F483849
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 861 | 404 | 860 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300033180|Ga0307510_10096709|Ga0307510_100967094 |
| Length | 135 |
| Sequence | MPAGSESNTVTDATVPAAAASVSANACIFREAKFKIGDVVKHRVFPFRGVVFDVDPVFDNTEEWLASIPEDVRPHKDQPFYHLLAENAETTYVAYVSEQNLLADETGKPCRHPLLREMFSSPKRGTYRMKAMKPN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 123 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 124 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 220 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 235 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 236 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 238 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 259 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 267 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 268 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 269 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 274 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 367 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 383 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 384 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 385 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 386 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 387 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 388 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 389 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 390 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 393 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 394 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 397 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 398 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 399 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.69 |
| Nodule | 0 |
| Rhizoplane | 8.71 |
| Rhizosphere | 83.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1028925 | 3300001978 | Bacteria | 628 |
| 2 | JGI24737J22298_10019086 | 3300001990 | Bacteria | 2193 |
| 3 | JGI24743J22301_10044562 | 3300001991 | Bacteria | 895 |
| 4 | JGI24750J21931_1003524 | 3300002070 | Bacteria | 1874 |
| 5 | JGI24748J21848_1033234 | 3300002074 | Bacteria | 642 |
| 6 | JGI24738J21930_10011766 | 3300002075 | Bacteria | 1919 |
| 7 | JGI24034J26672_10089043 | 3300002239 | Bacteria | 571 |
| 8 | JGI24751J29686_10020519 | 3300002459 | Bacteria | 1369 |
| 9 | Ga0065712_10322409 | 3300005290 | Bacteria | 826 |
| 10 | Ga0065715_10702056 | 3300005293 | Bacteria | 652 |
| 11 | Ga0070676_10015391 | 3300005328 | Bacteria | 4219 |
| 12 | Ga0070676_10468819 | 3300005328 | Bacteria | 889 |
| 13 | Ga0070690_100001376 | 3300005330 | Bacteria | 12659 |
| 14 | Ga0070670_100003133 | 3300005331 | Bacteria | 13679 |
| 15 | Ga0068869_100009339 | 3300005334 | Bacteria | 6361 |
| 16 | Ga0070666_10013599 | 3300005335 | Bacteria | 5168 |
| 17 | Ga0070680_101789962 | 3300005336 | Bacteria | 532 |
| 18 | Ga0070682_100010755 | 3300005337 | Bacteria | 5204 |
| 19 | Ga0070682_100293650 | 3300005337 | Bacteria | 1190 |
| 20 | Ga0068868_100020199 | 3300005338 | Bacteria | 5000 |
| 21 | Ga0068868_100500519 | 3300005338 | Bacteria | 1064 |
| 22 | Ga0070660_100014281 | 3300005339 | Bacteria | 5719 |
| 23 | Ga0070689_100006899 | 3300005340 | Bacteria | 7902 |
| 24 | Ga0070691_10052775 | 3300005341 | Bacteria | 1944 |
| 25 | Ga0070687_100012882 | 3300005343 | Bacteria | 3710 |
| 26 | Ga0070687_100523210 | 3300005343 | Bacteria | 802 |
| 27 | Ga0070661_100021198 | 3300005344 | Bacteria | 4638 |
| 28 | Ga0070692_10056845 | 3300005345 | Bacteria | 2049 |
| 29 | Ga0070668_100008205 | 3300005347 | Bacteria | 7754 |
| 30 | Ga0070668_100160307 | 3300005347 | Bacteria | 1825 |
| 31 | Ga0070668_100166489 | 3300005347 | Bacteria | 1792 |
| 32 | Ga0070669_100008028 | 3300005353 | Bacteria | 7535 |
| 33 | Ga0070669_100870649 | 3300005353 | Bacteria | 768 |
| 34 | Ga0070675_100042420 | 3300005354 | Bacteria | 3717 |
| 35 | Ga0070675_101786589 | 3300005354 | Bacteria | 567 |
| 36 | Ga0070671_100010429 | 3300005355 | Bacteria | 7454 |
| 37 | Ga0070671_100041032 | 3300005355 | Bacteria | 3845 |
| 38 | Ga0070674_100000275 | 3300005356 | Bacteria | 25078 |
| 39 | Ga0070674_100036192 | 3300005356 | Bacteria | 3311 |
| 40 | Ga0070674_100323462 | 3300005356 | Bacteria | 1237 |
| 41 | Ga0070674_100630857 | 3300005356 | Bacteria | 909 |
| 42 | Ga0070673_100011614 | 3300005364 | Bacteria | 6016 |
| 43 | Ga0070673_100092401 | 3300005364 | Bacteria | 2475 |
| 44 | Ga0070673_100521341 | 3300005364 | Bacteria | 1077 |
| 45 | Ga0070673_101658838 | 3300005364 | Bacteria | 604 |
| 46 | Ga0070673_102035744 | 3300005364 | Bacteria | 545 |
| 47 | Ga0070688_100001437 | 3300005365 | Bacteria | 11843 |
| 48 | Ga0070688_100080151 | 3300005365 | Bacteria | 2111 |
| 49 | Ga0070688_100224016 | 3300005365 | Bacteria | 1327 |
| 50 | Ga0070659_100003374 | 3300005366 | Bacteria | 11371 |
| 51 | Ga0070659_100108937 | 3300005366 | Bacteria | 2235 |
| 52 | Ga0070659_100952906 | 3300005366 | Bacteria | 752 |
| 53 | Ga0070659_100960362 | 3300005366 | Bacteria | 749 |
| 54 | Ga0070667_100006020 | 3300005367 | Bacteria | 10079 |
| 55 | Ga0070667_100240388 | 3300005367 | Bacteria | 1617 |
| 56 | Ga0070667_100284840 | 3300005367 | Bacteria | 1485 |
| 57 | Ga0070667_100599628 | 3300005367 | Bacteria | 1015 |
| 58 | Ga0070667_101593120 | 3300005367 | Bacteria | 614 |
| 59 | Ga0070703_10045473 | 3300005406 | Bacteria | 1385 |
| 60 | Ga0070709_10035104 | 3300005434 | Bacteria | 3045 |
| 61 | Ga0070709_10205860 | 3300005434 | Bacteria | 1396 |
| 62 | Ga0070714_100256997 | 3300005435 | Bacteria | 1617 |
| 63 | Ga0070713_101878632 | 3300005436 | Bacteria | 581 |
| 64 | Ga0070710_10018648 | 3300005437 | Bacteria | 3573 |
| 65 | Ga0070711_100037622 | 3300005439 | Bacteria | 3248 |
| 66 | Ga0070711_100174404 | 3300005439 | Bacteria | 1641 |
| 67 | Ga0070711_100304202 | 3300005439 | Bacteria | 1269 |
| 68 | Ga0070705_100009505 | 3300005440 | Bacteria | 4835 |
| 69 | Ga0070705_101469308 | 3300005440 | Bacteria | 570 |
| 70 | Ga0070700_100025249 | 3300005441 | Bacteria | 3499 |
| 71 | Ga0070700_100625970 | 3300005441 | Bacteria | 846 |
| 72 | Ga0070694_100004982 | 3300005444 | Bacteria | 8005 |
| 73 | Ga0070694_100135372 | 3300005444 | Bacteria | 1785 |
| 74 | Ga0070708_101746795 | 3300005445 | Bacteria | 578 |
| 75 | Ga0070663_100020001 | 3300005455 | Bacteria | 4423 |
| 76 | Ga0070663_100146754 | 3300005455 | Bacteria | 1805 |
| 77 | Ga0070663_100372111 | 3300005455 | Bacteria | 1162 |
| 78 | Ga0070678_100099477 | 3300005456 | Bacteria | 2251 |
| 79 | Ga0070678_100292966 | 3300005456 | Bacteria | 1380 |
| 80 | Ga0070678_101002156 | 3300005456 | Bacteria | 768 |
| 81 | Ga0070678_101312387 | 3300005456 | Bacteria | 674 |
| 82 | Ga0070662_100004091 | 3300005457 | Bacteria | 9161 |
| 83 | Ga0070681_10247498 | 3300005458 | Bacteria | 1695 |
| 84 | Ga0070681_10626746 | 3300005458 | Bacteria | 990 |
| 85 | Ga0068867_100031811 | 3300005459 | Bacteria | 3812 |
| 86 | Ga0068867_100078175 | 3300005459 | Bacteria | 2488 |
| 87 | Ga0068867_100242022 | 3300005459 | Bacteria | 1464 |
| 88 | Ga0068867_100473618 | 3300005459 | Bacteria | 1071 |
| 89 | Ga0068867_100615406 | 3300005459 | Bacteria | 949 |
| 90 | Ga0070685_10016452 | 3300005466 | Bacteria | 3941 |
| 91 | Ga0070706_100212586 | 3300005467 | Bacteria | 1806 |
| 92 | Ga0070706_101149242 | 3300005467 | Bacteria | 714 |
| 93 | Ga0070699_100070865 | 3300005518 | Bacteria | 3031 |
| 94 | Ga0070679_100039265 | 3300005530 | Bacteria | 4705 |
| 95 | Ga0070679_101741481 | 3300005530 | Bacteria | 571 |
| 96 | Ga0070684_100018150 | 3300005535 | Bacteria | 5789 |
| 97 | Ga0070697_100013631 | 3300005536 | Bacteria | 6376 |
| 98 | Ga0070697_100028741 | 3300005536 | Bacteria | 4454 |
| 99 | Ga0070697_100231453 | 3300005536 | Bacteria | 1576 |
| 100 | Ga0068853_100020087 | 3300005539 | Bacteria | 5552 |
| 101 | Ga0068853_100171394 | 3300005539 | Bacteria | 1964 |
| 102 | Ga0068853_100282295 | 3300005539 | Bacteria | 1531 |
| 103 | Ga0070672_100094945 | 3300005543 | Bacteria | 2411 |
| 104 | Ga0070672_100245114 | 3300005543 | Bacteria | 1508 |
| 105 | Ga0070686_100003128 | 3300005544 | Bacteria | 9069 |
| 106 | Ga0070686_100584165 | 3300005544 | Bacteria | 878 |
| 107 | Ga0070686_100694308 | 3300005544 | Bacteria | 811 |
| 108 | Ga0070695_100007641 | 3300005545 | Bacteria | 6403 |
| 109 | Ga0070695_100057449 | 3300005545 | Bacteria | 2514 |
| 110 | Ga0070695_100095923 | 3300005545 | Bacteria | 1989 |
| 111 | Ga0070695_100405651 | 3300005545 | Bacteria | 1034 |
| 112 | Ga0070695_100521152 | 3300005545 | Bacteria | 922 |
| 113 | Ga0070696_100016995 | 3300005546 | Bacteria | 4908 |
| 114 | Ga0070696_100128204 | 3300005546 | Bacteria | 1843 |
| 115 | Ga0070696_100162157 | 3300005546 | Bacteria | 1648 |
| 116 | Ga0070696_100724426 | 3300005546 | Bacteria | 813 |
| 117 | Ga0070693_100007741 | 3300005547 | Bacteria | 5265 |
| 118 | Ga0070665_100075206 | 3300005548 | Bacteria | 3384 |
| 119 | Ga0070665_100305492 | 3300005548 | Bacteria | 1594 |
| 120 | Ga0070665_101654487 | 3300005548 | Bacteria | 648 |
| 121 | Ga0070704_100001792 | 3300005549 | Bacteria | 11795 |
| 122 | Ga0070704_100019287 | 3300005549 | Bacteria | 4380 |
| 123 | Ga0070704_100024362 | 3300005549 | Bacteria | 3971 |
| 124 | Ga0070704_100950432 | 3300005549 | Bacteria | 775 |
| 125 | Ga0068855_100171842 | 3300005563 | Bacteria | 2454 |
| 126 | Ga0070664_100030826 | 3300005564 | Bacteria | 4476 |
| 127 | Ga0070664_100834048 | 3300005564 | Bacteria | 863 |
| 128 | Ga0068857_100055332 | 3300005577 | Bacteria | 3521 |
| 129 | Ga0068857_100599180 | 3300005577 | Bacteria | 1041 |
| 130 | Ga0068854_100065826 | 3300005578 | Bacteria | 2635 |
| 131 | Ga0068856_100013416 | 3300005614 | Bacteria | 7933 |
| 132 | Ga0070702_100000445 | 3300005615 | Bacteria | 14687 |
| 133 | Ga0070702_100014153 | 3300005615 | Bacteria | 4043 |
| 134 | Ga0070702_100137911 | 3300005615 | Bacteria | 1550 |
| 135 | Ga0070702_100197804 | 3300005615 | Bacteria | 1328 |
| 136 | Ga0070702_100339213 | 3300005615 | Bacteria | 1054 |
| 137 | Ga0068852_100023924 | 3300005616 | Bacteria | 4928 |
| 138 | Ga0068859_100064579 | 3300005617 | Bacteria | 3693 |
| 139 | Ga0068859_100076272 | 3300005617 | Bacteria | 3393 |
| 140 | Ga0068859_100177712 | 3300005617 | Bacteria | 2211 |
| 141 | Ga0068859_100798925 | 3300005617 | Bacteria | 1031 |
| 142 | Ga0068864_100014642 | 3300005618 | Bacteria | 6515 |
| 143 | Ga0068864_101067139 | 3300005618 | Bacteria | 803 |
| 144 | Ga0068864_101911486 | 3300005618 | Bacteria | 599 |
| 145 | Ga0068866_10010484 | 3300005718 | Bacteria | 3976 |
| 146 | Ga0068866_10025658 | 3300005718 | Bacteria | 2773 |
| 147 | Ga0068866_10526646 | 3300005718 | Bacteria | 786 |
| 148 | Ga0068861_100002085 | 3300005719 | Bacteria | 12958 |
| 149 | Ga0068861_100170318 | 3300005719 | Bacteria | 1804 |
| 150 | Ga0068851_10049757 | 3300005834 | Bacteria | 2127 |
| 151 | Ga0068870_10554701 | 3300005840 | Bacteria | 774 |
| 152 | Ga0068870_10942265 | 3300005840 | Bacteria | 612 |
| 153 | Ga0068863_100055445 | 3300005841 | Bacteria | 3753 |
| 154 | Ga0068863_100180491 | 3300005841 | Bacteria | 2026 |
| 155 | Ga0068858_100042027 | 3300005842 | Bacteria | 4238 |
| 156 | Ga0068858_100157551 | 3300005842 | Bacteria | 2137 |
| 157 | Ga0068858_100469326 | 3300005842 | Bacteria | 1214 |
| 158 | Ga0068858_100520498 | 3300005842 | Bacteria | 1150 |
| 159 | Ga0068860_100032669 | 3300005843 | Bacteria | 5000 |
| 160 | Ga0068860_100040580 | 3300005843 | Bacteria | 4448 |
| 161 | Ga0068860_100379516 | 3300005843 | Bacteria | 1395 |
| 162 | Ga0068860_100873544 | 3300005843 | Bacteria | 915 |
| 163 | Ga0068860_101457422 | 3300005843 | Bacteria | 706 |
| 164 | Ga0068862_100039283 | 3300005844 | Bacteria | 4018 |
| 165 | Ga0068862_100111456 | 3300005844 | Bacteria | 2402 |
| 166 | Ga0068862_100178168 | 3300005844 | Bacteria | 1906 |
| 167 | Ga0068862_100697580 | 3300005844 | Bacteria | 983 |
| 168 | Ga0081455_10005133 | 3300005937 | Bacteria | 14431 |
| 169 | Ga0081540_1246568 | 3300005983 | Bacteria | 625 |
| 170 | Ga0075365_10008060 | 3300006038 | Bacteria | 5949 |
| 171 | Ga0075365_10038896 | 3300006038 | Bacteria | 3094 |
| 172 | Ga0075368_10493295 | 3300006042 | Bacteria | 546 |
| 173 | Ga0075364_10606184 | 3300006051 | Bacteria | 748 |
| 174 | Ga0075364_10795905 | 3300006051 | Bacteria | 644 |
| 175 | Ga0075432_10031100 | 3300006058 | Bacteria | 1848 |
| 176 | Ga0075432_10343442 | 3300006058 | Bacteria | 631 |
| 177 | Ga0075432_10479138 | 3300006058 | Bacteria | 551 |
| 178 | Ga0070715_10005351 | 3300006163 | Bacteria | 4274 |
| 179 | Ga0070716_100009658 | 3300006173 | Bacteria | 4813 |
| 180 | Ga0070716_100196025 | 3300006173 | Bacteria | 1338 |
| 181 | Ga0070716_101752405 | 3300006173 | Bacteria | 513 |
| 182 | Ga0070712_100157957 | 3300006175 | Bacteria | 1748 |
| 183 | Ga0070712_100313748 | 3300006175 | Bacteria | 1273 |
| 184 | Ga0075362_10018081 | 3300006177 | Bacteria | 2912 |
| 185 | Ga0075367_10019210 | 3300006178 | Bacteria | 3787 |
| 186 | Ga0075367_10232577 | 3300006178 | Bacteria | 1154 |
| 187 | Ga0075367_10297691 | 3300006178 | Bacteria | 1015 |
| 188 | Ga0075366_10644056 | 3300006195 | Bacteria | 657 |
| 189 | Ga0097621_100087867 | 3300006237 | Bacteria | 2597 |
| 190 | Ga0097621_100143369 | 3300006237 | Bacteria | 2043 |
| 191 | Ga0097621_100584244 | 3300006237 | Bacteria | 1020 |
| 192 | Ga0068871_100159144 | 3300006358 | Bacteria | 1930 |
| 193 | Ga0068871_100183370 | 3300006358 | Bacteria | 1800 |
| 194 | Ga0068871_101624110 | 3300006358 | Bacteria | 612 |
| 195 | Ga0068871_102109836 | 3300006358 | Bacteria | 537 |
| 196 | Ga0075428_100134900 | 3300006844 | Bacteria | 2684 |
| 197 | Ga0075430_100083006 | 3300006846 | Bacteria | 2685 |
| 198 | Ga0075430_100250036 | 3300006846 | Bacteria | 1469 |
| 199 | Ga0075430_100293822 | 3300006846 | Bacteria | 1344 |
| 200 | Ga0075431_100086661 | 3300006847 | Bacteria | 3231 |
| 201 | Ga0075431_100293807 | 3300006847 | Bacteria | 1643 |
| 202 | Ga0075433_10023305 | 3300006852 | Bacteria | 5209 |
| 203 | Ga0075434_100217241 | 3300006871 | Bacteria | 1932 |
| 204 | Ga0075434_100248932 | 3300006871 | Bacteria | 1796 |
| 205 | Ga0075429_100013020 | 3300006880 | Bacteria | 7217 |
| 206 | Ga0068865_100000998 | 3300006881 | Bacteria | 16239 |
| 207 | Ga0068865_100016090 | 3300006881 | Bacteria | 4777 |
| 208 | Ga0068865_100039849 | 3300006881 | Bacteria | 3189 |
| 209 | Ga0068865_100104860 | 3300006881 | Bacteria | 2076 |
| 210 | Ga0068865_100486353 | 3300006881 | Bacteria | 1027 |
| 211 | Ga0075436_100001919 | 3300006914 | Bacteria | 14276 |
| 212 | Ga0075436_100029757 | 3300006914 | Bacteria | 3755 |
