | Bacteria | 5755 |
| 549 | Ga0495645_0025634 | 3300046543 | Bacteria | 4281 |
| 550 | Ga0495645_0104477 | 3300046543 | Bacteria | 2011 |
| 551 | Ga0495645_0111937 | 3300046543 | Bacteria | 1930 |
| 552 | Ga0495645_0117346 | 3300046543 | Bacteria | 1877 |
| 553 | Ga0495645_0184075 | 3300046543 | Bacteria | 1428 |
| 554 | Ga0495645_0410227 | 3300046543 | Bacteria | 861 |
| 555 | Ga0495667_0010662 | 3300046559 | Bacteria | 6212 |
| 556 | Ga0495667_0013591 | 3300046559 | Bacteria | 5504 |
| 557 | Ga0495667_0014297 | 3300046559 | Bacteria | 5361 |
| 558 | Ga0495667_0085290 | 3300046559 | Bacteria | 2049 |
| 559 | Ga0495667_0197927 | 3300046559 | Bacteria | 1286 |
| 560 | Ga0495634_0016697 | 3300046642 | Bacteria | 5245 |
| 561 | Ga0495634_0030642 | 3300046642 | Bacteria | 3713 |
| 562 | Ga0495634_0156316 | 3300046642 | Bacteria | 1439 |
| 563 | Ga0495634_0328990 | 3300046642 | Bacteria | 918 |
| 564 | Ga0495635_0011222 | 3300046663 | Bacteria | 6281 |
| 565 | Ga0495635_0040064 | 3300046663 | Bacteria | 3238 |
| 566 | Ga0495635_0067580 | 3300046663 | Bacteria | 2451 |
| 567 | Ga0495635_0108917 | 3300046663 | Bacteria | 1892 |
| 568 | Ga0495635_0173215 | 3300046663 | Bacteria | 1467 |
| 569 | Ga0495635_0177829 | 3300046663 | Bacteria | 1446 |
| 570 | Ga0495635_0195567 | 3300046663 | Bacteria | 1372 |
| 571 | Ga0495657_0012582 | 3300046675 | Bacteria | 6279 |
| 572 | Ga0495657_0058951 | 3300046675 | Bacteria | 2547 |
| 573 | Ga0495657_0080916 | 3300046675 | Bacteria | 2101 |
| 574 | Ga0495657_0312325 | 3300046675 | Bacteria | 935 |
| 575 | Ga0495599_0009205 | 3300046678 | Bacteria | 6027 |
| 576 | Ga0495599_0011342 | 3300046678 | Bacteria | 5473 |
| 577 | Ga0495599_0030990 | 3300046678 | Bacteria | 3356 |
| 578 | Ga0495599_0067825 | 3300046678 | Bacteria | 2227 |
| 579 | Ga0495599_0430113 | 3300046678 | Bacteria | 783 |
| 580 | Ga0495623_0002795 | 3300046679 | Bacteria | 11517 |
| 581 | Ga0495623_0009879 | 3300046679 | Bacteria | 6182 |
| 582 | Ga0495623_0011495 | 3300046679 | Bacteria | 5730 |
| 583 | Ga0495623_0075479 | 3300046679 | Bacteria | 2093 |
| 584 | Ga0495623_0146860 | 3300046679 | Bacteria | 1397 |
| 585 | Ga0495623_0545531 | 3300046679 | Bacteria | 607 |
| 586 | Ga0495646_0002025 | 3300046680 | Bacteria | 12277 |
| 587 | Ga0495646_0160005 | 3300046680 | Bacteria | 1247 |
| 588 | Ga0495646_0234269 | 3300046680 | Bacteria | 988 |
| 589 | Ga0495647_0103976 | 3300046681 | Bacteria | 1179 |
| 590 | Ga0495647_0140075 | 3300046681 | Bacteria | 1031 |
| 591 | Ga0495658_0036611 | 3300046683 | Bacteria | 2708 |
| 592 | Ga0495658_0037868 | 3300046683 | Bacteria | 2668 |
| 593 | Ga0495658_0139564 | 3300046683 | Bacteria | 1481 |
| 594 | Ga0495658_0612699 | 3300046683 | Bacteria | 697 |
| 595 | Ga0495613_0036904 | 3300046689 | Bacteria | 3623 |
| 596 | Ga0495613_0096540 | 3300046689 | Bacteria | 2137 |
| 597 | Ga0495613_0372588 | 3300046689 | Bacteria | 977 |
| 598 | Ga0495624_0060343 | 3300046690 | Bacteria | 2378 |
| 599 | Ga0495624_0077958 | 3300046690 | Bacteria | 2055 |
| 600 | Ga0495624_0143937 | 3300046690 | Bacteria | 1459 |
| 601 | Ga0495624_0180272 | 3300046690 | Bacteria | 1287 |
| 602 | Ga0495649_0079710 | 3300046694 | Bacteria | 1751 |
| 603 | Ga0495600_0004594 | 3300046809 | Bacteria | 8270 |
| 604 | Ga0495600_0015394 | 3300046809 | Bacteria | 4834 |
| 605 | Ga0495600_0033635 | 3300046809 | Bacteria | 3327 |
| 606 | Ga0495600_0096919 | 3300046809 | Bacteria | 1922 |
| 607 | Ga0495600_0376377 | 3300046809 | Bacteria | 886 |
| 608 | Ga0495581_0033423 | 3300047315 | Bacteria | 2977 |
| 609 | Ga0495581_0050006 | 3300047315 | Bacteria | 2414 |
| 610 | Ga0495581_0058733 | 3300047315 | Bacteria | 2221 |
| 611 | Ga0495604_0001885 | 3300047317 | Bacteria | 17044 |
| 612 | Ga0495604_0040234 | 3300047317 | Bacteria | 3671 |
| 613 | Ga0495604_0096156 | 3300047317 | Bacteria | 2186 |
| 614 | Ga0495636_0018877 | 3300047318 | Bacteria | 2768 |
| 615 | Ga0495674_0076760 | 3300047319 | Bacteria | 2873 |
| 616 | Ga0495674_0079307 | 3300047319 | Bacteria | 2819 |
| 617 | Ga0495674_0180758 | 3300047319 | Bacteria | 1756 |
| 618 | Ga0495674_0185795 | 3300047319 | Bacteria | 1729 |
| 619 | Ga0495674_0489817 | 3300047319 | Bacteria | 984 |
| 620 | Ga0495672_0208009 | 3300047320 | Bacteria | 974 |
| 621 | Ga0495676_0129467 | 3300047321 | Bacteria | 1824 |
| 622 | Ga0495680_0035554 | 3300047322 | Bacteria | 4011 |
| 623 | Ga0495680_0048111 | 3300047322 | Bacteria | 3350 |
| 624 | Ga0495680_0093367 | 3300047322 | Bacteria | 2252 |
| 625 | Ga0495680_0100960 | 3300047322 | Bacteria | 2149 |
| 626 | Ga0495680_0130236 | 3300047322 | Bacteria | 1849 |
| 627 | Ga0495675_0027173 | 3300047444 | Bacteria | 3647 |
| 628 | Ga0495675_0037109 | 3300047444 | Bacteria | 3104 |
| 629 | Ga0495675_0046694 | 3300047444 | Bacteria | 2757 |
| 630 | Ga0495675_0073229 | 3300047444 | Bacteria | 2160 |
| 631 | Ga0495675_0116145 | 3300047444 | Bacteria | 1668 |
| 632 | Ga0495675_0220360 | 3300047444 | Bacteria | 1148 |
| 633 | Ga0495684_0025194 | 3300047471 | Bacteria | 4573 |
| 634 | Ga0495684_0034787 | 3300047471 | Bacteria | 3865 |
| 635 | Ga0495684_0128051 | 3300047471 | Bacteria | 1908 |
| 636 | Ga0495684_0128822 | 3300047471 | Bacteria | 1902 |
| 637 | Ga0495684_0339889 | 3300047471 | Bacteria | 1068 |
| 638 | Ga0495593_0008464 | 3300047673 | Bacteria | 5980 |
| 639 | Ga0495593_0069045 | 3300047673 | Bacteria | 1838 |
| 640 | Ga0495593_0083391 | 3300047673 | Bacteria | 1651 |
| 641 | Ga0495602_0088671 | 3300048088 | Bacteria | 2574 |
| 642 | Ga0495602_0128241 | 3300048088 | Bacteria | 2028 |
| 643 | Ga0495614_0052326 | 3300048089 | Bacteria | 1750 |
| 644 | Ga0496101_0506323 | 3300048904 | Bacteria | 954 |
| 645 | Ga0496101_0831140 | 3300048904 | Bacteria | 728 |
| 646 | Ga0496102_0184059 | 3300048905 | Bacteria | 1968 |
| 647 | Ga0496102_0190783 | 3300048905 | Bacteria | 1931 |
| 648 | Ga0496102_0579088 | 3300048905 | Bacteria | 1045 |
| 649 | Ga0496104_0043763 | 3300048907 | Bacteria | 4205 |
| 650 | Ga0496104_0111343 | 3300048907 | Bacteria | 2625 |
| 651 | Ga0496104_1207925 | 3300048907 | Bacteria | 659 |
