F483954

General Info

Members Datasets Scaffolds Average Seq Length
864 386 1728 160

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10002642|Ga0316576_100026427
Length 191
Sequence MTPVEPEPAATGSSPSPGAAWSGGVPRVGVGVDVHPLEARRPCWVAGLEWVDEPAGCAGHSDGDVAAHAACDALLSAAGLGDLGAVVGVDRPEWAGASGLALLTEVARVVRAAGFTIGNVAVQVVGNRPKIGRRRDEAQRAMRGAIGAPVSVSGTTTDGLGLTGRGEGLAAVATAIVWQVGRHEPTRADPA

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
144 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
330 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
331 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
335 2501939600 Micromonospora sp. L5 Isolate Unclassified
336 2508501039 Frankia saprophytica CN3 Isolate Nodule
337 2517572101 Frankia sp. DC12 Isolate Nodule
338 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
339 2619618881 Frankia sp. ACN1ag Isolate Unclassified
340 2619619003 Frankia sp. CpI1-P Isolate Nodule
341 2626541554 Frankia sp. AvcI.1 Isolate Nodule
342 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
343 2643221670 Streptomyces sp. Root431 Isolate Unclassified
344 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
345 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
346 2684623036 Frankia sp. CgIM4 Isolate Nodule
347 2687453737 Frankia sp. BMG5.36 Isolate Nodule
348 2710264753 Frankia sp. KB5 Isolate Nodule
349 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
350 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
351 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
352 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
353 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
354 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
355 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
356 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
357 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
358 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
359 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
360 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
361 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
362 2867475112 Streptomyces sp. TM32 Isolate Unclassified
363 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
364 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
365 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
366 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
367 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
368 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
369 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
370 649633069 Micromonospora sp. L5 Isolate Unclassified
371 8002775197 Frankia nepalensis CN7 Isolate Nodule
372 8002784119 Frankia sp. AgB1.9 Isolate Nodule
373 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
374 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
375 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
376 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
377 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
378 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
379 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
380 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
381 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
382 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
383 8054920844 Frankia tisae Agncl-8 Isolate Nodule
384 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
385 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
386 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.06
Metatranscriptomes 0.93
Isolates 6.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 1.5
Rhizoplane 3.24
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10002642 3300031727 Bacteria 10232
2 rootL2_10080448 3300003322 Bacteria 1391
3 JGI25160J50197_1007531 3300003354 Bacteria 4248
4 JGI25160J50197_1032024 3300003354 Bacteria 1342
5 Ga0070658_10830260 3300005327 Bacteria 803
6 Ga0070658_11357014 3300005327 Bacteria 617
7 Ga0070676_10041165 3300005328 Bacteria 2677
8 Ga0070683_100033689 3300005329 Bacteria 4671
9 Ga0070683_100988027 3300005329 Bacteria 808
10 Ga0068869_100323220 3300005334 Bacteria 1252
11 Ga0068869_100832360 3300005334 Bacteria 795
12 Ga0070680_100000378 3300005336 Bacteria 30108
13 Ga0070680_100045649 3300005336 Bacteria 3563
14 Ga0070680_100449082 3300005336 Bacteria 1101
15 Ga0070682_100156247 3300005337 Bacteria 1570
16 Ga0068868_100034712 3300005338 Bacteria 3895
17 Ga0068868_101567650 3300005338 Bacteria 618
18 Ga0070660_100223051 3300005339 Bacteria 1532
19 Ga0070691_10667791 3300005341 Bacteria 620
20 Ga0070692_10638090 3300005345 Bacteria 709
21 Ga0070692_10952638 3300005345 Bacteria 597
22 Ga0070668_100003731 3300005347 Bacteria 11233
23 Ga0070668_100535101 3300005347 Bacteria 1018
24 Ga0070675_100111557 3300005354 Bacteria 2314
25 Ga0070671_100023038 3300005355 Bacteria 5090
26 Ga0070671_101587299 3300005355 Bacteria 580
27 Ga0070674_100373407 3300005356 Bacteria 1158
28 Ga0070667_100941687 3300005367 Bacteria 805
29 Ga0070709_10000441 3300005434 Bacteria 25152
30 Ga0070709_10139223 3300005434 Bacteria 1665
31 Ga0070714_100140905 3300005435 Bacteria 2164
32 Ga0070714_100263272 3300005435 Bacteria 1597
33 Ga0070713_100024518 3300005436 Bacteria 4700
34 Ga0070713_100056965 3300005436 Bacteria 3252
35 Ga0070713_100109446 3300005436 Bacteria 2407
36 Ga0070713_100136995 3300005436 Bacteria 2164
37 Ga0070710_10000167 3300005437 Bacteria 30282
38 Ga0070711_100001149 3300005439 Bacteria 14217
39 Ga0070711_100056367 3300005439 Bacteria 2717
40 Ga0070711_100793247 3300005439 Bacteria 803
41 Ga0070705_100060528 3300005440 Bacteria 2246
42 Ga0070705_100309896 3300005440 Bacteria 1135
43 Ga0070700_100046916 3300005441 Bacteria 2671
44 Ga0070700_100416559 3300005441 Bacteria 1014
45 Ga0070708_100059757 3300005445 Bacteria 3399
46 Ga0070708_100067253 3300005445 Bacteria 3217
47 Ga0070708_100918408 3300005445 Bacteria 822
48 Ga0070681_10000248 3300005458 Bacteria 42924
49 Ga0070685_10013217 3300005466 Bacteria 4349
50 Ga0070706_100004020 3300005467 Bacteria 14287
51 Ga0070706_100008150 3300005467 Bacteria 9773
52 Ga0070706_100101329 3300005467 Bacteria 2676
53 Ga0070706_100135209 3300005467 Bacteria 2301
54 Ga0070706_100365372 3300005467 Bacteria 1344
55 Ga0070706_100619557 3300005467 Bacteria 1005
56 Ga0070706_100708518 3300005467 Bacteria 933
57 Ga0070707_100000293 3300005468 Bacteria 49051
58 Ga0070707_100005742 3300005468 Bacteria 11572
59 Ga0070707_100010098 3300005468 Bacteria 8786
60 Ga0070707_100017292 3300005468 Bacteria 6779
61 Ga0070707_100623338 3300005468 Bacteria 1041
62 Ga0070698_100000106 3300005471 Bacteria 69519
63 Ga0070698_100007047 3300005471 Bacteria 12176
64 Ga0070698_100018347 3300005471 Bacteria 7367
65 Ga0070698_100019863 3300005471 Bacteria 7048
66 Ga0070698_100727356 3300005471 Bacteria 935
67 Ga0070679_100000157 3300005530 Bacteria 55087
68 Ga0070679_100378751 3300005530 Bacteria 1362
69 Ga0070684_100014045 3300005535 Bacteria 6475
70 Ga0070684_100037584 3300005535 Bacteria 4155
71 Ga0070684_100131557 3300005535 Bacteria 2257
72 Ga0070684_100781987 3300005535 Bacteria 892
73 Ga0070697_100132679 3300005536 Bacteria 2090
74 Ga0070693_100133834 3300005547 Bacteria 1553
75 Ga0070665_100003592 3300005548 Bacteria 16420
76 Ga0070665_100345281 3300005548 Bacteria 1493
77 Ga0068855_100045667 3300005563 Bacteria 5181
78 Ga0068855_100656538 3300005563 Bacteria 1126
79 Ga0068855_100909594 3300005563 Bacteria 929
80 Ga0070664_100230859 3300005564 Bacteria 1659
81 Ga0070664_100530887 3300005564 Bacteria 1087
82 Ga0068857_100101178 3300005577 Bacteria 2586
83 Ga0068857_100634179 3300005577 Bacteria 1012
84 Ga0068857_101146938 3300005577 Bacteria 751
85 Ga0068854_100035390 3300005578 Bacteria 3495
86 Ga0068856_100066806 3300005614 Bacteria 3553
87 Ga0068856_100927479 3300005614 Bacteria 889
88 Ga0068852_101473416 3300005616 Bacteria 703
89 Ga0068859_100000014 3300005617 Bacteria 280955
90 Ga0068859_100440453 3300005617 Bacteria 1399
91 Ga0068864_100411244 3300005618 Bacteria 1287
92 Ga0068861_100208166 3300005719 Bacteria 1646
93 Ga0068861_100742113 3300005719 Bacteria 916
94 Ga0068870_10245700 3300005840 Bacteria 1107
95 Ga0068870_10330077 3300005840 Bacteria 972