| 213 | Ga0097620_100064579 | 3300006931 | Bacteria | 3693 |
| 214 | Ga0097620_100076276 | 3300006931 | Bacteria | 3393 |
| 215 | Ga0097620_100177719 | 3300006931 | Bacteria | 2211 |
| 216 | Ga0097620_100799058 | 3300006931 | Bacteria | 1031 |
| 217 | Ga0075435_100014216 | 3300007076 | Bacteria | 5943 |
| 218 | Ga0075435_100239964 | 3300007076 | Bacteria | 1541 |
| 219 | Ga0105251_10207926 | 3300009011 | Bacteria | 881 |
| 220 | Ga0105244_10158062 | 3300009036 | Bacteria | 1083 |
| 221 | Ga0105250_10036408 | 3300009092 | Bacteria | 1975 |
| 222 | Ga0105250_10612003 | 3300009092 | Bacteria | 506 |
| 223 | Ga0105240_10163181 | 3300009093 | Bacteria | 2645 |
| 224 | Ga0105240_10741588 | 3300009093 | Bacteria | 1068 |
| 225 | Ga0111539_10345317 | 3300009094 | Bacteria | 1732 |
| 226 | Ga0111539_10430467 | 3300009094 | Bacteria | 1536 |
| 227 | Ga0105245_10012027 | 3300009098 | Bacteria | 7526 |
| 228 | Ga0105245_10939953 | 3300009098 | Bacteria | 907 |
| 229 | Ga0105245_11777469 | 3300009098 | Bacteria | 669 |
| 230 | Ga0105245_11842500 | 3300009098 | Bacteria | 658 |
| 231 | Ga0105247_10004362 | 3300009101 | Bacteria | 9038 |
| 232 | Ga0105247_10023200 | 3300009101 | Bacteria | 3738 |
| 233 | Ga0105247_10030449 | 3300009101 | Bacteria | 3271 |
| 234 | Ga0105247_10326034 | 3300009101 | Bacteria | 1073 |
| 235 | Ga0114129_12955773 | 3300009147 | Bacteria | 560 |
| 236 | Ga0105243_10015731 | 3300009148 | Bacteria | 5721 |
| 237 | Ga0105243_10017246 | 3300009148 | Bacteria | 5461 |
| 238 | Ga0105243_10100184 | 3300009148 | Bacteria | 2403 |
| 239 | Ga0105243_10119858 | 3300009148 | Bacteria | 2216 |
| 240 | Ga0105243_10135857 | 3300009148 | Bacteria | 2092 |
| 241 | Ga0105243_10302127 | 3300009148 | Bacteria | 1451 |
| 242 | Ga0105243_10469839 | 3300009148 | Bacteria | 1184 |
| 243 | Ga0105241_10005348 | 3300009174 | Bacteria | 9486 |
| 244 | Ga0105241_10872527 | 3300009174 | Bacteria | 834 |
| 245 | Ga0105242_10021809 | 3300009176 | Bacteria | 5033 |
| 246 | Ga0105242_10065504 | 3300009176 | Bacteria | 2997 |
| 247 | Ga0105242_10129369 | 3300009176 | Bacteria | 2177 |
| 248 | Ga0105242_10855383 | 3300009176 | Bacteria | 905 |
| 249 | Ga0105242_10989053 | 3300009176 | Bacteria | 848 |
| 250 | Ga0105248_10041042 | 3300009177 | Bacteria | 5187 |
| 251 | Ga0105248_10148167 | 3300009177 | Bacteria | 2648 |
| 252 | Ga0105248_11120679 | 3300009177 | Bacteria | 889 |
| 253 | Ga0105248_11685533 | 3300009177 | Bacteria | 719 |
| 254 | Ga0105237_10007474 | 3300009545 | Bacteria | 11954 |
| 255 | Ga0105237_12000541 | 3300009545 | Bacteria | 588 |
| 256 | Ga0105238_10015339 | 3300009551 | Bacteria | 7759 |
| 257 | Ga0105238_10459940 | 3300009551 | Bacteria | 1270 |
| 258 | Ga0105238_10714578 | 3300009551 | Bacteria | 1014 |
| 259 | Ga0105249_10024240 | 3300009553 | Bacteria | 5452 |
| 260 | Ga0105249_10029576 | 3300009553 | Bacteria | 4949 |
| 261 | Ga0105249_10159371 | 3300009553 | Bacteria | 2179 |
| 262 | Ga0105249_10403148 | 3300009553 | Bacteria | 1398 |
| 263 | Ga0105239_10045891 | 3300010375 | Bacteria | 4788 |
| 264 | Ga0105239_10138120 | 3300010375 | Bacteria | 2714 |
| 265 | Ga0105239_10284723 | 3300010375 | Bacteria | 1861 |
| 266 | Ga0105239_12413558 | 3300010375 | Bacteria | 612 |
| 267 | Ga0105239_13615712 | 3300010375 | Bacteria | 502 |
| 268 | Ga0105246_10054859 | 3300011119 | Bacteria | 2748 |
| 269 | Ga0105246_10159010 | 3300011119 | Bacteria | 1719 |
| 270 | Ga0105246_10317114 | 3300011119 | Bacteria | 1265 |
| 271 | Ga0105246_10630934 | 3300011119 | Bacteria | 930 |
| 272 | Ga0157337_1002251 | 3300012483 | Bacteria | 1076 |
| 273 | Ga0157341_1037117 | 3300012494 | Bacteria | 551 |
| 274 | Ga0157316_1023906 | 3300012510 | Bacteria | 691 |
| 275 | Ga0157373_10084195 | 3300013100 | Bacteria | 2242 |
| 276 | Ga0157373_11551358 | 3300013100 | Bacteria | 506 |
| 277 | Ga0157371_10003206 | 3300013102 | Bacteria | 15027 |
| 278 | Ga0157371_10471891 | 3300013102 | Bacteria | 924 |
| 279 | Ga0157369_10001593 | 3300013105 | Bacteria | 27785 |
| 280 | Ga0157374_10214798 | 3300013296 | Bacteria | 1886 |
| 281 | Ga0157374_11105310 | 3300013296 | Bacteria | 813 |
| 282 | Ga0157374_11281924 | 3300013296 | Bacteria | 755 |
| 283 | Ga0157378_10036344 | 3300013297 | Bacteria | 4359 |
| 284 | Ga0157378_10085711 | 3300013297 | Bacteria | 2854 |
| 285 | Ga0157378_10186086 | 3300013297 | Bacteria | 1956 |
| 286 | Ga0157378_10241763 | 3300013297 | Bacteria | 1725 |
| 287 | Ga0157378_11717341 | 3300013297 | Bacteria | 675 |
| 288 | Ga0163162_10002904 | 3300013306 | Bacteria | 16323 |
| 289 | Ga0163162_11024713 | 3300013306 | Bacteria | 934 |
| 290 | Ga0163162_11452917 | 3300013306 | Bacteria | 781 |
| 291 | Ga0163162_11582814 | 3300013306 | Bacteria | 747 |
| 292 | Ga0157372_10040181 | 3300013307 | Bacteria | 5165 |
| 293 | Ga0157372_10429835 | 3300013307 | Bacteria | 1539 |
| 294 | Ga0157372_10979473 | 3300013307 | Bacteria | 980 |
| 295 | Ga0157372_11098674 | 3300013307 | Bacteria | 920 |
| 296 | Ga0157375_10010582 | 3300013308 | Bacteria | 8121 |
| 297 | Ga0157375_10027601 | 3300013308 | Bacteria | 5308 |
| 298 | Ga0157375_10028166 | 3300013308 | Bacteria | 5261 |
| 299 | Ga0157375_11374802 | 3300013308 | Bacteria | 831 |
| 300 | Ga0157375_11454595 | 3300013308 | Bacteria | 808 |
| 301 | Ga0163163_10063241 | 3300014325 | Bacteria | 3669 |
| 302 | Ga0163163_10107625 | 3300014325 | Bacteria | 2814 |
| 303 | Ga0163163_10393705 | 3300014325 | Bacteria | 1443 |
| 304 | Ga0163163_11829712 | 3300014325 | Bacteria | 667 |
| 305 | Ga0157380_10007507 | 3300014326 | Bacteria | 7744 |
| 306 | Ga0157380_10018172 | 3300014326 | Bacteria | 5216 |
| 307 | Ga0157380_10302218 | 3300014326 | Bacteria | 1475 |
| 308 | Ga0157380_10416284 | 3300014326 | Bacteria | 1280 |
| 309 | Ga0157380_10637002 | 3300014326 | Bacteria | 1061 |
| 310 | Ga0157377_10021414 | 3300014745 | Bacteria | 3400 |
| 311 | Ga0157377_11062925 | 3300014745 | Bacteria | 617 |
| 312 | Ga0157379_10013548 | 3300014968 | Bacteria | 7146 |
| 313 | Ga0157379_10508135 | 3300014968 | Bacteria | 1117 |
| 314 | Ga0157379_10755635 | 3300014968 | Bacteria | 915 |
| 315 | Ga0157376_10013476 | 3300014969 | Bacteria | 6101 |
| 316 | Ga0157376_10072385 | 3300014969 | Bacteria | 2932 |
| 317 | Ga0157376_10652569 | 3300014969 | Bacteria | 1053 |
| 318 | Ga0157376_10885532 | 3300014969 | Bacteria | 910 |
| 319 | Ga0163161_10008920 | 3300017792 | Bacteria | 6932 |
| 320 | Ga0163161_10056704 | 3300017792 | Bacteria | 2846 |
| 321 | Ga0213874_10020258 | 3300021377 | Bacteria | 1821 |
| 322 | Ga0213876_10006369 | 3300021384 | Bacteria | 6433 |
| 323 | Ga0213876_10077112 | 3300021384 | Bacteria | 1760 |
| 324 | Ga0213875_10197640 | 3300021388 | Bacteria | 946 |
| 325 | Ga0209758_1025921 | 3300025297 | Bacteria | 2557 |
| 326 | Ga0207697_10044785 | 3300025315 | Bacteria | 1821 |
| 327 | Ga0207656_10030214 | 3300025321 | Bacteria | 2237 |
| 328 | Ga0207696_1099964 | 3300025711 | Bacteria | 790 |
| 329 | Ga0207653_10027500 | 3300025885 | Bacteria | 1827 |
| 330 | Ga0207692_10027209 | 3300025898 | Bacteria | 2692 |
| 331 | Ga0207642_10463120 | 3300025899 | Bacteria | 770 |
| 332 | Ga0207710_10023415 | 3300025900 | Bacteria | 2654 |
| 333 | Ga0207710_10033842 | 3300025900 | Bacteria | 2243 |
| 334 | Ga0207688_10001879 | 3300025901 | Bacteria | 11244 |
| 335 | Ga0207688_10146973 | 3300025901 | Bacteria | 1390 |
| 336 | Ga0207688_10305616 | 3300025901 | Bacteria | 973 |
| 337 | Ga0207680_10035235 | 3300025903 | Bacteria | 2871 |
| 338 | Ga0207647_10285172 | 3300025904 | Bacteria | 942 |
| 339 | Ga0207685_10012642 | 3300025905 | Bacteria | 2583 |
| 340 | Ga0207685_10154312 | 3300025905 | Bacteria | 1042 |
| 341 | Ga0207685_10247036 | 3300025905 | Bacteria | 861 |
| 342 | Ga0207699_10016553 | 3300025906 | Bacteria | 3859 |
| 343 | Ga0207699_10459905 | 3300025906 | Bacteria | 914 |
| 344 | Ga0207645_10023305 | 3300025907 | Bacteria | 4024 |
| 345 | Ga0207645_10218030 | 3300025907 | Bacteria | 1257 |
| 346 | Ga0207643_10100900 | 3300025908 | Bacteria | 1693 |
| 347 | Ga0207643_10148085 | 3300025908 | Bacteria | 1406 |
| 348 | Ga0207643_10693610 | 3300025908 | Bacteria | 658 |
| 349 | Ga0207684_10550803 | 3300025910 | Bacteria | 987 |
| 350 | Ga0207654_10115847 | 3300025911 | Bacteria | 1675 |
| 351 | Ga0207654_10841459 | 3300025911 | Bacteria | 664 |
| 352 | Ga0207707_10561414 | 3300025912 | Bacteria | 969 |
| 353 | Ga0207707_11506509 | 3300025912 | Bacteria | 533 |
| 354 | Ga0207671_10079776 | 3300025914 | Bacteria | 2453 |
| 355 | Ga0207693_10001954 | 3300025915 | Bacteria | 18068 |
| 356 | Ga0207693_10283705 | 3300025915 | Bacteria | 1298 |
| 357 | Ga0207693_10872796 | 3300025915 | Bacteria | 691 |
| 358 | Ga0207663_10080345 | 3300025916 | Bacteria | 2132 |
| 359 | Ga0207663_10152629 | 3300025916 | Bacteria | 1622 |
| 360 | Ga0207663_10463002 | 3300025916 | Bacteria | 979 |
| 361 | Ga0207660_10393411 | 3300025917 | Bacteria | 1115 |
| 362 | Ga0207662_10001539 | 3300025918 | Bacteria | 11250 |
| 363 | Ga0207662_10595848 | 3300025918 | Bacteria | 769 |
| 364 | Ga0207662_10847787 | 3300025918 | Bacteria | 646 |
| 365 | Ga0207657_10003469 | 3300025919 | Bacteria | 16828 |
| 366 | Ga0207657_10727962 | 3300025919 | Bacteria | 769 |
| 367 | Ga0207649_10039470 | 3300025920 | Bacteria | 2863 |
| 368 | Ga0207652_10059743 | 3300025921 | Bacteria | 3287 |
| 369 | Ga0207681_11012806 | 3300025923 | Bacteria | 697 |
| 370 | Ga0207650_10134837 | 3300025925 | Bacteria | 1936 |
| 371 | Ga0207659_10074550 | 3300025926 | Bacteria | 2487 |
| 372 | Ga0207687_10097210 | 3300025927 | Bacteria | 2160 |
| 373 | Ga0207687_10475962 | 3300025927 | Bacteria | 1039 |
| 374 | Ga0207700_10258811 | 3300025928 | Bacteria | 1489 |
| 375 | Ga0207664_10805038 | 3300025929 | Bacteria | 845 |
| 376 | Ga0207644_10065280 | 3300025931 | Bacteria | 2646 |
| 377 | Ga0207690_10032064 | 3300025932 | Bacteria | 3368 |
| 378 | Ga0207690_10044640 | 3300025932 | Bacteria | 2923 |
| 379 | Ga0207706_10000505 | 3300025933 | Bacteria | 41538 |
| 380 | Ga0207706_10236896 | 3300025933 | Bacteria | 1596 |
| 381 | Ga0207706_10489200 | 3300025933 | Bacteria | 1063 |
| 382 | Ga0207706_11252863 | 3300025933 | Bacteria | 614 |
| 383 | Ga0207686_10009659 | 3300025934 | Bacteria | 5239 |
| 384 | Ga0207686_10148722 | 3300025934 | Bacteria | 1628 |
| 385 | Ga0207686_10424519 | 3300025934 | Bacteria | 1018 |
| 386 | Ga0207686_10951209 | 3300025934 | Bacteria | 695 |
| 387 | Ga0207709_10055094 | 3300025935 | Bacteria | 2455 |
| 388 | Ga0207709_10070652 | 3300025935 | Bacteria | 2214 |
| 389 | Ga0207709_10359418 | 3300025935 | Bacteria | 1102 |
| 390 | Ga0207709_10380399 | 3300025935 | Bacteria | 1074 |
| 391 | Ga0207670_10117314 | 3300025936 | Bacteria | 1929 |
| 392 | Ga0207670_10146308 | 3300025936 | Bacteria | 1748 |
| 393 | Ga0207669_10083184 | 3300025937 | Bacteria | 2057 |
| 394 | Ga0207669_10127152 | 3300025937 | Bacteria | 1743 |
| 395 | Ga0207669_10273833 | 3300025937 | Bacteria | 1269 |
| 396 | Ga0207669_10365290 | 3300025937 | Bacteria | 1120 |
| 397 | Ga0207704_10017796 | 3300025938 | Bacteria | 3695 |
| 398 | Ga0207704_10155653 | 3300025938 | Bacteria | 1619 |
| 399 | Ga0207704_10684986 | 3300025938 | Bacteria | 847 |
| 400 | Ga0207704_11558721 | 3300025938 | Bacteria | 567 |
| 401 | Ga0207665_10000279 | 3300025939 | Bacteria | 35535 |
| 402 | Ga0207665_10028507 | 3300025939 | Bacteria | 3688 |
| 403 | Ga0207665_10037094 | 3300025939 | Bacteria | 3243 |
| 404 | Ga0207691_10048425 | 3300025940 | Bacteria | 3897 |
| 405 | Ga0207711_10184993 | 3300025941 | Bacteria | 1896 |
| 406 | Ga0207711_10492437 | 3300025941 | Bacteria | 1142 |
| 407 | Ga0207689_10197488 | 3300025942 | Bacteria | 1660 |
| 408 | Ga0207661_10254250 | 3300025944 | Bacteria | 1563 |
| 409 | Ga0207679_10161833 | 3300025945 | Bacteria | 1833 |
| 410 | Ga0207667_10066389 | 3300025949 | Bacteria | 3760 |
| 411 | Ga0207667_10437479 | 3300025949 | Bacteria | 1330 |
| 412 | Ga0207651_10104557 | 3300025960 | Bacteria | 2110 |
| 413 | Ga0207651_10212441 | 3300025960 | Bacteria | 1558 |
| 414 | Ga0207651_10622422 | 3300025960 | Bacteria | 946 |
| 415 | Ga0207651_12028490 | 3300025960 | Bacteria | 517 |
| 416 | Ga0207712_10004588 | 3300025961 | Bacteria | 8721 |
| 417 | Ga0207712_10033910 | 3300025961 | Bacteria | 3455 |
| 418 | Ga0207712_10075883 | 3300025961 | Bacteria | 2431 |
| 419 | Ga0207712_10623882 | 3300025961 | Bacteria | 935 |
| 420 | Ga0207668_10031602 | 3300025972 | Bacteria | 3489 |
| 421 | Ga0207668_10039053 | 3300025972 | Bacteria | 3191 |
| 422 | Ga0207668_11521886 | 3300025972 | Bacteria | 604 |
| 423 | Ga0207640_10051924 | 3300025981 | Bacteria | 2667 |
| 424 | Ga0207658_10146117 | 3300025986 | Bacteria | 1921 |
| 425 | Ga0207658_10390219 | 3300025986 | Bacteria | 1221 |
| 426 | Ga0207658_11732547 | 3300025986 | Bacteria | 570 |
| 427 | Ga0207677_10078964 | 3300026023 | Bacteria | 2352 |
| 428 | Ga0207677_10132733 | 3300026023 | Bacteria | 1894 |
| 429 | Ga0207677_11137124 | 3300026023 | Bacteria | 713 |
| 430 | Ga0207677_11641751 | 3300026023 | Bacteria | 595 |
| 431 | Ga0207703_10023879 | 3300026035 | Bacteria | 4809 |
| 432 | Ga0207703_10030555 | 3300026035 | Bacteria | 4259 |
| 433 | Ga0207703_10540465 | 3300026035 | Bacteria | 1098 |
| 434 | Ga0207703_11131682 | 3300026035 | Bacteria | 752 |
| 435 | Ga0207639_10024061 | 3300026041 | Bacteria | 4403 |
| 436 | Ga0207639_10228144 | 3300026041 | Bacteria | 1612 |
| 437 | Ga0207639_10257470 | 3300026041 | Bacteria | 1525 |
| 438 | Ga0207678_10000649 | 3300026067 | Bacteria | 32026 |
| 439 | Ga0207678_10045189 | 3300026067 | Bacteria | 3809 |
| 440 | Ga0207678_10052318 | 3300026067 | Bacteria | 3524 |
| 441 | Ga0207708_10040182 | 3300026075 | Bacteria | 3566 |
| 442 | Ga0207708_10130590 | 3300026075 | Bacteria | 1964 |
| 443 | Ga0207708_10602993 | 3300026075 | Bacteria | 930 |
| 444 | Ga0207702_10244567 | 3300026078 | Bacteria | 1682 |
| 445 | Ga0207702_11199078 | 3300026078 | Bacteria | 753 |
| 446 | Ga0207641_10298130 | 3300026088 | Bacteria | 1522 |
| 447 | Ga0207641_10854305 | 3300026088 | Bacteria | 902 |
| 448 | Ga0207648_10048532 | 3300026089 | Bacteria | 3716 |
| 449 | Ga0207648_10214466 | 3300026089 | Bacteria | 1709 |
| 450 | Ga0207648_10268950 | 3300026089 | Bacteria | 1522 |
| 451 | Ga0207648_10361204 | 3300026089 | Bacteria | 1310 |
| 452 | Ga0207676_11697285 | 3300026095 | Bacteria | 630 |
| 453 | Ga0207676_11759858 | 3300026095 | Bacteria | 618 |
| 454 | Ga0207674_10020971 | 3300026116 | Bacteria | 7049 |
| 455 | Ga0207674_10586627 | 3300026116 | Bacteria | 1077 |
| 456 | Ga0207675_100000985 | 3300026118 | Bacteria | 28260 |
| 457 | Ga0207675_100015450 | 3300026118 | Bacteria | 7121 |
| 458 | Ga0207675_100044704 | 3300026118 | Bacteria | 4139 |
| 459 | Ga0207675_100199765 | 3300026118 | Bacteria | 1920 |