| 652 | Ga0496105_0098486 | 3300048908 | Bacteria | 2414 |
| 653 | Ga0496105_0192839 | 3300048908 | Bacteria | 1665 |
| 654 | Ga0496105_0582576 | 3300048908 | Bacteria | 870 |
| 655 | Ga0496106_0094702 | 3300048909 | Bacteria | 2309 |
| 656 | Ga0496106_0205869 | 3300048909 | Bacteria | 1567 |
| 657 | Ga0496106_0432978 | 3300048909 | Bacteria | 1057 |
| 658 | Ga0496106_0989096 | 3300048909 | Bacteria | 662 |
| 659 | Ga0496107_0088449 | 3300048910 | Bacteria | 2261 |
| 660 | Ga0496107_0170863 | 3300048910 | Bacteria | 1613 |
| 661 | Ga0496108_0000089 | 3300048911 | Bacteria | 97102 |
| 662 | Ga0496108_0001256 | 3300048911 | Bacteria | 19832 |
| 663 | Ga0496108_0218297 | 3300048911 | Bacteria | 1656 |
| 664 | Ga0496109_0028644 | 3300048912 | Bacteria | 4984 |
| 665 | Ga0496109_0229235 | 3300048912 | Bacteria | 1747 |
| 666 | Ga0496109_1216682 | 3300048912 | Bacteria | 690 |
| 667 | Ga0496110_0146583 | 3300048913 | Bacteria | 2135 |
| 668 | Ga0496111_0302658 | 3300048914 | Bacteria | 1185 |
| 669 | Ga0496111_0678388 | 3300048914 | Bacteria | 751 |
| 670 | Ga0496111_1068871 | 3300048914 | Bacteria | 576 |
| 671 | Ga0496116_0000531 | 3300048919 | Bacteria | 51345 |
| 672 | Ga0496117_0009641 | 3300048920 | Bacteria | 8934 |
| 673 | Ga0496117_0085382 | 3300048920 | Bacteria | 2055 |
| 674 | Ga0496118_0005065 | 3300048921 | Bacteria | 15171 |
| 675 | Ga0496118_0011579 | 3300048921 | Bacteria | 8591 |
| 676 | Ga0496119_0010904 | 3300048922 | Bacteria | 7593 |
| 677 | Ga0496119_0018969 | 3300048922 | Bacteria | 5092 |
| 678 | Ga0496121_0013354 | 3300048924 | Bacteria | 8834 |
| 679 | Ga0496124_0417991 | 3300048927 | Bacteria | 925 |
| 680 | Ga0496126_0097143 | 3300048929 | Bacteria | 2582 |
| 681 | Ga0501306_016543 | 3300049127 | Bacteria | 992 |
| 682 | Ga0501031_0003647 | 3300049568 | Bacteria | 9910 |
| 683 | Ga0501031_0142076 | 3300049568 | Bacteria | 1569 |
| 684 | Ga0501032_0007954 | 3300049569 | Bacteria | 7725 |
| 685 | Ga0501032_0021958 | 3300049569 | Bacteria | 4431 |
| 686 | Ga0501032_0027168 | 3300049569 | Bacteria | 3934 |
| 687 | Ga0501032_0365624 | 3300049569 | Bacteria | 928 |
| 688 | Ga0501032_0584412 | 3300049569 | Bacteria | 711 |
| 689 | Ga0501033_0005797 | 3300049570 | Bacteria | 9720 |
| 690 | Ga0501033_0026344 | 3300049570 | Bacteria | 4376 |
| 691 | Ga0501033_0127682 | 3300049570 | Bacteria | 1843 |
| 692 | Ga0501034_0007085 | 3300049571 | Bacteria | 11960 |
| 693 | Ga0501034_0016284 | 3300049571 | Bacteria | 7632 |
| 694 | Ga0501034_0189316 | 3300049571 | Bacteria | 2020 |
| 695 | Ga0501036_0000154 | 3300049572 | Bacteria | 45221 |
| 696 | Ga0501036_0007966 | 3300049572 | Bacteria | 8671 |
| 697 | Ga0501036_0053216 | 3300049572 | Bacteria | 3428 |
| 698 | Ga0501036_0410164 | 3300049572 | Bacteria | 1130 |
| 699 | Ga0501037_0008259 | 3300049573 | Bacteria | 7632 |
| 700 | Ga0501037_0075979 | 3300049573 | Bacteria | 2439 |
| 701 | Ga0501037_0076860 | 3300049573 | Bacteria | 2423 |
| 702 | Ga0501037_0334101 | 3300049573 | Bacteria | 1047 |
| 703 | Ga0501038_0012221 | 3300049574 | Bacteria | 7839 |
| 704 | Ga0501038_0055608 | 3300049574 | Bacteria | 3399 |
| 705 | Ga0501038_0072316 | 3300049574 | Bacteria | 2922 |
| 706 | Ga0501038_0113482 | 3300049574 | Bacteria | 2242 |
| 707 | Ga0501038_0211385 | 3300049574 | Bacteria | 1552 |
| 708 | Ga0501038_0443406 | 3300049574 | Bacteria | 999 |
| 709 | Ga0501038_1176201 | 3300049574 | Bacteria | 558 |
| 710 | Ga0501039_0012712 | 3300049575 | Bacteria | 6432 |
| 711 | Ga0501039_0023069 | 3300049575 | Bacteria | 4774 |
| 712 | Ga0501039_0179217 | 3300049575 | Bacteria | 1666 |
| 713 | Ga0501039_0378682 | 3300049575 | Bacteria | 1112 |
| 714 | Ga0501039_0510083 | 3300049575 | Bacteria | 944 |
| 715 | Ga0501040_0004621 | 3300049576 | Bacteria | 8930 |
| 716 | Ga0501041_0034922 | 3300049577 | Bacteria | 3045 |
| 717 | Ga0501042_0004260 | 3300049578 | Bacteria | 9107 |
| 718 | Ga0501042_0014535 | 3300049578 | Bacteria | 5375 |
| 719 | Ga0501043_0003227 | 3300049579 | Bacteria | 13459 |
| 720 | Ga0501043_0005709 | 3300049579 | Bacteria | 10024 |
| 721 | Ga0501043_0070359 | 3300049579 | Bacteria | 2748 |
| 722 | Ga0501043_0101652 | 3300049579 | Bacteria | 2259 |
| 723 | Ga0501043_0139305 | 3300049579 | Bacteria | 1900 |
| 724 | Ga0501043_0672747 | 3300049579 | Bacteria | 758 |
| 725 | Ga0501046_0002283 | 3300049580 | Bacteria | 18080 |
| 726 | Ga0501046_0020154 | 3300049580 | Bacteria | 5519 |
| 727 | Ga0501046_0026740 | 3300049580 | Bacteria | 4713 |
| 728 | Ga0501046_0081810 | 3300049580 | Bacteria | 2494 |
| 729 | Ga0501047_0000942 | 3300049581 | Bacteria | 29462 |
| 730 | Ga0501047_0001481 | 3300049581 | Bacteria | 22897 |
| 731 | Ga0501047_0002944 | 3300049581 | Bacteria | 16139 |
| 732 | Ga0501047_0065463 | 3300049581 | Bacteria | 3503 |
| 733 | Ga0501047_0366928 | 3300049581 | Bacteria | 1275 |
| 734 | Ga0501047_0462617 | 3300049581 | Bacteria | 1097 |
| 735 | Ga0501047_0720906 | 3300049581 | Bacteria | 814 |
| 736 | Ga0501048_0016037 | 3300049582 | Bacteria | 5524 |
| 737 | Ga0501048_0032217 | 3300049582 | Bacteria | 3788 |
| 738 | Ga0501048_0240033 | 3300049582 | Bacteria | 1286 |
| 739 | Ga0501048_0980695 | 3300049582 | Bacteria | 608 |
| 740 | Ga0501067_0005755 | 3300049583 | Bacteria | 6878 |
| 741 | Ga0501068_0002878 | 3300049584 | Bacteria | 9163 |
| 742 | Ga0501070_0006175 | 3300049586 | Bacteria | 10207 |
| 743 | Ga0501070_0027422 | 3300049586 | Bacteria | 4778 |
| 744 | Ga0501071_0000622 | 3300049587 | Bacteria | 18372 |
| 745 | Ga0501072_0011566 | 3300049588 | Bacteria | 6743 |
| 746 | Ga0501073_0013975 | 3300049589 | Bacteria | 5835 |
| 747 | Ga0501073_0044039 | 3300049589 | Bacteria | 3145 |
| 748 | Ga0501074_0003420 | 3300049590 | Bacteria | 11243 |
| 749 | Ga0501074_0004389 | 3300049590 | Bacteria | 10081 |
| 750 | Ga0501076_0112951 | 3300049592 | Bacteria | 2197 |
| 751 | Ga0501077_0053126 | 3300049593 | Bacteria | 2572 |
| 752 | Ga0501077_0106942 | 3300049593 | Bacteria | 1773 |
| 753 | Ga0501077_0496030 | 3300049593 | Bacteria | 783 |
| 754 | Ga0501079_0007822 | 3300049741 | Bacteria | 8094 |
| 755 | Ga0501080_0083601 | 3300049742 | Bacteria | 2965 |