96 Ga0068863_100001561 3300005841 Bacteria 22636
97 Ga0068863_100518828 3300005841 Bacteria 1175
98 Ga0068863_100660614 3300005841 Bacteria 1037
99 Ga0068858_100000988 3300005842 Bacteria 29336
100 Ga0068858_100098622 3300005842 Bacteria 2724
101 Ga0068858_100128337 3300005842 Bacteria 2376
102 Ga0068858_100999291 3300005842 Bacteria 820
103 Ga0068860_100220675 3300005843 Bacteria 1841
104 Ga0068862_100000026 3300005844 Bacteria 194499
105 Ga0068862_100273324 3300005844 Bacteria 1546
106 Ga0081455_10340559 3300005937 Bacteria 1061
107 Ga0081455_10622525 3300005937 Bacteria 700
108 Ga0081540_1001613 3300005983 Bacteria 19226
109 Ga0081540_1018566 3300005983 Bacteria 4260
110 Ga0081540_1053918 3300005983 Bacteria 1968
111 Ga0070717_10019735 3300006028 Bacteria 5291
112 Ga0070717_10026460 3300006028 Bacteria 4627
113 Ga0070717_10030210 3300006028 Bacteria 4353
114 Ga0070717_10147018 3300006028 Bacteria 2036
115 Ga0070717_10434658 3300006028 Bacteria 1181
116 Ga0070717_10678247 3300006028 Bacteria 936
117 Ga0070715_10041187 3300006163 Bacteria 1934
118 Ga0070715_10060863 3300006163 Bacteria 1657
119 Ga0070716_100047672 3300006173 Bacteria 2418
120 Ga0070716_100177436 3300006173 Bacteria 1396
121 Ga0070712_100030922 3300006175 Bacteria 3603
122 Ga0070712_100074524 3300006175 Bacteria 2438
123 Ga0070712_100231617 3300006175 Bacteria 1467
124 Ga0070712_100240806 3300006175 Bacteria 1441
125 Ga0070712_100644711 3300006175 Bacteria 899
126 Ga0097621_100307456 3300006237 Bacteria 1402
127 Ga0097621_100832032 3300006237 Bacteria 857
128 Ga0075370_10513327 3300006353 Bacteria 724
129 Ga0068871_100070094 3300006358 Bacteria 2881
130 Ga0075428_100034513 3300006844 Bacteria 5579
131 Ga0075428_100118780 3300006844 Bacteria 2879
132 Ga0075428_100119380 3300006844 Bacteria 2871
133 Ga0075428_100754583 3300006844 Bacteria 1035
134 Ga0075430_100001268 3300006846 Bacteria 20341
135 Ga0075433_10033010 3300006852 Bacteria 4436
136 Ga0075434_100072963 3300006871 Bacteria 3424
137 Ga0075434_100083829 3300006871 Bacteria 3186
138 Ga0075434_100235372 3300006871 Bacteria 1851
139 Ga0075429_100056417 3300006880 Bacteria 3419
140 Ga0075429_100347609 3300006880 Bacteria 1298
141 Ga0075436_100011256 3300006914 Bacteria 6136
142 Ga0097620_100000014 3300006931 Bacteria 280955
143 Ga0097620_100440501 3300006931 Bacteria 1399
144 Ga0097620_101893390 3300006931 Bacteria 659
145 Ga0075435_100083841 3300007076 Bacteria 2621
146 Ga0075435_101007016 3300007076 Bacteria 727
147 Ga0105240_10788943 3300009093 Bacteria 1030
148 Ga0105240_11732384 3300009093 Bacteria 652
149 Ga0111539_10015815 3300009094 Bacteria 9372
150 Ga0105245_10179266 3300009098 Bacteria 2023
151 Ga0105245_10260627 3300009098 Bacteria 1687
152 Ga0105247_10002241 3300009101 Bacteria 13301
153 Ga0105247_10252732 3300009101 Bacteria 1205
154 Ga0114129_10011093 3300009147 Bacteria 12838
155 Ga0114129_10369545 3300009147 Bacteria 1896
156 Ga0114129_10416511 3300009147 Bacteria 1768
157 Ga0114129_11413429 3300009147 Bacteria 858
158 Ga0105241_10285913 3300009174 Bacteria 1410
159 Ga0105242_10026296 3300009176 Bacteria 4612
160 Ga0105248_10000023 3300009177 Bacteria 264241
161 Ga0105249_10959429 3300009553 Bacteria 923
162 Ga0105239_10031946 3300010375 Bacteria 5784
163 Ga0157371_10741787 3300013102 Bacteria 737
164 Ga0157370_10054444 3300013104 Bacteria 3814
165 Ga0157369_10134948 3300013105 Bacteria 2613
166 Ga0157369_11350249 3300013105 Bacteria 726
167 Ga0157374_10035799 3300013296 Bacteria 4543
168 Ga0157378_11451665 3300013297 Bacteria 730
169 Ga0157372_10212112 3300013307 Bacteria 2244
170 Ga0157372_10425825 3300013307 Bacteria 1547
171 Ga0157372_10510965 3300013307 Bacteria 1401
172 Ga0157372_10726498 3300013307 Bacteria 1155
173 Ga0163163_10014092 3300014325 Bacteria 7341
174 Ga0163163_10075078 3300014325 Bacteria 3374
175 Ga0157379_10000591 3300014968 Bacteria 29342
176 Ga0157379_10013216 3300014968 Bacteria 7230
177 Ga0157379_10266661 3300014968 Bacteria 1557
178 Ga0157376_10055825 3300014969 Bacteria 3297
179 Ga0206356_11141531 3300020070 Bacteria 1167
180 Ga0206353_10914106 3300020082 Bacteria 1304
181 Ga0224712_10086688 3300022467 Bacteria 1303
182 Ga0224572_1030548 3300024225 Bacteria 1029
183 Ga0207426_1006879 3300025302 Bacteria 4850
184 Ga0207426_1023061 3300025302 Bacteria 2128
185 Ga0207426_1085890 3300025302 Bacteria 843
186 Ga0207692_10824581 3300025898 Bacteria 607
187 Ga0207710_10000063 3300025900 Bacteria 163065
188 Ga0207685_10114534 3300025905 Bacteria 1174
189 Ga0207699_10002656 3300025906 Bacteria 8440
190 Ga0207699_10071582 3300025906 Bacteria 2121
191 Ga0207705_10000348 3300025909 Bacteria 41776
192 Ga0207705_10293472 3300025909 Bacteria 1246
193 Ga0207705_11029655 3300025909 Bacteria 636
194 Ga0207705_11207974 3300025909 Bacteria 580
195 Ga0207684_10000571 3300025910 Bacteria 44831
196 Ga0207684_10007405 3300025910 Bacteria 9884
197 Ga0207684_10014224 3300025910 Bacteria 6868
198 Ga0207684_10019030 3300025910 Bacteria 5874
199 Ga0207684_10115821 3300025910 Bacteria 2296
200 Ga0207684_10217467 3300025910 Bacteria 1649
201 Ga0207654_10063304 3300025911 Bacteria 2170
202 Ga0207707_10000447 3300025912 Bacteria 42935
203 Ga0207671_10116320 3300025914 Bacteria 2039
204 Ga0207671_10578103 3300025914 Bacteria 896
205 Ga0207693_10050689 3300025915 Bacteria 3259
206 Ga0207693_10068335 3300025915 Bacteria 2781
207 Ga0207693_10146872 3300025915 Bacteria 1854
208 Ga0207693_10280689 3300025915 Bacteria 1305
209 Ga0207693_10414351 3300025915 Bacteria 1053
210 Ga0207663_10001400 3300025916 Bacteria 11181
211 Ga0207663_10077291 3300025916 Bacteria 2166
212 Ga0207663_10679173 3300025916 Bacteria 814
213 Ga0207660_10000102 3300025917 Bacteria 47733
214 Ga0207660_10032415 3300025917 Bacteria 3607
215 Ga0207660_10593741 3300025917 Bacteria 902
216 Ga0207660_11035537 3300025917 Bacteria 669
217 Ga0207657_10045026 3300025919 Bacteria 3876
218 Ga0207649_11061553 3300025920 Bacteria 638
219 Ga0207652_10000182 3300025921 Bacteria 66390
220 Ga0207652_11277800 3300025921 Bacteria 636
221 Ga0207646_10000050 3300025922 Bacteria 171554
222 Ga0207646_10001770 3300025922 Bacteria 26156
223 Ga0207646_10010918 3300025922 Bacteria 8823
224 Ga0207646_10011667 3300025922 Bacteria 8497
225 Ga0207646_10036233 3300025922 Bacteria 4454
226 Ga0207659_10156377 3300025926 Bacteria 1785
227 Ga0207687_10212399 3300025927 Bacteria 1519
228 Ga0207700_10020409 3300025928 Bacteria 4500
229 Ga0207700_10043799 3300025928 Bacteria 3290
230 Ga0207700_10049497 3300025928 Bacteria 3126
231 Ga0207700_10196509 3300025928 Bacteria 1697
232 Ga0207700_10545446 3300025928 Bacteria 1029
233 Ga0207700_10559077 3300025928 Bacteria 1016
234 Ga0207664_10006510 3300025929 Bacteria 8038
235 Ga0207664_10016910 3300025929 Bacteria 5334
236 Ga0207664_10024264 3300025929 Bacteria 4556
237 Ga0207664_10082736 3300025929 Bacteria 2615
238 Ga0207664_10263843 3300025929 Bacteria 1507
239 Ga0207664_10275815 3300025929 Bacteria 1474
240 Ga0207664_10321133 3300025929 Bacteria 1366
241 Ga0207664_10719683 3300025929 Bacteria 898
242 Ga0207644_10039981 3300025931 Bacteria 3312
243 Ga0207690_10093644 3300025932 Bacteria 2129
244 Ga0207690_10799248 3300025932 Bacteria 779
245 Ga0207669_10336888 3300025937 Bacteria 1160
246 Ga0207665_10005907 3300025939 Bacteria 8148
247 Ga0207665_10056110 3300025939 Bacteria 2659
248 Ga0207711_10008340 3300025941 Bacteria 8672
249 Ga0207689_10024235 3300025942 Bacteria 5092
250 Ga0207689_10750024 3300025942 Bacteria 824
251 Ga0207689_11297907 3300025942 Bacteria 612
252 Ga0207661_10024459 3300025944 Bacteria 4579
253 Ga0207661_10065601 3300025944 Bacteria 2948
254 Ga0207661_10141014 3300025944 Bacteria 2074
255 Ga0207679_10217579 3300025945 Bacteria 1605
256 Ga0207679_11057190 3300025945 Bacteria 744
257 Ga0207667_10531724 3300025949 Bacteria 1190
258 Ga0207667_10848359 3300025949 Bacteria 908
259 Ga0207667_10989708 3300025949 Bacteria 829
260 Ga0207712_10011761 3300025961 Bacteria 5579
261 Ga0207712_10483478 3300025961 Bacteria 1056
262 Ga0207668_10008602 3300025972 Bacteria 6093
263 Ga0207668_10017092 3300025972 Bacteria 4539
264 Ga0207668_10058268 3300025972 Bacteria 2699
265 Ga0207668_10341457 3300025972 Bacteria 1249
266 Ga0207640_10510809 3300025981 Bacteria 1002