| 460 | Ga0207683_10002194 | 3300026121 | Bacteria | 17161 |
| 461 | Ga0207683_10051649 | 3300026121 | Bacteria | 3602 |
| 462 | Ga0207683_10747827 | 3300026121 | Bacteria | 907 |
| 463 | Ga0207683_11175887 | 3300026121 | Bacteria | 711 |
| 464 | Ga0207698_10127066 | 3300026142 | Bacteria | 2170 |
| 465 | Ga0209998_10098885 | 3300027717 | Bacteria | 721 |
| 466 | Ga0209813_10411481 | 3300027866 | Bacteria | 547 |
| 467 | Ga0207428_10096598 | 3300027907 | Bacteria | 2288 |
| 468 | Ga0268266_10059838 | 3300028379 | Bacteria | 3282 |
| 469 | Ga0268266_10074683 | 3300028379 | Bacteria | 2944 |
| 470 | Ga0268266_10552562 | 3300028379 | Bacteria | 1103 |
| 471 | Ga0268266_11983132 | 3300028379 | Bacteria | 556 |
| 472 | Ga0268265_10023030 | 3300028380 | Bacteria | 4386 |
| 473 | Ga0268265_10112188 | 3300028380 | Bacteria | 2228 |
| 474 | Ga0268265_10124979 | 3300028380 | Bacteria | 2127 |
| 475 | Ga0268265_10922945 | 3300028380 | Bacteria | 858 |
| 476 | Ga0268265_11750371 | 3300028380 | Bacteria | 628 |
| 477 | Ga0268264_10076817 | 3300028381 | Bacteria | 2842 |
| 478 | Ga0268264_10077878 | 3300028381 | Bacteria | 2825 |
| 479 | Ga0268264_10408921 | 3300028381 | Bacteria | 1306 |
| 480 | Ga0268264_10670583 | 3300028381 | Bacteria | 1028 |
| 481 | Ga0265325_10468076 | 3300031241 | Bacteria | 548 |
| 482 | Ga0265329_10301536 | 3300031242 | Bacteria | 542 |
| 483 | Ga0265340_10144092 | 3300031247 | Bacteria | 1089 |
| 484 | Ga0265340_10399998 | 3300031247 | Bacteria | 606 |
| 485 | Ga0307513_10173346 | 3300031456 | Bacteria | 2031 |
| 486 | Ga0307408_100789957 | 3300031548 | Bacteria | 861 |
| 487 | Ga0265313_10047971 | 3300031595 | Bacteria | 2064 |
| 488 | Ga0316575_10004895 | 3300031665 | Bacteria | 4732 |
| 489 | Ga0316579_10058729 | 3300031691 | Bacteria | 1807 |
| 490 | Ga0316576_10207929 | 3300031727 | Bacteria | 1473 |
| 491 | Ga0307405_11189713 | 3300031731 | Bacteria | 659 |
| 492 | Ga0316577_10056669 | 3300031733 | Bacteria | 2187 |
| 493 | Ga0307413_10494820 | 3300031824 | Bacteria | 980 |
| 494 | Ga0307413_11024229 | 3300031824 | Bacteria | 709 |
| 495 | Ga0307410_10324225 | 3300031852 | Bacteria | 1223 |
| 496 | Ga0307406_10509595 | 3300031901 | Bacteria | 977 |
| 497 | Ga0307412_12215963 | 3300031911 | Bacteria | 512 |
| 498 | Ga0307409_100345302 | 3300031995 | Bacteria | 1402 |
| 499 | Ga0307409_100414078 | 3300031995 | Bacteria | 1291 |
| 500 | Ga0307409_100910454 | 3300031995 | Bacteria | 894 |
| 501 | Ga0307409_101548714 | 3300031995 | Bacteria | 691 |
| 502 | Ga0307416_101480355 | 3300032002 | Bacteria | 785 |
| 503 | Ga0307414_10206262 | 3300032004 | Bacteria | 1603 |
| 504 | Ga0307411_10011190 | 3300032005 | Bacteria | 4828 |
| 505 | Ga0307411_12253575 | 3300032005 | Bacteria | 511 |
| 506 | Ga0307415_100301164 | 3300032126 | Bacteria | 1328 |
| 507 | Ga0316583_10022510 | 3300032133 | Bacteria | 2255 |
| 508 | Ga0316585_10023764 | 3300032137 | Bacteria | 1892 |
| 509 | Ga0316580_10030001 | 3300032139 | Bacteria | 1683 |
| 510 | Ga0316593_10028564 | 3300032168 | Bacteria | 1798 |
| 511 | Ga0307510_10096709 | 3300033180 | Bacteria | 2767 |
| 512 | Ga0373930_0004849 | 3300034816 | Bacteria | 2210 |
| 513 | Ga0373958_0092834 | 3300034819 | Bacteria | 699 |
| 514 | Ga0373938_0066839 | 3300034957 | Bacteria | 852 |
| 515 | Ga0373926_0166696 | 3300035083 | Bacteria | 842 |
| 516 | Ga0373928_0126157 | 3300035084 | Bacteria | 690 |
| 517 | Ga0373944_0414027 | 3300035089 | Bacteria | 521 |
| 518 | Ga0373952_0284728 | 3300035092 | Bacteria | 510 |
| 519 | Ga0373932_0007779 | 3300035112 | Bacteria | 2558 |
| 520 | Ga0373939_0184898 | 3300035114 | Bacteria | 779 |
| 521 | Ga0373941_0032315 | 3300035115 | Bacteria | 1566 |
| 522 | Ga0373945_0049713 | 3300035116 | Bacteria | 1539 |
| 523 | Ga0373945_0087401 | 3300035116 | Bacteria | 1202 |
| 524 | Ga0373960_0011292 | 3300035121 | Bacteria | 2198 |
| 525 | Ga0373960_0135534 | 3300035121 | Bacteria | 829 |
| 526 | Ga0373943_0070087 | 3300035170 | Bacteria | 1773 |
| 527 | Ga0373946_0055664 | 3300035171 | Bacteria | 1668 |
| 528 | Ga0373942_0057060 | 3300035207 | Bacteria | 1110 |
| 529 | Ga0373961_0063510 | 3300035241 | Bacteria | 1127 |
| 530 | Ga0373961_0085572 | 3300035241 | Bacteria | 999 |
| 531 | Ga0316574_0250114 | 3300035398 | Bacteria | 1132 |
| 532 | Ga0373931_0013327 | 3300035691 | Bacteria | 4001 |
| 533 | Ga0373931_0064636 | 3300035691 | Bacteria | 1981 |
| 534 | Ga0373927_0029439 | 3300035695 | Bacteria | 3579 |
| 535 | Ga0373947_0017366 | 3300035725 | Bacteria | 4139 |
| 536 | Ga0316582_0245048 | 3300036647 | Bacteria | 1228 |
| 537 | Ga0316584_0097468 | 3300036712 | Bacteria | 2201 |
| 538 | Ga0373925_0007361 | 3300037068 | Bacteria | 8031 |
| 539 | Ga0395900_0064855 | 3300037418 | Bacteria | 3752 |
| 540 | Ga0395898_0033273 | 3300037466 | Bacteria | 5146 |
| 541 | Ga0395905_0002526 | 3300037471 | Bacteria | 20182 |
| 542 | Ga0436364_0857246 | 3300037853 | Bacteria | 529 |
| 543 | Ga0436364_1190915 | 3300037853 | Bacteria | 4917 |
| 544 | Ga0395901_0016472 | 3300038443 | Bacteria | 7531 |
| 545 | Ga0395901_1802119 | 3300038443 | Bacteria | 561 |
| 546 | Ga0242420_003812 | 3300038996 | Bacteria | 2248 |
| 547 | Ga0400483_017169 | 3300039062 | Bacteria | 12778 |
| 548 | Ga0400483_232856 | 3300039062 | Bacteria | 4763 |
| 549 | Ga0436365_0605653 | 3300039437 | Bacteria | 55706 |
| 550 | Ga0436365_0624031 | 3300039437 | Bacteria | 1190 |
| 551 | Ga0436365_0675144 | 3300039437 | Bacteria | 2654 |
| 552 | Ga0436360_0700895 | 3300039438 | Bacteria | 1048 |
| 553 | Ga0436363_0156265 | 3300039450 | Bacteria | 1202 |
| 554 | Ga0436363_0580065 | 3300039450 | Bacteria | 40060 |
| 555 | Ga0439465_0183145 | 3300041413 | Bacteria | 758 |
| 556 | Ga0451807_0639680 | 3300041486 | Bacteria | 755 |
| 557 | Ga0451835_0177526 | 3300041492 | Bacteria | 588 |
| 558 | Ga0451841_0234897 | 3300041498 | Bacteria | 696 |
| 559 | Ga0451853_1699730 | 3300041512 | Bacteria | 1570 |
| 560 | Ga0439459_0188092 | 3300042438 | Bacteria | 558 |
| 561 | Ga0495603_0000148 | 3300046455 | Bacteria | 34900 |
| 562 | Ga0495603_0686298 | 3300046455 | Bacteria | 586 |
| 563 | Ga0495629_0000108 | 3300046459 | Bacteria | 73826 |
| 564 | Ga0495638_0164821 | 3300046460 | Bacteria | 1276 |
| 565 | Ga0495638_0398733 | 3300046460 | Bacteria | 714 |
| 566 | Ga0495641_0004971 | 3300046461 | Bacteria | 9186 |
| 567 | Ga0495580_0000631 | 3300046472 | Bacteria | 29831 |
| 568 | Ga0495582_0001363 | 3300046473 | Bacteria | 13741 |
| 569 | Ga0495639_0001765 | 3300046475 | Bacteria | 9584 |
| 570 | Ga0495584_0060037 | 3300046491 | Bacteria | 1912 |
| 571 | Ga0495594_0000184 | 3300046499 | Bacteria | 30383 |
| 572 | Ga0495616_0087516 | 3300046513 | Bacteria | 1480 |
| 573 | Ga0495631_0342093 | 3300046518 | Bacteria | 637 |
| 574 | Ga0495637_0090107 | 3300046520 | Bacteria | 1211 |
| 575 | Ga0495637_0139440 | 3300046520 | Bacteria | 921 |
| 576 | Ga0495644_0071623 | 3300046523 | Bacteria | 1303 |
| 577 | Ga0495644_0247376 | 3300046523 | Bacteria | 692 |
| 578 | Ga0495644_0254740 | 3300046523 | Bacteria | 682 |
| 579 | Ga0495666_0073821 | 3300046526 | Bacteria | 1618 |
| 580 | Ga0495642_0237425 | 3300046528 | Bacteria | 796 |
| 581 | Ga0495598_0154550 | 3300046537 | Bacteria | 803 |
| 582 | Ga0495622_0005648 | 3300046557 | Bacteria | 5801 |
| 583 | Ga0495667_0176463 | 3300046559 | Bacteria | 1372 |
| 584 | Ga0495656_0176444 | 3300046615 | Bacteria | 1048 |
| 585 | Ga0495656_0224219 | 3300046615 | Bacteria | 941 |
| 586 | Ga0495668_0475313 | 3300046616 | Bacteria | 688 |
| 587 | Ga0495634_0035977 | 3300046642 | Bacteria | 3388 |
| 588 | Ga0495625_0145654 | 3300046660 | Bacteria | 1595 |
| 589 | Ga0495625_0842655 | 3300046660 | Bacteria | 530 |
| 590 | Ga0495659_0014153 | 3300046664 | Bacteria | 2607 |
| 591 | Ga0495659_0292844 | 3300046664 | Bacteria | 686 |
| 592 | Ga0495659_0354024 | 3300046664 | Bacteria | 628 |
| 593 | Ga0495588_0050724 | 3300046674 | Bacteria | 2135 |
| 594 | Ga0495647_0017965 | 3300046681 | Bacteria | 2510 |
| 595 | Ga0495658_0001757 | 3300046683 | Bacteria | 11192 |
| 596 | Ga0495613_0010164 | 3300046689 | Bacteria | 6992 |
| 597 | Ga0495624_0768145 | 3300046690 | Bacteria | 570 |
| 598 | Ga0495671_0129113 | 3300046692 | Bacteria | 1233 |
| 599 | Ga0495581_0000791 | 3300047315 | Bacteria | 16789 |
| 600 | Ga0495581_0354730 | 3300047315 | Bacteria | 856 |
| 601 | Ga0495636_0033357 | 3300047318 | Bacteria | 2115 |
| 602 | Ga0495676_0020611 | 3300047321 | Bacteria | 5779 |
| 603 | Ga0495680_0027004 | 3300047322 | Bacteria | 4724 |
| 604 | Ga0495683_0297785 | 3300047323 | Bacteria | 694 |
| 605 | Ga0495593_0000532 | 3300047673 | Bacteria | 21592 |
| 606 | Ga0495614_0004704 | 3300048089 | Bacteria | 6156 |
| 607 | Ga0496100_0008884 | 3300048903 | Bacteria | 5621 |
| 608 | Ga0496100_0038441 | 3300048903 | Bacteria | 3032 |
| 609 | Ga0496100_0222197 | 3300048903 | Bacteria | 1387 |
| 610 | Ga0496100_0288584 | 3300048903 | Bacteria | 1225 |
| 611 | Ga0496101_0044884 | 3300048904 | Bacteria | 3164 |
| 612 | Ga0496101_0072460 | 3300048904 | Bacteria | 2528 |
| 613 | Ga0496101_0075993 | 3300048904 | Bacteria | 2473 |
| 614 | Ga0496101_0186270 | 3300048904 | Bacteria | 1600 |
| 615 | Ga0496101_0326509 | 3300048904 | Bacteria | 1204 |
| 616 | Ga0496101_0725830 | 3300048904 | Bacteria | 784 |
| 617 | Ga0496102_0124358 | 3300048905 | Bacteria | 2410 |
| 618 | Ga0496102_0147845 | 3300048905 | Bacteria | 2206 |
| 619 | Ga0496102_0583991 | 3300048905 | Bacteria | 1040 |
| 620 | Ga0496102_1115674 | 3300048905 | Bacteria | 708 |
| 621 | Ga0496103_0013161 | 3300048906 | Bacteria | 4905 |
| 622 | Ga0496103_0021332 | 3300048906 | Bacteria | 3896 |
| 623 | Ga0496103_0135224 | 3300048906 | Bacteria | 1575 |
| 624 | Ga0496103_0798128 | 3300048906 | Bacteria | 595 |
| 625 | Ga0496104_0002041 | 3300048907 | Bacteria | 17532 |
| 626 | Ga0496104_0036056 | 3300048907 | Bacteria | 4620 |
| 627 | Ga0496104_0058885 | 3300048907 | Bacteria | 3636 |
| 628 | Ga0496104_0093438 | 3300048907 | Bacteria | 2877 |
| 629 | Ga0496104_0132150 | 3300048907 | Bacteria | 2398 |
| 630 | Ga0496104_1172335 | 3300048907 | Bacteria | 671 |
| 631 | Ga0496105_0003656 | 3300048908 | Bacteria | 11431 |
| 632 | Ga0496105_0124092 | 3300048908 | Bacteria | 2129 |
| 633 | Ga0496105_0134091 | 3300048908 | Bacteria | 2041 |
| 634 | Ga0496105_0145860 | 3300048908 | Bacteria | 1946 |
| 635 | Ga0496105_0487136 | 3300048908 | Bacteria | 969 |
| 636 | Ga0496106_0005509 | 3300048909 | Bacteria | 9361 |
| 637 | Ga0496106_0019071 | 3300048909 | Bacteria | 5084 |
| 638 | Ga0496106_0026054 | 3300048909 | Bacteria | 4351 |
| 639 | Ga0496106_0126504 | 3300048909 | Bacteria | 2001 |
| 640 | Ga0496106_0365307 | 3300048909 | Bacteria | 1159 |
| 641 | Ga0496107_0002100 | 3300048910 | Bacteria | 12758 |
| 642 | Ga0496107_0015213 | 3300048910 | Bacteria | 5390 |
| 643 | Ga0496107_0030382 | 3300048910 | Bacteria | 3850 |
| 644 | Ga0496107_0077990 | 3300048910 | Bacteria | 2413 |
| 645 | Ga0496107_0167234 | 3300048910 | Bacteria | 1631 |
| 646 | Ga0496108_0074343 | 3300048911 | Bacteria | 2869 |
| 647 | Ga0496108_0076405 | 3300048911 | Bacteria | 2831 |
| 648 | Ga0496108_0125673 | 3300048911 | Bacteria | 2201 |
| 649 | Ga0496109_0056608 | 3300048912 | Bacteria | 3578 |
| 650 | Ga0496109_0062095 | 3300048912 | Bacteria | 3416 |
| 651 | Ga0496109_0182005 | 3300048912 | Bacteria | 1974 |
| 652 | Ga0496109_0216032 | 3300048912 | Bacteria | 1803 |
| 653 | Ga0496109_0288681 | 3300048912 | Bacteria | 1546 |
| 654 | Ga0496109_0315550 | 3300048912 | Bacteria | 1475 |
| 655 | Ga0496109_0611203 | 3300048912 | Bacteria | 1026 |
| 656 | Ga0496109_1731241 | 3300048912 | Bacteria | 559 |
| 657 | Ga0496110_0047501 | 3300048913 | Bacteria | 3759 |
| 658 | Ga0496110_0194503 | 3300048913 | Bacteria | 1842 |
| 659 | Ga0496110_0224059 | 3300048913 | Bacteria | 1710 |
| 660 | Ga0496110_1367548 | 3300048913 | Bacteria | 617 |
| 661 | Ga0496111_0046706 | 3300048914 | Bacteria | 3118 |
| 662 | Ga0496111_0383590 | 3300048914 | Bacteria | 1039 |
| 663 | Ga0496111_0835196 | 3300048914 | Bacteria | 665 |
| 664 | Ga0496112_0005268 | 3300048915 | Bacteria | 11147 |
| 665 | Ga0496112_0021265 | 3300048915 | Bacteria | 6167 |
| 666 | Ga0496112_0361505 | 3300048915 | Bacteria | 1393 |
| 667 | Ga0496112_1066364 | 3300048915 | Bacteria | 727 |
| 668 | Ga0496113_0020982 | 3300048916 | Bacteria | 4603 |
| 669 | Ga0496113_0115870 | 3300048916 | Bacteria | 2090 |
| 670 | Ga0496113_0146790 | 3300048916 | Bacteria | 1859 |
| 671 | Ga0496113_0288667 | 3300048916 | Bacteria | 1312 |
| 672 | Ga0496114_0002432 | 3300048917 | Bacteria | 14201 |
| 673 | Ga0496114_0035057 | 3300048917 | Bacteria | 4142 |
| 674 | Ga0496114_0105089 | 3300048917 | Bacteria | 2415 |
| 675 | Ga0496114_0851670 | 3300048917 | Bacteria | 792 |
| 676 | Ga0496115_0009593 | 3300048918 | Bacteria | 7195 |
| 677 | Ga0496115_0066964 | 3300048918 | Bacteria | 2903 |
| 678 | Ga0496115_0156515 | 3300048918 | Bacteria | 1883 |
| 679 | Ga0496115_0243852 | 3300048918 | Bacteria | 1481 |
| 680 | Ga0496115_0807762 | 3300048918 | Bacteria | 729 |
| 681 | Ga0501031_0052882 | 3300049568 | Bacteria | 2646 |
| 682 | Ga0501032_0271591 | 3300049569 | Bacteria | 1099 |
| 683 | Ga0501032_0408411 | 3300049569 | Bacteria | 872 |
| 684 | Ga0501032_0835801 | 3300049569 | Bacteria | 581 |
| 685 | Ga0501033_0072638 | 3300049570 | Bacteria | 2526 |
| 686 | Ga0501033_0090562 | 3300049570 | Bacteria | 2238 |
| 687 | Ga0501034_1396173 | 3300049571 | Bacteria | 575 |
| 688 | Ga0501036_0079357 | 3300049572 | Bacteria | 2776 |
| 689 | Ga0501036_0703256 | 3300049572 | Bacteria | 835 |
| 690 | Ga0501037_0038417 | 3300049573 | Bacteria | 3527 |
| 691 | Ga0501037_0236580 | 3300049573 | Bacteria | 1281 |
| 692 | Ga0501038_0081297 | 3300049574 | Bacteria | 2730 |
| 693 | Ga0501038_1185629 | 3300049574 | Bacteria | 555 |
| 694 | Ga0501039_0094995 | 3300049575 | Bacteria | 2324 |
| 695 | Ga0501039_0145735 | 3300049575 | Bacteria | 1861 |
| 696 | Ga0501039_0246737 | 3300049575 | Bacteria | 1404 |
| 697 | Ga0501040_0166222 | 3300049576 | Bacteria | 1561 |
| 698 | Ga0501040_0167790 | 3300049576 | Bacteria | 1553 |
| 699 | Ga0501040_0234172 | 3300049576 | Bacteria | 1308 |
| 700 | Ga0501040_0523547 | 3300049576 | Bacteria | 855 |
| 701 | Ga0501041_0041028 | 3300049577 | Bacteria | 2811 |
| 702 | Ga0501041_0086437 | 3300049577 | Bacteria | 1934 |
| 703 | Ga0501041_0372876 | 3300049577 | Bacteria | 903 |
| 704 | Ga0501041_0969256 | 3300049577 | Bacteria | 547 |
| 705 | Ga0501042_0031007 | 3300049578 | Bacteria | 3782 |
| 706 | Ga0501042_0072129 | 3300049578 | Bacteria | 2471 |
| 707 | Ga0501042_0097051 | 3300049578 | Bacteria | 2118 |
| 708 | Ga0501042_0168740 | 3300049578 | Bacteria | 1579 |
| 709 | Ga0501042_0284805 | 3300049578 | Bacteria | 1194 |