| 756 | Ga0501080_1530389 | 3300049742 | Bacteria | 566 |
| 757 | Ga0501081_0357331 | 3300049743 | Bacteria | 1077 |
| 758 | Ga0501083_0001270 | 3300049744 | Bacteria | 17091 |
| 759 | Ga0501083_0118403 | 3300049744 | Bacteria | 1738 |
| 760 | Ga0501035_0028772 | 3300049822 | Bacteria | 5070 |
| 761 | Ga0501035_0095857 | 3300049822 | Bacteria | 2607 |
| 762 | Ga0501035_0238991 | 3300049822 | Bacteria | 1545 |
| 763 | Ga0501035_0888496 | 3300049822 | Bacteria | 706 |
| 764 | Ga0501044_0003451 | 3300049823 | Bacteria | 17804 |
| 765 | Ga0501044_0035021 | 3300049823 | Bacteria | 5259 |
| 766 | Ga0501044_0041277 | 3300049823 | Bacteria | 4803 |
| 767 | Ga0501044_0091875 | 3300049823 | Bacteria | 3061 |
| 768 | Ga0501044_0246014 | 3300049823 | Bacteria | 1731 |
| 769 | Ga0501044_0327568 | 3300049823 | Bacteria | 1455 |
| 770 | Ga0501044_0383816 | 3300049823 | Bacteria | 1319 |
| 771 | Ga0501045_0057322 | 3300049824 | Bacteria | 2850 |
| 772 | Ga0501045_0090932 | 3300049824 | Bacteria | 2256 |
| 773 | Ga0501045_0185223 | 3300049824 | Bacteria | 1551 |
| 774 | Ga0501045_0506026 | 3300049824 | Bacteria | 897 |
| 775 | nmdc:mga0yw44_435289_c1 | 3300050492 | Bacteria | 888 |
| 776 | nmdc:mga05p37_321547_c1 | 3300050507 | Bacteria | 1831 |
| 777 | nmdc:mga05p37_37397_c1 | 3300050507 | Bacteria | 5951 |
| 778 | nmdc:mga05p37_949924_c1 | 3300050507 | Bacteria | 920 |
| 779 | nmdc:mga09592_65666_c1 | 3300050508 | Bacteria | 3074 |
| 780 | nmdc:mga0qj67_240697_c1 | 3300050509 | Bacteria | 1468 |
| 781 | nmdc:mga0qj67_246669_c1 | 3300050509 | Bacteria | 1449 |
| 782 | nmdc:mga0qj67_2892_c1 | 3300050509 | Bacteria | 12324 |
| 783 | nmdc:mga08y16_198717_c1 | 3300050511 | Bacteria | 2078 |
| 784 | nmdc:mga0n895_1155215_c1 | 3300050512 | Bacteria | 750 |
| 785 | nmdc:mga0n895_161895_c1 | 3300050512 | Bacteria | 2270 |
| 786 | nmdc:mga0rr50_471666_c1 | 3300050513 | Bacteria | 1065 |
| 787 | nmdc:mga0rr50_962047_c1 | 3300050513 | Bacteria | 728 |
| 788 | Ga0495601_0006464 | 3300053077 | Bacteria | 6854 |
| 789 | Ga0495601_0049082 | 3300053077 | Bacteria | 2660 |
| 790 | Ga0495601_0049458 | 3300053077 | Bacteria | 2650 |
| 791 | Ga0495601_0071249 | 3300053077 | Bacteria | 2219 |
| 792 | Ga0495601_0097978 | 3300053077 | Bacteria | 1892 |
| 793 | Ga0495601_0249439 | 3300053077 | Bacteria | 1159 |
| 794 | Ga0495601_0295142 | 3300053077 | Bacteria | 1056 |
| 795 | Ga0495612_0009063 | 3300053078 | Bacteria | 4036 |
| 796 | Ga0495612_0191873 | 3300053078 | Bacteria | 899 |
| 797 | Ga0495595_0037522 | 3300053084 | Bacteria | 2204 |
| 798 | Ga0495595_0103102 | 3300053084 | Bacteria | 1378 |
| 799 | Ga0495595_0167464 | 3300053084 | Bacteria | 1086 |
| 800 | Ga0495619_0014393 | 3300053085 | Bacteria | 4995 |
| 801 | Ga0495619_0022405 | 3300053085 | Bacteria | 4042 |
| 802 | Ga0495619_0040149 | 3300053085 | Bacteria | 3058 |
| 803 | Ga0495619_0286917 | 3300053085 | Bacteria | 1140 |
| 804 | Ga0500583_0064530 | 3300053092 | Bacteria | 1737 |
| 805 | Ga0500600_0121728 | 3300053149 | Bacteria | 1343 |
| 806 | Ga0587070_053478 | 3300059491 | Bacteria | 813 |
| 807 | Ga0501082_0011694 | 3300060353 | Bacteria | 7546 |
| 808 | Ga0501082_0012789 | 3300060353 | Bacteria | 7213 |
| 809 | Ga0466962_0010959 | 3300061719 | Bacteria | 4362 |
| 810 | Ga0466962_0044244 | 3300061719 | Bacteria | 2129 |
| 811 | Ga0466962_0371018 | 3300061719 | Bacteria | 714 |
| 812 | Ga0530510_0069504 | 3300061734 | Bacteria | 2555 |
| 813 | 2501943498 | 2501939600 | Bacteria | 6907073 |
| 814 | 2508671931 | 2508501039 | Bacteria | 9978592 |
| 815 | 2517761204 | 2517572101 | Bacteria | 6884336 |
| 816 | 2554257207 | 2554235005 | Bacteria | 6457341 |
| 817 | 2619854895 | 2619618881 | Bacteria | 7521104 |
| 818 | 2620353659 | 2619619003 | Bacteria | 7619552 |
| 819 | 2626636690 | 2626541554 | Bacteria | 7741902 |
| 820 | 2643942406 | 2643221587 | Bacteria | 7586415 |
| 821 | 2644390030 | 2643221670 | Bacteria | 6497041 |
| 822 | 2644429487 | 2643221677 | Bacteria | 7584031 |
| 823 | 2676204419 | 2675902999 | Bacteria | 9438463 |
| 824 | 2686540651 | 2684623036 | Bacteria | 5199090 |
| 825 | 2689961918 | 2687453737 | Bacteria | 11203906 |
| 826 | 2710604847 | 2710264753 | Bacteria | 5455564 |
| 827 | 2729909292 | 2728369276 | Bacteria | 5610032 |
| 828 | 2768643475 | 2767802112 | Bacteria | 6465194 |
| 829 | 2774848994 | 2773857921 | Bacteria | 9435764 |
| 830 | 2793978330 | 2791355406 | Bacteria | 11364898 |
| 831 | 2799185844 | 2799112218 | Bacteria | 4315149 |
| 832 | 2812362636 | 2811994880 | Bacteria | 4147780 |
| 833 | 2819742014 | 2818991472 | Bacteria | 10089953 |
| 834 | 2848551754 | 2848551377 | Bacteria | 3720646 |
| 835 | 2856859308 | 2856858025 | Bacteria | 7255264 |
| 836 | 2858902630 | 2858902515 | Bacteria | 7086037 |
| 837 | 2862179359 | 2862178590 | Bacteria | 8583590 |
| 838 | 2862290517 | 2862290372 | Bacteria | 7471434 |
| 839 | 2862706474 | 2862705112 | Bacteria | 6563286 |
| 840 | 2867478820 | 2867475112 | Bacteria | 6909112 |
| 841 | 2887446831 | 2887443736 | Bacteria | 4426037 |
| 842 | 2912760898 | 2912757875 | Bacteria | 7940295 |
| 843 | 2990045330 | 2990044586 | Bacteria | 6603797 |
| 844 | 2990092103 | 2990088156 | Bacteria | 6657676 |
| 845 | 2997600303 | 2997600082 | Bacteria | 9896405 |
| 846 | 3003004917 | 3002998708 | Bacteria | 11715108 |
| 847 | 3006325199 | 3006321560 | Bacteria | 8247479 |
| 848 | 649812828 | 649633069 | Bacteria | 6962533 |
| 849 | 8002782679 | 8002775197 | Bacteria | 10728764 |
| 850 | 8002786604 | 8002784119 | Bacteria | 9788632 |
| 851 | 8003859215 | 8003856774 | Bacteria | 7675274 |
| 852 | 8008490305 | 8008485437 | Bacteria | 7198341 |
| 853 | 8025529607 | 8025524527 | Bacteria | 7197316 |
| 854 | 8047897972 | 8047893842 | Bacteria | 11723082 |
| 855 | 8048360922 | 8048356638 | Bacteria | 11044339 |
| 856 | 8048374935 | 8048369669 | Bacteria | 11666822 |
| 857 | 8048383270 | 8048379754 | Bacteria | 11877923 |
| 858 | 8053952141 | 8053945823 | Bacteria | 8962862 |
| 859 | 8054161759 | 8054160619 | Bacteria | 7783213 |
| 860 | 8054914818 | 8054913762 | Bacteria | 7713009 |