267 Ga0207658_10077365 3300025986 Bacteria 2538
268 Ga0207677_10189568 3300026023 Bacteria 1625
269 Ga0207677_10246824 3300026023 Bacteria 1447
270 Ga0207703_10000177 3300026035 Bacteria 74044
271 Ga0207703_10092098 3300026035 Bacteria 2551
272 Ga0207678_10402313 3300026067 Bacteria 1186
273 Ga0207678_11039196 3300026067 Bacteria 725
274 Ga0207708_10046225 3300026075 Bacteria 3315
275 Ga0207708_10428322 3300026075 Bacteria 1098
276 Ga0207702_10008591 3300026078 Bacteria 8612
277 Ga0207702_10073374 3300026078 Bacteria 2950
278 Ga0207641_10001246 3300026088 Bacteria 25381
279 Ga0207641_10489966 3300026088 Bacteria 1192
280 Ga0207641_11844219 3300026088 Bacteria 606
281 Ga0207676_10020765 3300026095 Bacteria 4809
282 Ga0207676_10124276 3300026095 Bacteria 2182
283 Ga0207674_10093078 3300026116 Bacteria 3003
284 Ga0207674_10421863 3300026116 Bacteria 1289
285 Ga0207674_10461013 3300026116 Bacteria 1228
286 Ga0207675_100440936 3300026118 Bacteria 1289
287 Ga0207683_10046419 3300026121 Bacteria 3801
288 Ga0207683_10613999 3300026121 Bacteria 1007
289 Ga0207683_11229930 3300026121 Bacteria 694
290 Ga0207698_10005031 3300026142 Bacteria 8107
291 Ga0207698_10199535 3300026142 Bacteria 1790
292 Ga0207698_10992746 3300026142 Bacteria 850
293 Ga0207428_10080588 3300027907 Bacteria 2543
294 Ga0207428_10147382 3300027907 Bacteria 1793
295 Ga0268266_10010672 3300028379 Bacteria 8006
296 Ga0268266_11405046 3300028379 Bacteria 673
297 Ga0268265_10000167 3300028380 Bacteria 80076
298 Ga0268265_10222941 3300028380 Bacteria 1651
299 Ga0268265_10526864 3300028380 Bacteria 1118
300 Ga0268265_11177587 3300028380 Bacteria 763
301 Ga0268265_11560763 3300028380 Bacteria 665
302 Ga0268264_10189272 3300028381 Bacteria 1875
303 Ga0265336_10014847 3300028666 Bacteria 2573
304 Ga0265338_10001588 3300028800 Bacteria 36478
305 Ga0307511_10000924 3300030521 Bacteria 31060
306 Ga0316181_1259639 3300030744 Bacteria 2042
307 Ga0316182_1047903 3300030745 Bacteria 882
308 Ga0307509_10080166 3300031507 Bacteria 3377
309 Ga0307408_100102913 3300031548 Bacteria 2179
310 Ga0307508_10008805 3300031616 Bacteria 9311
311 Ga0316578_10086854 3300031728 Bacteria 1865
312 Ga0307516_10312573 3300031730 Bacteria 1244
313 Ga0307405_10021951 3300031731 Bacteria 3599
314 Ga0307405_10092100 3300031731 Bacteria 2010
315 Ga0307413_11261712 3300031824 Bacteria 645
316 Ga0307410_10002324 3300031852 Bacteria 9141
317 Ga0307406_10013416 3300031901 Bacteria 4693
318 Ga0307406_10129409 3300031901 Bacteria 1769
319 Ga0307406_10170601 3300031901 Bacteria 1574
320 Ga0307406_10329638 3300031901 Bacteria 1184
321 Ga0307407_10016132 3300031903 Bacteria 3711
322 Ga0307412_10117616 3300031911 Bacteria 1908
323 Ga0307409_100002175 3300031995 Bacteria 10114
324 Ga0307409_100214905 3300031995 Bacteria 1731
325 Ga0307409_100830985 3300031995 Bacteria 933
326 Ga0307416_100001592 3300032002 Bacteria 12462
327 Ga0307416_100816414 3300032002 Bacteria 1029
328 Ga0307416_100890291 3300032002 Bacteria 990
329 Ga0307414_10142211 3300032004 Bacteria 1880
330 Ga0307411_10542842 3300032005 Bacteria 990
331 Ga0307415_100163451 3300032126 Bacteria 1728
332 Ga0307415_100196679 3300032126 Bacteria 1596
333 Ga0307415_100248294 3300032126 Bacteria 1444
334 Ga0316583_10031368 3300032133 Bacteria 1892
335 Ga0316585_10031802 3300032137 Bacteria 1660
336 Ga0316593_10033826 3300032168 Bacteria 1675
337 Ga0316596_1059218 3300033541 Bacteria 1021
338 Ga0373948_0045068 3300034817 Bacteria 933
339 Ga0373950_0019988 3300034818 Bacteria 1174
340 Ga0373938_0001351 3300034957 Bacteria 3933
341 Ga0373938_0024287 3300034957 Bacteria 1252
342 Ga0373926_0138080 3300035083 Bacteria 925
343 Ga0373934_0005701 3300035086 Bacteria 4610
344 Ga0373934_0021260 3300035086 Bacteria 2498
345 Ga0373934_0045353 3300035086 Bacteria 1738
346 Ga0373934_0080975 3300035086 Bacteria 1304
347 Ga0373934_0148505 3300035086 Bacteria 959
348 Ga0373940_0012484 3300035088 Bacteria 2035
349 Ga0373940_0019963 3300035088 Bacteria 1698
350 Ga0373949_0109638 3300035090 Bacteria 765
351 Ga0373923_0010543 3300035111 Bacteria 3365
352 Ga0373923_0048506 3300035111 Bacteria 1773
353 Ga0373932_0034341 3300035112 Bacteria 1428
354 Ga0373936_0057934 3300035113 Bacteria 1576
355 Ga0373936_0060812 3300035113 Bacteria 1541
356 Ga0373939_0147077 3300035114 Bacteria 854
357 Ga0373945_0070583 3300035116 Bacteria 1321
358 Ga0373945_0086228 3300035116 Bacteria 1210
359 Ga0373945_0370729 3300035116 Bacteria 623
360 Ga0373953_0030538 3300035117 Bacteria 2090
361 Ga0373953_0075136 3300035117 Bacteria 1398
362 Ga0373954_0025119 3300035118 Bacteria 2722
363 Ga0373954_0029298 3300035118 Bacteria 2534
364 Ga0373954_0420087 3300035118 Bacteria 661
365 Ga0373956_0016570 3300035119 Bacteria 3096
366 Ga0373957_0003290 3300035120 Bacteria 4758
367 Ga0373957_0043046 3300035120 Bacteria 1705
368 Ga0373943_0138393 3300035170 Bacteria 1309
369 Ga0373943_0215829 3300035170 Bacteria 1067
370 Ga0373943_0358612 3300035170 Bacteria 836
371 Ga0373955_0001996 3300035172 Bacteria 8807
372 Ga0373955_0028116 3300035172 Bacteria 2913
373 Ga0373955_0051109 3300035172 Bacteria 2250
374 Ga0373955_0174813 3300035172 Bacteria 1272
375 Ga0373942_0004639 3300035207 Bacteria 3185
376 Ga0373962_0007476 3300035242 Bacteria 2677
377 Ga0373924_0001561 3300035410 Bacteria 7480
378 Ga0373924_0004802 3300035410 Bacteria 4748
379 Ga0373924_0013989 3300035410 Bacteria 3024
380 Ga0373924_0015890 3300035410 Bacteria 2867
381 Ga0373935_0027621 3300035692 Bacteria 3508
382 Ga0373935_0073817 3300035692 Bacteria 2204
383 Ga0373935_0097858 3300035692 Bacteria 1930
384 Ga0373935_0244850 3300035692 Bacteria 1253
385 Ga0373935_0428118 3300035692 Bacteria 953
386 Ga0373927_0097232 3300035695 Bacteria 1914
387 Ga0373927_0272400 3300035695 Bacteria 1113
388 Ga0373927_0412279 3300035695 Bacteria 891
389 Ga0373933_0030947 3300035724 Bacteria 3101
390 Ga0373933_0053445 3300035724 Bacteria 2419
391 Ga0373933_0095274 3300035724 Bacteria 1841
392 Ga0373947_0068874 3300035725 Bacteria 2165
393 Ga0373947_0112435 3300035725 Bacteria 1722
394 Ga0373947_0116750 3300035725 Bacteria 1692
395 Ga0373947_0162064 3300035725 Bacteria 1447
396 Ga0373947_0846423 3300035725 Bacteria 624
397 Ga0373937_0003111 3300036401 Bacteria 13875
398 Ga0373937_0035586 3300036401 Bacteria 4533
399 Ga0373937_0038368 3300036401 Bacteria 4364
400 Ga0373937_0104665 3300036401 Bacteria 2629
401 Ga0373937_0153395 3300036401 Bacteria 2158
402 Ga0373937_0409504 3300036401 Bacteria 1286
403 Ga0372808_010553 3300036459 Bacteria 1301
404 Ga0316584_0597659 3300036712 Bacteria 765
405 Ga0373925_0022330 3300037068 Bacteria 4615
406 Ga0373925_0075923 3300037068 Bacteria 2547
407 Ga0373925_0097651 3300037068 Bacteria 2253
408 Ga0373925_0163570 3300037068 Bacteria 1754
409 Ga0373925_0482750 3300037068 Bacteria 1016
410 Ga0373925_0565430 3300037068 Bacteria 935
411 Ga0395905_0216764 3300037471 Bacteria 1792
412 Ga0436364_0138124 3300037853 Bacteria 7843
413 Ga0436364_0442522 3300037853 Bacteria 713
414 Ga0436365_1035924 3300039437 Bacteria 1013
415 Ga0439436_0004676 3300041404 Bacteria 4199
416 Ga0439438_007646 3300041405 Bacteria 3670
417 Ga0439439_0002938 3300041406 Bacteria 3701
418 Ga0451845_0546170 3300041501 Bacteria 1171
419 Ga0451853_1630264 3300041512 Bacteria 1477
420 Ga0439448_0155724 3300042005 Bacteria 794
421 Ga0439449_0003010 3300042007 Bacteria 6575
422 Ga0439450_064216 3300042008 Unclassified 892
423 Ga0439457_002873 3300042014 Bacteria 4799
424 Ga0450906_037508 3300042145 Bacteria 855
425 Ga0450907_021556 3300042146 Bacteria 1084
426 Ga0439464_0195325 3300042439 Bacteria 644
427 Ga0466969_0034210 3300044656 Bacteria 2575
428 Ga0466972_0351811 3300044658 Bacteria 689
429 Ga0466965_0084407 3300044683 Bacteria 1609
430 Ga0466965_0627195 3300044683 Bacteria 612
431 Ga0466966_0008603 3300044684 Bacteria 6757
432 Ga0466966_0058021 3300044684 Bacteria 2447
433 Ga0466966_0148381 3300044684 Bacteria 1431
434 Ga0466961_0103869 3300044693 Bacteria 1789
435 Ga0466961_0213071 3300044693 Bacteria 1192
436 Ga0466961_0230460 3300044693 Bacteria 1140
437 Ga0466961_0929049 3300044693 Bacteria 518
438 Ga0466963_0020181 3300044694 Bacteria 4189
439 Ga0466963_0232742 3300044694 Bacteria 1291
440 Ga0466963_1035374 3300044694 Bacteria 578