| 710 | Ga0501042_0365726 | 3300049578 | Bacteria | 1044 |
| 711 | Ga0501042_0904361 | 3300049578 | Bacteria | 643 |
| 712 | Ga0501043_0082488 | 3300049579 | Bacteria | 2527 |
| 713 | Ga0501043_0613251 | 3300049579 | Bacteria | 803 |
| 714 | Ga0501046_0108044 | 3300049580 | Bacteria | 2128 |
| 715 | Ga0501046_0136611 | 3300049580 | Bacteria | 1857 |
| 716 | Ga0501046_0287798 | 3300049580 | Bacteria | 1202 |
| 717 | Ga0501047_0172522 | 3300049581 | Bacteria | 2031 |
| 718 | Ga0501048_0054602 | 3300049582 | Bacteria | 2838 |
| 719 | Ga0501048_0144873 | 3300049582 | Bacteria | 1680 |
| 720 | Ga0501048_0234973 | 3300049582 | Bacteria | 1301 |
| 721 | Ga0501048_0243093 | 3300049582 | Bacteria | 1277 |
| 722 | Ga0501048_0582328 | 3300049582 | Bacteria | 803 |
| 723 | Ga0501067_0016955 | 3300049583 | Bacteria | 4024 |
| 724 | Ga0501068_0121080 | 3300049584 | Bacteria | 1631 |
| 725 | Ga0501068_0467554 | 3300049584 | Bacteria | 817 |
| 726 | Ga0501069_0112830 | 3300049585 | Bacteria | 1549 |
| 727 | Ga0501069_0272967 | 3300049585 | Bacteria | 989 |
| 728 | Ga0501070_0041065 | 3300049586 | Bacteria | 3854 |
| 729 | Ga0501070_0129742 | 3300049586 | Bacteria | 2083 |
| 730 | Ga0501070_0271165 | 3300049586 | Bacteria | 1386 |
| 731 | Ga0501071_0117457 | 3300049587 | Bacteria | 1970 |
| 732 | Ga0501071_0166028 | 3300049587 | Bacteria | 1652 |
| 733 | Ga0501071_0483985 | 3300049587 | Bacteria | 949 |
| 734 | Ga0501071_1254694 | 3300049587 | Bacteria | 573 |
| 735 | Ga0501072_0105720 | 3300049588 | Bacteria | 2238 |
| 736 | Ga0501072_0118318 | 3300049588 | Bacteria | 2111 |
| 737 | Ga0501072_0800746 | 3300049588 | Bacteria | 738 |
| 738 | Ga0501073_0220123 | 3300049589 | Bacteria | 1311 |
| 739 | Ga0501074_0007373 | 3300049590 | Bacteria | 7952 |
| 740 | Ga0501074_0113667 | 3300049590 | Bacteria | 1937 |
| 741 | Ga0501074_0137770 | 3300049590 | Bacteria | 1746 |
| 742 | Ga0501074_0150390 | 3300049590 | Bacteria | 1664 |
| 743 | Ga0501075_0014554 | 3300049591 | Bacteria | 5639 |
| 744 | Ga0501075_0161931 | 3300049591 | Bacteria | 1707 |
| 745 | Ga0501075_0251811 | 3300049591 | Bacteria | 1346 |
| 746 | Ga0501075_0614201 | 3300049591 | Bacteria | 829 |
| 747 | Ga0501076_0007256 | 3300049592 | Bacteria | 8063 |
| 748 | Ga0501076_0175326 | 3300049592 | Bacteria | 1747 |
| 749 | Ga0501076_0231154 | 3300049592 | Bacteria | 1512 |
| 750 | Ga0501076_0977355 | 3300049592 | Bacteria | 698 |
| 751 | Ga0501076_1685064 | 3300049592 | Bacteria | 520 |
| 752 | Ga0501077_0386231 | 3300049593 | Bacteria | 894 |
| 753 | Ga0501217_140471 | 3300049661 | Bacteria | 715 |
| 754 | Ga0501079_0027934 | 3300049741 | Bacteria | 4328 |
| 755 | Ga0501079_0126525 | 3300049741 | Bacteria | 1988 |
| 756 | Ga0501079_0496974 | 3300049741 | Bacteria | 959 |
| 757 | Ga0501079_0514294 | 3300049741 | Bacteria | 941 |
| 758 | Ga0501080_0034100 | 3300049742 | Bacteria | 4751 |
| 759 | Ga0501080_0109437 | 3300049742 | Bacteria | 2561 |
| 760 | Ga0501080_0113110 | 3300049742 | Bacteria | 2516 |
| 761 | Ga0501080_0186053 | 3300049742 | Bacteria | 1910 |
| 762 | Ga0501081_0034225 | 3300049743 | Bacteria | 3456 |
| 763 | Ga0501081_0081757 | 3300049743 | Bacteria | 2263 |
| 764 | Ga0501081_0110175 | 3300049743 | Bacteria | 1953 |
| 765 | Ga0501081_0120753 | 3300049743 | Bacteria | 1866 |
| 766 | Ga0501081_0206238 | 3300049743 | Bacteria | 1426 |
| 767 | Ga0501081_0223037 | 3300049743 | Bacteria | 1371 |
| 768 | Ga0501081_0410723 | 3300049743 | Bacteria | 1003 |
| 769 | Ga0501081_0572780 | 3300049743 | Bacteria | 844 |
| 770 | Ga0501083_0071736 | 3300049744 | Bacteria | 2302 |
| 771 | Ga0501083_0093175 | 3300049744 | Bacteria | 1989 |
| 772 | Ga0501083_0189095 | 3300049744 | Bacteria | 1344 |
| 773 | Ga0501083_0206016 | 3300049744 | Bacteria | 1282 |
| 774 | Ga0501035_0253567 | 3300049822 | Bacteria | 1493 |
| 775 | Ga0501045_0009046 | 3300049824 | Bacteria | 6956 |
| 776 | Ga0501045_0010366 | 3300049824 | Bacteria | 6526 |
| 777 | Ga0501045_0070295 | 3300049824 | Bacteria | 2575 |
| 778 | Ga0501045_0324274 | 3300049824 | Bacteria | 1146 |
| 779 | Ga0501045_0675290 | 3300049824 | Bacteria | 763 |
| 780 | Ga0501045_0775796 | 3300049824 | Bacteria | 706 |
| 781 | nmdc:mga03683_15964_c1 | 3300050489 | Bacteria | 2812 |
| 782 | nmdc:mga03n38_68501_c1 | 3300050490 | Bacteria | 1636 |
| 783 | nmdc:mga00v17_139972_c1 | 3300050491 | Bacteria | 1551 |
| 784 | nmdc:mga00v17_169270_c1 | 3300050491 | Bacteria | 1408 |
| 785 | nmdc:mga0yw44_20189_c1 | 3300050492 | Bacteria | 3692 |
| 786 | nmdc:mga0yw44_547_c1 | 3300050492 | Bacteria | 13523 |
| 787 | nmdc:mga0yw44_925302_c1 | 3300050492 | Bacteria | 591 |
| 788 | nmdc:mga0k408_429986_c1 | 3300050493 | Bacteria | 785 |
| 789 | nmdc:mga06z11_261251_c1 | 3300050494 | Bacteria | 1022 |
| 790 | nmdc:mga06z11_95534_c1 | 3300050494 | Bacteria | 1621 |
| 791 | nmdc:mga04h51_448451_c1 | 3300050495 | Bacteria | 546 |
| 792 | nmdc:mga05p37_1304921_c1 | 3300050507 | Bacteria | 740 |
| 793 | nmdc:mga05p37_441578_c1 | 3300050507 | Bacteria | 1509 |
| 794 | nmdc:mga09592_145331_c1 | 3300050508 | Bacteria | 2045 |
| 795 | nmdc:mga0qj67_308275_c1 | 3300050509 | Bacteria | 1282 |
| 796 | nmdc:mga06r32_211664_c1 | 3300050510 | Bacteria | 1926 |
| 797 | nmdc:mga06r32_219887_c1 | 3300050510 | Bacteria | 1888 |
| 798 | nmdc:mga06r32_73600_c1 | 3300050510 | Bacteria | 3310 |
| 799 | nmdc:mga08y16_1161108_c1 | 3300050511 | Bacteria | 745 |
| 800 | nmdc:mga08y16_1905337_c1 | 3300050511 | Bacteria | 545 |
| 801 | nmdc:mga0n895_427870_c1 | 3300050512 | Bacteria | 1338 |
| 802 | nmdc:mga0n895_49893_c1 | 3300050512 | Bacteria | 4103 |
| 803 | nmdc:mga0rr50_134099_c1 | 3300050513 | Bacteria | 1986 |
| 804 | nmdc:mga0rr50_47369_c1 | 3300050513 | Bacteria | 3171 |
| 805 | nmdc:mga0rr50_96219_c1 | 3300050513 | Bacteria | 2316 |
| 806 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 807 | nmdc:mga08x19_27763_c1 | 3300050514 | Bacteria | 3542 |
| 808 | nmdc:mga0a205_170480_c1 | 3300050515 | Bacteria | 2073 |
| 809 | Ga0495655_0001031 | 3300053083 | Bacteria | 4299 |
| 810 | Ga0495619_0003279 | 3300053085 | Bacteria | 10467 |
| 811 | Ga0500643_018592 | 3300053087 | Bacteria | 2303 |
| 812 | Ga0500644_0024700 | 3300053088 | Bacteria | 1840 |
| 813 | Ga0500646_0003069 | 3300053090 | Bacteria | 4281 |
| 814 | Ga0500646_0016337 | 3300053090 | Bacteria | 1938 |
| 815 | Ga0500583_0122296 | 3300053092 | Bacteria | 1288 |
| 816 | Ga0500650_0234769 | 3300053098 | Bacteria | 826 |
| 817 | Ga0500562_022493 | 3300053108 | Bacteria | 1643 |
| 818 | Ga0500593_070115 | 3300053117 | Bacteria | 1522 |
| 819 | Ga0500594_0025695 | 3300053118 | Bacteria | 1511 |
| 820 | Ga0500594_0141893 | 3300053118 | Bacteria | 767 |
| 821 | Ga0500614_170082 | 3300053123 | Bacteria | 663 |
| 822 | Ga0500614_261551 | 3300053123 | Bacteria | 540 |
| 823 | Ga0500642_0227476 | 3300053130 | Bacteria | 862 |
| 824 | Ga0500642_0355745 | 3300053130 | Bacteria | 649 |
| 825 | Ga0500658_0049180 | 3300053134 | Bacteria | 1717 |
| 826 | Ga0500568_0000059 | 3300053139 | Bacteria | 108096 |
| 827 | Ga0500568_0225875 | 3300053139 | Bacteria | 683 |
| 828 | Ga0500577_0236977 | 3300053142 | Bacteria | 791 |
| 829 | Ga0500588_0209785 | 3300053146 | Bacteria | 723 |
| 830 | Ga0500604_0045189 | 3300053151 | Bacteria | 1343 |
| 831 | Ga0500616_0004149 | 3300053153 | Bacteria | 10466 |
| 832 | Ga0500622_0188200 | 3300053156 | Bacteria | 948 |
| 833 | Ga0500633_0246841 | 3300053160 | Bacteria | 663 |
| 834 | Ga0500611_010983 | 3300053727 | Bacteria | 1484 |
| 835 | Ga0500609_000984 | 3300053731 | Bacteria | 4262 |
| 836 | Ga0500587_064367 | 3300053739 | Bacteria | 566 |
| 837 | Ga0501084_0046221 | 3300054114 | Bacteria | 3646 |
| 838 | Ga0501084_0060586 | 3300054114 | Bacteria | 3168 |
| 839 | Ga0501084_0083027 | 3300054114 | Bacteria | 2689 |
| 840 | Ga0501084_0158583 | 3300054114 | Bacteria | 1909 |
| 841 | Ga0501084_0210098 | 3300054114 | Bacteria | 1642 |
| 842 | Ga0501084_0320876 | 3300054114 | Bacteria | 1308 |
| 843 | Ga0501084_0795499 | 3300054114 | Bacteria | 797 |
| 844 | Ga0501084_1422262 | 3300054114 | Bacteria | 581 |
| 845 | Ga0587076_180618 | 3300059645 | Bacteria | 531 |
| 846 | Ga0501082_0064175 | 3300060353 | Bacteria | 3163 |
| 847 | Ga0501082_0108225 | 3300060353 | Bacteria | 2405 |
| 848 | Ga0501082_0206670 | 3300060353 | Bacteria | 1708 |
| 849 | Ga0501082_0227710 | 3300060353 | Bacteria | 1623 |
| 850 | Ga0501082_0284411 | 3300060353 | Bacteria | 1440 |
| 851 | Ga0501082_0417794 | 3300060353 | Bacteria | 1171 |
| 852 | Ga0501082_0437280 | 3300060353 | Bacteria | 1143 |
| 853 | Ga0501082_0460171 | 3300060353 | Bacteria | 1112 |
| 854 | Ga0501082_0561493 | 3300060353 | Bacteria | 998 |
| 855 | Ga0501082_0933486 | 3300060353 | Bacteria | 759 |
| 856 | Ga0530510_0046257 | 3300061734 | Bacteria | 3144 |
| 857 | Ga0530510_0138527 | 3300061734 | Bacteria | 1792 |
| 858 | Ga0530510_0142456 | 3300061734 | Bacteria | 1767 |
| 859 | Ga0530510_0205656 | 3300061734 | Bacteria | 1463 |
| 860 | Ga0530510_0589594 | 3300061734 | Bacteria | 845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_0639680 | Ga0451807_0639680_185_517 | 105 |
| 2 | 3300005367 | Ga0070667_100599628 | Ga0070667_1005996281 | 106 |
| 3 | 3300006358 | Ga0068871_102109836 | Ga0068871_1021098361 | 106 |
| 4 | 3300028379 | Ga0268266_11983132 | Ga0268266_119831322 | 106 |
| 5 | 3300049576 | Ga0501040_0166222 | Ga0501040_0166222_1067_1393 | 106 |
| 6 | 3300049578 | Ga0501042_0031007 | Ga0501042_0031007_110_436 | 106 |
| 7 | 3300049592 | Ga0501076_1685064 | Ga0501076_1685064_130_456 | 106 |
| 8 | 3300049741 | Ga0501079_0126525 | Ga0501079_0126525_478_804 | 106 |
| 9 | 3300049743 | Ga0501081_0572780 | Ga0501081_0572780_225_551 | 106 |
| 10 | 3300060353 | Ga0501082_0460171 | Ga0501082_0460171_318_644 | 106 |
| 11 | 3300061734 | Ga0530510_0589594 | Ga0530510_0589594_127_453 | 106 |
| 12 | 3300031901 | Ga0307406_10509595 | Ga0307406_105095952 | 107 |
| 13 | 3300049575 | Ga0501039_0094995 | Ga0501039_0094995_382_708 | 107 |
| 14 | 3300049577 | Ga0501041_0041028 | Ga0501041_0041028_2388_2714 | 107 |
| 15 | 3300049580 | Ga0501046_0287798 | Ga0501046_0287798_488_814 | 107 |
| 16 | 3300049582 | Ga0501048_0582328 | Ga0501048_0582328_360_686 | 107 |
| 17 | 3300049741 | Ga0501079_0514294 | Ga0501079_0514294_364_690 | 107 |
| 18 | 3300049743 | Ga0501081_0110175 | Ga0501081_0110175_22_348 | 107 |
| 19 | 3300050510 | nmdc:mga06r32_211664_c1 | nmdc:mga06r32_211664_c1_436_762 | 107 |
| 20 | 3300054114 | Ga0501084_0158583 | Ga0501084_0158583_1019_1345 | 107 |
| 21 | 3300060353 | Ga0501082_0417794 | Ga0501082_0417794_769_1095 | 107 |
| 22 | 3300005355 | Ga0070671_100010429 | Ga0070671_1000104295 | 108 |
| 23 | 3300005364 | Ga0070673_101658838 | Ga0070673_1016588381 | 108 |
| 24 | 3300005455 | Ga0070663_100372111 | Ga0070663_1003721112 | 108 |
| 25 | 3300005459 | Ga0068867_100615406 | Ga0068867_1006154062 | 108 |
| 26 | 3300005615 | Ga0070702_100197804 | Ga0070702_1001978041 | 108 |
| 27 | 3300009098 | Ga0105245_10939953 | Ga0105245_109399532 | 108 |
| 28 | 3300009148 | Ga0105243_10469839 | Ga0105243_104698392 | 108 |
| 29 | 3300011119 | Ga0105246_10159010 | Ga0105246_101590101 | 108 |
| 30 | 3300013100 | Ga0157373_11551358 | Ga0157373_115513581 | 108 |
| 31 | 3300013297 | Ga0157378_11717341 | Ga0157378_117173412 | 108 |
| 32 | 3300014969 | Ga0157376_10885532 | Ga0157376_108855321 | 108 |
| 33 | 3300026023 | Ga0207677_11137124 | Ga0207677_111371242 | 108 |
| 34 | 3300026067 | Ga0207678_10045189 | Ga0207678_100451893 | 108 |
| 35 | 3300026075 | Ga0207708_10602993 | Ga0207708_106029932 | 108 |
| 36 | 3300031242 | Ga0265329_10301536 | Ga0265329_103015361 | 108 |
| 37 | 3300031247 | Ga0265340_10399998 | Ga0265340_103999981 | 108 |
| 38 | 3300031824 | Ga0307413_11024229 | Ga0307413_110242292 | 108 |
| 39 | 3300035116 | Ga0373945_0087401 | Ga0373945_0087401_866_1192 | 108 |
| 40 | 3300046537 | Ga0495598_0154550 | Ga0495598_0154550_343_693 | 108 |
| 41 | 3300046615 | Ga0495656_0176444 | Ga0495656_0176444_632_964 | 108 |
| 42 | 3300046664 | Ga0495659_0292844 | Ga0495659_0292844_229_579 | 108 |
| 43 | 3300048903 | Ga0496100_0222197 | Ga0496100_0222197_1017_1367 | 108 |
| 44 | 3300049574 | Ga0501038_1185629 | Ga0501038_1185629_40_369 | 108 |
| 45 | 3300049576 | Ga0501040_0234172 | Ga0501040_0234172_207_536 | 108 |
| 46 | 3300049577 | Ga0501041_0372876 | Ga0501041_0372876_228_557 | 108 |
| 47 | 3300049578 | Ga0501042_0284805 | Ga0501042_0284805_690_1019 | 108 |
| 48 | 3300049588 | Ga0501072_0800746 | Ga0501072_0800746_67_399 | 108 |
| 49 | 3300049591 | Ga0501075_0251811 | Ga0501075_0251811_489_818 | 108 |
| 50 | 3300049661 | Ga0501217_140471 | Ga0501217_140471_26_370 | 108 |
| 51 | 3300049743 | Ga0501081_0223037 | Ga0501081_0223037_389_718 | 108 |
| 52 | 3300053117 | Ga0500593_070115 | Ga0500593_070115_866_1192 | 108 |
| 53 | 3300053153 | Ga0500616_0004149 | Ga0500616_0004149_8704_9036 | 108 |
| 54 | 3300053156 | Ga0500622_0188200 | Ga0500622_0188200_552_878 | 108 |
| 55 | 3300060353 | Ga0501082_0227710 | Ga0501082_0227710_1267_1596 | 108 |
| 56 | 3300060353 | Ga0501082_0933486 | Ga0501082_0933486_39_380 | 108 |
| 57 | 3300001978 | JGI24747J21853_1028925 | JGI24747J21853_10289251 | 109 |
| 58 | 3300001990 | JGI24737J22298_10019086 | JGI24737J22298_100190862 | 109 |
| 59 | 3300001991 | JGI24743J22301_10044562 | JGI24743J22301_100445621 | 109 |
| 60 | 3300002070 | JGI24750J21931_1003524 | JGI24750J21931_10035241 | 109 |
| 61 | 3300002074 | JGI24748J21848_1033234 | JGI24748J21848_10332341 | 109 |
| 62 | 3300002075 | JGI24738J21930_10011766 | JGI24738J21930_100117662 | 109 |
| 63 | 3300002239 | JGI24034J26672_10089043 | JGI24034J26672_100890431 | 109 |
| 64 | 3300002459 | JGI24751J29686_10020519 | JGI24751J29686_100205191 | 109 |
| 65 | 3300005290 | Ga0065712_10322409 | Ga0065712_103224091 | 109 |
| 66 | 3300005293 | Ga0065715_10702056 | Ga0065715_107020561 | 109 |
| 67 | 3300005328 | Ga0070676_10015391 | Ga0070676_100153913 | 109 |
| 68 | 3300005328 | Ga0070676_10468819 | Ga0070676_104688191 | 109 |
| 69 | 3300005330 | Ga0070690_100001376 | Ga0070690_1000013767 | 109 |
| 70 | 3300005331 | Ga0070670_100003133 | Ga0070670_1000031338 | 109 |
| 71 | 3300005334 | Ga0068869_100009339 | Ga0068869_1000093394 | 109 |
| 72 | 3300005335 | Ga0070666_10013599 | Ga0070666_100135994 | 109 |
| 73 | 3300005336 | Ga0070680_101789962 | Ga0070680_1017899621 | 109 |
| 74 | 3300005337 | Ga0070682_100010755 | Ga0070682_1000107553 | 109 |
| 75 | 3300005337 | Ga0070682_100293650 | Ga0070682_1002936501 | 109 |
| 76 | 3300005338 | Ga0068868_100020199 | Ga0068868_1000201993 | 109 |
| 77 | 3300005338 | Ga0068868_100500519 | Ga0068868_1005005192 | 109 |
| 78 | 3300005339 | Ga0070660_100014281 | Ga0070660_1000142814 | 109 |