| 861 | 8054926257 | 8054920844 | Bacteria | 7068637 |
| 862 | 8056058339 | 8056054917 | Bacteria | 5736694 |
| 863 | 8056450880 | 8056447290 | Bacteria | 7680491 |
| 864 | 8056671241 | 8056667051 | Bacteria | 6953971 |
| 865 | Ga0316576_10002642 | |||
| 866 | rootL2_10080448 | |||
| 867 | JGI25160J50197_1007531 | |||
| 868 | JGI25160J50197_1032024 | |||
| 869 | Ga0070658_10830260 | |||
| 870 | Ga0070658_11357014 | |||
| 871 | Ga0070676_10041165 | |||
| 872 | Ga0070683_100033689 | |||
| 873 | Ga0070683_100988027 | |||
| 874 | Ga0068869_100323220 | |||
| 875 | Ga0068869_100832360 | |||
| 876 | Ga0070680_100000378 | |||
| 877 | Ga0070680_100045649 | |||
| 878 | Ga0070680_100449082 | |||
| 879 | Ga0070682_100156247 | |||
| 880 | Ga0068868_100034712 | |||
| 881 | Ga0068868_101567650 | |||
| 882 | Ga0070660_100223051 | |||
| 883 | Ga0070691_10667791 | |||
| 884 | Ga0070692_10638090 | |||
| 885 | Ga0070692_10952638 | |||
| 886 | Ga0070668_100003731 | |||
| 887 | Ga0070668_100535101 | |||
| 888 | Ga0070675_100111557 | |||
| 889 | Ga0070671_100023038 | |||
| 890 | Ga0070671_101587299 | |||
| 891 | Ga0070674_100373407 | |||
| 892 | Ga0070667_100941687 | |||
| 893 | Ga0070709_10000441 | |||
| 894 | Ga0070709_10139223 | |||
| 895 | Ga0070714_100140905 | |||
| 896 | Ga0070714_100263272 | |||
| 897 | Ga0070713_100024518 | |||
| 898 | Ga0070713_100056965 | |||
| 899 | Ga0070713_100109446 | |||
| 900 | Ga0070713_100136995 | |||
| 901 | Ga0070710_10000167 | |||
| 902 | Ga0070711_100001149 | |||
| 903 | Ga0070711_100056367 | |||
| 904 | Ga0070711_100793247 | |||
| 905 | Ga0070705_100060528 | |||
| 906 | Ga0070705_100309896 | |||
| 907 | Ga0070700_100046916 | |||
| 908 | Ga0070700_100416559 | |||
| 909 | Ga0070708_100059757 | |||
| 910 | Ga0070708_100067253 | |||
| 911 | Ga0070708_100918408 | |||
| 912 | Ga0070681_10000248 | |||
| 913 | Ga0070685_10013217 | |||
| 914 | Ga0070706_100004020 | |||
| 915 | Ga0070706_100008150 | |||
| 916 | Ga0070706_100101329 | |||
| 917 | Ga0070706_100135209 | |||
| 918 | Ga0070706_100365372 | |||
| 919 | Ga0070706_100619557 | |||
| 920 | Ga0070706_100708518 | |||
| 921 | Ga0070707_100000293 | |||
| 922 | Ga0070707_100005742 | |||
| 923 | Ga0070707_100010098 | |||
| 924 | Ga0070707_100017292 | |||
| 925 | Ga0070707_100623338 | |||
| 926 | Ga0070698_100000106 | |||
| 927 | Ga0070698_100007047 | |||
| 928 | Ga0070698_100018347 | |||
| 929 | Ga0070698_100019863 | |||
| 930 | Ga0070698_100727356 | |||
| 931 | Ga0070679_100000157 | |||
| 932 | Ga0070679_100378751 | |||
| 933 | Ga0070684_100014045 | |||
| 934 | Ga0070684_100037584 | |||
| 935 | Ga0070684_100131557 | |||
| 936 | Ga0070684_100781987 | |||
| 937 | Ga0070697_100132679 | |||
| 938 | Ga0070693_100133834 | |||
| 939 | Ga0070665_100003592 | |||
| 940 | Ga0070665_100345281 | |||
| 941 | Ga0068855_100045667 | |||
| 942 | Ga0068855_100656538 | |||
| 943 | Ga0068855_100909594 | |||
| 944 | Ga0070664_100230859 | |||
| 945 | Ga0070664_100530887 | |||
| 946 | Ga0068857_100101178 | |||
| 947 | Ga0068857_100634179 | |||
| 948 | Ga0068857_101146938 | |||
| 949 | Ga0068854_100035390 | |||
| 950 | Ga0068856_100066806 | |||
| 951 | Ga0068856_100927479 | |||
| 952 | Ga0068852_101473416 | |||
| 953 | Ga0068859_100000014 | |||
| 954 | Ga0068859_100440453 | |||
| 955 | Ga0068864_100411244 | |||
| 956 | Ga0068861_100208166 | |||
| 957 | Ga0068861_100742113 | |||
| 958 | Ga0068870_10245700 | |||
| 959 | Ga0068870_10330077 | |||
| 960 | Ga0068863_100001561 | |||
| 961 | Ga0068863_100518828 | |||
| 962 | Ga0068863_100660614 | |||
| 963 | Ga0068858_100000988 | |||
| 964 | Ga0068858_100098622 | |||
| 965 | Ga0068858_100128337 | |||
| 966 | Ga0068858_100999291 | |||
| 967 | Ga0068860_100220675 | |||
| 968 | Ga0068862_100000026 | |||
| 969 | Ga0068862_100273324 | |||
| 970 | Ga0081455_10340559 | |||
| 971 | Ga0081455_10622525 | |||
| 972 | Ga0081540_1001613 | |||
| 973 | Ga0081540_1018566 | |||
| 974 | Ga0081540_1053918 | |||
| 975 | Ga0070717_10019735 | |||
| 976 | Ga0070717_10026460 | |||
| 977 | Ga0070717_10030210 | |||
| 978 | Ga0070717_10147018 | |||
| 979 | Ga0070717_10434658 | |||
| 980 | Ga0070717_10678247 | |||
| 981 | Ga0070715_10041187 | |||
| 982 | Ga0070715_10060863 | |||
| 983 | Ga0070716_100047672 | |||
| 984 | Ga0070716_100177436 | |||
| 985 | Ga0070712_100030922 | |||
| 986 | Ga0070712_100074524 | |||
| 987 | Ga0070712_100231617 | |||
| 988 | Ga0070712_100240806 | |||
| 989 | Ga0070712_100644711 | |||
| 990 | Ga0097621_100307456 | |||
| 991 | Ga0097621_100832032 | |||
| 992 | Ga0075370_10513327 | |||
| 993 | Ga0068871_100070094 | |||
| 994 | Ga0075428_100034513 | |||
| 995 | Ga0075428_100118780 | |||
| 996 | Ga0075428_100119380 | |||
| 997 | Ga0075428_100754583 | |||
| 998 | Ga0075430_100001268 | |||
| 999 | Ga0075433_10033010 | |||
| 1000 | Ga0075434_100072963 | |||
| 1001 | Ga0075434_100083829 | |||
| 1002 | Ga0075434_100235372 | |||
| 1003 | Ga0075429_100056417 | |||
| 1004 | Ga0075429_100347609 | |||
| 1005 | Ga0075436_100011256 | |||
| 1006 | Ga0097620_100000014 | |||
| 1007 | Ga0097620_100440501 | |||
| 1008 | Ga0097620_101893390 | |||
| 1009 | Ga0075435_100083841 | |||
| 1010 | Ga0075435_101007016 | |||
| 1011 | Ga0105240_10788943 | |||
| 1012 | Ga0105240_11732384 | |||
| 1013 | Ga0111539_10015815 | |||
| 1014 | Ga0105245_10179266 | |||
| 1015 | Ga0105245_10260627 | |||
| 1016 | Ga0105247_10002241 | |||
| 1017 | Ga0105247_10252732 | |||
| 1018 | Ga0114129_10011093 | |||
| 1019 | Ga0114129_10369545 | |||
| 1020 | Ga0114129_10416511 | |||
| 1021 | Ga0114129_11413429 | |||
| 1022 | Ga0105241_10285913 | |||
| 1023 | Ga0105242_10026296 | |||
| 1024 | Ga0105248_10000023 | |||
| 1025 | Ga0105249_10959429 | |||
| 1026 | Ga0105239_10031946 | |||
| 1027 | Ga0157371_10741787 | |||
| 1028 | Ga0157370_10054444 | |||
| 1029 | Ga0157369_10134948 | |||
| 1030 | Ga0157369_11350249 | |||
| 1031 | Ga0157374_10035799 | |||
| 1032 | Ga0157378_11451665 | |||
| 1033 | Ga0157372_10212112 | |||
| 1034 | Ga0157372_10425825 | |||
| 1035 | Ga0157372_10510965 | |||
| 1036 | Ga0157372_10726498 | |||
| 1037 | Ga0163163_10014092 | |||
| 1038 | Ga0163163_10075078 | |||