441 Ga0466971_0129872 3300044719 Bacteria 1169
442 Ga0466971_0135183 3300044719 Bacteria 1146
443 Ga0466971_0164182 3300044719 Bacteria 1040
444 Ga0466970_0029810 3300044765 Bacteria 2876
445 Ga0466957_0057195 3300044842 Bacteria 2386
446 Ga0466957_0071149 3300044842 Bacteria 2151
447 Ga0466957_0102417 3300044842 Bacteria 1806
448 Ga0466959_0052176 3300045049 Bacteria 2996
449 Ga0466959_0167846 3300045049 Bacteria 1540
450 Ga0466959_0178549 3300045049 Bacteria 1486
451 Ga0466958_0024286 3300045836 Bacteria 3566
452 Ga0466958_0237509 3300045836 Bacteria 1164
453 Ga0466967_0045855 3300045976 Bacteria 3802
454 Ga0466967_0059629 3300045976 Bacteria 3379
455 Ga0466967_0263618 3300045976 Bacteria 1649
456 Ga0466967_0451821 3300045976 Bacteria 1256
457 Ga0466967_0481497 3300045976 Bacteria 1216
458 Ga0466967_0514767 3300045976 Bacteria 1175
459 Ga0495592_0020623 3300046454 Bacteria 5015
460 Ga0495592_0040596 3300046454 Bacteria 3491
461 Ga0495592_0080032 3300046454 Bacteria 2364
462 Ga0495629_0010288 3300046459 Bacteria 6813
463 Ga0495629_0016085 3300046459 Bacteria 5374
464 Ga0495629_0234605 3300046459 Bacteria 1264
465 Ga0495629_0291550 3300046459 Bacteria 1118
466 Ga0495629_0538606 3300046459 Bacteria 784
467 Ga0495641_0022020 3300046461 Bacteria 3197
468 Ga0495641_0040560 3300046461 Bacteria 2164
469 Ga0495641_0100960 3300046461 Bacteria 1287
470 Ga0495641_0164049 3300046461 Bacteria 994
471 Ga0495651_0013776 3300046462 Bacteria 6252
472 Ga0495651_0023559 3300046462 Bacteria 4786
473 Ga0495651_0045682 3300046462 Bacteria 3392
474 Ga0495651_0413952 3300046462 Bacteria 877
475 Ga0495653_0004085 3300046463 Bacteria 11805
476 Ga0495653_0099959 3300046463 Bacteria 2103
477 Ga0495653_0118950 3300046463 Bacteria 1886
478 Ga0495653_0148784 3300046463 Bacteria 1638
479 Ga0495653_0206246 3300046463 Bacteria 1330
480 Ga0495580_0006356 3300046472 Bacteria 9639
481 Ga0495580_0381264 3300046472 Bacteria 952
482 Ga0495582_0023230 3300046473 Bacteria 3392
483 Ga0495582_0052440 3300046473 Bacteria 2249
484 Ga0495582_0113679 3300046473 Bacteria 1521
485 Ga0495639_0080775 3300046475 Bacteria 1514
486 Ga0495639_0136912 3300046475 Bacteria 1175
487 Ga0495662_0007495 3300046476 Bacteria 5393
488 Ga0495662_0030488 3300046476 Bacteria 2603
489 Ga0495662_0065763 3300046476 Bacteria 1752
490 Ga0495662_0072679 3300046476 Bacteria 1668
491 Ga0495664_0005749 3300046477 Bacteria 6829
492 Ga0495664_0072442 3300046477 Bacteria 2058
493 Ga0495664_0085246 3300046477 Bacteria 1896
494 Ga0495664_0097076 3300046477 Bacteria 1773
495 Ga0495664_0167894 3300046477 Bacteria 1331
496 Ga0495664_0420121 3300046477 Bacteria 802
497 Ga0495608_0009299 3300046511 Bacteria 6872
498 Ga0495608_0012696 3300046511 Bacteria 5844
499 Ga0495608_0020023 3300046511 Bacteria 4600
500 Ga0495608_0020654 3300046511 Bacteria 4524
501 Ga0495608_0043589 3300046511 Bacteria 2997
502 Ga0495608_0050023 3300046511 Bacteria 2773
503 Ga0495608_0136905 3300046511 Bacteria 1564
504 Ga0495618_0023383 3300046514 Bacteria 3820
505 Ga0495618_0085902 3300046514 Bacteria 2011
506 Ga0495618_0306198 3300046514 Bacteria 986
507 Ga0495628_0009159 3300046516 Bacteria 8462
508 Ga0495628_0035809 3300046516 Bacteria 3987
509 Ga0495628_0049060 3300046516 Bacteria 3343
510 Ga0495628_0066341 3300046516 Bacteria 2821
511 Ga0495628_0106678 3300046516 Bacteria 2157
512 Ga0495628_0194282 3300046516 Bacteria 1531
513 Ga0495628_0324487 3300046516 Bacteria 1135
514 Ga0495630_0013860 3300046517 Bacteria 5863
515 Ga0495630_0030486 3300046517 Bacteria 4012
516 Ga0495630_0072980 3300046517 Bacteria 2584
517 Ga0495630_0105333 3300046517 Bacteria 2135
518 Ga0495630_0280641 3300046517 Bacteria 1272
519 Ga0495630_0405390 3300046517 Bacteria 1045
520 Ga0495632_0093457 3300046519 Bacteria 1423
521 Ga0495666_0341109 3300046526 Bacteria 675
522 Ga0495666_0390748 3300046526 Bacteria 625
523 Ga0495652_0003756 3300046529 Bacteria 14860
524 Ga0495652_0063661 3300046529 Bacteria 3104
525 Ga0495652_0144893 3300046529 Bacteria 1863
526 Ga0495652_0185972 3300046529 Bacteria 1589
527 Ga0495652_0273393 3300046529 Bacteria 1240
528 Ga0495652_0611303 3300046529 Bacteria 742
529 Ga0495665_0003104 3300046531 Bacteria 8989
530 Ga0495665_0004214 3300046531 Bacteria 7765
531 Ga0495665_0027326 3300046531 Bacteria 3063
532 Ga0495640_0008144 3300046533 Bacteria 8232
533 Ga0495640_0047578 3300046533 Bacteria 2967
534 Ga0495640_0156121 3300046533 Bacteria 1464
535 Ga0495640_0162392 3300046533 Bacteria 1430
536 Ga0495586_0049948 3300046535 Bacteria 2262
537 Ga0495586_0105587 3300046535 Bacteria 1566
538 Ga0495586_0157718 3300046535 Bacteria 1279
539 Ga0495586_0166583 3300046535 Bacteria 1244
540 Ga0495586_0503546 3300046535 Bacteria 699
541 Ga0495586_0679398 3300046535 Bacteria 595
542 Ga0495587_0002579 3300046536 Bacteria 12116
543 Ga0495587_0018810 3300046536 Bacteria 4282
544 Ga0495587_0033300 3300046536 Bacteria 3111
545 Ga0495587_0033817 3300046536 Bacteria 3084
546 Ga0495587_0040481 3300046536 Bacteria 2785
547 Ga0495597_0113877 3300046542 Bacteria 1132
548 Ga0495645_0013643 3300046543 Bacteria 5755
549 Ga0495645_0025634 3300046543 Bacteria 4281
550 Ga0495645_0104477 3300046543 Bacteria 2011
551 Ga0495645_0111937 3300046543 Bacteria 1930
552 Ga0495645_0117346 3300046543 Bacteria 1877
553 Ga0495645_0184075 3300046543 Bacteria 1428
554 Ga0495645_0410227 3300046543 Bacteria 861
555 Ga0495667_0010662 3300046559 Bacteria 6212
556 Ga0495667_0013591 3300046559 Bacteria 5504
557 Ga0495667_0014297 3300046559 Bacteria 5361
558 Ga0495667_0085290 3300046559 Bacteria 2049
559 Ga0495667_0197927 3300046559 Bacteria 1286
560 Ga0495634_0016697 3300046642 Bacteria 5245
561 Ga0495634_0030642 3300046642 Bacteria 3713
562 Ga0495634_0156316 3300046642 Bacteria 1439
563 Ga0495634_0328990 3300046642 Bacteria 918
564 Ga0495635_0011222 3300046663 Bacteria 6281
565 Ga0495635_0040064 3300046663 Bacteria 3238
566 Ga0495635_0067580 3300046663 Bacteria 2451
567 Ga0495635_0108917 3300046663 Bacteria 1892
568 Ga0495635_0173215 3300046663 Bacteria 1467
569 Ga0495635_0177829 3300046663 Bacteria 1446
570 Ga0495635_0195567 3300046663 Bacteria 1372
571 Ga0495657_0012582 3300046675 Bacteria 6279
572 Ga0495657_0058951 3300046675 Bacteria 2547
573 Ga0495657_0080916 3300046675 Bacteria 2101
574 Ga0495657_0312325 3300046675 Bacteria 935
575 Ga0495599_0009205 3300046678 Bacteria 6027
576 Ga0495599_0011342 3300046678 Bacteria 5473
577 Ga0495599_0030990 3300046678 Bacteria 3356
578 Ga0495599_0067825 3300046678 Bacteria 2227
579 Ga0495599_0430113 3300046678 Bacteria 783
580 Ga0495623_0002795 3300046679 Bacteria 11517
581 Ga0495623_0009879 3300046679 Bacteria 6182
582 Ga0495623_0011495 3300046679 Bacteria 5730
583 Ga0495623_0075479 3300046679 Bacteria 2093
584 Ga0495623_0146860 3300046679 Bacteria 1397
585 Ga0495623_0545531 3300046679 Bacteria 607
586 Ga0495646_0002025 3300046680 Bacteria 12277
587 Ga0495646_0160005 3300046680 Bacteria 1247
588 Ga0495646_0234269 3300046680 Bacteria 988
589 Ga0495647_0103976 3300046681 Bacteria 1179
590 Ga0495647_0140075 3300046681 Bacteria 1031
591 Ga0495658_0036611 3300046683 Bacteria 2708
592 Ga0495658_0037868 3300046683 Bacteria 2668
593 Ga0495658_0139564 3300046683 Bacteria 1481
594 Ga0495658_0612699 3300046683 Bacteria 697
595 Ga0495613_0036904 3300046689 Bacteria 3623
596 Ga0495613_0096540 3300046689 Bacteria 2137
597 Ga0495613_0372588 3300046689 Bacteria 977
598 Ga0495624_0060343 3300046690 Bacteria 2378
599 Ga0495624_0077958 3300046690 Bacteria 2055
600 Ga0495624_0143937 3300046690 Bacteria 1459
601 Ga0495624_0180272 3300046690 Bacteria 1287
602 Ga0495649_0079710 3300046694 Bacteria 1751
603 Ga0495600_0004594 3300046809 Bacteria 8270
604 Ga0495600_0015394 3300046809 Bacteria 4834
605 Ga0495600_0033635 3300046809 Bacteria 3327
606 Ga0495600_0096919 3300046809 Bacteria 1922
607 Ga0495600_0376377 3300046809 Bacteria 886
608 Ga0495581_0033423 3300047315 Bacteria 2977
609 Ga0495581_0050006 3300047315 Bacteria 2414
610 Ga0495581_0058733 3300047315 Bacteria 2221
611 Ga0495604_0001885 3300047317 Bacteria 17044
612 Ga0495604_0040234 3300047317 Bacteria 3671
613 Ga0495604_0096156 3300047317 Bacteria 2186
614 Ga0495636_0018877 3300047318 Bacteria 2768
615 Ga0495674_0076760 3300047319 Bacteria 2873