| 79 | 3300005340 | Ga0070689_100006899 | Ga0070689_1000068998 | 109 |
| 80 | 3300005341 | Ga0070691_10052775 | Ga0070691_100527753 | 109 |
| 81 | 3300005343 | Ga0070687_100012882 | Ga0070687_1000128822 | 109 |
| 82 | 3300005343 | Ga0070687_100523210 | Ga0070687_1005232102 | 109 |
| 83 | 3300005344 | Ga0070661_100021198 | Ga0070661_1000211983 | 109 |
| 84 | 3300005345 | Ga0070692_10056845 | Ga0070692_100568453 | 109 |
| 85 | 3300005347 | Ga0070668_100008205 | Ga0070668_1000082052 | 109 |
| 86 | 3300005347 | Ga0070668_100160307 | Ga0070668_1001603072 | 109 |
| 87 | 3300005347 | Ga0070668_100166489 | Ga0070668_1001664892 | 109 |
| 88 | 3300005353 | Ga0070669_100008028 | Ga0070669_1000080284 | 109 |
| 89 | 3300005353 | Ga0070669_100870649 | Ga0070669_1008706491 | 109 |
| 90 | 3300005354 | Ga0070675_100042420 | Ga0070675_1000424203 | 109 |
| 91 | 3300005354 | Ga0070675_101786589 | Ga0070675_1017865891 | 109 |
| 92 | 3300005355 | Ga0070671_100041032 | Ga0070671_1000410323 | 109 |
| 93 | 3300005356 | Ga0070674_100000275 | Ga0070674_1000002759 | 109 |
| 94 | 3300005356 | Ga0070674_100036192 | Ga0070674_1000361923 | 109 |
| 95 | 3300005356 | Ga0070674_100323462 | Ga0070674_1003234622 | 109 |
| 96 | 3300005356 | Ga0070674_100630857 | Ga0070674_1006308572 | 109 |
| 97 | 3300005364 | Ga0070673_100011614 | Ga0070673_1000116143 | 109 |
| 98 | 3300005364 | Ga0070673_100092401 | Ga0070673_1000924012 | 109 |
| 99 | 3300005364 | Ga0070673_100521341 | Ga0070673_1005213412 | 109 |
| 100 | 3300005364 | Ga0070673_102035744 | Ga0070673_1020357441 | 109 |
| 101 | 3300005365 | Ga0070688_100001437 | Ga0070688_1000014378 | 109 |
| 102 | 3300005365 | Ga0070688_100080151 | Ga0070688_1000801512 | 109 |
| 103 | 3300005365 | Ga0070688_100224016 | Ga0070688_1002240162 | 109 |
| 104 | 3300005366 | Ga0070659_100003374 | Ga0070659_1000033742 | 109 |
| 105 | 3300005366 | Ga0070659_100108937 | Ga0070659_1001089373 | 109 |
| 106 | 3300005366 | Ga0070659_100952906 | Ga0070659_1009529062 | 109 |
| 107 | 3300005366 | Ga0070659_100960362 | Ga0070659_1009603621 | 109 |
| 108 | 3300005367 | Ga0070667_100006020 | Ga0070667_1000060206 | 109 |
| 109 | 3300005367 | Ga0070667_100240388 | Ga0070667_1002403882 | 109 |
| 110 | 3300005367 | Ga0070667_100284840 | Ga0070667_1002848402 | 109 |
| 111 | 3300005367 | Ga0070667_101593120 | Ga0070667_1015931201 | 109 |
| 112 | 3300005406 | Ga0070703_10045473 | Ga0070703_100454732 | 109 |
| 113 | 3300005434 | Ga0070709_10035104 | Ga0070709_100351042 | 109 |
| 114 | 3300005434 | Ga0070709_10205860 | Ga0070709_102058602 | 109 |
| 115 | 3300005435 | Ga0070714_100256997 | Ga0070714_1002569971 | 109 |
| 116 | 3300005436 | Ga0070713_101878632 | Ga0070713_1018786321 | 109 |
| 117 | 3300005437 | Ga0070710_10018648 | Ga0070710_100186483 | 109 |
| 118 | 3300005439 | Ga0070711_100037622 | Ga0070711_1000376223 | 109 |
| 119 | 3300005439 | Ga0070711_100174404 | Ga0070711_1001744042 | 109 |
| 120 | 3300005439 | Ga0070711_100304202 | Ga0070711_1003042022 | 109 |
| 121 | 3300005440 | Ga0070705_100009505 | Ga0070705_1000095053 | 109 |
| 122 | 3300005440 | Ga0070705_101469308 | Ga0070705_1014693081 | 109 |
| 123 | 3300005441 | Ga0070700_100025249 | Ga0070700_1000252493 | 109 |
| 124 | 3300005441 | Ga0070700_100625970 | Ga0070700_1006259701 | 109 |
| 125 | 3300005444 | Ga0070694_100004982 | Ga0070694_1000049824 | 109 |
| 126 | 3300005444 | Ga0070694_100135372 | Ga0070694_1001353723 | 109 |
| 127 | 3300005445 | Ga0070708_101746795 | Ga0070708_1017467951 | 109 |
| 128 | 3300005455 | Ga0070663_100020001 | Ga0070663_1000200014 | 109 |
| 129 | 3300005455 | Ga0070663_100146754 | Ga0070663_1001467543 | 109 |
| 130 | 3300005456 | Ga0070678_100099477 | Ga0070678_1000994772 | 109 |
| 131 | 3300005456 | Ga0070678_100292966 | Ga0070678_1002929662 | 109 |
| 132 | 3300005456 | Ga0070678_101002156 | Ga0070678_1010021561 | 109 |
| 133 | 3300005456 | Ga0070678_101312387 | Ga0070678_1013123871 | 109 |
| 134 | 3300005457 | Ga0070662_100004091 | Ga0070662_1000040914 | 109 |
| 135 | 3300005458 | Ga0070681_10247498 | Ga0070681_102474982 | 109 |
| 136 | 3300005458 | Ga0070681_10626746 | Ga0070681_106267461 | 109 |
| 137 | 3300005459 | Ga0068867_100031811 | Ga0068867_1000318112 | 109 |
| 138 | 3300005459 | Ga0068867_100078175 | Ga0068867_1000781752 | 109 |
| 139 | 3300005459 | Ga0068867_100242022 | Ga0068867_1002420222 | 109 |
| 140 | 3300005459 | Ga0068867_100473618 | Ga0068867_1004736182 | 109 |
| 141 | 3300005466 | Ga0070685_10016452 | Ga0070685_100164522 | 109 |
| 142 | 3300005467 | Ga0070706_100212586 | Ga0070706_1002125863 | 109 |
| 143 | 3300005467 | Ga0070706_101149242 | Ga0070706_1011492422 | 109 |
| 144 | 3300005518 | Ga0070699_100070865 | Ga0070699_1000708652 | 109 |
| 145 | 3300005530 | Ga0070679_100039265 | Ga0070679_1000392655 | 109 |
| 146 | 3300005530 | Ga0070679_101741481 | Ga0070679_1017414812 | 109 |
| 147 | 3300005535 | Ga0070684_100018150 | Ga0070684_1000181502 | 109 |
| 148 | 3300005536 | Ga0070697_100013631 | Ga0070697_1000136315 | 109 |
| 149 | 3300005536 | Ga0070697_100028741 | Ga0070697_1000287413 | 109 |
| 150 | 3300005536 | Ga0070697_100231453 | Ga0070697_1002314532 | 109 |
| 151 | 3300005539 | Ga0068853_100020087 | Ga0068853_1000200874 | 109 |
| 152 | 3300005539 | Ga0068853_100171394 | Ga0068853_1001713942 | 109 |
| 153 | 3300005539 | Ga0068853_100282295 | Ga0068853_1002822952 | 109 |
| 154 | 3300005543 | Ga0070672_100094945 | Ga0070672_1000949453 | 109 |
| 155 | 3300005543 | Ga0070672_100245114 | Ga0070672_1002451142 | 109 |
| 156 | 3300005544 | Ga0070686_100003128 | Ga0070686_1000031284 | 109 |
| 157 | 3300005544 | Ga0070686_100584165 | Ga0070686_1005841652 | 109 |
| 158 | 3300005544 | Ga0070686_100694308 | Ga0070686_1006943081 | 109 |
| 159 | 3300005545 | Ga0070695_100007641 | Ga0070695_1000076412 | 109 |
| 160 | 3300005545 | Ga0070695_100057449 | Ga0070695_1000574492 | 109 |
| 161 | 3300005545 | Ga0070695_100095923 | Ga0070695_1000959232 | 109 |
| 162 | 3300005545 | Ga0070695_100405651 | Ga0070695_1004056512 | 109 |
| 163 | 3300005545 | Ga0070695_100521152 | Ga0070695_1005211522 | 109 |
| 164 | 3300005546 | Ga0070696_100016995 | Ga0070696_1000169953 | 109 |
| 165 | 3300005546 | Ga0070696_100128204 | Ga0070696_1001282042 | 109 |
| 166 | 3300005546 | Ga0070696_100162157 | Ga0070696_1001621572 | 109 |
| 167 | 3300005546 | Ga0070696_100724426 | Ga0070696_1007244262 | 109 |
| 168 | 3300005547 | Ga0070693_100007741 | Ga0070693_1000077413 | 109 |
| 169 | 3300005548 | Ga0070665_100075206 | Ga0070665_1000752064 | 109 |
| 170 | 3300005548 | Ga0070665_100305492 | Ga0070665_1003054922 | 109 |
| 171 | 3300005548 | Ga0070665_101654487 | Ga0070665_1016544871 | 109 |
| 172 | 3300005549 | Ga0070704_100001792 | Ga0070704_1000017923 | 109 |
| 173 | 3300005549 | Ga0070704_100019287 | Ga0070704_1000192875 | 109 |
| 174 | 3300005549 | Ga0070704_100024362 | Ga0070704_1000243623 | 109 |
| 175 | 3300005549 | Ga0070704_100950432 | Ga0070704_1009504321 | 109 |
| 176 | 3300005563 | Ga0068855_100171842 | Ga0068855_1001718423 | 109 |
| 177 | 3300005564 | Ga0070664_100030826 | Ga0070664_1000308263 | 109 |
| 178 | 3300005564 | Ga0070664_100834048 | Ga0070664_1008340482 | 109 |
| 179 | 3300005577 | Ga0068857_100055332 | Ga0068857_1000553322 | 109 |
| 180 | 3300005577 | Ga0068857_100599180 | Ga0068857_1005991802 | 109 |
| 181 | 3300005578 | Ga0068854_100065826 | Ga0068854_1000658262 | 109 |
| 182 | 3300005614 | Ga0068856_100013416 | Ga0068856_1000134164 | 109 |
| 183 | 3300005615 | Ga0070702_100000445 | Ga0070702_1000004452 | 109 |
| 184 | 3300005615 | Ga0070702_100014153 | Ga0070702_1000141532 | 109 |
| 185 | 3300005615 | Ga0070702_100137911 | Ga0070702_1001379112 | 109 |
| 186 | 3300005615 | Ga0070702_100339213 | Ga0070702_1003392132 | 109 |
| 187 | 3300005616 | Ga0068852_100023924 | Ga0068852_1000239243 | 109 |
| 188 | 3300005617 | Ga0068859_100064579 | Ga0068859_1000645793 | 109 |
| 189 | 3300005617 | Ga0068859_100076272 | Ga0068859_1000762722 | 109 |
| 190 | 3300005617 | Ga0068859_100177712 | Ga0068859_1001777122 | 109 |
| 191 | 3300005617 | Ga0068859_100798925 | Ga0068859_1007989251 | 109 |
| 192 | 3300005618 | Ga0068864_100014642 | Ga0068864_1000146424 | 109 |
| 193 | 3300005618 | Ga0068864_101067139 | Ga0068864_1010671392 | 109 |
| 194 | 3300005618 | Ga0068864_101911486 | Ga0068864_1019114861 | 109 |
| 195 | 3300005718 | Ga0068866_10010484 | Ga0068866_100104843 | 109 |
| 196 | 3300005718 | Ga0068866_10025658 | Ga0068866_100256583 | 109 |
| 197 | 3300005718 | Ga0068866_10526646 | Ga0068866_105266462 | 109 |
| 198 | 3300005719 | Ga0068861_100002085 | Ga0068861_1000020857 | 109 |
| 199 | 3300005719 | Ga0068861_100170318 | Ga0068861_1001703182 | 109 |
| 200 | 3300005834 | Ga0068851_10049757 | Ga0068851_100497572 | 109 |
| 201 | 3300005840 | Ga0068870_10554701 | Ga0068870_105547012 | 109 |
| 202 | 3300005840 | Ga0068870_10942265 | Ga0068870_109422652 | 109 |
| 203 | 3300005841 | Ga0068863_100055445 | Ga0068863_1000554451 | 109 |
| 204 | 3300005841 | Ga0068863_100180491 | Ga0068863_1001804912 | 109 |
| 205 | 3300005842 | Ga0068858_100042027 | Ga0068858_1000420273 | 109 |
| 206 | 3300005842 | Ga0068858_100157551 | Ga0068858_1001575512 | 109 |
| 207 | 3300005842 | Ga0068858_100469326 | Ga0068858_1004693262 | 109 |
| 208 | 3300005842 | Ga0068858_100520498 | Ga0068858_1005204982 | 109 |
| 209 | 3300005843 | Ga0068860_100032669 | Ga0068860_1000326694 | 109 |
| 210 | 3300005843 | Ga0068860_100040580 | Ga0068860_1000405803 | 109 |
| 211 | 3300005843 | Ga0068860_100379516 | Ga0068860_1003795162 | 109 |
| 212 | 3300005843 | Ga0068860_100873544 | Ga0068860_1008735441 | 109 |
| 213 | 3300005843 | Ga0068860_101457422 | Ga0068860_1014574221 | 109 |
| 214 | 3300005844 | Ga0068862_100039283 | Ga0068862_1000392832 | 109 |
| 215 | 3300005844 | Ga0068862_100111456 | Ga0068862_1001114562 | 109 |
| 216 | 3300005844 | Ga0068862_100178168 | Ga0068862_1001781682 | 109 |
| 217 | 3300005844 | Ga0068862_100697580 | Ga0068862_1006975802 | 109 |
| 218 | 3300005937 | Ga0081455_10005133 | Ga0081455_100051338 | 109 |
| 219 | 3300005983 | Ga0081540_1246568 | Ga0081540_12465682 | 109 |
| 220 | 3300006038 | Ga0075365_10008060 | Ga0075365_100080602 | 109 |
| 221 | 3300006038 | Ga0075365_10038896 | Ga0075365_100388962 | 109 |
| 222 | 3300006042 | Ga0075368_10493295 | Ga0075368_104932952 | 109 |
| 223 | 3300006051 | Ga0075364_10606184 | Ga0075364_106061842 | 109 |
| 224 | 3300006051 | Ga0075364_10795905 | Ga0075364_107959051 | 109 |
| 225 | 3300006058 | Ga0075432_10031100 | Ga0075432_100311001 | 109 |
| 226 | 3300006058 | Ga0075432_10343442 | Ga0075432_103434422 | 109 |
| 227 | 3300006058 | Ga0075432_10479138 | Ga0075432_104791382 | 109 |
| 228 | 3300006163 | Ga0070715_10005351 | Ga0070715_100053512 | 109 |
| 229 | 3300006173 | Ga0070716_100009658 | Ga0070716_1000096583 | 109 |
| 230 | 3300006173 | Ga0070716_100196025 | Ga0070716_1001960252 | 109 |
| 231 | 3300006173 | Ga0070716_101752405 | Ga0070716_1017524051 | 109 |
| 232 | 3300006175 | Ga0070712_100157957 | Ga0070712_1001579572 | 109 |
| 233 | 3300006175 | Ga0070712_100313748 | Ga0070712_1003137482 | 109 |
| 234 | 3300006177 | Ga0075362_10018081 | Ga0075362_100180812 | 109 |
| 235 | 3300006178 | Ga0075367_10019210 | Ga0075367_100192103 | 109 |
| 236 | 3300006178 | Ga0075367_10232577 | Ga0075367_102325771 | 109 |
| 237 | 3300006178 | Ga0075367_10297691 | Ga0075367_102976912 | 109 |
| 238 | 3300006195 | Ga0075366_10644056 | Ga0075366_106440561 | 109 |
| 239 | 3300006237 | Ga0097621_100087867 | Ga0097621_1000878673 | 109 |
| 240 | 3300006237 | Ga0097621_100143369 | Ga0097621_1001433692 | 109 |
| 241 | 3300006237 | Ga0097621_100584244 | Ga0097621_1005842442 | 109 |
| 242 | 3300006358 | Ga0068871_100159144 | Ga0068871_1001591442 | 109 |
| 243 | 3300006358 | Ga0068871_100183370 | Ga0068871_1001833702 | 109 |
| 244 | 3300006358 | Ga0068871_101624110 | Ga0068871_1016241101 | 109 |
| 245 | 3300006844 | Ga0075428_100134900 | Ga0075428_1001349003 | 109 |
| 246 | 3300006846 | Ga0075430_100083006 | Ga0075430_1000830062 | 109 |
| 247 | 3300006846 | Ga0075430_100250036 | Ga0075430_1002500362 | 109 |
| 248 | 3300006846 | Ga0075430_100293822 | Ga0075430_1002938222 | 109 |
| 249 | 3300006847 | Ga0075431_100086661 | Ga0075431_1000866612 | 109 |
| 250 | 3300006847 | Ga0075431_100293807 | Ga0075431_1002938072 | 109 |
| 251 | 3300006852 | Ga0075433_10023305 | Ga0075433_100233054 | 109 |
| 252 | 3300006871 | Ga0075434_100217241 | Ga0075434_1002172413 | 109 |
| 253 | 3300006871 | Ga0075434_100248932 | Ga0075434_1002489322 | 109 |
| 254 | 3300006880 | Ga0075429_100013020 | Ga0075429_1000130203 | 109 |
| 255 | 3300006881 | Ga0068865_100000998 | Ga0068865_1000009989 | 109 |
| 256 | 3300006881 | Ga0068865_100016090 | Ga0068865_1000160904 | 109 |
| 257 | 3300006881 | Ga0068865_100039849 | Ga0068865_1000398493 | 109 |
| 258 | 3300006881 | Ga0068865_100104860 | Ga0068865_1001048603 | 109 |
| 259 | 3300006881 | Ga0068865_100486353 | Ga0068865_1004863532 | 109 |
| 260 | 3300006914 | Ga0075436_100001919 | Ga0075436_1000019197 | 109 |
| 261 | 3300006914 | Ga0075436_100029757 | Ga0075436_1000297574 | 109 |
| 262 | 3300006931 | Ga0097620_100064579 | Ga0097620_1000645793 | 109 |
| 263 | 3300006931 | Ga0097620_100076276 | Ga0097620_1000762763 | 109 |
| 264 | 3300006931 | Ga0097620_100177719 | Ga0097620_1001777192 | 109 |
| 265 | 3300006931 | Ga0097620_100799058 | Ga0097620_1007990581 | 109 |
| 266 | 3300007076 | Ga0075435_100014216 | Ga0075435_1000142164 | 109 |
| 267 | 3300007076 | Ga0075435_100239964 | Ga0075435_1002399642 | 109 |
| 268 | 3300009011 | Ga0105251_10207926 | Ga0105251_102079262 | 109 |
| 269 | 3300009036 | Ga0105244_10158062 | Ga0105244_101580621 | 109 |
| 270 | 3300009092 | Ga0105250_10036408 | Ga0105250_100364083 | 109 |
| 271 | 3300009092 | Ga0105250_10612003 | Ga0105250_106120031 | 109 |
| 272 | 3300009093 | Ga0105240_10163181 | Ga0105240_101631812 | 109 |
| 273 | 3300009093 | Ga0105240_10741588 | Ga0105240_107415882 | 109 |
| 274 | 3300009094 | Ga0111539_10345317 | Ga0111539_103453172 | 109 |
| 275 | 3300009094 | Ga0111539_10430467 | Ga0111539_104304672 | 109 |
| 276 | 3300009098 | Ga0105245_10012027 | Ga0105245_100120278 | 109 |
| 277 | 3300009098 | Ga0105245_11777469 | Ga0105245_117774691 | 109 |
| 278 | 3300009098 | Ga0105245_11842500 | Ga0105245_118425001 | 109 |
| 279 | 3300009101 | Ga0105247_10004362 | Ga0105247_100043623 | 109 |
| 280 | 3300009101 | Ga0105247_10023200 | Ga0105247_100232002 | 109 |
| 281 | 3300009101 | Ga0105247_10030449 | Ga0105247_100304492 | 109 |
| 282 | 3300009101 | Ga0105247_10326034 | Ga0105247_103260342 | 109 |
| 283 | 3300009147 | Ga0114129_12955773 | Ga0114129_129557731 | 109 |
| 284 | 3300009148 | Ga0105243_10015731 | Ga0105243_100157313 | 109 |