| 1039 | Ga0157379_10000591 | |||
| 1040 | Ga0157379_10013216 | |||
| 1041 | Ga0157379_10266661 | |||
| 1042 | Ga0157376_10055825 | |||
| 1043 | Ga0206356_11141531 | |||
| 1044 | Ga0206353_10914106 | |||
| 1045 | Ga0224712_10086688 | |||
| 1046 | Ga0224572_1030548 | |||
| 1047 | Ga0207426_1006879 | |||
| 1048 | Ga0207426_1023061 | |||
| 1049 | Ga0207426_1085890 | |||
| 1050 | Ga0207692_10824581 | |||
| 1051 | Ga0207710_10000063 | |||
| 1052 | Ga0207685_10114534 | |||
| 1053 | Ga0207699_10002656 | |||
| 1054 | Ga0207699_10071582 | |||
| 1055 | Ga0207705_10000348 | |||
| 1056 | Ga0207705_10293472 | |||
| 1057 | Ga0207705_11029655 | |||
| 1058 | Ga0207705_11207974 | |||
| 1059 | Ga0207684_10000571 | |||
| 1060 | Ga0207684_10007405 | |||
| 1061 | Ga0207684_10014224 | |||
| 1062 | Ga0207684_10019030 | |||
| 1063 | Ga0207684_10115821 | |||
| 1064 | Ga0207684_10217467 | |||
| 1065 | Ga0207654_10063304 | |||
| 1066 | Ga0207707_10000447 | |||
| 1067 | Ga0207671_10116320 | |||
| 1068 | Ga0207671_10578103 | |||
| 1069 | Ga0207693_10050689 | |||
| 1070 | Ga0207693_10068335 | |||
| 1071 | Ga0207693_10146872 | |||
| 1072 | Ga0207693_10280689 | |||
| 1073 | Ga0207693_10414351 | |||
| 1074 | Ga0207663_10001400 | |||
| 1075 | Ga0207663_10077291 | |||
| 1076 | Ga0207663_10679173 | |||
| 1077 | Ga0207660_10000102 | |||
| 1078 | Ga0207660_10032415 | |||
| 1079 | Ga0207660_10593741 | |||
| 1080 | Ga0207660_11035537 | |||
| 1081 | Ga0207657_10045026 | |||
| 1082 | Ga0207649_11061553 | |||
| 1083 | Ga0207652_10000182 | |||
| 1084 | Ga0207652_11277800 | |||
| 1085 | Ga0207646_10000050 | |||
| 1086 | Ga0207646_10001770 | |||
| 1087 | Ga0207646_10010918 | |||
| 1088 | Ga0207646_10011667 | |||
| 1089 | Ga0207646_10036233 | |||
| 1090 | Ga0207659_10156377 | |||
| 1091 | Ga0207687_10212399 | |||
| 1092 | Ga0207700_10020409 | |||
| 1093 | Ga0207700_10043799 | |||
| 1094 | Ga0207700_10049497 | |||
| 1095 | Ga0207700_10196509 | |||
| 1096 | Ga0207700_10545446 | |||
| 1097 | Ga0207700_10559077 | |||
| 1098 | Ga0207664_10006510 | |||
| 1099 | Ga0207664_10016910 | |||
| 1100 | Ga0207664_10024264 | |||
| 1101 | Ga0207664_10082736 | |||
| 1102 | Ga0207664_10263843 | |||
| 1103 | Ga0207664_10275815 | |||
| 1104 | Ga0207664_10321133 | |||
| 1105 | Ga0207664_10719683 | |||
| 1106 | Ga0207644_10039981 | |||
| 1107 | Ga0207690_10093644 | |||
| 1108 | Ga0207690_10799248 | |||
| 1109 | Ga0207669_10336888 | |||
| 1110 | Ga0207665_10005907 | |||
| 1111 | Ga0207665_10056110 | |||
| 1112 | Ga0207711_10008340 | |||
| 1113 | Ga0207689_10024235 | |||
| 1114 | Ga0207689_10750024 | |||
| 1115 | Ga0207689_11297907 | |||
| 1116 | Ga0207661_10024459 | |||
| 1117 | Ga0207661_10065601 | |||
| 1118 | Ga0207661_10141014 | |||
| 1119 | Ga0207679_10217579 | |||
| 1120 | Ga0207679_11057190 | |||
| 1121 | Ga0207667_10531724 | |||
| 1122 | Ga0207667_10848359 | |||
| 1123 | Ga0207667_10989708 | |||
| 1124 | Ga0207712_10011761 | |||
| 1125 | Ga0207712_10483478 | |||
| 1126 | Ga0207668_10008602 | |||
| 1127 | Ga0207668_10017092 | |||
| 1128 | Ga0207668_10058268 | |||
| 1129 | Ga0207668_10341457 | |||
| 1130 | Ga0207640_10510809 | |||
| 1131 | Ga0207658_10077365 | |||
| 1132 | Ga0207677_10189568 | |||
| 1133 | Ga0207677_10246824 | |||
| 1134 | Ga0207703_10000177 | |||
| 1135 | Ga0207703_10092098 | |||
| 1136 | Ga0207678_10402313 | |||
| 1137 | Ga0207678_11039196 | |||
| 1138 | Ga0207708_10046225 | |||
| 1139 | Ga0207708_10428322 | |||
| 1140 | Ga0207702_10008591 | |||
| 1141 | Ga0207702_10073374 | |||
| 1142 | Ga0207641_10001246 | |||
| 1143 | Ga0207641_10489966 | |||
| 1144 | Ga0207641_11844219 | |||
| 1145 | Ga0207676_10020765 | |||
| 1146 | Ga0207676_10124276 | |||
| 1147 | Ga0207674_10093078 | |||
| 1148 | Ga0207674_10421863 | |||
| 1149 | Ga0207674_10461013 | |||
| 1150 | Ga0207675_100440936 | |||
| 1151 | Ga0207683_10046419 | |||
| 1152 | Ga0207683_10613999 | |||
| 1153 | Ga0207683_11229930 | |||
| 1154 | Ga0207698_10005031 | |||
| 1155 | Ga0207698_10199535 | |||
| 1156 | Ga0207698_10992746 | |||
| 1157 | Ga0207428_10080588 | |||
| 1158 | Ga0207428_10147382 | |||
| 1159 | Ga0268266_10010672 | |||
| 1160 | Ga0268266_11405046 | |||
| 1161 | Ga0268265_10000167 | |||
| 1162 | Ga0268265_10222941 | |||
| 1163 | Ga0268265_10526864 | |||
| 1164 | Ga0268265_11177587 | |||
| 1165 | Ga0268265_11560763 | |||
| 1166 | Ga0268264_10189272 | |||
| 1167 | Ga0265336_10014847 | |||
| 1168 | Ga0265338_10001588 | |||
| 1169 | Ga0307511_10000924 | |||
| 1170 | Ga0316181_1259639 | |||
| 1171 | Ga0316182_1047903 | |||
| 1172 | Ga0307509_10080166 | |||
| 1173 | Ga0307408_100102913 | |||
| 1174 | Ga0307508_10008805 | |||
| 1175 | Ga0316578_10086854 | |||
| 1176 | Ga0307516_10312573 | |||
| 1177 | Ga0307405_10021951 | |||
| 1178 | Ga0307405_10092100 | |||
| 1179 | Ga0307413_11261712 | |||
| 1180 | Ga0307410_10002324 | |||
| 1181 | Ga0307406_10013416 | |||
| 1182 | Ga0307406_10129409 | |||
| 1183 | Ga0307406_10170601 | |||
| 1184 | Ga0307406_10329638 | |||
| 1185 | Ga0307407_10016132 | |||
| 1186 | Ga0307412_10117616 | |||
| 1187 | Ga0307409_100002175 | |||
| 1188 | Ga0307409_100214905 | |||
| 1189 | Ga0307409_100830985 | |||
| 1190 | Ga0307416_100001592 | |||
| 1191 | Ga0307416_100816414 | |||
| 1192 | Ga0307416_100890291 | |||
| 1193 | Ga0307414_10142211 | |||
| 1194 | Ga0307411_10542842 | |||
| 1195 | Ga0307415_100163451 | |||
| 1196 | Ga0307415_100196679 | |||
| 1197 | Ga0307415_100248294 | |||
| 1198 | Ga0316583_10031368 | |||
| 1199 | Ga0316585_10031802 | |||
| 1200 | Ga0316593_10033826 | |||
| 1201 | Ga0316596_1059218 | |||
| 1202 | Ga0373948_0045068 | |||
| 1203 | Ga0373950_0019988 | |||
| 1204 | Ga0373938_0001351 | |||
| 1205 | Ga0373938_0024287 | |||
| 1206 | Ga0373926_0138080 | |||
| 1207 | Ga0373934_0005701 | |||
| 1208 | Ga0373934_0021260 | |||
| 1209 | Ga0373934_0045353 | |||
| 1210 | Ga0373934_0080975 | |||
| 1211 | Ga0373934_0148505 | |||
| 1212 | Ga0373940_0012484 | |||
| 1213 | Ga0373940_0019963 | |||
| 1214 | Ga0373949_0109638 | |||
| 1215 | Ga0373923_0010543 | |||
| 1216 | Ga0373923_0048506 | |||
| 1217 | Ga0373932_0034341 | |||