616 Ga0495674_0079307 3300047319 Bacteria 2819
617 Ga0495674_0180758 3300047319 Bacteria 1756
618 Ga0495674_0185795 3300047319 Bacteria 1729
619 Ga0495674_0489817 3300047319 Bacteria 984
620 Ga0495672_0208009 3300047320 Bacteria 974
621 Ga0495676_0129467 3300047321 Bacteria 1824
622 Ga0495680_0035554 3300047322 Bacteria 4011
623 Ga0495680_0048111 3300047322 Bacteria 3350
624 Ga0495680_0093367 3300047322 Bacteria 2252
625 Ga0495680_0100960 3300047322 Bacteria 2149
626 Ga0495680_0130236 3300047322 Bacteria 1849
627 Ga0495675_0027173 3300047444 Bacteria 3647
628 Ga0495675_0037109 3300047444 Bacteria 3104
629 Ga0495675_0046694 3300047444 Bacteria 2757
630 Ga0495675_0073229 3300047444 Bacteria 2160
631 Ga0495675_0116145 3300047444 Bacteria 1668
632 Ga0495675_0220360 3300047444 Bacteria 1148
633 Ga0495684_0025194 3300047471 Bacteria 4573
634 Ga0495684_0034787 3300047471 Bacteria 3865
635 Ga0495684_0128051 3300047471 Bacteria 1908
636 Ga0495684_0128822 3300047471 Bacteria 1902
637 Ga0495684_0339889 3300047471 Bacteria 1068
638 Ga0495593_0008464 3300047673 Bacteria 5980
639 Ga0495593_0069045 3300047673 Bacteria 1838
640 Ga0495593_0083391 3300047673 Bacteria 1651
641 Ga0495602_0088671 3300048088 Bacteria 2574
642 Ga0495602_0128241 3300048088 Bacteria 2028
643 Ga0495614_0052326 3300048089 Bacteria 1750
644 Ga0496101_0506323 3300048904 Bacteria 954
645 Ga0496101_0831140 3300048904 Bacteria 728
646 Ga0496102_0184059 3300048905 Bacteria 1968
647 Ga0496102_0190783 3300048905 Bacteria 1931
648 Ga0496102_0579088 3300048905 Bacteria 1045
649 Ga0496104_0043763 3300048907 Bacteria 4205
650 Ga0496104_0111343 3300048907 Bacteria 2625
651 Ga0496104_1207925 3300048907 Bacteria 659
652 Ga0496105_0098486 3300048908 Bacteria 2414
653 Ga0496105_0192839 3300048908 Bacteria 1665
654 Ga0496105_0582576 3300048908 Bacteria 870
655 Ga0496106_0094702 3300048909 Bacteria 2309
656 Ga0496106_0205869 3300048909 Bacteria 1567
657 Ga0496106_0432978 3300048909 Bacteria 1057
658 Ga0496106_0989096 3300048909 Bacteria 662
659 Ga0496107_0088449 3300048910 Bacteria 2261
660 Ga0496107_0170863 3300048910 Bacteria 1613
661 Ga0496108_0000089 3300048911 Bacteria 97102
662 Ga0496108_0001256 3300048911 Bacteria 19832
663 Ga0496108_0218297 3300048911 Bacteria 1656
664 Ga0496109_0028644 3300048912 Bacteria 4984
665 Ga0496109_0229235 3300048912 Bacteria 1747
666 Ga0496109_1216682 3300048912 Bacteria 690
667 Ga0496110_0146583 3300048913 Bacteria 2135
668 Ga0496111_0302658 3300048914 Bacteria 1185
669 Ga0496111_0678388 3300048914 Bacteria 751
670 Ga0496111_1068871 3300048914 Bacteria 576
671 Ga0496116_0000531 3300048919 Bacteria 51345
672 Ga0496117_0009641 3300048920 Bacteria 8934
673 Ga0496117_0085382 3300048920 Bacteria 2055
674 Ga0496118_0005065 3300048921 Bacteria 15171
675 Ga0496118_0011579 3300048921 Bacteria 8591
676 Ga0496119_0010904 3300048922 Bacteria 7593
677 Ga0496119_0018969 3300048922 Bacteria 5092
678 Ga0496121_0013354 3300048924 Bacteria 8834
679 Ga0496124_0417991 3300048927 Bacteria 925
680 Ga0496126_0097143 3300048929 Bacteria 2582
681 Ga0501306_016543 3300049127 Bacteria 992
682 Ga0501031_0003647 3300049568 Bacteria 9910
683 Ga0501031_0142076 3300049568 Bacteria 1569
684 Ga0501032_0007954 3300049569 Bacteria 7725
685 Ga0501032_0021958 3300049569 Bacteria 4431
686 Ga0501032_0027168 3300049569 Bacteria 3934
687 Ga0501032_0365624 3300049569 Bacteria 928
688 Ga0501032_0584412 3300049569 Bacteria 711
689 Ga0501033_0005797 3300049570 Bacteria 9720
690 Ga0501033_0026344 3300049570 Bacteria 4376
691 Ga0501033_0127682 3300049570 Bacteria 1843
692 Ga0501034_0007085 3300049571 Bacteria 11960
693 Ga0501034_0016284 3300049571 Bacteria 7632
694 Ga0501034_0189316 3300049571 Bacteria 2020
695 Ga0501036_0000154 3300049572 Bacteria 45221
696 Ga0501036_0007966 3300049572 Bacteria 8671
697 Ga0501036_0053216 3300049572 Bacteria 3428
698 Ga0501036_0410164 3300049572 Bacteria 1130
699 Ga0501037_0008259 3300049573 Bacteria 7632
700 Ga0501037_0075979 3300049573 Bacteria 2439
701 Ga0501037_0076860 3300049573 Bacteria 2423
702 Ga0501037_0334101 3300049573 Bacteria 1047
703 Ga0501038_0012221 3300049574 Bacteria 7839
704 Ga0501038_0055608 3300049574 Bacteria 3399
705 Ga0501038_0072316 3300049574 Bacteria 2922
706 Ga0501038_0113482 3300049574 Bacteria 2242
707 Ga0501038_0211385 3300049574 Bacteria 1552
708 Ga0501038_0443406 3300049574 Bacteria 999
709 Ga0501038_1176201 3300049574 Bacteria 558
710 Ga0501039_0012712 3300049575 Bacteria 6432
711 Ga0501039_0023069 3300049575 Bacteria 4774
712 Ga0501039_0179217 3300049575 Bacteria 1666
713 Ga0501039_0378682 3300049575 Bacteria 1112
714 Ga0501039_0510083 3300049575 Bacteria 944
715 Ga0501040_0004621 3300049576 Bacteria 8930
716 Ga0501041_0034922 3300049577 Bacteria 3045
717 Ga0501042_0004260 3300049578 Bacteria 9107
718 Ga0501042_0014535 3300049578 Bacteria 5375
719 Ga0501043_0003227 3300049579 Bacteria 13459
720 Ga0501043_0005709 3300049579 Bacteria 10024
721 Ga0501043_0070359 3300049579 Bacteria 2748
722 Ga0501043_0101652 3300049579 Bacteria 2259
723 Ga0501043_0139305 3300049579 Bacteria 1900
724 Ga0501043_0672747 3300049579 Bacteria 758
725 Ga0501046_0002283 3300049580 Bacteria 18080
726 Ga0501046_0020154 3300049580 Bacteria 5519
727 Ga0501046_0026740 3300049580 Bacteria 4713
728 Ga0501046_0081810 3300049580 Bacteria 2494
729 Ga0501047_0000942 3300049581 Bacteria 29462
730 Ga0501047_0001481 3300049581 Bacteria 22897
731 Ga0501047_0002944 3300049581 Bacteria 16139
732 Ga0501047_0065463 3300049581 Bacteria 3503
733 Ga0501047_0366928 3300049581 Bacteria 1275
734 Ga0501047_0462617 3300049581 Bacteria 1097
735 Ga0501047_0720906 3300049581 Bacteria 814
736 Ga0501048_0016037 3300049582 Bacteria 5524
737 Ga0501048_0032217 3300049582 Bacteria 3788
738 Ga0501048_0240033 3300049582 Bacteria 1286
739 Ga0501048_0980695 3300049582 Bacteria 608
740 Ga0501067_0005755 3300049583 Bacteria 6878
741 Ga0501068_0002878 3300049584 Bacteria 9163
742 Ga0501070_0006175 3300049586 Bacteria 10207
743 Ga0501070_0027422 3300049586 Bacteria 4778
744 Ga0501071_0000622 3300049587 Bacteria 18372
745 Ga0501072_0011566 3300049588 Bacteria 6743
746 Ga0501073_0013975 3300049589 Bacteria 5835
747 Ga0501073_0044039 3300049589 Bacteria 3145
748 Ga0501074_0003420 3300049590 Bacteria 11243
749 Ga0501074_0004389 3300049590 Bacteria 10081
750 Ga0501076_0112951 3300049592 Bacteria 2197
751 Ga0501077_0053126 3300049593 Bacteria 2572
752 Ga0501077_0106942 3300049593 Bacteria 1773
753 Ga0501077_0496030 3300049593 Bacteria 783
754 Ga0501079_0007822 3300049741 Bacteria 8094
755 Ga0501080_0083601 3300049742 Bacteria 2965
756 Ga0501080_1530389 3300049742 Bacteria 566
757 Ga0501081_0357331 3300049743 Bacteria 1077
758 Ga0501083_0001270 3300049744 Bacteria 17091
759 Ga0501083_0118403 3300049744 Bacteria 1738
760 Ga0501035_0028772 3300049822 Bacteria 5070
761 Ga0501035_0095857 3300049822 Bacteria 2607
762 Ga0501035_0238991 3300049822 Bacteria 1545
763 Ga0501035_0888496 3300049822 Bacteria 706
764 Ga0501044_0003451 3300049823 Bacteria 17804
765 Ga0501044_0035021 3300049823 Bacteria 5259
766 Ga0501044_0041277 3300049823 Bacteria 4803
767 Ga0501044_0091875 3300049823 Bacteria 3061
768 Ga0501044_0246014 3300049823 Bacteria 1731
769 Ga0501044_0327568 3300049823 Bacteria 1455
770 Ga0501044_0383816 3300049823 Bacteria 1319
771 Ga0501045_0057322 3300049824 Bacteria 2850
772 Ga0501045_0090932 3300049824 Bacteria 2256
773 Ga0501045_0185223 3300049824 Bacteria 1551
774 Ga0501045_0506026 3300049824 Bacteria 897
775 nmdc:mga0yw44_435289_c1 3300050492 Bacteria 888
776 nmdc:mga05p37_321547_c1 3300050507 Bacteria 1831
777 nmdc:mga05p37_37397_c1 3300050507 Bacteria 5951
778 nmdc:mga05p37_949924_c1 3300050507 Bacteria 920
779 nmdc:mga09592_65666_c1 3300050508 Bacteria 3074
780 nmdc:mga0qj67_240697_c1 3300050509 Bacteria 1468
781 nmdc:mga0qj67_246669_c1 3300050509 Bacteria 1449
782 nmdc:mga0qj67_2892_c1 3300050509 Bacteria 12324
783 nmdc:mga08y16_198717_c1 3300050511 Bacteria 2078
784 nmdc:mga0n895_1155215_c1 3300050512 Bacteria 750
785 nmdc:mga0n895_161895_c1 3300050512 Bacteria 2270
786 nmdc:mga0rr50_471666_c1 3300050513 Bacteria 1065
787 nmdc:mga0rr50_962047_c1 3300050513 Bacteria 728
788 Ga0495601_0006464 3300053077 Bacteria 6854
789 Ga0495601_0049082 3300053077 Bacteria 2660
790 Ga0495601_0049458 3300053077 Bacteria 2650
791 Ga0495601_0071249 3300053077 Bacteria 2219
792 Ga0495601_0097978 3300053077 Bacteria 1892
793 Ga0495601_0249439 3300053077 Bacteria 1159
794 Ga0495601_0295142 3300053077 Bacteria 1056
795 Ga0495612_0009063 3300053078 Bacteria 4036
796 Ga0495612_0191873 3300053078 Bacteria 899
797 Ga0495595_0037522 3300053084 Bacteria 2204
798 Ga0495595_0103102 3300053084 Bacteria 1378
799 Ga0495595_0167464 3300053084 Bacteria 1086
800 Ga0495619_0014393 3300053085 Bacteria 4995
801 Ga0495619_0022405 3300053085 Bacteria 4042
802 Ga0495619_0040149 3300053085 Bacteria 3058
803 Ga0495619_0286917 3300053085 Bacteria 1140
804 Ga0500583_0064530 3300053092 Bacteria 1737
805 Ga0500600_0121728 3300053149 Bacteria 1343
806 Ga0587070_053478 3300059491 Bacteria 813
807 Ga0501082_0011694 3300060353 Bacteria 7546
808 Ga0501082_0012789 3300060353 Bacteria 7213
809 Ga0466962_0010959 3300061719 Bacteria 4362
810 Ga0466962_0044244 3300061719 Bacteria 2129
811 Ga0466962_0371018 3300061719 Bacteria 714
812 Ga0530510_0069504 3300061734 Bacteria 2555
813 2501943498 2501939600 Bacteria 6907073
814 2508671931 2508501039 Bacteria 9978592
815 2517761204 2517572101 Bacteria 6884336
816 2554257207 2554235005 Bacteria 6457341
817 2619854895 2619618881 Bacteria 7521104
818 2620353659 2619619003 Bacteria 7619552
819 2626636690 2626541554 Bacteria 7741902
820 2643942406 2643221587 Bacteria 7586415
821 2644390030 2643221670 Bacteria 6497041
822 2644429487 2643221677 Bacteria 7584031
823 2676204419 2675902999 Bacteria 9438463
824 2686540651 2684623036 Bacteria 5199090
825 2689961918 2687453737 Bacteria 11203906
826 2710604847 2710264753 Bacteria 5455564
827 2729909292 2728369276 Bacteria 5610032
828 2768643475 2767802112 Bacteria 6465194
829 2774848994 2773857921 Bacteria 9435764
830 2793978330 2791355406 Bacteria 11364898
831 2799185844 2799112218 Bacteria 4315149
832 2812362636 2811994880 Bacteria 4147780
833 2819742014 2818991472 Bacteria 10089953
834 2848551754 2848551377 Bacteria 3720646
835 2856859308 2856858025 Bacteria 7255264
836 2858902630 2858902515 Bacteria 7086037
837 2862179359 2862178590 Bacteria 8583590
838 2862290517 2862290372 Bacteria 7471434
839 2862706474 2862705112 Bacteria 6563286
840 2867478820 2867475112 Bacteria 6909112
841 2887446831 2887443736 Bacteria 4426037
842 2912760898 2912757875 Bacteria 7940295
843 2990045330 2990044586 Bacteria 6603797
844 2990092103 2990088156 Bacteria 6657676
845 2997600303 2997600082 Bacteria 9896405
846 3003004917 3002998708 Bacteria 11715108
847 3006325199 3006321560 Bacteria 8247479
848 649812828 649633069 Bacteria 6962533
849 8002782679 8002775197 Bacteria 10728764
850 8002786604 8002784119 Bacteria 9788632
851 8003859215 8003856774 Bacteria 7675274
852 8008490305 8008485437 Bacteria 7198341
853 8025529607 8025524527 Bacteria 7197316
854 8047897972 8047893842 Bacteria 11723082
855 8048360922 8048356638 Bacteria 11044339
856 8048374935 8048369669 Bacteria 11666822
857 8048383270 8048379754 Bacteria 11877923
858 8053952141 8053945823 Bacteria 8962862
859 8054161759 8054160619 Bacteria 7783213
860 8054914818 8054913762 Bacteria 7713009
861 8054926257 8054920844 Bacteria 7068637
862 8056058339 8056054917 Bacteria 5736694
863 8056450880 8056447290 Bacteria 7680491
864 8056671241 8056667051 Bacteria 6953971
865 Ga0316576_10002642
866 rootL2_10080448
867 JGI25160J50197_1007531
868 JGI25160J50197_1032024
869 Ga0070658_10830260
870 Ga0070658_11357014
871 Ga0070676_10041165
872 Ga0070683_100033689
873 Ga0070683_100988027
874 Ga0068869_100323220
875 Ga0068869_100832360
876 Ga0070680_100000378
877 Ga0070680_100045649
878 Ga0070680_100449082
879 Ga0070682_100156247
880 Ga0068868_100034712
881 Ga0068868_101567650
882 Ga0070660_100223051
883 Ga0070691_10667791
884 Ga0070692_10638090
885 Ga0070692_10952638
886 Ga0070668_100003731
887 Ga0070668_100535101
888 Ga0070675_100111557
889 Ga0070671_100023038
890 Ga0070671_101587299
891 Ga0070674_100373407
892 Ga0070667_100941687
893 Ga0070709_10000441
894 Ga0070709_10139223
895 Ga0070714_100140905
896 Ga0070714_100263272
897 Ga0070713_100024518
898 Ga0070713_100056965
899 Ga0070713_100109446
900 Ga0070713_100136995
901 Ga0070710_10000167
902 Ga0070711_100001149
903 Ga0070711_100056367
904 Ga0070711_100793247
905 Ga0070705_100060528
906 Ga0070705_100309896
907 Ga0070700_100046916
908 Ga0070700_100416559
909 Ga0070708_100059757
910 Ga0070708_100067253
911 Ga0070708_100918408
912 Ga0070681_10000248
913 Ga0070685_10013217
914 Ga0070706_100004020
915 Ga0070706_100008150
916 Ga0070706_100101329
917 Ga0070706_100135209
918 Ga0070706_100365372
919 Ga0070706_100619557
920 Ga0070706_100708518
921 Ga0070707_100000293
922 Ga0070707_100005742
923 Ga0070707_100010098
924 Ga0070707_100017292
925 Ga0070707_100623338
926 Ga0070698_100000106
927 Ga0070698_100007047
928 Ga0070698_100018347
929 Ga0070698_100019863
930 Ga0070698_100727356
931 Ga0070679_100000157
932 Ga0070679_100378751
933 Ga0070684_100014045
934 Ga0070684_100037584
935 Ga0070684_100131557
936 Ga0070684_100781987
937 Ga0070697_100132679
938 Ga0070693_100133834
939 Ga0070665_100003592
940 Ga0070665_100345281
941 Ga0068855_100045667
942 Ga0068855_100656538
943 Ga0068855_100909594
944 Ga0070664_100230859
945 Ga0070664_100530887
946 Ga0068857_100101178
947 Ga0068857_100634179
948 Ga0068857_101146938
949 Ga0068854_100035390
950 Ga0068856_100066806
951 Ga0068856_100927479
952 Ga0068852_101473416
953 Ga0068859_100000014
954 Ga0068859_100440453
955 Ga0068864_100411244
956 Ga0068861_100208166
957 Ga0068861_100742113
958 Ga0068870_10245700
959 Ga0068870_10330077
960 Ga0068863_100001561
961 Ga0068863_100518828
962 Ga0068863_100660614
963 Ga0068858_100000988
964 Ga0068858_100098622
965 Ga0068858_100128337
966 Ga0068858_100999291
967 Ga0068860_100220675
968 Ga0068862_100000026
969 Ga0068862_100273324
970 Ga0081455_10340559
971 Ga0081455_10622525
972 Ga0081540_1001613
973 Ga0081540_1018566
974 Ga0081540_1053918
975 Ga0070717_10019735
976 Ga0070717_10026460
977 Ga0070717_10030210
978 Ga0070717_10147018
979 Ga0070717_10434658
980 Ga0070717_10678247
981 Ga0070715_10041187
982 Ga0070715_10060863
983 Ga0070716_100047672
984 Ga0070716_100177436
985 Ga0070712_100030922
986 Ga0070712_100074524
987 Ga0070712_100231617
988 Ga0070712_100240806
989 Ga0070712_100644711
990 Ga0097621_100307456
991 Ga0097621_100832032
992 Ga0075370_10513327
993 Ga0068871_100070094
994 Ga0075428_100034513
995 Ga0075428_100118780
996 Ga0075428_100119380
997 Ga0075428_100754583
998 Ga0075430_100001268
999 Ga0075433_10033010
1000 Ga0075434_100072963
1001 Ga0075434_100083829
1002 Ga0075434_100235372
1003 Ga0075429_100056417
1004 Ga0075429_100347609
1005 Ga0075436_100011256
1006 Ga0097620_100000014
1007 Ga0097620_100440501
1008 Ga0097620_101893390
1009 Ga0075435_100083841
1010 Ga0075435_101007016
1011 Ga0105240_10788943
1012 Ga0105240_11732384
1013 Ga0111539_10015815
1014 Ga0105245_10179266
1015 Ga0105245_10260627
1016 Ga0105247_10002241
1017 Ga0105247_10252732
1018 Ga0114129_10011093
1019 Ga0114129_10369545
1020 Ga0114129_10416511
1021 Ga0114129_11413429
1022 Ga0105241_10285913
1023 Ga0105242_10026296
1024 Ga0105248_10000023
1025 Ga0105249_10959429
1026 Ga0105239_10031946
1027 Ga0157371_10741787
1028 Ga0157370_10054444
1029 Ga0157369_10134948
1030 Ga0157369_11350249
1031 Ga0157374_10035799
1032 Ga0157378_11451665
1033 Ga0157372_10212112
1034 Ga0157372_10425825
1035 Ga0157372_10510965
1036 Ga0157372_10726498
1037 Ga0163163_10014092
1038 Ga0163163_10075078
1039 Ga0157379_10000591
1040 Ga0157379_10013216
1041 Ga0157379_10266661
1042 Ga0157376_10055825
1043 Ga0206356_11141531
1044 Ga0206353_10914106
1045 Ga0224712_10086688
1046 Ga0224572_1030548
1047 Ga0207426_1006879
1048 Ga0207426_1023061
1049 Ga0207426_1085890
1050 Ga0207692_10824581
1051 Ga0207710_10000063
1052 Ga0207685_10114534
1053 Ga0207699_10002656
1054 Ga0207699_10071582
1055 Ga0207705_10000348
1056 Ga0207705_10293472
1057 Ga0207705_11029655
1058 Ga0207705_11207974
1059 Ga0207684_10000571
1060 Ga0207684_10007405
1061 Ga0207684_10014224
1062 Ga0207684_10019030
1063 Ga0207684_10115821
1064 Ga0207684_10217467
1065 Ga0207654_10063304
1066 Ga0207707_10000447
1067 Ga0207671_10116320
1068 Ga0207671_10578103
1069 Ga0207693_10050689
1070 Ga0207693_10068335
1071 Ga0207693_10146872
1072 Ga0207693_10280689
1073 Ga0207693_10414351
1074 Ga0207663_10001400
1075 Ga0207663_10077291
1076 Ga0207663_10679173
1077 Ga0207660_10000102
1078 Ga0207660_10032415
1079 Ga0207660_10593741
1080 Ga0207660_11035537
1081 Ga0207657_10045026
1082 Ga0207649_11061553
1083 Ga0207652_10000182
1084 Ga0207652_11277800
1085 Ga0207646_10000050
1086 Ga0207646_10001770
1087 Ga0207646_10010918
1088 Ga0207646_10011667
1089 Ga0207646_10036233
1090 Ga0207659_10156377
1091 Ga0207687_10212399
1092 Ga0207700_10020409
1093 Ga0207700_10043799
1094 Ga0207700_10049497
1095 Ga0207700_10196509
1096 Ga0207700_10545446
1097 Ga0207700_10559077
1098 Ga0207664_10006510
1099 Ga0207664_10016910
1100 Ga0207664_10024264
1101 Ga0207664_10082736
1102 Ga0207664_10263843
1103 Ga0207664_10275815
1104 Ga0207664_10321133
1105 Ga0207664_10719683
1106 Ga0207644_10039981
1107 Ga0207690_10093644
1108 Ga0207690_10799248
1109 Ga0207669_10336888
1110 Ga0207665_10005907
1111 Ga0207665_10056110
1112 Ga0207711_10008340
1113 Ga0207689_10024235
1114 Ga0207689_10750024
1115 Ga0207689_11297907
1116 Ga0207661_10024459
1117 Ga0207661_10065601
1118 Ga0207661_10141014
1119 Ga0207679_10217579
1120 Ga0207679_11057190
1121 Ga0207667_10531724
1122 Ga0207667_10848359
1123 Ga0207667_10989708
1124 Ga0207712_10011761
1125 Ga0207712_10483478
1126 Ga0207668_10008602
1127 Ga0207668_10017092
1128 Ga0207668_10058268
1129 Ga0207668_10341457
1130 Ga0207640_10510809
1131 Ga0207658_10077365
1132 Ga0207677_10189568
1133 Ga0207677_10246824
1134 Ga0207703_10000177
1135 Ga0207703_10092098
1136 Ga0207678_10402313
1137 Ga0207678_11039196
1138 Ga0207708_10046225
1139 Ga0207708_10428322
1140 Ga0207702_10008591
1141 Ga0207702_10073374
1142 Ga0207641_10001246
1143 Ga0207641_10489966
1144 Ga0207641_11844219
1145 Ga0207676_10020765
1146 Ga0207676_10124276
1147 Ga0207674_10093078
1148 Ga0207674_10421863
1149 Ga0207674_10461013
1150 Ga0207675_100440936
1151 Ga0207683_10046419
1152 Ga0207683_10613999
1153 Ga0207683_11229930
1154 Ga0207698_10005031
1155 Ga0207698_10199535
1156 Ga0207698_10992746
1157 Ga0207428_10080588
1158 Ga0207428_10147382
1159 Ga0268266_10010672
1160 Ga0268266_11405046
1161 Ga0268265_10000167
1162 Ga0268265_10222941
1163 Ga0268265_10526864
1164 Ga0268265_11177587
1165 Ga0268265_11560763
1166 Ga0268264_10189272
1167 Ga0265336_10014847
1168 Ga0265338_10001588
1169 Ga0307511_10000924
1170 Ga0316181_1259639
1171 Ga0316182_1047903
1172 Ga0307509_10080166
1173 Ga0307408_100102913
1174 Ga0307508_10008805
1175 Ga0316578_10086854
1176 Ga0307516_10312573
1177 Ga0307405_10021951
1178 Ga0307405_10092100
1179 Ga0307413_11261712
1180 Ga0307410_10002324
1181 Ga0307406_10013416
1182 Ga0307406_10129409
1183 Ga0307406_10170601
1184 Ga0307406_10329638
1185 Ga0307407_10016132
1186 Ga0307412_10117616
1187 Ga0307409_100002175
1188 Ga0307409_100214905
1189 Ga0307409_100830985
1190 Ga0307416_100001592
1191 Ga0307416_100816414
1192 Ga0307416_100890291
1193 Ga0307414_10142211
1194 Ga0307411_10542842
1195 Ga0307415_100163451
1196 Ga0307415_100196679
1197 Ga0307415_100248294
1198 Ga0316583_10031368
1199 Ga0316585_10031802
1200 Ga0316593_10033826
1201 Ga0316596_1059218
1202 Ga0373948_0045068
1203 Ga0373950_0019988
1204 Ga0373938_0001351
1205 Ga0373938_0024287
1206 Ga0373926_0138080
1207 Ga0373934_0005701
1208 Ga0373934_0021260
1209 Ga0373934_0045353
1210 Ga0373934_0080975
1211 Ga0373934_0148505
1212 Ga0373940_0012484
1213 Ga0373940_0019963
1214 Ga0373949_0109638
1215 Ga0373923_0010543
1216 Ga0373923_0048506
1217 Ga0373932_0034341
1218 Ga0373936_0057934
1219 Ga0373936_0060812
1220 Ga0373939_0147077
1221 Ga0373945_0070583
1222 Ga0373945_0086228
1223 Ga0373945_0370729
1224 Ga0373953_0030538
1225 Ga0373953_0075136
1226 Ga0373954_0025119
1227 Ga0373954_0029298
1228 Ga0373954_0420087
1229 Ga0373956_0016570
1230 Ga0373957_0003290
1231 Ga0373957_0043046
1232 Ga0373943_0138393
1233 Ga0373943_0215829
1234 Ga0373943_0358612
1235 Ga0373955_0001996
1236 Ga0373955_0028116
1237 Ga0373955_0051109
1238 Ga0373955_0174813
1239 Ga0373942_0004639
1240 Ga0373962_0007476
1241 Ga0373924_0001561
1242 Ga0373924_0004802
1243 Ga0373924_0013989
1244 Ga0373924_0015890
1245 Ga0373935_0027621
1246 Ga0373935_0073817
1247 Ga0373935_0097858
1248 Ga0373935_0244850
1249 Ga0373935_0428118
1250 Ga0373927_0097232
1251 Ga0373927_0272400
1252 Ga0373927_0412279
1253 Ga0373933_0030947
1254 Ga0373933_0053445
1255 Ga0373933_0095274
1256 Ga0373947_0068874
1257 Ga0373947_0112435
1258 Ga0373947_0116750
1259 Ga0373947_0162064
1260 Ga0373947_0846423
1261 Ga0373937_0003111
1262 Ga0373937_0035586
1263 Ga0373937_0038368
1264 Ga0373937_0104665
1265 Ga0373937_0153395
1266 Ga0373937_0409504
1267 Ga0372808_010553
1268 Ga0316584_0597659
1269 Ga0373925_0022330
1270 Ga0373925_0075923
1271 Ga0373925_0097651
1272 Ga0373925_0163570
1273 Ga0373925_0482750
1274 Ga0373925_0565430
1275 Ga0395905_0216764
1276 Ga0436364_0138124
1277 Ga0436364_0442522
1278 Ga0436365_1035924
1279 Ga0439436_0004676
1280 Ga0439438_007646
1281 Ga0439439_0002938
1282 Ga0451845_0546170
1283 Ga0451853_1630264
1284 Ga0439448_0155724
1285 Ga0439449_0003010
1286 Ga0439450_064216
1287 Ga0439457_002873
1288 Ga0450906_037508
1289 Ga0450907_021556
1290 Ga0439464_0195325
1291 Ga0466969_0034210
1292 Ga0466972_0351811
1293 Ga0466965_0084407
1294 Ga0466965_0627195
1295 Ga0466966_0008603
1296 Ga0466966_0058021
1297 Ga0466966_0148381
1298 Ga0466961_0103869
1299 Ga0466961_0213071
1300 Ga0466961_0230460
1301 Ga0466961_0929049
1302 Ga0466963_0020181
1303 Ga0466963_0232742
1304 Ga0466963_1035374
1305 Ga0466971_0129872
1306 Ga0466971_0135183
1307 Ga0466971_0164182
1308 Ga0466970_0029810
1309 Ga0466957_0057195
1310 Ga0466957_0071149
1311 Ga0466957_0102417
1312 Ga0466959_0052176
1313 Ga0466959_0167846
1314 Ga0466959_0178549
1315 Ga0466958_0024286
1316 Ga0466958_0237509
1317 Ga0466967_0045855
1318 Ga0466967_0059629
1319 Ga0466967_0263618
1320 Ga0466967_0451821
1321 Ga0466967_0481497
1322 Ga0466967_0514767
1323 Ga0495592_0020623
1324 Ga0495592_0040596
1325 Ga0495592_0080032
1326 Ga0495629_0010288
1327 Ga0495629_0016085
1328 Ga0495629_0234605
1329 Ga0495629_0291550
1330 Ga0495629_0538606
1331 Ga0495641_0022020
1332 Ga0495641_0040560
1333 Ga0495641_0100960
1334 Ga0495641_0164049
1335 Ga0495651_0013776
1336 Ga0495651_0023559
1337 Ga0495651_0045682
1338 Ga0495651_0413952
1339 Ga0495653_0004085
1340 Ga0495653_0099959
1341 Ga0495653_0118950
1342 Ga0495653_0148784
1343 Ga0495653_0206246
1344 Ga0495580_0006356
1345 Ga0495580_0381264
1346 Ga0495582_0023230
1347 Ga0495582_0052440
1348 Ga0495582_0113679
1349 Ga0495639_0080775
1350 Ga0495639_0136912
1351 Ga0495662_0007495
1352 Ga0495662_0030488
1353 Ga0495662_0065763
1354 Ga0495662_0072679
1355 Ga0495664_0005749
1356 Ga0495664_0072442
1357 Ga0495664_0085246
1358 Ga0495664_0097076
1359 Ga0495664_0167894
1360 Ga0495664_0420121
1361 Ga0495608_0009299
1362 Ga0495608_0012696
1363 Ga0495608_0020023
1364 Ga0495608_0020654
1365 Ga0495608_0043589
1366 Ga0495608_0050023
1367 Ga0495608_0136905
1368 Ga0495618_0023383
1369 Ga0495618_0085902
1370 Ga0495618_0306198
1371 Ga0495628_0009159
1372 Ga0495628_0035809
1373 Ga0495628_0049060
1374 Ga0495628_0066341
1375 Ga0495628_0106678
1376 Ga0495628_0194282
1377 Ga0495628_0324487
1378 Ga0495630_0013860
1379 Ga0495630_0030486
1380 Ga0495630_0072980
1381 Ga0495630_0105333
1382 Ga0495630_0280641
1383 Ga0495630_0405390
1384 Ga0495632_0093457
1385 Ga0495666_0341109
1386 Ga0495666_0390748
1387 Ga0495652_0003756
1388 Ga0495652_0063661
1389 Ga0495652_0144893
1390 Ga0495652_0185972
1391 Ga0495652_0273393
1392 Ga0495652_0611303
1393 Ga0495665_0003104
1394 Ga0495665_0004214
1395 Ga0495665_0027326
1396 Ga0495640_0008144
1397 Ga0495640_0047578
1398 Ga0495640_0156121
1399 Ga0495640_0162392
1400 Ga0495586_0049948
1401 Ga0495586_0105587
1402 Ga0495586_0157718
1403 Ga0495586_0166583
1404 Ga0495586_0503546
1405 Ga0495586_0679398
1406 Ga0495587_0002579
1407 Ga0495587_0018810
1408 Ga0495587_0033300
1409 Ga0495587_0033817
1410 Ga0495587_0040481
1411 Ga0495597_0113877
1412 Ga0495645_0013643
1413 Ga0495645_0025634
1414 Ga0495645_0104477
1415 Ga0495645_0111937
1416 Ga0495645_0117346
1417 Ga0495645_0184075
1418 Ga0495645_0410227
1419 Ga0495667_0010662
1420 Ga0495667_0013591
1421 Ga0495667_0014297
1422 Ga0495667_0085290
1423 Ga0495667_0197927
1424 Ga0495634_0016697
1425 Ga0495634_0030642
1426 Ga0495634_0156316
1427 Ga0495634_0328990
1428 Ga0495635_0011222
1429 Ga0495635_0040064
1430 Ga0495635_0067580
1431 Ga0495635_0108917
1432 Ga0495635_0173215
1433 Ga0495635_0177829
1434 Ga0495635_0195567
1435 Ga0495657_0012582
1436 Ga0495657_0058951
1437 Ga0495657_0080916
1438 Ga0495657_0312325
1439 Ga0495599_0009205
1440 Ga0495599_0011342
1441 Ga0495599_0030990
1442 Ga0495599_0067825
1443 Ga0495599_0430113
1444 Ga0495623_0002795
1445 Ga0495623_0009879
1446 Ga0495623_0011495
1447 Ga0495623_0075479
1448 Ga0495623_0146860
1449 Ga0495623_0545531
1450 Ga0495646_0002025
1451 Ga0495646_0160005
1452 Ga0495646_0234269
1453 Ga0495647_0103976
1454 Ga0495647_0140075
1455 Ga0495658_0036611
1456 Ga0495658_0037868
1457 Ga0495658_0139564
1458 Ga0495658_0612699
1459 Ga0495613_0036904
1460 Ga0495613_0096540
1461 Ga0495613_0372588
1462 Ga0495624_0060343
1463 Ga0495624_0077958
1464 Ga0495624_0143937
1465 Ga0495624_0180272
1466 Ga0495649_0079710
1467 Ga0495600_0004594
1468 Ga0495600_0015394
1469 Ga0495600_0033635
1470 Ga0495600_0096919
1471 Ga0495600_0376377
1472 Ga0495581_0033423
1473 Ga0495581_0050006
1474 Ga0495581_0058733
1475 Ga0495604_0001885
1476 Ga0495604_0040234
1477 Ga0495604_0096156
1478 Ga0495636_0018877
1479 Ga0495674_0076760
1480 Ga0495674_0079307
1481 Ga0495674_0180758
1482 Ga0495674_0185795
1483 Ga0495674_0489817
1484 Ga0495672_0208009
1485 Ga0495676_0129467
1486 Ga0495680_0035554
1487 Ga0495680_0048111
1488 Ga0495680_0093367
1489 Ga0495680_0100960
1490 Ga0495680_0130236
1491 Ga0495675_0027173
1492 Ga0495675_0037109
1493 Ga0495675_0046694
1494 Ga0495675_0073229
1495 Ga0495675_0116145
1496 Ga0495675_0220360
1497 Ga0495684_0025194
1498 Ga0495684_0034787
1499 Ga0495684_0128051
1500 Ga0495684_0128822
1501 Ga0495684_0339889
1502 Ga0495593_0008464
1503 Ga0495593_0069045
1504 Ga0495593_0083391
1505 Ga0495602_0088671
1506 Ga0495602_0128241
1507 Ga0495614_0052326
1508 Ga0496101_0506323
1509 Ga0496101_0831140
1510 Ga0496102_0184059
1511 Ga0496102_0190783
1512 Ga0496102_0579088
1513 Ga0496104_0043763
1514 Ga0496104_0111343
1515 Ga0496104_1207925
1516 Ga0496105_0098486
1517 Ga0496105_0192839
1518 Ga0496105_0582576
1519 Ga0496106_0094702
1520 Ga0496106_0205869
1521 Ga0496106_0432978
1522 Ga0496106_0989096
1523 Ga0496107_0088449
1524 Ga0496107_0170863
1525 Ga0496108_0000089
1526 Ga0496108_0001256
1527 Ga0496108_0218297
1528 Ga0496109_0028644
1529 Ga0496109_0229235
1530 Ga0496109_1216682
1531 Ga0496110_0146583
1532 Ga0496111_0302658
1533 Ga0496111_0678388
1534 Ga0496111_1068871
1535 Ga0496116_0000531
1536 Ga0496117_0009641
1537 Ga0496117_0085382
1538 Ga0496118_0005065
1539 Ga0496118_0011579
1540 Ga0496119_0010904
1541 Ga0496119_0018969
1542 Ga0496121_0013354
1543 Ga0496124_0417991
1544 Ga0496126_0097143
1545 Ga0501306_016543
1546 Ga0501031_0003647
1547 Ga0501031_0142076
1548 Ga0501032_0007954
1549 Ga0501032_0021958
1550 Ga0501032_0027168
1551 Ga0501032_0365624
1552 Ga0501032_0584412
1553 Ga0501033_0005797
1554 Ga0501033_0026344
1555 Ga0501033_0127682
1556 Ga0501034_0007085
1557 Ga0501034_0016284
1558 Ga0501034_0189316
1559 Ga0501036_0000154
1560 Ga0501036_0007966
1561 Ga0501036_0053216
1562 Ga0501036_0410164
1563 Ga0501037_0008259
1564 Ga0501037_0075979
1565 Ga0501037_0076860
1566 Ga0501037_0334101
1567 Ga0501038_0012221
1568 Ga0501038_0055608
1569 Ga0501038_0072316
1570 Ga0501038_0113482
1571 Ga0501038_0211385
1572 Ga0501038_0443406
1573 Ga0501038_1176201
1574 Ga0501039_0012712
1575 Ga0501039_0023069
1576 Ga0501039_0179217
1577 Ga0501039_0378682
1578 Ga0501039_0510083
1579 Ga0501040_0004621
1580 Ga0501041_0034922
1581 Ga0501042_0004260
1582 Ga0501042_0014535
1583 Ga0501043_0003227
1584 Ga0501043_0005709
1585 Ga0501043_0070359
1586 Ga0501043_0101652
1587 Ga0501043_0139305
1588 Ga0501043_0672747
1589 Ga0501046_0002283
1590 Ga0501046_0020154
1591 Ga0501046_0026740
1592 Ga0501046_0081810
1593 Ga0501047_0000942
1594 Ga0501047_0001481
1595 Ga0501047_0002944
1596 Ga0501047_0065463
1597 Ga0501047_0366928
1598 Ga0501047_0462617
1599 Ga0501047_0720906
1600 Ga0501048_0016037
1601 Ga0501048_0032217
1602 Ga0501048_0240033
1603 Ga0501048_0980695
1604 Ga0501067_0005755
1605 Ga0501068_0002878
1606 Ga0501070_0006175
1607 Ga0501070_0027422
1608 Ga0501071_0000622
1609 Ga0501072_0011566
1610 Ga0501073_0013975
1611 Ga0501073_0044039
1612 Ga0501074_0003420
1613 Ga0501074_0004389
1614 Ga0501076_0112951
1615 Ga0501077_0053126
1616 Ga0501077_0106942
1617 Ga0501077_0496030
1618 Ga0501079_0007822
1619 Ga0501080_0083601
1620 Ga0501080_1530389
1621 Ga0501081_0357331
1622 Ga0501083_0001270
1623 Ga0501083_0118403
1624 Ga0501035_0028772
1625 Ga0501035_0095857
1626 Ga0501035_0238991
1627 Ga0501035_0888496
1628 Ga0501044_0003451
1629 Ga0501044_0035021
1630 Ga0501044_0041277
1631 Ga0501044_0091875
1632 Ga0501044_0246014
1633 Ga0501044_0327568
1634 Ga0501044_0383816
1635 Ga0501045_0057322
1636 Ga0501045_0090932
1637 Ga0501045_0185223
1638 Ga0501045_0506026
1639 nmdc:mga0yw44_435289_c1
1640 nmdc:mga05p37_321547_c1
1641 nmdc:mga05p37_37397_c1
1642 nmdc:mga05p37_949924_c1
1643 nmdc:mga09592_65666_c1
1644 nmdc:mga0qj67_240697_c1
1645 nmdc:mga0qj67_246669_c1
1646 nmdc:mga0qj67_2892_c1
1647 nmdc:mga08y16_198717_c1
1648 nmdc:mga0n895_1155215_c1
1649 nmdc:mga0n895_161895_c1
1650 nmdc:mga0rr50_471666_c1
1651 nmdc:mga0rr50_962047_c1
1652 Ga0495601_0006464
1653 Ga0495601_0049082
1654 Ga0495601_0049458
1655 Ga0495601_0071249
1656 Ga0495601_0097978
1657 Ga0495601_0249439
1658 Ga0495601_0295142
1659 Ga0495612_0009063
1660 Ga0495612_0191873
1661 Ga0495595_0037522
1662 Ga0495595_0103102
1663 Ga0495595_0167464
1664 Ga0495619_0014393
1665 Ga0495619_0022405
1666 Ga0495619_0040149
1667 Ga0495619_0286917
1668 Ga0500583_0064530
1669 Ga0500600_0121728
1670 Ga0587070_053478
1671 Ga0501082_0011694
1672 Ga0501082_0012789
1673 Ga0466962_0010959
1674 Ga0466962_0044244
1675 Ga0466962_0371018
1676 Ga0530510_0069504
1677 2501943498
1678 2508671931
1679 2517761204
1680 2554257207
1681 2619854895
1682 2620353659
1683 2626636690
1684 2643942406
1685 2644390030
1686 2644429487
1687 2676204419
1688 2686540651
1689 2689961918
1690 2710604847
1691 2729909292
1692 2768643475
1693 2774848994
1694 2793978330
1695 2799185844
1696 2812362636
1697 2819742014
1698 2848551754
1699 2856859308
1700 2858902630
1701 2862179359
1702 2862290517
1703 2862706474
1704 2867478820
1705 2887446831
1706 2912760898
1707 2990045330
1708 2990092103
1709 2997600303
1710 3003004917
1711 3006325199
1712 649812828
1713 8002782679
1714 8002786604
1715 8003859215
1716 8008490305
1717 8025529607
1718 8047897972
1719 8048360922
1720 8048374935
1721 8048383270
1722 8053952141
1723 8054161759
1724 8054914818
1725 8054926257
1726 8056058339
1727 8056450880
1728 8056671241

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

26

178

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9701 4 157
2uzh-assembly1.cif.gz_B mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9651 4 157
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9579 4 157
2uzh-assembly1.cif.gz_B mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9529 4 157
5l12-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9476 3 155
ID Description Score Start End Superfamily
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.964 4 157 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9517 4 157 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9395 4 157 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9286 1 157 3.30.1330.50
1iv1B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9251 5 155 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A838FW88-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9807 4 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A010YGM3-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9805 4 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A7W1ZEY7-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.98 3 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A6G7YFC1-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9799 4 156 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A4Q8CV62-F1-model_v4 deleted 0.9798 4 157

Map