| 285 | 3300009148 | Ga0105243_10017246 | Ga0105243_100172464 | 109 |
| 286 | 3300009148 | Ga0105243_10100184 | Ga0105243_101001841 | 109 |
| 287 | 3300009148 | Ga0105243_10119858 | Ga0105243_101198582 | 109 |
| 288 | 3300009148 | Ga0105243_10135857 | Ga0105243_101358572 | 109 |
| 289 | 3300009148 | Ga0105243_10302127 | Ga0105243_103021272 | 109 |
| 290 | 3300009174 | Ga0105241_10005348 | Ga0105241_100053485 | 109 |
| 291 | 3300009174 | Ga0105241_10872527 | Ga0105241_108725272 | 109 |
| 292 | 3300009176 | Ga0105242_10021809 | Ga0105242_100218092 | 109 |
| 293 | 3300009176 | Ga0105242_10065504 | Ga0105242_100655041 | 109 |
| 294 | 3300009176 | Ga0105242_10129369 | Ga0105242_101293692 | 109 |
| 295 | 3300009176 | Ga0105242_10855383 | Ga0105242_108553832 | 109 |
| 296 | 3300009176 | Ga0105242_10989053 | Ga0105242_109890532 | 109 |
| 297 | 3300009177 | Ga0105248_10041042 | Ga0105248_100410423 | 109 |
| 298 | 3300009177 | Ga0105248_10148167 | Ga0105248_101481673 | 109 |
| 299 | 3300009177 | Ga0105248_11120679 | Ga0105248_111206792 | 109 |
| 300 | 3300009177 | Ga0105248_11685533 | Ga0105248_116855332 | 109 |
| 301 | 3300009545 | Ga0105237_10007474 | Ga0105237_100074744 | 109 |
| 302 | 3300009545 | Ga0105237_12000541 | Ga0105237_120005411 | 109 |
| 303 | 3300009551 | Ga0105238_10015339 | Ga0105238_100153394 | 109 |
| 304 | 3300009551 | Ga0105238_10459940 | Ga0105238_104599402 | 109 |
| 305 | 3300009551 | Ga0105238_10714578 | Ga0105238_107145782 | 109 |
| 306 | 3300009553 | Ga0105249_10024240 | Ga0105249_100242406 | 109 |
| 307 | 3300009553 | Ga0105249_10029576 | Ga0105249_100295763 | 109 |
| 308 | 3300009553 | Ga0105249_10159371 | Ga0105249_101593712 | 109 |
| 309 | 3300009553 | Ga0105249_10403148 | Ga0105249_104031482 | 109 |
| 310 | 3300010375 | Ga0105239_10045891 | Ga0105239_100458913 | 109 |
| 311 | 3300010375 | Ga0105239_10138120 | Ga0105239_101381203 | 109 |
| 312 | 3300010375 | Ga0105239_10284723 | Ga0105239_102847232 | 109 |
| 313 | 3300010375 | Ga0105239_12413558 | Ga0105239_124135582 | 109 |
| 314 | 3300010375 | Ga0105239_13615712 | Ga0105239_136157121 | 109 |
| 315 | 3300011119 | Ga0105246_10054859 | Ga0105246_100548592 | 109 |
| 316 | 3300011119 | Ga0105246_10317114 | Ga0105246_103171142 | 109 |
| 317 | 3300011119 | Ga0105246_10630934 | Ga0105246_106309341 | 109 |
| 318 | 3300012483 | Ga0157337_1002251 | Ga0157337_10022512 | 109 |
| 319 | 3300012494 | Ga0157341_1037117 | Ga0157341_10371171 | 109 |
| 320 | 3300012510 | Ga0157316_1023906 | Ga0157316_10239062 | 109 |
| 321 | 3300013100 | Ga0157373_10084195 | Ga0157373_100841952 | 109 |
| 322 | 3300013102 | Ga0157371_10003206 | Ga0157371_100032069 | 109 |
| 323 | 3300013102 | Ga0157371_10471891 | Ga0157371_104718912 | 109 |
| 324 | 3300013105 | Ga0157369_10001593 | Ga0157369_100015934 | 109 |
| 325 | 3300013296 | Ga0157374_10214798 | Ga0157374_102147983 | 109 |
| 326 | 3300013296 | Ga0157374_11105310 | Ga0157374_111053102 | 109 |
| 327 | 3300013296 | Ga0157374_11281924 | Ga0157374_112819242 | 109 |
| 328 | 3300013297 | Ga0157378_10036344 | Ga0157378_100363442 | 109 |
| 329 | 3300013297 | Ga0157378_10085711 | Ga0157378_100857113 | 109 |
| 330 | 3300013297 | Ga0157378_10186086 | Ga0157378_101860862 | 109 |
| 331 | 3300013297 | Ga0157378_10241763 | Ga0157378_102417632 | 109 |
| 332 | 3300013306 | Ga0163162_10002904 | Ga0163162_100029049 | 109 |
| 333 | 3300013306 | Ga0163162_11024713 | Ga0163162_110247132 | 109 |
| 334 | 3300013306 | Ga0163162_11452917 | Ga0163162_114529171 | 109 |
| 335 | 3300013306 | Ga0163162_11582814 | Ga0163162_115828142 | 109 |
| 336 | 3300013307 | Ga0157372_10040181 | Ga0157372_100401813 | 109 |
| 337 | 3300013307 | Ga0157372_10429835 | Ga0157372_104298352 | 109 |
| 338 | 3300013307 | Ga0157372_10979473 | Ga0157372_109794732 | 109 |
| 339 | 3300013307 | Ga0157372_11098674 | Ga0157372_110986742 | 109 |
| 340 | 3300013308 | Ga0157375_10010582 | Ga0157375_100105825 | 109 |
| 341 | 3300013308 | Ga0157375_10027601 | Ga0157375_100276012 | 109 |
| 342 | 3300013308 | Ga0157375_10028166 | Ga0157375_100281663 | 109 |
| 343 | 3300013308 | Ga0157375_11374802 | Ga0157375_113748021 | 109 |
| 344 | 3300013308 | Ga0157375_11454595 | Ga0157375_114545952 | 109 |
| 345 | 3300014325 | Ga0163163_10063241 | Ga0163163_100632412 | 109 |
| 346 | 3300014325 | Ga0163163_10107625 | Ga0163163_101076253 | 109 |
| 347 | 3300014325 | Ga0163163_10393705 | Ga0163163_103937052 | 109 |
| 348 | 3300014325 | Ga0163163_11829712 | Ga0163163_118297121 | 109 |
| 349 | 3300014326 | Ga0157380_10007507 | Ga0157380_100075074 | 109 |
| 350 | 3300014326 | Ga0157380_10018172 | Ga0157380_100181722 | 109 |
| 351 | 3300014326 | Ga0157380_10302218 | Ga0157380_103022182 | 109 |
| 352 | 3300014326 | Ga0157380_10416284 | Ga0157380_104162842 | 109 |
| 353 | 3300014326 | Ga0157380_10637002 | Ga0157380_106370022 | 109 |
| 354 | 3300014745 | Ga0157377_10021414 | Ga0157377_100214142 | 109 |
| 355 | 3300014745 | Ga0157377_11062925 | Ga0157377_110629252 | 109 |
| 356 | 3300014968 | Ga0157379_10013548 | Ga0157379_100135483 | 109 |
| 357 | 3300014968 | Ga0157379_10508135 | Ga0157379_105081352 | 109 |
| 358 | 3300014968 | Ga0157379_10755635 | Ga0157379_107556351 | 109 |
| 359 | 3300014969 | Ga0157376_10013476 | Ga0157376_100134764 | 109 |
| 360 | 3300014969 | Ga0157376_10072385 | Ga0157376_100723853 | 109 |
| 361 | 3300014969 | Ga0157376_10652569 | Ga0157376_106525692 | 109 |
| 362 | 3300017792 | Ga0163161_10008920 | Ga0163161_100089204 | 109 |
| 363 | 3300017792 | Ga0163161_10056704 | Ga0163161_100567043 | 109 |
| 364 | 3300021377 | Ga0213874_10020258 | Ga0213874_100202582 | 109 |
| 365 | 3300021384 | Ga0213876_10006369 | Ga0213876_100063694 | 109 |
| 366 | 3300021384 | Ga0213876_10077112 | Ga0213876_100771122 | 109 |
| 367 | 3300021388 | Ga0213875_10197640 | Ga0213875_101976401 | 109 |
| 368 | 3300025297 | Ga0209758_1025921 | Ga0209758_10259212 | 109 |
| 369 | 3300025315 | Ga0207697_10044785 | Ga0207697_100447852 | 109 |
| 370 | 3300025321 | Ga0207656_10030214 | Ga0207656_100302143 | 109 |
| 371 | 3300025711 | Ga0207696_1099964 | Ga0207696_10999642 | 109 |
| 372 | 3300025885 | Ga0207653_10027500 | Ga0207653_100275002 | 109 |
| 373 | 3300025898 | Ga0207692_10027209 | Ga0207692_100272092 | 109 |
| 374 | 3300025899 | Ga0207642_10463120 | Ga0207642_104631201 | 109 |
| 375 | 3300025900 | Ga0207710_10023415 | Ga0207710_100234153 | 109 |
| 376 | 3300025900 | Ga0207710_10033842 | Ga0207710_100338423 | 109 |
| 377 | 3300025901 | Ga0207688_10001879 | Ga0207688_100018793 | 109 |
| 378 | 3300025901 | Ga0207688_10146973 | Ga0207688_101469732 | 109 |
| 379 | 3300025901 | Ga0207688_10305616 | Ga0207688_103056162 | 109 |
| 380 | 3300025903 | Ga0207680_10035235 | Ga0207680_100352352 | 109 |
| 381 | 3300025904 | Ga0207647_10285172 | Ga0207647_102851722 | 109 |
| 382 | 3300025905 | Ga0207685_10012642 | Ga0207685_100126422 | 109 |
| 383 | 3300025905 | Ga0207685_10154312 | Ga0207685_101543122 | 109 |
| 384 | 3300025905 | Ga0207685_10247036 | Ga0207685_102470362 | 109 |
| 385 | 3300025906 | Ga0207699_10016553 | Ga0207699_100165532 | 109 |
| 386 | 3300025906 | Ga0207699_10459905 | Ga0207699_104599052 | 109 |
| 387 | 3300025907 | Ga0207645_10023305 | Ga0207645_100233054 | 109 |
| 388 | 3300025907 | Ga0207645_10218030 | Ga0207645_102180302 | 109 |
| 389 | 3300025908 | Ga0207643_10100900 | Ga0207643_101009002 | 109 |
| 390 | 3300025908 | Ga0207643_10148085 | Ga0207643_101480852 | 109 |
| 391 | 3300025908 | Ga0207643_10693610 | Ga0207643_106936102 | 109 |
| 392 | 3300025910 | Ga0207684_10550803 | Ga0207684_105508032 | 109 |
| 393 | 3300025911 | Ga0207654_10115847 | Ga0207654_101158473 | 109 |
| 394 | 3300025911 | Ga0207654_10841459 | Ga0207654_108414592 | 109 |
| 395 | 3300025912 | Ga0207707_10561414 | Ga0207707_105614142 | 109 |
| 396 | 3300025912 | Ga0207707_11506509 | Ga0207707_115065091 | 109 |
| 397 | 3300025914 | Ga0207671_10079776 | Ga0207671_100797762 | 109 |
| 398 | 3300025915 | Ga0207693_10001954 | Ga0207693_100019544 | 109 |
| 399 | 3300025915 | Ga0207693_10283705 | Ga0207693_102837052 | 109 |
| 400 | 3300025915 | Ga0207693_10872796 | Ga0207693_108727961 | 109 |
| 401 | 3300025916 | Ga0207663_10080345 | Ga0207663_100803452 | 109 |
| 402 | 3300025916 | Ga0207663_10152629 | Ga0207663_101526292 | 109 |
| 403 | 3300025916 | Ga0207663_10463002 | Ga0207663_104630022 | 109 |
| 404 | 3300025917 | Ga0207660_10393411 | Ga0207660_103934112 | 109 |
| 405 | 3300025918 | Ga0207662_10001539 | Ga0207662_100015396 | 109 |
| 406 | 3300025918 | Ga0207662_10595848 | Ga0207662_105958482 | 109 |
| 407 | 3300025918 | Ga0207662_10847787 | Ga0207662_108477871 | 109 |
| 408 | 3300025919 | Ga0207657_10003469 | Ga0207657_1000346910 | 109 |
| 409 | 3300025919 | Ga0207657_10727962 | Ga0207657_107279622 | 109 |
| 410 | 3300025920 | Ga0207649_10039470 | Ga0207649_100394703 | 109 |
| 411 | 3300025921 | Ga0207652_10059743 | Ga0207652_100597433 | 109 |
| 412 | 3300025923 | Ga0207681_11012806 | Ga0207681_110128062 | 109 |
| 413 | 3300025925 | Ga0207650_10134837 | Ga0207650_101348371 | 109 |
| 414 | 3300025926 | Ga0207659_10074550 | Ga0207659_100745502 | 109 |
| 415 | 3300025927 | Ga0207687_10097210 | Ga0207687_100972103 | 109 |
| 416 | 3300025927 | Ga0207687_10475962 | Ga0207687_104759622 | 109 |
| 417 | 3300025928 | Ga0207700_10258811 | Ga0207700_102588112 | 109 |
| 418 | 3300025929 | Ga0207664_10805038 | Ga0207664_108050381 | 109 |
| 419 | 3300025931 | Ga0207644_10065280 | Ga0207644_100652803 | 109 |
| 420 | 3300025932 | Ga0207690_10032064 | Ga0207690_100320643 | 109 |
| 421 | 3300025932 | Ga0207690_10044640 | Ga0207690_100446403 | 109 |
| 422 | 3300025933 | Ga0207706_10000505 | Ga0207706_1000050518 | 109 |
| 423 | 3300025933 | Ga0207706_10236896 | Ga0207706_102368962 | 109 |
| 424 | 3300025933 | Ga0207706_10489200 | Ga0207706_104892002 | 109 |
| 425 | 3300025933 | Ga0207706_11252863 | Ga0207706_112528631 | 109 |
| 426 | 3300025934 | Ga0207686_10009659 | Ga0207686_100096593 | 109 |
| 427 | 3300025934 | Ga0207686_10148722 | Ga0207686_101487223 | 109 |
| 428 | 3300025934 | Ga0207686_10424519 | Ga0207686_104245192 | 109 |
| 429 | 3300025934 | Ga0207686_10951209 | Ga0207686_109512092 | 109 |
| 430 | 3300025935 | Ga0207709_10055094 | Ga0207709_100550941 | 109 |
| 431 | 3300025935 | Ga0207709_10070652 | Ga0207709_100706522 | 109 |
| 432 | 3300025935 | Ga0207709_10359418 | Ga0207709_103594181 | 109 |
| 433 | 3300025935 | Ga0207709_10380399 | Ga0207709_103803992 | 109 |
| 434 | 3300025936 | Ga0207670_10117314 | Ga0207670_101173142 | 109 |
| 435 | 3300025936 | Ga0207670_10146308 | Ga0207670_101463082 | 109 |
| 436 | 3300025937 | Ga0207669_10083184 | Ga0207669_100831842 | 109 |
| 437 | 3300025937 | Ga0207669_10127152 | Ga0207669_101271522 | 109 |
| 438 | 3300025937 | Ga0207669_10273833 | Ga0207669_102738332 | 109 |
| 439 | 3300025937 | Ga0207669_10365290 | Ga0207669_103652902 | 109 |
| 440 | 3300025938 | Ga0207704_10017796 | Ga0207704_100177963 | 109 |
| 441 | 3300025938 | Ga0207704_10155653 | Ga0207704_101556532 | 109 |
| 442 | 3300025938 | Ga0207704_10684986 | Ga0207704_106849862 | 109 |
| 443 | 3300025938 | Ga0207704_11558721 | Ga0207704_115587211 | 109 |
| 444 | 3300025939 | Ga0207665_10000279 | Ga0207665_100002799 | 109 |
| 445 | 3300025939 | Ga0207665_10028507 | Ga0207665_100285072 | 109 |
| 446 | 3300025939 | Ga0207665_10037094 | Ga0207665_100370943 | 109 |
| 447 | 3300025940 | Ga0207691_10048425 | Ga0207691_100484254 | 109 |
| 448 | 3300025941 | Ga0207711_10184993 | Ga0207711_101849932 | 109 |
| 449 | 3300025941 | Ga0207711_10492437 | Ga0207711_104924372 | 109 |
| 450 | 3300025942 | Ga0207689_10197488 | Ga0207689_101974882 | 109 |
| 451 | 3300025944 | Ga0207661_10254250 | Ga0207661_102542502 | 109 |
| 452 | 3300025945 | Ga0207679_10161833 | Ga0207679_101618332 | 109 |
| 453 | 3300025949 | Ga0207667_10066389 | Ga0207667_100663893 | 109 |
| 454 | 3300025949 | Ga0207667_10437479 | Ga0207667_104374792 | 109 |
| 455 | 3300025960 | Ga0207651_10104557 | Ga0207651_101045573 | 109 |
| 456 | 3300025960 | Ga0207651_10212441 | Ga0207651_102124411 | 109 |
| 457 | 3300025960 | Ga0207651_10622422 | Ga0207651_106224221 | 109 |
| 458 | 3300025960 | Ga0207651_12028490 | Ga0207651_120284901 | 109 |
| 459 | 3300025961 | Ga0207712_10004588 | Ga0207712_100045884 | 109 |
| 460 | 3300025961 | Ga0207712_10033910 | Ga0207712_100339103 | 109 |
| 461 | 3300025961 | Ga0207712_10075883 | Ga0207712_100758833 | 109 |
| 462 | 3300025961 | Ga0207712_10623882 | Ga0207712_106238822 | 109 |
| 463 | 3300025972 | Ga0207668_10031602 | Ga0207668_100316022 | 109 |
| 464 | 3300025972 | Ga0207668_10039053 | Ga0207668_100390531 | 109 |
| 465 | 3300025972 | Ga0207668_11521886 | Ga0207668_115218861 | 109 |
| 466 | 3300025981 | Ga0207640_10051924 | Ga0207640_100519242 | 109 |
| 467 | 3300025986 | Ga0207658_10146117 | Ga0207658_101461172 | 109 |
| 468 | 3300025986 | Ga0207658_10390219 | Ga0207658_103902192 | 109 |
| 469 | 3300025986 | Ga0207658_11732547 | Ga0207658_117325471 | 109 |
| 470 | 3300026023 | Ga0207677_10078964 | Ga0207677_100789643 | 109 |
| 471 | 3300026023 | Ga0207677_10132733 | Ga0207677_101327331 | 109 |
| 472 | 3300026023 | Ga0207677_11641751 | Ga0207677_116417512 | 109 |
| 473 | 3300026035 | Ga0207703_10023879 | Ga0207703_100238791 | 109 |
| 474 | 3300026035 | Ga0207703_10030555 | Ga0207703_100305554 | 109 |
| 475 | 3300026035 | Ga0207703_10540465 | Ga0207703_105404652 | 109 |
| 476 | 3300026035 | Ga0207703_11131682 | Ga0207703_111316822 | 109 |
| 477 | 3300026041 | Ga0207639_10024061 | Ga0207639_100240613 | 109 |
| 478 | 3300026041 | Ga0207639_10228144 | Ga0207639_102281441 | 109 |
| 479 | 3300026041 | Ga0207639_10257470 | Ga0207639_102574702 | 109 |
| 480 | 3300026067 | Ga0207678_10000649 | Ga0207678_100006493 | 109 |
| 481 | 3300026067 | Ga0207678_10052318 | Ga0207678_100523183 | 109 |
| 482 | 3300026075 | Ga0207708_10040182 | Ga0207708_100401822 | 109 |
| 483 | 3300026075 | Ga0207708_10130590 | Ga0207708_101305902 | 109 |
| 484 | 3300026078 | Ga0207702_10244567 | Ga0207702_102445671 | 109 |
| 485 | 3300026078 | Ga0207702_11199078 | Ga0207702_111990781 | 109 |
| 486 | 3300026088 | Ga0207641_10298130 | Ga0207641_102981303 | 109 |
| 487 | 3300026088 | Ga0207641_10854305 | Ga0207641_108543051 | 109 |
| 488 | 3300026089 | Ga0207648_10048532 | Ga0207648_100485323 | 109 |
| 489 | 3300026089 | Ga0207648_10214466 | Ga0207648_102144662 | 109 |
| 490 | 3300026089 | Ga0207648_10268950 | Ga0207648_102689502 | 109 |
| 491 | 3300026089 | Ga0207648_10361204 | Ga0207648_103612042 | 109 |
| 492 | 3300026095 | Ga0207676_11697285 | Ga0207676_116972852 | 109 |
| 493 | 3300026095 | Ga0207676_11759858 | Ga0207676_117598581 | 109 |
| 494 | 3300026116 | Ga0207674_10020971 | Ga0207674_100209714 | 109 |
| 495 | 3300026116 | Ga0207674_10586627 | Ga0207674_105866272 | 109 |