| 1218 | Ga0373936_0057934 | |||
| 1219 | Ga0373936_0060812 | |||
| 1220 | Ga0373939_0147077 | |||
| 1221 | Ga0373945_0070583 | |||
| 1222 | Ga0373945_0086228 | |||
| 1223 | Ga0373945_0370729 | |||
| 1224 | Ga0373953_0030538 | |||
| 1225 | Ga0373953_0075136 | |||
| 1226 | Ga0373954_0025119 | |||
| 1227 | Ga0373954_0029298 | |||
| 1228 | Ga0373954_0420087 | |||
| 1229 | Ga0373956_0016570 | |||
| 1230 | Ga0373957_0003290 | |||
| 1231 | Ga0373957_0043046 | |||
| 1232 | Ga0373943_0138393 | |||
| 1233 | Ga0373943_0215829 | |||
| 1234 | Ga0373943_0358612 | |||
| 1235 | Ga0373955_0001996 | |||
| 1236 | Ga0373955_0028116 | |||
| 1237 | Ga0373955_0051109 | |||
| 1238 | Ga0373955_0174813 | |||
| 1239 | Ga0373942_0004639 | |||
| 1240 | Ga0373962_0007476 | |||
| 1241 | Ga0373924_0001561 | |||
| 1242 | Ga0373924_0004802 | |||
| 1243 | Ga0373924_0013989 | |||
| 1244 | Ga0373924_0015890 | |||
| 1245 | Ga0373935_0027621 | |||
| 1246 | Ga0373935_0073817 | |||
| 1247 | Ga0373935_0097858 | |||
| 1248 | Ga0373935_0244850 | |||
| 1249 | Ga0373935_0428118 | |||
| 1250 | Ga0373927_0097232 | |||
| 1251 | Ga0373927_0272400 | |||
| 1252 | Ga0373927_0412279 | |||
| 1253 | Ga0373933_0030947 | |||
| 1254 | Ga0373933_0053445 | |||
| 1255 | Ga0373933_0095274 | |||
| 1256 | Ga0373947_0068874 | |||
| 1257 | Ga0373947_0112435 | |||
| 1258 | Ga0373947_0116750 | |||
| 1259 | Ga0373947_0162064 | |||
| 1260 | Ga0373947_0846423 | |||
| 1261 | Ga0373937_0003111 | |||
| 1262 | Ga0373937_0035586 | |||
| 1263 | Ga0373937_0038368 | |||
| 1264 | Ga0373937_0104665 | |||
| 1265 | Ga0373937_0153395 | |||
| 1266 | Ga0373937_0409504 | |||
| 1267 | Ga0372808_010553 | |||
| 1268 | Ga0316584_0597659 | |||
| 1269 | Ga0373925_0022330 | |||
| 1270 | Ga0373925_0075923 | |||
| 1271 | Ga0373925_0097651 | |||
| 1272 | Ga0373925_0163570 | |||
| 1273 | Ga0373925_0482750 | |||
| 1274 | Ga0373925_0565430 | |||
| 1275 | Ga0395905_0216764 | |||
| 1276 | Ga0436364_0138124 | |||
| 1277 | Ga0436364_0442522 | |||
| 1278 | Ga0436365_1035924 | |||
| 1279 | Ga0439436_0004676 | |||
| 1280 | Ga0439438_007646 | |||
| 1281 | Ga0439439_0002938 | |||
| 1282 | Ga0451845_0546170 | |||
| 1283 | Ga0451853_1630264 | |||
| 1284 | Ga0439448_0155724 | |||
| 1285 | Ga0439449_0003010 | |||
| 1286 | Ga0439450_064216 | |||
| 1287 | Ga0439457_002873 | |||
| 1288 | Ga0450906_037508 | |||
| 1289 | Ga0450907_021556 | |||
| 1290 | Ga0439464_0195325 | |||
| 1291 | Ga0466969_0034210 | |||
| 1292 | Ga0466972_0351811 | |||
| 1293 | Ga0466965_0084407 | |||
| 1294 | Ga0466965_0627195 | |||
| 1295 | Ga0466966_0008603 | |||
| 1296 | Ga0466966_0058021 | |||
| 1297 | Ga0466966_0148381 | |||
| 1298 | Ga0466961_0103869 | |||
| 1299 | Ga0466961_0213071 | |||
| 1300 | Ga0466961_0230460 | |||
| 1301 | Ga0466961_0929049 | |||
| 1302 | Ga0466963_0020181 | |||
| 1303 | Ga0466963_0232742 | |||
| 1304 | Ga0466963_1035374 | |||
| 1305 | Ga0466971_0129872 | |||
| 1306 | Ga0466971_0135183 | |||
| 1307 | Ga0466971_0164182 | |||
| 1308 | Ga0466970_0029810 | |||
| 1309 | Ga0466957_0057195 | |||
| 1310 | Ga0466957_0071149 | |||
| 1311 | Ga0466957_0102417 | |||
| 1312 | Ga0466959_0052176 | |||
| 1313 | Ga0466959_0167846 | |||
| 1314 | Ga0466959_0178549 | |||
| 1315 | Ga0466958_0024286 | |||
| 1316 | Ga0466958_0237509 | |||
| 1317 | Ga0466967_0045855 | |||
| 1318 | Ga0466967_0059629 | |||
| 1319 | Ga0466967_0263618 | |||
| 1320 | Ga0466967_0451821 | |||
| 1321 | Ga0466967_0481497 | |||
| 1322 | Ga0466967_0514767 | |||
| 1323 | Ga0495592_0020623 | |||
| 1324 | Ga0495592_0040596 | |||
| 1325 | Ga0495592_0080032 | |||
| 1326 | Ga0495629_0010288 | |||
| 1327 | Ga0495629_0016085 | |||
| 1328 | Ga0495629_0234605 | |||
| 1329 | Ga0495629_0291550 | |||
| 1330 | Ga0495629_0538606 | |||
| 1331 | Ga0495641_0022020 | |||
| 1332 | Ga0495641_0040560 | |||
| 1333 | Ga0495641_0100960 | |||
| 1334 | Ga0495641_0164049 | |||
| 1335 | Ga0495651_0013776 | |||
| 1336 | Ga0495651_0023559 | |||
| 1337 | Ga0495651_0045682 | |||
| 1338 | Ga0495651_0413952 | |||
| 1339 | Ga0495653_0004085 | |||
| 1340 | Ga0495653_0099959 | |||
| 1341 | Ga0495653_0118950 | |||
| 1342 | Ga0495653_0148784 | |||
| 1343 | Ga0495653_0206246 | |||
| 1344 | Ga0495580_0006356 | |||
| 1345 | Ga0495580_0381264 | |||
| 1346 | Ga0495582_0023230 | |||
| 1347 | Ga0495582_0052440 | |||
| 1348 | Ga0495582_0113679 | |||
| 1349 | Ga0495639_0080775 | |||
| 1350 | Ga0495639_0136912 | |||
| 1351 | Ga0495662_0007495 | |||
| 1352 | Ga0495662_0030488 | |||
| 1353 | Ga0495662_0065763 | |||
| 1354 | Ga0495662_0072679 | |||
| 1355 | Ga0495664_0005749 | |||
| 1356 | Ga0495664_0072442 | |||
| 1357 | Ga0495664_0085246 | |||
| 1358 | Ga0495664_0097076 | |||
| 1359 | Ga0495664_0167894 | |||
| 1360 | Ga0495664_0420121 | |||
| 1361 | Ga0495608_0009299 | |||
| 1362 | Ga0495608_0012696 | |||
| 1363 | Ga0495608_0020023 | |||
| 1364 | Ga0495608_0020654 | |||
| 1365 | Ga0495608_0043589 | |||
| 1366 | Ga0495608_0050023 | |||
| 1367 | Ga0495608_0136905 | |||
| 1368 | Ga0495618_0023383 | |||
| 1369 | Ga0495618_0085902 | |||
| 1370 | Ga0495618_0306198 | |||
| 1371 | Ga0495628_0009159 | |||
| 1372 | Ga0495628_0035809 | |||
| 1373 | Ga0495628_0049060 | |||
| 1374 | Ga0495628_0066341 | |||
| 1375 | Ga0495628_0106678 | |||
| 1376 | Ga0495628_0194282 | |||
| 1377 | Ga0495628_0324487 | |||
| 1378 | Ga0495630_0013860 | |||
| 1379 | Ga0495630_0030486 | |||
| 1380 | Ga0495630_0072980 | |||
| 1381 | Ga0495630_0105333 | |||
| 1382 | Ga0495630_0280641 | |||
| 1383 | Ga0495630_0405390 | |||
| 1384 | Ga0495632_0093457 | |||
| 1385 | Ga0495666_0341109 | |||
| 1386 | Ga0495666_0390748 | |||
| 1387 | Ga0495652_0003756 | |||
| 1388 | Ga0495652_0063661 | |||
| 1389 | Ga0495652_0144893 | |||
| 1390 | Ga0495652_0185972 | |||
| 1391 | Ga0495652_0273393 | |||
| 1392 | Ga0495652_0611303 | |||
| 1393 | Ga0495665_0003104 | |||
| 1394 | Ga0495665_0004214 | |||
| 1395 | Ga0495665_0027326 | |||
| 1396 | Ga0495640_0008144 | |||
| 1397 | Ga0495640_0047578 | |||
| 1398 | Ga0495640_0156121 | |||
| 1399 | Ga0495640_0162392 | |||
| 1400 | Ga0495586_0049948 | |||
| 1401 | Ga0495586_0105587 | |||
| 1402 | Ga0495586_0157718 | |||