| 496 | 3300026118 | Ga0207675_100000985 | Ga0207675_1000009854 | 109 |
| 497 | 3300026118 | Ga0207675_100015450 | Ga0207675_1000154504 | 109 |
| 498 | 3300026118 | Ga0207675_100044704 | Ga0207675_1000447044 | 109 |
| 499 | 3300026118 | Ga0207675_100199765 | Ga0207675_1001997653 | 109 |
| 500 | 3300026121 | Ga0207683_10002194 | Ga0207683_1000219418 | 109 |
| 501 | 3300026121 | Ga0207683_10051649 | Ga0207683_100516493 | 109 |
| 502 | 3300026121 | Ga0207683_10747827 | Ga0207683_107478272 | 109 |
| 503 | 3300026121 | Ga0207683_11175887 | Ga0207683_111758871 | 109 |
| 504 | 3300026142 | Ga0207698_10127066 | Ga0207698_101270661 | 109 |
| 505 | 3300027717 | Ga0209998_10098885 | Ga0209998_100988852 | 109 |
| 506 | 3300027866 | Ga0209813_10411481 | Ga0209813_104114811 | 109 |
| 507 | 3300027907 | Ga0207428_10096598 | Ga0207428_100965983 | 109 |
| 508 | 3300028379 | Ga0268266_10059838 | Ga0268266_100598383 | 109 |
| 509 | 3300028379 | Ga0268266_10074683 | Ga0268266_100746832 | 109 |
| 510 | 3300028379 | Ga0268266_10552562 | Ga0268266_105525622 | 109 |
| 511 | 3300028380 | Ga0268265_10023030 | Ga0268265_100230302 | 109 |
| 512 | 3300028380 | Ga0268265_10112188 | Ga0268265_101121882 | 109 |
| 513 | 3300028380 | Ga0268265_10124979 | Ga0268265_101249792 | 109 |
| 514 | 3300028380 | Ga0268265_10922945 | Ga0268265_109229452 | 109 |
| 515 | 3300028380 | Ga0268265_11750371 | Ga0268265_117503711 | 109 |
| 516 | 3300028381 | Ga0268264_10076817 | Ga0268264_100768172 | 109 |
| 517 | 3300028381 | Ga0268264_10077878 | Ga0268264_100778782 | 109 |
| 518 | 3300028381 | Ga0268264_10408921 | Ga0268264_104089212 | 109 |
| 519 | 3300028381 | Ga0268264_10670583 | Ga0268264_106705832 | 109 |
| 520 | 3300031241 | Ga0265325_10468076 | Ga0265325_104680761 | 109 |
| 521 | 3300031247 | Ga0265340_10144092 | Ga0265340_101440922 | 109 |
| 522 | 3300031456 | Ga0307513_10173346 | Ga0307513_101733463 | 109 |
| 523 | 3300031548 | Ga0307408_100789957 | Ga0307408_1007899572 | 109 |
| 524 | 3300031595 | Ga0265313_10047971 | Ga0265313_100479712 | 109 |
| 525 | 3300031665 | Ga0316575_10004895 | Ga0316575_100048954 | 109 |
| 526 | 3300031691 | Ga0316579_10058729 | Ga0316579_100587293 | 109 |
| 527 | 3300031727 | Ga0316576_10207929 | Ga0316576_102079292 | 109 |
| 528 | 3300031731 | Ga0307405_11189713 | Ga0307405_111897131 | 109 |
| 529 | 3300031733 | Ga0316577_10056669 | Ga0316577_100566692 | 109 |
| 530 | 3300031824 | Ga0307413_10494820 | Ga0307413_104948202 | 109 |
| 531 | 3300031852 | Ga0307410_10324225 | Ga0307410_103242252 | 109 |
| 532 | 3300031911 | Ga0307412_12215963 | Ga0307412_122159631 | 109 |
| 533 | 3300031995 | Ga0307409_100345302 | Ga0307409_1003453022 | 109 |
| 534 | 3300031995 | Ga0307409_100414078 | Ga0307409_1004140782 | 109 |
| 535 | 3300031995 | Ga0307409_100910454 | Ga0307409_1009104541 | 109 |
| 536 | 3300031995 | Ga0307409_101548714 | Ga0307409_1015487142 | 109 |
| 537 | 3300032002 | Ga0307416_101480355 | Ga0307416_1014803551 | 109 |
| 538 | 3300032004 | Ga0307414_10206262 | Ga0307414_102062623 | 109 |
| 539 | 3300032005 | Ga0307411_10011190 | Ga0307411_100111906 | 109 |
| 540 | 3300032005 | Ga0307411_12253575 | Ga0307411_122535751 | 109 |
| 541 | 3300032126 | Ga0307415_100301164 | Ga0307415_1003011643 | 109 |
| 542 | 3300032133 | Ga0316583_10022510 | Ga0316583_100225101 | 109 |
| 543 | 3300032137 | Ga0316585_10023764 | Ga0316585_100237642 | 109 |
| 544 | 3300032139 | Ga0316580_10030001 | Ga0316580_100300012 | 109 |
| 545 | 3300032168 | Ga0316593_10028564 | Ga0316593_100285643 | 109 |
| 546 | 3300033180 | Ga0307510_10096709 | Ga0307510_100967094 | 109 |
| 547 | 3300034816 | Ga0373930_0004849 | Ga0373930_0004849_1101_1430 | 109 |
| 548 | 3300034819 | Ga0373958_0092834 | Ga0373958_0092834_266_595 | 109 |
| 549 | 3300034957 | Ga0373938_0066839 | Ga0373938_0066839_299_628 | 109 |
| 550 | 3300035083 | Ga0373926_0166696 | Ga0373926_0166696_325_657 | 109 |
| 551 | 3300035084 | Ga0373928_0126157 | Ga0373928_0126157_159_488 | 109 |
| 552 | 3300035089 | Ga0373944_0414027 | Ga0373944_0414027_12_344 | 109 |
| 553 | 3300035092 | Ga0373952_0284728 | Ga0373952_0284728_40_375 | 109 |
| 554 | 3300035112 | Ga0373932_0007779 | Ga0373932_0007779_1316_1645 | 109 |
| 555 | 3300035114 | Ga0373939_0184898 | Ga0373939_0184898_327_656 | 109 |
| 556 | 3300035115 | Ga0373941_0032315 | Ga0373941_0032315_340_669 | 109 |
| 557 | 3300035116 | Ga0373945_0049713 | Ga0373945_0049713_99_431 | 109 |
| 558 | 3300035121 | Ga0373960_0011292 | Ga0373960_0011292_1052_1384 | 109 |
| 559 | 3300035121 | Ga0373960_0135534 | Ga0373960_0135534_91_420 | 109 |
| 560 | 3300035170 | Ga0373943_0070087 | Ga0373943_0070087_575_907 | 109 |
| 561 | 3300035171 | Ga0373946_0055664 | Ga0373946_0055664_445_777 | 109 |
| 562 | 3300035207 | Ga0373942_0057060 | Ga0373942_0057060_717_1046 | 109 |
| 563 | 3300035241 | Ga0373961_0063510 | Ga0373961_0063510_751_1080 | 109 |
| 564 | 3300035241 | Ga0373961_0085572 | Ga0373961_0085572_131_460 | 109 |
| 565 | 3300035398 | Ga0316574_0250114 | Ga0316574_0250114_724_1056 | 109 |
| 566 | 3300035691 | Ga0373931_0013327 | Ga0373931_0013327_2377_2706 | 109 |
| 567 | 3300035691 | Ga0373931_0064636 | Ga0373931_0064636_923_1255 | 109 |
| 568 | 3300035695 | Ga0373927_0029439 | Ga0373927_0029439_2195_2527 | 109 |
| 569 | 3300035725 | Ga0373947_0017366 | Ga0373947_0017366_761_1093 | 109 |
| 570 | 3300036647 | Ga0316582_0245048 | Ga0316582_0245048_391_723 | 109 |
| 571 | 3300036712 | Ga0316584_0097468 | Ga0316584_0097468_1140_1472 | 109 |
| 572 | 3300037068 | Ga0373925_0007361 | Ga0373925_0007361_2334_2666 | 109 |
| 573 | 3300037418 | Ga0395900_0064855 | Ga0395900_0064855_2456_2785 | 109 |
| 574 | 3300037466 | Ga0395898_0033273 | Ga0395898_0033273_1160_1489 | 109 |
| 575 | 3300037471 | Ga0395905_0002526 | Ga0395905_0002526_16019_16348 | 109 |
| 576 | 3300037853 | Ga0436364_0857246 | Ga0436364_0857246_145_477 | 109 |
| 577 | 3300037853 | Ga0436364_1190915 | Ga0436364_1190915_307_636 | 109 |
| 578 | 3300038443 | Ga0395901_0016472 | Ga0395901_0016472_6209_6538 | 109 |
| 579 | 3300038443 | Ga0395901_1802119 | Ga0395901_1802119_175_516 | 109 |
| 580 | 3300038996 | Ga0242420_003812 | Ga0242420_003812_16_345 | 109 |
| 581 | 3300039062 | Ga0400483_017169 | Ga0400483_017169_7357_7689 | 109 |
| 582 | 3300039062 | Ga0400483_232856 | Ga0400483_232856_3072_3404 | 109 |
| 583 | 3300039437 | Ga0436365_0605653 | Ga0436365_0605653_17496_17825 | 109 |
| 584 | 3300039437 | Ga0436365_0624031 | Ga0436365_0624031_426_755 | 109 |
| 585 | 3300039437 | Ga0436365_0675144 | Ga0436365_0675144_1515_1850 | 109 |
| 586 | 3300039438 | Ga0436360_0700895 | Ga0436360_0700895_526_855 | 109 |
| 587 | 3300039450 | Ga0436363_0156265 | Ga0436363_0156265_487_816 | 109 |
| 588 | 3300039450 | Ga0436363_0580065 | Ga0436363_0580065_20587_20916 | 109 |
| 589 | 3300041413 | Ga0439465_0183145 | Ga0439465_0183145_29_361 | 109 |
| 590 | 3300041492 | Ga0451835_0177526 | Ga0451835_0177526_107_487 | 109 |
| 591 | 3300041498 | Ga0451841_0234897 | Ga0451841_0234897_12_341 | 109 |
| 592 | 3300041512 | Ga0451853_1699730 | Ga0451853_1699730_489_878 | 109 |
| 593 | 3300042438 | Ga0439459_0188092 | Ga0439459_0188092_146_475 | 109 |
| 594 | 3300046455 | Ga0495603_0000148 | Ga0495603_0000148_11771_12103 | 109 |
| 595 | 3300046455 | Ga0495603_0686298 | Ga0495603_0686298_215_547 | 109 |
| 596 | 3300046459 | Ga0495629_0000108 | Ga0495629_0000108_18319_18651 | 109 |
| 597 | 3300046460 | Ga0495638_0164821 | Ga0495638_0164821_785_1117 | 109 |
| 598 | 3300046460 | Ga0495638_0398733 | Ga0495638_0398733_208_615 | 109 |
| 599 | 3300046461 | Ga0495641_0004971 | Ga0495641_0004971_4660_4992 | 109 |
| 600 | 3300046472 | Ga0495580_0000631 | Ga0495580_0000631_20540_20872 | 109 |
| 601 | 3300046473 | Ga0495582_0001363 | Ga0495582_0001363_8556_8888 | 109 |
| 602 | 3300046475 | Ga0495639_0001765 | Ga0495639_0001765_3916_4248 | 109 |
| 603 | 3300046491 | Ga0495584_0060037 | Ga0495584_0060037_843_1175 | 109 |
| 604 | 3300046499 | Ga0495594_0000184 | Ga0495594_0000184_16149_16481 | 109 |
| 605 | 3300046513 | Ga0495616_0087516 | Ga0495616_0087516_472_804 | 109 |
| 606 | 3300046518 | Ga0495631_0342093 | Ga0495631_0342093_292_624 | 109 |
| 607 | 3300046520 | Ga0495637_0090107 | Ga0495637_0090107_537_869 | 109 |
| 608 | 3300046520 | Ga0495637_0139440 | Ga0495637_0139440_28_360 | 109 |
| 609 | 3300046523 | Ga0495644_0071623 | Ga0495644_0071623_960_1292 | 109 |
| 610 | 3300046523 | Ga0495644_0247376 | Ga0495644_0247376_47_379 | 109 |
| 611 | 3300046523 | Ga0495644_0254740 | Ga0495644_0254740_125_457 | 109 |
| 612 | 3300046526 | Ga0495666_0073821 | Ga0495666_0073821_426_758 | 109 |
| 613 | 3300046528 | Ga0495642_0237425 | Ga0495642_0237425_41_373 | 109 |
| 614 | 3300046557 | Ga0495622_0005648 | Ga0495622_0005648_3681_4013 | 109 |
| 615 | 3300046559 | Ga0495667_0176463 | Ga0495667_0176463_1024_1356 | 109 |
| 616 | 3300046615 | Ga0495656_0224219 | Ga0495656_0224219_396_728 | 109 |
| 617 | 3300046616 | Ga0495668_0475313 | Ga0495668_0475313_240_572 | 109 |
| 618 | 3300046642 | Ga0495634_0035977 | Ga0495634_0035977_2485_2817 | 109 |
| 619 | 3300046660 | Ga0495625_0145654 | Ga0495625_0145654_442_849 | 109 |
| 620 | 3300046660 | Ga0495625_0842655 | Ga0495625_0842655_76_408 | 109 |
| 621 | 3300046664 | Ga0495659_0014153 | Ga0495659_0014153_1448_1780 | 109 |
| 622 | 3300046664 | Ga0495659_0354024 | Ga0495659_0354024_21_353 | 109 |
| 623 | 3300046674 | Ga0495588_0050724 | Ga0495588_0050724_1101_1433 | 109 |
| 624 | 3300046681 | Ga0495647_0017965 | Ga0495647_0017965_894_1226 | 109 |
| 625 | 3300046683 | Ga0495658_0001757 | Ga0495658_0001757_4445_4777 | 109 |
| 626 | 3300046689 | Ga0495613_0010164 | Ga0495613_0010164_4031_4363 | 109 |
| 627 | 3300046690 | Ga0495624_0768145 | Ga0495624_0768145_59_391 | 109 |
| 628 | 3300046692 | Ga0495671_0129113 | Ga0495671_0129113_385_717 | 109 |
| 629 | 3300047315 | Ga0495581_0000791 | Ga0495581_0000791_6599_6931 | 109 |
| 630 | 3300047315 | Ga0495581_0354730 | Ga0495581_0354730_78_416 | 109 |
| 631 | 3300047318 | Ga0495636_0033357 | Ga0495636_0033357_883_1215 | 109 |
| 632 | 3300047321 | Ga0495676_0020611 | Ga0495676_0020611_3995_4327 | 109 |
| 633 | 3300047322 | Ga0495680_0027004 | Ga0495680_0027004_4263_4595 | 109 |
| 634 | 3300047323 | Ga0495683_0297785 | Ga0495683_0297785_48_380 | 109 |
| 635 | 3300047673 | Ga0495593_0000532 | Ga0495593_0000532_10311_10643 | 109 |
| 636 | 3300048089 | Ga0495614_0004704 | Ga0495614_0004704_3899_4231 | 109 |
| 637 | 3300048903 | Ga0496100_0008884 | Ga0496100_0008884_1456_1785 | 109 |
| 638 | 3300048903 | Ga0496100_0038441 | Ga0496100_0038441_1729_2058 | 109 |
| 639 | 3300048903 | Ga0496100_0288584 | Ga0496100_0288584_584_916 | 109 |
| 640 | 3300048904 | Ga0496101_0044884 | Ga0496101_0044884_17_349 | 109 |
| 641 | 3300048904 | Ga0496101_0072460 | Ga0496101_0072460_871_1200 | 109 |
| 642 | 3300048904 | Ga0496101_0075993 | Ga0496101_0075993_1218_1547 | 109 |
| 643 | 3300048904 | Ga0496101_0186270 | Ga0496101_0186270_544_879 | 109 |
| 644 | 3300048904 | Ga0496101_0326509 | Ga0496101_0326509_782_1114 | 109 |
| 645 | 3300048904 | Ga0496101_0725830 | Ga0496101_0725830_400_735 | 109 |
| 646 | 3300048905 | Ga0496102_0124358 | Ga0496102_0124358_315_647 | 109 |
| 647 | 3300048905 | Ga0496102_0147845 | Ga0496102_0147845_909_1244 | 109 |
| 648 | 3300048905 | Ga0496102_0583991 | Ga0496102_0583991_10_342 | 109 |
| 649 | 3300048905 | Ga0496102_1115674 | Ga0496102_1115674_242_571 | 109 |
| 650 | 3300048906 | Ga0496103_0013161 | Ga0496103_0013161_2226_2555 | 109 |
| 651 | 3300048906 | Ga0496103_0021332 | Ga0496103_0021332_2783_3112 | 109 |
| 652 | 3300048906 | Ga0496103_0135224 | Ga0496103_0135224_38_370 | 109 |
| 653 | 3300048906 | Ga0496103_0798128 | Ga0496103_0798128_26_358 | 109 |
| 654 | 3300048907 | Ga0496104_0002041 | Ga0496104_0002041_1586_1921 | 109 |
| 655 | 3300048907 | Ga0496104_0036056 | Ga0496104_0036056_1992_2321 | 109 |
| 656 | 3300048907 | Ga0496104_0058885 | Ga0496104_0058885_1456_1785 | 109 |
| 657 | 3300048907 | Ga0496104_0093438 | Ga0496104_0093438_1235_1570 | 109 |
| 658 | 3300048907 | Ga0496104_0132150 | Ga0496104_0132150_1782_2114 | 109 |
| 659 | 3300048907 | Ga0496104_1172335 | Ga0496104_1172335_163_492 | 109 |
| 660 | 3300048908 | Ga0496105_0003656 | Ga0496105_0003656_4363_4692 | 109 |
| 661 | 3300048908 | Ga0496105_0124092 | Ga0496105_0124092_698_1030 | 109 |
| 662 | 3300048908 | Ga0496105_0134091 | Ga0496105_0134091_1479_1811 | 109 |
| 663 | 3300048908 | Ga0496105_0145860 | Ga0496105_0145860_1273_1608 | 109 |
| 664 | 3300048908 | Ga0496105_0487136 | Ga0496105_0487136_267_596 | 109 |
| 665 | 3300048909 | Ga0496106_0005509 | Ga0496106_0005509_3492_3821 | 109 |
| 666 | 3300048909 | Ga0496106_0019071 | Ga0496106_0019071_644_979 | 109 |
| 667 | 3300048909 | Ga0496106_0026054 | Ga0496106_0026054_2745_3074 | 109 |
| 668 | 3300048909 | Ga0496106_0126504 | Ga0496106_0126504_597_929 | 109 |
| 669 | 3300048909 | Ga0496106_0365307 | Ga0496106_0365307_740_1075 | 109 |
| 670 | 3300048910 | Ga0496107_0002100 | Ga0496107_0002100_3725_4054 | 109 |
| 671 | 3300048910 | Ga0496107_0015213 | Ga0496107_0015213_3264_3596 | 109 |
| 672 | 3300048910 | Ga0496107_0030382 | Ga0496107_0030382_75_404 | 109 |
| 673 | 3300048910 | Ga0496107_0077990 | Ga0496107_0077990_1962_2294 | 109 |
| 674 | 3300048910 | Ga0496107_0167234 | Ga0496107_0167234_343_678 | 109 |
| 675 | 3300048911 | Ga0496108_0074343 | Ga0496108_0074343_510_845 | 109 |
| 676 | 3300048911 | Ga0496108_0076405 | Ga0496108_0076405_197_526 | 109 |
| 677 | 3300048911 | Ga0496108_0125673 | Ga0496108_0125673_946_1275 | 109 |
| 678 | 3300048912 | Ga0496109_0056608 | Ga0496109_0056608_2935_3264 | 109 |
| 679 | 3300048912 | Ga0496109_0062095 | Ga0496109_0062095_489_818 | 109 |
| 680 | 3300048912 | Ga0496109_0182005 | Ga0496109_0182005_1037_1372 | 109 |
| 681 | 3300048912 | Ga0496109_0216032 | Ga0496109_0216032_1126_1461 | 109 |
| 682 | 3300048912 | Ga0496109_0288681 | Ga0496109_0288681_799_1131 | 109 |
| 683 | 3300048912 | Ga0496109_0315550 | Ga0496109_0315550_28_360 | 109 |
| 684 | 3300048912 | Ga0496109_0611203 | Ga0496109_0611203_33_362 | 109 |
| 685 | 3300048912 | Ga0496109_1731241 | Ga0496109_1731241_180_512 | 109 |
| 686 | 3300048913 | Ga0496110_0047501 | Ga0496110_0047501_690_1019 | 109 |
| 687 | 3300048913 | Ga0496110_0194503 | Ga0496110_0194503_26_361 | 109 |
| 688 | 3300048913 | Ga0496110_0224059 | Ga0496110_0224059_264_596 | 109 |
| 689 | 3300048913 | Ga0496110_1367548 | Ga0496110_1367548_37_366 | 109 |
| 690 | 3300048914 | Ga0496111_0046706 | Ga0496111_0046706_1552_1884 | 109 |
| 691 | 3300048914 | Ga0496111_0383590 | Ga0496111_0383590_622_951 | 109 |
| 692 | 3300048914 | Ga0496111_0835196 | Ga0496111_0835196_91_420 | 109 |
| 693 | 3300048915 | Ga0496112_0005268 | Ga0496112_0005268_4276_4605 | 109 |