| 1403 | Ga0495586_0166583 | |||
| 1404 | Ga0495586_0503546 | |||
| 1405 | Ga0495586_0679398 | |||
| 1406 | Ga0495587_0002579 | |||
| 1407 | Ga0495587_0018810 | |||
| 1408 | Ga0495587_0033300 | |||
| 1409 | Ga0495587_0033817 | |||
| 1410 | Ga0495587_0040481 | |||
| 1411 | Ga0495597_0113877 | |||
| 1412 | Ga0495645_0013643 | |||
| 1413 | Ga0495645_0025634 | |||
| 1414 | Ga0495645_0104477 | |||
| 1415 | Ga0495645_0111937 | |||
| 1416 | Ga0495645_0117346 | |||
| 1417 | Ga0495645_0184075 | |||
| 1418 | Ga0495645_0410227 | |||
| 1419 | Ga0495667_0010662 | |||
| 1420 | Ga0495667_0013591 | |||
| 1421 | Ga0495667_0014297 | |||
| 1422 | Ga0495667_0085290 | |||
| 1423 | Ga0495667_0197927 | |||
| 1424 | Ga0495634_0016697 | |||
| 1425 | Ga0495634_0030642 | |||
| 1426 | Ga0495634_0156316 | |||
| 1427 | Ga0495634_0328990 | |||
| 1428 | Ga0495635_0011222 | |||
| 1429 | Ga0495635_0040064 | |||
| 1430 | Ga0495635_0067580 | |||
| 1431 | Ga0495635_0108917 | |||
| 1432 | Ga0495635_0173215 | |||
| 1433 | Ga0495635_0177829 | |||
| 1434 | Ga0495635_0195567 | |||
| 1435 | Ga0495657_0012582 | |||
| 1436 | Ga0495657_0058951 | |||
| 1437 | Ga0495657_0080916 | |||
| 1438 | Ga0495657_0312325 | |||
| 1439 | Ga0495599_0009205 | |||
| 1440 | Ga0495599_0011342 | |||
| 1441 | Ga0495599_0030990 | |||
| 1442 | Ga0495599_0067825 | |||
| 1443 | Ga0495599_0430113 | |||
| 1444 | Ga0495623_0002795 | |||
| 1445 | Ga0495623_0009879 | |||
| 1446 | Ga0495623_0011495 | |||
| 1447 | Ga0495623_0075479 | |||
| 1448 | Ga0495623_0146860 | |||
| 1449 | Ga0495623_0545531 | |||
| 1450 | Ga0495646_0002025 | |||
| 1451 | Ga0495646_0160005 | |||
| 1452 | Ga0495646_0234269 | |||
| 1453 | Ga0495647_0103976 | |||
| 1454 | Ga0495647_0140075 | |||
| 1455 | Ga0495658_0036611 | |||
| 1456 | Ga0495658_0037868 | |||
| 1457 | Ga0495658_0139564 | |||
| 1458 | Ga0495658_0612699 | |||
| 1459 | Ga0495613_0036904 | |||
| 1460 | Ga0495613_0096540 | |||
| 1461 | Ga0495613_0372588 | |||
| 1462 | Ga0495624_0060343 | |||
| 1463 | Ga0495624_0077958 | |||
| 1464 | Ga0495624_0143937 | |||
| 1465 | Ga0495624_0180272 | |||
| 1466 | Ga0495649_0079710 | |||
| 1467 | Ga0495600_0004594 | |||
| 1468 | Ga0495600_0015394 | |||
| 1469 | Ga0495600_0033635 | |||
| 1470 | Ga0495600_0096919 | |||
| 1471 | Ga0495600_0376377 | |||
| 1472 | Ga0495581_0033423 | |||
| 1473 | Ga0495581_0050006 | |||
| 1474 | Ga0495581_0058733 | |||
| 1475 | Ga0495604_0001885 | |||
| 1476 | Ga0495604_0040234 | |||
| 1477 | Ga0495604_0096156 | |||
| 1478 | Ga0495636_0018877 | |||
| 1479 | Ga0495674_0076760 | |||
| 1480 | Ga0495674_0079307 | |||
| 1481 | Ga0495674_0180758 | |||
| 1482 | Ga0495674_0185795 | |||
| 1483 | Ga0495674_0489817 | |||
| 1484 | Ga0495672_0208009 | |||
| 1485 | Ga0495676_0129467 | |||
| 1486 | Ga0495680_0035554 | |||
| 1487 | Ga0495680_0048111 | |||
| 1488 | Ga0495680_0093367 | |||
| 1489 | Ga0495680_0100960 | |||
| 1490 | Ga0495680_0130236 | |||
| 1491 | Ga0495675_0027173 | |||
| 1492 | Ga0495675_0037109 | |||
| 1493 | Ga0495675_0046694 | |||
| 1494 | Ga0495675_0073229 | |||
| 1495 | Ga0495675_0116145 | |||
| 1496 | Ga0495675_0220360 | |||
| 1497 | Ga0495684_0025194 | |||
| 1498 | Ga0495684_0034787 | |||
| 1499 | Ga0495684_0128051 | |||
| 1500 | Ga0495684_0128822 | |||
| 1501 | Ga0495684_0339889 | |||
| 1502 | Ga0495593_0008464 | |||
| 1503 | Ga0495593_0069045 | |||
| 1504 | Ga0495593_0083391 | |||
| 1505 | Ga0495602_0088671 | |||
| 1506 | Ga0495602_0128241 | |||
| 1507 | Ga0495614_0052326 | |||
| 1508 | Ga0496101_0506323 | |||
| 1509 | Ga0496101_0831140 | |||
| 1510 | Ga0496102_0184059 | |||
| 1511 | Ga0496102_0190783 | |||
| 1512 | Ga0496102_0579088 | |||
| 1513 | Ga0496104_0043763 | |||
| 1514 | Ga0496104_0111343 | |||
| 1515 | Ga0496104_1207925 | |||
| 1516 | Ga0496105_0098486 | |||
| 1517 | Ga0496105_0192839 | |||
| 1518 | Ga0496105_0582576 | |||
| 1519 | Ga0496106_0094702 | |||
| 1520 | Ga0496106_0205869 | |||
| 1521 | Ga0496106_0432978 | |||
| 1522 | Ga0496106_0989096 | |||
| 1523 | Ga0496107_0088449 | |||
| 1524 | Ga0496107_0170863 | |||
| 1525 | Ga0496108_0000089 | |||
| 1526 | Ga0496108_0001256 | |||
| 1527 | Ga0496108_0218297 | |||
| 1528 | Ga0496109_0028644 | |||
| 1529 | Ga0496109_0229235 | |||
| 1530 | Ga0496109_1216682 | |||
| 1531 | Ga0496110_0146583 | |||
| 1532 | Ga0496111_0302658 | |||
| 1533 | Ga0496111_0678388 | |||
| 1534 | Ga0496111_1068871 | |||
| 1535 | Ga0496116_0000531 | |||
| 1536 | Ga0496117_0009641 | |||
| 1537 | Ga0496117_0085382 | |||
| 1538 | Ga0496118_0005065 | |||
| 1539 | Ga0496118_0011579 | |||
| 1540 | Ga0496119_0010904 | |||
| 1541 | Ga0496119_0018969 | |||
| 1542 | Ga0496121_0013354 | |||
| 1543 | Ga0496124_0417991 | |||
| 1544 | Ga0496126_0097143 | |||
| 1545 | Ga0501306_016543 | |||
| 1546 | Ga0501031_0003647 | |||
| 1547 | Ga0501031_0142076 | |||
| 1548 | Ga0501032_0007954 | |||
| 1549 | Ga0501032_0021958 | |||
| 1550 | Ga0501032_0027168 | |||
| 1551 | Ga0501032_0365624 | |||
| 1552 | Ga0501032_0584412 | |||
| 1553 | Ga0501033_0005797 | |||
| 1554 | Ga0501033_0026344 | |||
| 1555 | Ga0501033_0127682 | |||
| 1556 | Ga0501034_0007085 | |||
| 1557 | Ga0501034_0016284 | |||
| 1558 | Ga0501034_0189316 | |||
| 1559 | Ga0501036_0000154 | |||
| 1560 | Ga0501036_0007966 | |||
| 1561 | Ga0501036_0053216 | |||
| 1562 | Ga0501036_0410164 | |||
| 1563 | Ga0501037_0008259 | |||
| 1564 | Ga0501037_0075979 | |||
| 1565 | Ga0501037_0076860 | |||
| 1566 | Ga0501037_0334101 | |||
| 1567 | Ga0501038_0012221 | |||
| 1568 | Ga0501038_0055608 | |||
| 1569 | Ga0501038_0072316 | |||
| 1570 | Ga0501038_0113482 | |||
| 1571 | Ga0501038_0211385 | |||
| 1572 | Ga0501038_0443406 | |||
| 1573 | Ga0501038_1176201 | |||
| 1574 | Ga0501039_0012712 | |||
| 1575 | Ga0501039_0023069 | |||
| 1576 | Ga0501039_0179217 | |||
| 1577 | Ga0501039_0378682 | |||
| 1578 | Ga0501039_0510083 | |||
| 1579 | Ga0501040_0004621 | |||
| 1580 | Ga0501041_0034922 | |||
| 1581 | Ga0501042_0004260 | |||
| 1582 | Ga0501042_0014535 | |||
| 1583 | Ga0501043_0003227 | |||
| 1584 | Ga0501043_0005709 | |||
| 1585 | Ga0501043_0070359 | |||
| 1586 | Ga0501043_0101652 | |||
| 1587 | Ga0501043_0139305 | |||
| 1588 | Ga0501043_0672747 | |||
| 1589 | Ga0501046_0002283 | |||
| 1590 | Ga0501046_0020154 | |||
| 1591 | Ga0501046_0026740 | |||
| 1592 | Ga0501046_0081810 | |||
| 1593 | Ga0501047_0000942 | |||
| 1594 | Ga0501047_0001481 | |||
| 1595 | Ga0501047_0002944 | |||
| 1596 | Ga0501047_0065463 | |||
| 1597 | Ga0501047_0366928 | |||
| 1598 | Ga0501047_0462617 | |||
| 1599 | Ga0501047_0720906 | |||
| 1600 | Ga0501048_0016037 | |||
| 1601 | Ga0501048_0032217 | |||
| 1602 | Ga0501048_0240033 | |||
| 1603 | Ga0501048_0980695 | |||
| 1604 | Ga0501067_0005755 | |||
| 1605 | Ga0501068_0002878 | |||
| 1606 | Ga0501070_0006175 | |||
| 1607 | Ga0501070_0027422 | |||
| 1608 | Ga0501071_0000622 | |||
| 1609 | Ga0501072_0011566 | |||
| 1610 | Ga0501073_0013975 | |||
| 1611 | Ga0501073_0044039 | |||
| 1612 | Ga0501074_0003420 | |||
| 1613 | Ga0501074_0004389 | |||
| 1614 | Ga0501076_0112951 | |||
| 1615 | Ga0501077_0053126 | |||
| 1616 | Ga0501077_0106942 | |||
| 1617 | Ga0501077_0496030 | |||
| 1618 | Ga0501079_0007822 | |||
| 1619 | Ga0501080_0083601 | |||
| 1620 | Ga0501080_1530389 | |||
| 1621 | Ga0501081_0357331 | |||
| 1622 | Ga0501083_0001270 | |||
| 1623 | Ga0501083_0118403 | |||
| 1624 | Ga0501035_0028772 | |||
| 1625 | Ga0501035_0095857 | |||
| 1626 | Ga0501035_0238991 | |||
| 1627 | Ga0501035_0888496 | |||
| 1628 | Ga0501044_0003451 | |||
| 1629 | Ga0501044_0035021 | |||
| 1630 | Ga0501044_0041277 | |||
| 1631 | Ga0501044_0091875 | |||
| 1632 | Ga0501044_0246014 | |||
| 1633 | Ga0501044_0327568 | |||
| 1634 | Ga0501044_0383816 | |||
| 1635 | Ga0501045_0057322 | |||
| 1636 | Ga0501045_0090932 | |||
| 1637 | Ga0501045_0185223 | |||
| 1638 | Ga0501045_0506026 | |||
| 1639 | nmdc:mga0yw44_435289_c1 | |||
| 1640 | nmdc:mga05p37_321547_c1 | |||
| 1641 | nmdc:mga05p37_37397_c1 | |||
| 1642 | nmdc:mga05p37_949924_c1 | |||
| 1643 | nmdc:mga09592_65666_c1 | |||
| 1644 | nmdc:mga0qj67_240697_c1 | |||
| 1645 | nmdc:mga0qj67_246669_c1 | |||
| 1646 | nmdc:mga0qj67_2892_c1 | |||
| 1647 | nmdc:mga08y16_198717_c1 | |||
| 1648 | nmdc:mga0n895_1155215_c1 | |||
| 1649 | nmdc:mga0n895_161895_c1 | |||
| 1650 | nmdc:mga0rr50_471666_c1 | |||
| 1651 | nmdc:mga0rr50_962047_c1 | |||
| 1652 | Ga0495601_0006464 | |||
| 1653 | Ga0495601_0049082 | |||
| 1654 | Ga0495601_0049458 | |||
| 1655 | Ga0495601_0071249 | |||
| 1656 | Ga0495601_0097978 | |||
| 1657 | Ga0495601_0249439 | |||
| 1658 | Ga0495601_0295142 | |||
| 1659 | Ga0495612_0009063 | |||
| 1660 | Ga0495612_0191873 | |||
| 1661 | Ga0495595_0037522 | |||
| 1662 | Ga0495595_0103102 | |||
| 1663 | Ga0495595_0167464 | |||
| 1664 | Ga0495619_0014393 | |||
| 1665 | Ga0495619_0022405 | |||
| 1666 | Ga0495619_0040149 | |||
| 1667 | Ga0495619_0286917 | |||
| 1668 | Ga0500583_0064530 | |||
| 1669 | Ga0500600_0121728 | |||
| 1670 | Ga0587070_053478 | |||
| 1671 | Ga0501082_0011694 | |||
| 1672 | Ga0501082_0012789 | |||
| 1673 | Ga0466962_0010959 | |||
| 1674 | Ga0466962_0044244 | |||
| 1675 | Ga0466962_0371018 | |||
| 1676 | Ga0530510_0069504 | |||
| 1677 | 2501943498 | |||
| 1678 | 2508671931 | |||
| 1679 | 2517761204 | |||
| 1680 | 2554257207 | |||
| 1681 | 2619854895 | |||
| 1682 | 2620353659 | |||
| 1683 | 2626636690 | |||
| 1684 | 2643942406 | |||
| 1685 | 2644390030 | |||
| 1686 | 2644429487 | |||
| 1687 | 2676204419 | |||
| 1688 | 2686540651 | |||
| 1689 | 2689961918 | |||
| 1690 | 2710604847 | |||
| 1691 | 2729909292 | |||
| 1692 | 2768643475 | |||
| 1693 | 2774848994 | |||
| 1694 | 2793978330 | |||
| 1695 | 2799185844 | |||
| 1696 | 2812362636 | |||
| 1697 | 2819742014 | |||
| 1698 | 2848551754 | |||
| 1699 | 2856859308 | |||
| 1700 | 2858902630 | |||
| 1701 | 2862179359 | |||
| 1702 | 2862290517 | |||
| 1703 | 2862706474 | |||
| 1704 | 2867478820 | |||
| 1705 | 2887446831 | |||
| 1706 | 2912760898 | |||
| 1707 | 2990045330 | |||
| 1708 | 2990092103 | |||
| 1709 | 2997600303 | |||
| 1710 | 3003004917 | |||
| 1711 | 3006325199 | |||
| 1712 | 649812828 | |||
| 1713 | 8002782679 | |||
| 1714 | 8002786604 | |||
| 1715 | 8003859215 | |||
| 1716 | 8008490305 | |||
| 1717 | 8025529607 | |||
| 1718 | 8047897972 | |||
| 1719 | 8048360922 | |||
| 1720 | 8048374935 | |||
| 1721 | 8048383270 | |||
| 1722 | 8053952141 | |||
| 1723 | 8054161759 | |||
| 1724 | 8054914818 | |||
| 1725 | 8054926257 | |||
| 1726 | 8056058339 | |||
| 1727 | 8056450880 | |||
| 1728 | 8056671241 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2uzh-assembly1.cif.gz_C | mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) | 0.9701 | 4 | 157 |
| 2uzh-assembly1.cif.gz_B | mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) | 0.9651 | 4 | 157 |
| 2uzh-assembly1.cif.gz_C | mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) | 0.9579 | 4 | 157 |
| 2uzh-assembly1.cif.gz_B | mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) | 0.9529 | 4 | 157 |
| 5l12-assembly1.cif.gz_A | crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant | 0.9476 | 3 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2uzhA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.964 | 4 | 157 | 3.30.1330.50 |
| 2uzhA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9517 | 4 | 157 | 3.30.1330.50 |
| 5b8fC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9395 | 4 | 157 | 3.30.1330.50 |
| af_B6TL41_66_225_3.30.1330.50 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9286 | 1 | 157 | 3.30.1330.50 |
| 1iv1B00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 0.9251 | 5 | 155 | 3.30.1330.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838FW88-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9807 | 4 | 157 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A010YGM3-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9805 | 4 | 155 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A7W1ZEY7-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.98 | 3 | 155 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A6G7YFC1-F1-model_v4 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) | 0.9799 | 4 | 156 |
GO:0008685
GO:0016114 GO:0019288 GO:0046872 |
| AF-A0A4Q8CV62-F1-model_v4 | deleted | 0.9798 | 4 | 157 |
|