| 694 | 3300048915 | Ga0496112_0021265 | Ga0496112_0021265_5411_5740 | 109 |
| 695 | 3300048915 | Ga0496112_0361505 | Ga0496112_0361505_978_1313 | 109 |
| 696 | 3300048915 | Ga0496112_1066364 | Ga0496112_1066364_270_605 | 109 |
| 697 | 3300048916 | Ga0496113_0020982 | Ga0496113_0020982_3988_4317 | 109 |
| 698 | 3300048916 | Ga0496113_0115870 | Ga0496113_0115870_1495_1824 | 109 |
| 699 | 3300048916 | Ga0496113_0146790 | Ga0496113_0146790_1035_1367 | 109 |
| 700 | 3300048916 | Ga0496113_0288667 | Ga0496113_0288667_246_581 | 109 |
| 701 | 3300048917 | Ga0496114_0002432 | Ga0496114_0002432_6611_6940 | 109 |
| 702 | 3300048917 | Ga0496114_0035057 | Ga0496114_0035057_2391_2720 | 109 |
| 703 | 3300048917 | Ga0496114_0105089 | Ga0496114_0105089_733_1065 | 109 |
| 704 | 3300048917 | Ga0496114_0851670 | Ga0496114_0851670_277_612 | 109 |
| 705 | 3300048918 | Ga0496115_0009593 | Ga0496115_0009593_5004_5333 | 109 |
| 706 | 3300048918 | Ga0496115_0066964 | Ga0496115_0066964_1430_1765 | 109 |
| 707 | 3300048918 | Ga0496115_0156515 | Ga0496115_0156515_339_671 | 109 |
| 708 | 3300048918 | Ga0496115_0243852 | Ga0496115_0243852_929_1261 | 109 |
| 709 | 3300048918 | Ga0496115_0807762 | Ga0496115_0807762_134_463 | 109 |
| 710 | 3300049568 | Ga0501031_0052882 | Ga0501031_0052882_553_885 | 109 |
| 711 | 3300049569 | Ga0501032_0271591 | Ga0501032_0271591_717_1049 | 109 |
| 712 | 3300049569 | Ga0501032_0408411 | Ga0501032_0408411_61_393 | 109 |
| 713 | 3300049569 | Ga0501032_0835801 | Ga0501032_0835801_35_373 | 109 |
| 714 | 3300049570 | Ga0501033_0072638 | Ga0501033_0072638_1257_1589 | 109 |
| 715 | 3300049570 | Ga0501033_0090562 | Ga0501033_0090562_883_1212 | 109 |
| 716 | 3300049571 | Ga0501034_1396173 | Ga0501034_1396173_189_527 | 109 |
| 717 | 3300049572 | Ga0501036_0079357 | Ga0501036_0079357_1907_2245 | 109 |
| 718 | 3300049572 | Ga0501036_0703256 | Ga0501036_0703256_341_673 | 109 |
| 719 | 3300049573 | Ga0501037_0038417 | Ga0501037_0038417_2859_3191 | 109 |
| 720 | 3300049573 | Ga0501037_0236580 | Ga0501037_0236580_830_1159 | 109 |
| 721 | 3300049574 | Ga0501038_0081297 | Ga0501038_0081297_1960_2292 | 109 |
| 722 | 3300049575 | Ga0501039_0145735 | Ga0501039_0145735_276_608 | 109 |
| 723 | 3300049575 | Ga0501039_0246737 | Ga0501039_0246737_621_965 | 109 |
| 724 | 3300049576 | Ga0501040_0167790 | Ga0501040_0167790_791_1123 | 109 |
| 725 | 3300049576 | Ga0501040_0523547 | Ga0501040_0523547_214_546 | 109 |
| 726 | 3300049577 | Ga0501041_0086437 | Ga0501041_0086437_1044_1376 | 109 |
| 727 | 3300049577 | Ga0501041_0969256 | Ga0501041_0969256_193_531 | 109 |
| 728 | 3300049578 | Ga0501042_0072129 | Ga0501042_0072129_1909_2238 | 109 |
| 729 | 3300049578 | Ga0501042_0097051 | Ga0501042_0097051_874_1206 | 109 |
| 730 | 3300049578 | Ga0501042_0168740 | Ga0501042_0168740_521_853 | 109 |
| 731 | 3300049578 | Ga0501042_0365726 | Ga0501042_0365726_525_863 | 109 |
| 732 | 3300049578 | Ga0501042_0904361 | Ga0501042_0904361_115_459 | 109 |
| 733 | 3300049579 | Ga0501043_0082488 | Ga0501043_0082488_93_425 | 109 |
| 734 | 3300049579 | Ga0501043_0613251 | Ga0501043_0613251_365_703 | 109 |
| 735 | 3300049580 | Ga0501046_0108044 | Ga0501046_0108044_1555_1887 | 109 |
| 736 | 3300049580 | Ga0501046_0136611 | Ga0501046_0136611_168_506 | 109 |
| 737 | 3300049581 | Ga0501047_0172522 | Ga0501047_0172522_1033_1371 | 109 |
| 738 | 3300049582 | Ga0501048_0054602 | Ga0501048_0054602_464_793 | 109 |
| 739 | 3300049582 | Ga0501048_0144873 | Ga0501048_0144873_1317_1649 | 109 |
| 740 | 3300049582 | Ga0501048_0234973 | Ga0501048_0234973_806_1144 | 109 |
| 741 | 3300049582 | Ga0501048_0243093 | Ga0501048_0243093_319_651 | 109 |
| 742 | 3300049583 | Ga0501067_0016955 | Ga0501067_0016955_419_757 | 109 |
| 743 | 3300049584 | Ga0501068_0121080 | Ga0501068_0121080_1032_1364 | 109 |
| 744 | 3300049584 | Ga0501068_0467554 | Ga0501068_0467554_20_358 | 109 |
| 745 | 3300049585 | Ga0501069_0112830 | Ga0501069_0112830_1139_1477 | 109 |
| 746 | 3300049585 | Ga0501069_0272967 | Ga0501069_0272967_321_653 | 109 |
| 747 | 3300049586 | Ga0501070_0041065 | Ga0501070_0041065_2417_2755 | 109 |
| 748 | 3300049586 | Ga0501070_0129742 | Ga0501070_0129742_151_483 | 109 |
| 749 | 3300049586 | Ga0501070_0271165 | Ga0501070_0271165_293_622 | 109 |
| 750 | 3300049587 | Ga0501071_0117457 | Ga0501071_0117457_1266_1598 | 109 |
| 751 | 3300049587 | Ga0501071_0166028 | Ga0501071_0166028_304_636 | 109 |
| 752 | 3300049587 | Ga0501071_0483985 | Ga0501071_0483985_232_564 | 109 |
| 753 | 3300049587 | Ga0501071_1254694 | Ga0501071_1254694_192_530 | 109 |
| 754 | 3300049588 | Ga0501072_0105720 | Ga0501072_0105720_34_366 | 109 |
| 755 | 3300049588 | Ga0501072_0118318 | Ga0501072_0118318_70_399 | 109 |
| 756 | 3300049589 | Ga0501073_0220123 | Ga0501073_0220123_168_506 | 109 |
| 757 | 3300049590 | Ga0501074_0007373 | Ga0501074_0007373_4362_4700 | 109 |
| 758 | 3300049590 | Ga0501074_0113667 | Ga0501074_0113667_376_720 | 109 |
| 759 | 3300049590 | Ga0501074_0137770 | Ga0501074_0137770_525_854 | 109 |
| 760 | 3300049590 | Ga0501074_0150390 | Ga0501074_0150390_784_1116 | 109 |
| 761 | 3300049591 | Ga0501075_0014554 | Ga0501075_0014554_1221_1550 | 109 |
| 762 | 3300049591 | Ga0501075_0161931 | Ga0501075_0161931_1243_1587 | 109 |
| 763 | 3300049591 | Ga0501075_0614201 | Ga0501075_0614201_264_596 | 109 |
| 764 | 3300049592 | Ga0501076_0007256 | Ga0501076_0007256_3624_3968 | 109 |
| 765 | 3300049592 | Ga0501076_0175326 | Ga0501076_0175326_398_727 | 109 |
| 766 | 3300049592 | Ga0501076_0231154 | Ga0501076_0231154_1158_1490 | 109 |
| 767 | 3300049592 | Ga0501076_0977355 | Ga0501076_0977355_349_681 | 109 |
| 768 | 3300049593 | Ga0501077_0386231 | Ga0501077_0386231_437_769 | 109 |
| 769 | 3300049741 | Ga0501079_0027934 | Ga0501079_0027934_3021_3365 | 109 |
| 770 | 3300049741 | Ga0501079_0496974 | Ga0501079_0496974_291_623 | 109 |
| 771 | 3300049742 | Ga0501080_0034100 | Ga0501080_0034100_4022_4366 | 109 |
| 772 | 3300049742 | Ga0501080_0109437 | Ga0501080_0109437_2167_2499 | 109 |
| 773 | 3300049742 | Ga0501080_0113110 | Ga0501080_0113110_98_436 | 109 |
| 774 | 3300049742 | Ga0501080_0186053 | Ga0501080_0186053_1044_1373 | 109 |
| 775 | 3300049743 | Ga0501081_0034225 | Ga0501081_0034225_1568_1900 | 109 |
| 776 | 3300049743 | Ga0501081_0081757 | Ga0501081_0081757_561_893 | 109 |
| 777 | 3300049743 | Ga0501081_0120753 | Ga0501081_0120753_1374_1703 | 109 |
| 778 | 3300049743 | Ga0501081_0206238 | Ga0501081_0206238_923_1255 | 109 |
| 779 | 3300049743 | Ga0501081_0410723 | Ga0501081_0410723_586_924 | 109 |
| 780 | 3300049744 | Ga0501083_0071736 | Ga0501083_0071736_1166_1504 | 109 |
| 781 | 3300049744 | Ga0501083_0093175 | Ga0501083_0093175_458_787 | 109 |
| 782 | 3300049744 | Ga0501083_0189095 | Ga0501083_0189095_784_1116 | 109 |
| 783 | 3300049744 | Ga0501083_0206016 | Ga0501083_0206016_32_370 | 109 |
| 784 | 3300049822 | Ga0501035_0253567 | Ga0501035_0253567_982_1314 | 109 |
| 785 | 3300049824 | Ga0501045_0009046 | Ga0501045_0009046_5740_6069 | 109 |
| 786 | 3300049824 | Ga0501045_0010366 | Ga0501045_0010366_4197_4529 | 109 |
| 787 | 3300049824 | Ga0501045_0070295 | Ga0501045_0070295_1282_1614 | 109 |
| 788 | 3300049824 | Ga0501045_0324274 | Ga0501045_0324274_572_904 | 109 |
| 789 | 3300049824 | Ga0501045_0675290 | Ga0501045_0675290_98_430 | 109 |
| 790 | 3300049824 | Ga0501045_0775796 | Ga0501045_0775796_178_510 | 109 |
| 791 | 3300050489 | nmdc:mga03683_15964_c1 | nmdc:mga03683_15964_c1_2035_2415 | 109 |
| 792 | 3300050490 | nmdc:mga03n38_68501_c1 | nmdc:mga03n38_68501_c1_950_1330 | 109 |
| 793 | 3300050491 | nmdc:mga00v17_139972_c1 | nmdc:mga00v17_139972_c1_663_1043 | 109 |
| 794 | 3300050491 | nmdc:mga00v17_169270_c1 | nmdc:mga00v17_169270_c1_858_1193 | 109 |
| 795 | 3300050492 | nmdc:mga0yw44_20189_c1 | nmdc:mga0yw44_20189_c1_2389_2724 | 109 |
| 796 | 3300050492 | nmdc:mga0yw44_547_c1 | nmdc:mga0yw44_547_c1_8977_9309 | 109 |
| 797 | 3300050492 | nmdc:mga0yw44_925302_c1 | nmdc:mga0yw44_925302_c1_10_390 | 109 |
| 798 | 3300050493 | nmdc:mga0k408_429986_c1 | nmdc:mga0k408_429986_c1_179_559 | 109 |
| 799 | 3300050494 | nmdc:mga06z11_261251_c1 | nmdc:mga06z11_261251_c1_421_801 | 109 |
| 800 | 3300050494 | nmdc:mga06z11_95534_c1 | nmdc:mga06z11_95534_c1_776_1111 | 109 |
| 801 | 3300050495 | nmdc:mga04h51_448451_c1 | nmdc:mga04h51_448451_c1_11_346 | 109 |
| 802 | 3300050507 | nmdc:mga05p37_1304921_c1 | nmdc:mga05p37_1304921_c1_375_704 | 109 |
| 803 | 3300050507 | nmdc:mga05p37_441578_c1 | nmdc:mga05p37_441578_c1_504_836 | 109 |
| 804 | 3300050508 | nmdc:mga09592_145331_c1 | nmdc:mga09592_145331_c1_1095_1424 | 109 |
| 805 | 3300050509 | nmdc:mga0qj67_308275_c1 | nmdc:mga0qj67_308275_c1_232_564 | 109 |
| 806 | 3300050510 | nmdc:mga06r32_219887_c1 | nmdc:mga06r32_219887_c1_252_581 | 109 |
| 807 | 3300050510 | nmdc:mga06r32_73600_c1 | nmdc:mga06r32_73600_c1_559_891 | 109 |
| 808 | 3300050511 | nmdc:mga08y16_1161108_c1 | nmdc:mga08y16_1161108_c1_263_592 | 109 |
| 809 | 3300050511 | nmdc:mga08y16_1905337_c1 | nmdc:mga08y16_1905337_c1_115_444 | 109 |
| 810 | 3300050512 | nmdc:mga0n895_427870_c1 | nmdc:mga0n895_427870_c1_348_680 | 109 |
| 811 | 3300050512 | nmdc:mga0n895_49893_c1 | nmdc:mga0n895_49893_c1_1096_1425 | 109 |
| 812 | 3300050513 | nmdc:mga0rr50_134099_c1 | nmdc:mga0rr50_134099_c1_212_547 | 109 |
| 813 | 3300050513 | nmdc:mga0rr50_47369_c1 | nmdc:mga0rr50_47369_c1_1549_1878 | 109 |
| 814 | 3300050513 | nmdc:mga0rr50_96219_c1 | nmdc:mga0rr50_96219_c1_1647_1979 | 109 |
| 815 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_357237_357572 | 109 |
| 816 | 3300050514 | nmdc:mga08x19_27763_c1 | nmdc:mga08x19_27763_c1_791_1120 | 109 |
| 817 | 3300050515 | nmdc:mga0a205_170480_c1 | nmdc:mga0a205_170480_c1_847_1176 | 109 |
| 818 | 3300053083 | Ga0495655_0001031 | Ga0495655_0001031_2620_2952 | 109 |
| 819 | 3300053085 | Ga0495619_0003279 | Ga0495619_0003279_5109_5441 | 109 |
| 820 | 3300053087 | Ga0500643_018592 | Ga0500643_018592_929_1336 | 109 |
| 821 | 3300053088 | Ga0500644_0024700 | Ga0500644_0024700_34_441 | 109 |
| 822 | 3300053090 | Ga0500646_0003069 | Ga0500646_0003069_665_1072 | 109 |
| 823 | 3300053090 | Ga0500646_0016337 | Ga0500646_0016337_725_1072 | 109 |
| 824 | 3300053092 | Ga0500583_0122296 | Ga0500583_0122296_265_672 | 109 |
| 825 | 3300053098 | Ga0500650_0234769 | Ga0500650_0234769_182_589 | 109 |
| 826 | 3300053108 | Ga0500562_022493 | Ga0500562_022493_752_1159 | 109 |
| 827 | 3300053118 | Ga0500594_0025695 | Ga0500594_0025695_483_851 | 109 |
| 828 | 3300053118 | Ga0500594_0141893 | Ga0500594_0141893_236_643 | 109 |
| 829 | 3300053123 | Ga0500614_170082 | Ga0500614_170082_20_403 | 109 |
| 830 | 3300053123 | Ga0500614_261551 | Ga0500614_261551_185_517 | 109 |
| 831 | 3300053130 | Ga0500642_0227476 | Ga0500642_0227476_466_798 | 109 |
| 832 | 3300053130 | Ga0500642_0355745 | Ga0500642_0355745_157_522 | 109 |
| 833 | 3300053134 | Ga0500658_0049180 | Ga0500658_0049180_202_609 | 109 |
| 834 | 3300053139 | Ga0500568_0000059 | Ga0500568_0000059_83729_84061 | 109 |
| 835 | 3300053139 | Ga0500568_0225875 | Ga0500568_0225875_237_644 | 109 |
| 836 | 3300053142 | Ga0500577_0236977 | Ga0500577_0236977_13_393 | 109 |
| 837 | 3300053146 | Ga0500588_0209785 | Ga0500588_0209785_34_441 | 109 |
| 838 | 3300053151 | Ga0500604_0045189 | Ga0500604_0045189_734_1141 | 109 |
| 839 | 3300053160 | Ga0500633_0246841 | Ga0500633_0246841_211_618 | 109 |
| 840 | 3300053727 | Ga0500611_010983 | Ga0500611_010983_614_1021 | 109 |
| 841 | 3300053731 | Ga0500609_000984 | Ga0500609_000984_1883_2290 | 109 |
| 842 | 3300053739 | Ga0500587_064367 | Ga0500587_064367_76_483 | 109 |
| 843 | 3300054114 | Ga0501084_0046221 | Ga0501084_0046221_2666_3004 | 109 |
| 844 | 3300054114 | Ga0501084_0060586 | Ga0501084_0060586_2802_3134 | 109 |
| 845 | 3300054114 | Ga0501084_0083027 | Ga0501084_0083027_2331_2660 | 109 |
| 846 | 3300054114 | Ga0501084_0210098 | Ga0501084_0210098_353_685 | 109 |
| 847 | 3300054114 | Ga0501084_0320876 | Ga0501084_0320876_166_504 | 109 |
| 848 | 3300054114 | Ga0501084_0795499 | Ga0501084_0795499_325_669 | 109 |
| 849 | 3300054114 | Ga0501084_1422262 | Ga0501084_1422262_114_449 | 109 |
| 850 | 3300059645 | Ga0587076_180618 | Ga0587076_180618_49_384 | 109 |
| 851 | 3300060353 | Ga0501082_0064175 | Ga0501082_0064175_334_678 | 109 |
| 852 | 3300060353 | Ga0501082_0108225 | Ga0501082_0108225_1733_2065 | 109 |
| 853 | 3300060353 | Ga0501082_0206670 | Ga0501082_0206670_508_837 | 109 |
| 854 | 3300060353 | Ga0501082_0284411 | Ga0501082_0284411_561_899 | 109 |
| 855 | 3300060353 | Ga0501082_0437280 | Ga0501082_0437280_463_795 | 109 |
| 856 | 3300060353 | Ga0501082_0561493 | Ga0501082_0561493_428_766 | 109 |
| 857 | 3300061734 | Ga0530510_0046257 | Ga0530510_0046257_1034_1366 | 109 |
| 858 | 3300061734 | Ga0530510_0138527 | Ga0530510_0138527_1150_1494 | 109 |
| 859 | 3300061734 | Ga0530510_0142456 | Ga0530510_0142456_605_934 | 109 |
| 860 | 3300061734 | Ga0530510_0205656 | Ga0530510_0205656_1003_1335 | 109 |
| 861 | iso_pu_bacteria | 2829745981 | 2829748695 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ycq-assembly1.cif.gz_A | unique specificity-enhancing factor for the aaa+ lon protease | 0.7828 | 6 | 91 |
| 1nz9-assembly1.cif.gz_A | solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus | 0.7574 | 8 | 78 |
| 8p4f-assembly1.cif.gz_Z | structural insights into human co-transcriptional capping - structure 6 | 0.7444 | 6 | 79 |
| 2xhc-assembly1.cif.gz_A | crystal structure of thermotoga maritima n-utilization substance g (nusg) | 0.7393 | 7 | 78 |
| 7yta-assembly1.cif.gz_A | crystal structure of ntagdp3 agd1-2 in complex with an h3k9me2 peptide | 0.7273 | 6 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7YTU9_87_190_2.30.30.390 | Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain | 0.8627 | 4 | 104 | 2.30.30.390 |
| af_F1M5Q6_492_592_2.30.30.390 | Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain | 0.8526 | 8 | 105 | 2.30.30.390 |
| af_E9QDW7_114_220_2.30.30.390 | Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain | 0.8478 | 8 | 105 | 2.30.30.390 |
| af_Q7YTU9_87_190_2.30.30.390 | Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain | 0.8324 | 4 | 104 | 2.30.30.390 |
| af_F1M5Q6_492_592_2.30.30.390 | Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain | 0.8048 | 8 | 105 | 2.30.30.390 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382NR55-F1-model_v4 | Hemimethylated DNA-binding domain-containing protein | 0.9948 | 5 | 70 |
GO:0003677
|
| AF-A0A318TGI0-F1-model_v4 | Heat shock protein HspQ | 0.9885 | 5 | 71 |
GO:0003677
|
| AF-A0A530N009-F1-model_v4 | deleted | 0.9868 | 5 | 76 |
|
| AF-A0A192IKE5-F1-model_v4 | deleted | 0.9852 | 6 | 105 |
|
| AF-A0A349QEL8-F1-model_v4 | deleted | 0.9851 | 5 | 105 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar