F483849

General Info

Members Datasets Scaffolds Average Seq Length
861 404 860 112

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10096709|Ga0307510_100967094
Length 135
Sequence MPAGSESNTVTDATVPAAAASVSANACIFREAKFKIGDVVKHRVFPFRGVVFDVDPVFDNTEEWLASIPEDVRPHKDQPFYHLLAENAETTYVAYVSEQNLLADETGKPCRHPLLREMFSSPKRGTYRMKAMKPN

Samples

Sample ID Description Type Environment
1 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
123 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
124 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
220 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
235 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
236 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
239 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
267 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
274 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
384 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
385 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
386 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
387 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
388 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
389 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
390 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
393 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
396 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
397 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
398 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
399 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
400 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
404 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.23
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.69
Nodule 0
Rhizoplane 8.71
Rhizosphere 83.51
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1028925 3300001978 Bacteria 628
2 JGI24737J22298_10019086 3300001990 Bacteria 2193
3 JGI24743J22301_10044562 3300001991 Bacteria 895
4 JGI24750J21931_1003524 3300002070 Bacteria 1874
5 JGI24748J21848_1033234 3300002074 Bacteria 642
6 JGI24738J21930_10011766 3300002075 Bacteria 1919
7 JGI24034J26672_10089043 3300002239 Bacteria 571
8 JGI24751J29686_10020519 3300002459 Bacteria 1369
9 Ga0065712_10322409 3300005290 Bacteria 826
10 Ga0065715_10702056 3300005293 Bacteria 652
11 Ga0070676_10015391 3300005328 Bacteria 4219
12 Ga0070676_10468819 3300005328 Bacteria 889
13 Ga0070690_100001376 3300005330 Bacteria 12659
14 Ga0070670_100003133 3300005331 Bacteria 13679
15 Ga0068869_100009339 3300005334 Bacteria 6361
16 Ga0070666_10013599 3300005335 Bacteria 5168
17 Ga0070680_101789962 3300005336 Bacteria 532
18 Ga0070682_100010755 3300005337 Bacteria 5204
19 Ga0070682_100293650 3300005337 Bacteria 1190
20 Ga0068868_100020199 3300005338 Bacteria 5000
21 Ga0068868_100500519 3300005338 Bacteria 1064
22 Ga0070660_100014281 3300005339 Bacteria 5719
23 Ga0070689_100006899 3300005340 Bacteria 7902
24 Ga0070691_10052775 3300005341 Bacteria 1944
25 Ga0070687_100012882 3300005343 Bacteria 3710
26 Ga0070687_100523210 3300005343 Bacteria 802
27 Ga0070661_100021198 3300005344 Bacteria 4638
28 Ga0070692_10056845 3300005345 Bacteria 2049
29 Ga0070668_100008205 3300005347 Bacteria 7754
30 Ga0070668_100160307 3300005347 Bacteria 1825
31 Ga0070668_100166489 3300005347 Bacteria 1792
32 Ga0070669_100008028 3300005353 Bacteria 7535
33 Ga0070669_100870649 3300005353 Bacteria 768
34 Ga0070675_100042420 3300005354 Bacteria 3717
35 Ga0070675_101786589 3300005354 Bacteria 567
36 Ga0070671_100010429 3300005355 Bacteria 7454
37 Ga0070671_100041032 3300005355 Bacteria 3845
38 Ga0070674_100000275 3300005356 Bacteria 25078
39 Ga0070674_100036192 3300005356 Bacteria 3311
40 Ga0070674_100323462 3300005356 Bacteria 1237
41 Ga0070674_100630857 3300005356 Bacteria 909
42 Ga0070673_100011614 3300005364 Bacteria 6016
43 Ga0070673_100092401 3300005364 Bacteria 2475
44 Ga0070673_100521341 3300005364 Bacteria 1077
45 Ga0070673_101658838 3300005364 Bacteria 604
46 Ga0070673_102035744 3300005364 Bacteria 545
47 Ga0070688_100001437 3300005365 Bacteria 11843
48 Ga0070688_100080151 3300005365 Bacteria 2111
49 Ga0070688_100224016 3300005365 Bacteria 1327
50 Ga0070659_100003374 3300005366 Bacteria 11371
51 Ga0070659_100108937 3300005366 Bacteria 2235
52 Ga0070659_100952906 3300005366 Bacteria 752
53 Ga0070659_100960362 3300005366 Bacteria 749
54 Ga0070667_100006020 3300005367 Bacteria 10079
55 Ga0070667_100240388 3300005367 Bacteria 1617
56 Ga0070667_100284840 3300005367 Bacteria 1485
57 Ga0070667_100599628 3300005367 Bacteria 1015
58 Ga0070667_101593120 3300005367 Bacteria 614
59 Ga0070703_10045473 3300005406 Bacteria 1385
60 Ga0070709_10035104 3300005434 Bacteria 3045
61 Ga0070709_10205860 3300005434 Bacteria 1396
62 Ga0070714_100256997 3300005435 Bacteria 1617
63 Ga0070713_101878632 3300005436 Bacteria 581
64 Ga0070710_10018648 3300005437 Bacteria 3573
65 Ga0070711_100037622 3300005439 Bacteria 3248
66 Ga0070711_100174404 3300005439 Bacteria 1641
67 Ga0070711_100304202 3300005439 Bacteria 1269
68 Ga0070705_100009505 3300005440 Bacteria 4835
69 Ga0070705_101469308 3300005440 Bacteria 570
70 Ga0070700_100025249 3300005441 Bacteria 3499
71 Ga0070700_100625970 3300005441 Bacteria 846
72 Ga0070694_100004982 3300005444 Bacteria 8005
73 Ga0070694_100135372 3300005444 Bacteria 1785
74 Ga0070708_101746795 3300005445 Bacteria 578
75 Ga0070663_100020001 3300005455 Bacteria 4423
76 Ga0070663_100146754 3300005455 Bacteria 1805
77 Ga0070663_100372111 3300005455 Bacteria 1162
78 Ga0070678_100099477 3300005456 Bacteria 2251
79 Ga0070678_100292966 3300005456 Bacteria 1380
80 Ga0070678_101002156 3300005456 Bacteria 768
81 Ga0070678_101312387 3300005456 Bacteria 674
82 Ga0070662_100004091 3300005457 Bacteria 9161
83 Ga0070681_10247498 3300005458 Bacteria 1695
84 Ga0070681_10626746 3300005458 Bacteria 990
85 Ga0068867_100031811 3300005459 Bacteria 3812
86 Ga0068867_100078175 3300005459 Bacteria 2488
87 Ga0068867_100242022 3300005459 Bacteria 1464
88 Ga0068867_100473618 3300005459 Bacteria 1071
89 Ga0068867_100615406 3300005459 Bacteria 949
90 Ga0070685_10016452 3300005466 Bacteria 3941
91 Ga0070706_100212586 3300005467 Bacteria 1806
92 Ga0070706_101149242 3300005467 Bacteria 714
93 Ga0070699_100070865 3300005518 Bacteria 3031
94 Ga0070679_100039265 3300005530 Bacteria 4705
95 Ga0070679_101741481 3300005530 Bacteria 571
96 Ga0070684_100018150 3300005535 Bacteria 5789
97 Ga0070697_100013631 3300005536 Bacteria 6376
98 Ga0070697_100028741 3300005536 Bacteria 4454
99 Ga0070697_100231453 3300005536 Bacteria 1576
100 Ga0068853_100020087 3300005539 Bacteria 5552
101 Ga0068853_100171394 3300005539 Bacteria 1964
102 Ga0068853_100282295 3300005539 Bacteria 1531
103 Ga0070672_100094945 3300005543 Bacteria 2411
104 Ga0070672_100245114 3300005543 Bacteria 1508
105 Ga0070686_100003128 3300005544 Bacteria 9069
106 Ga0070686_100584165 3300005544 Bacteria 878
107 Ga0070686_100694308 3300005544 Bacteria 811
108 Ga0070695_100007641 3300005545 Bacteria 6403
109 Ga0070695_100057449 3300005545 Bacteria 2514
110 Ga0070695_100095923 3300005545 Bacteria 1989
111 Ga0070695_100405651 3300005545 Bacteria 1034
112 Ga0070695_100521152 3300005545 Bacteria 922
113 Ga0070696_100016995 3300005546 Bacteria 4908
114 Ga0070696_100128204 3300005546 Bacteria 1843
115 Ga0070696_100162157 3300005546 Bacteria 1648
116 Ga0070696_100724426 3300005546 Bacteria 813
117 Ga0070693_100007741 3300005547 Bacteria 5265
118 Ga0070665_100075206 3300005548 Bacteria 3384
119 Ga0070665_100305492 3300005548 Bacteria 1594
120 Ga0070665_101654487 3300005548 Bacteria 648
121 Ga0070704_100001792 3300005549 Bacteria 11795
122 Ga0070704_100019287 3300005549 Bacteria 4380
123 Ga0070704_100024362 3300005549 Bacteria 3971
124 Ga0070704_100950432 3300005549 Bacteria 775
125 Ga0068855_100171842 3300005563 Bacteria 2454
126 Ga0070664_100030826 3300005564 Bacteria 4476
127 Ga0070664_100834048 3300005564 Bacteria 863
128 Ga0068857_100055332 3300005577 Bacteria 3521
129 Ga0068857_100599180 3300005577 Bacteria 1041
130 Ga0068854_100065826 3300005578 Bacteria 2635
131 Ga0068856_100013416 3300005614 Bacteria 7933
132 Ga0070702_100000445 3300005615 Bacteria 14687
133 Ga0070702_100014153 3300005615 Bacteria 4043
134 Ga0070702_100137911 3300005615 Bacteria 1550
135 Ga0070702_100197804 3300005615 Bacteria 1328
136 Ga0070702_100339213 3300005615 Bacteria 1054
137 Ga0068852_100023924 3300005616 Bacteria 4928
138 Ga0068859_100064579 3300005617 Bacteria 3693
139 Ga0068859_100076272 3300005617 Bacteria 3393
140 Ga0068859_100177712 3300005617 Bacteria 2211
141 Ga0068859_100798925 3300005617 Bacteria 1031
142 Ga0068864_100014642 3300005618 Bacteria 6515
143 Ga0068864_101067139 3300005618 Bacteria 803
144 Ga0068864_101911486 3300005618 Bacteria 599
145 Ga0068866_10010484 3300005718 Bacteria 3976
146 Ga0068866_10025658 3300005718 Bacteria 2773
147 Ga0068866_10526646 3300005718 Bacteria 786
148 Ga0068861_100002085 3300005719 Bacteria 12958
149 Ga0068861_100170318 3300005719 Bacteria 1804
150 Ga0068851_10049757 3300005834 Bacteria 2127
151 Ga0068870_10554701 3300005840 Bacteria 774
152 Ga0068870_10942265 3300005840 Bacteria 612
153 Ga0068863_100055445 3300005841 Bacteria 3753
154 Ga0068863_100180491 3300005841 Bacteria 2026
155 Ga0068858_100042027 3300005842 Bacteria 4238
156 Ga0068858_100157551 3300005842 Bacteria 2137
157 Ga0068858_100469326 3300005842 Bacteria 1214
158 Ga0068858_100520498 3300005842 Bacteria 1150
159 Ga0068860_100032669 3300005843 Bacteria 5000
160 Ga0068860_100040580 3300005843 Bacteria 4448
161 Ga0068860_100379516 3300005843 Bacteria 1395
162 Ga0068860_100873544 3300005843 Bacteria 915
163 Ga0068860_101457422 3300005843 Bacteria 706
164 Ga0068862_100039283 3300005844 Bacteria 4018
165 Ga0068862_100111456 3300005844 Bacteria 2402
166 Ga0068862_100178168 3300005844 Bacteria 1906
167 Ga0068862_100697580 3300005844 Bacteria 983
168 Ga0081455_10005133 3300005937 Bacteria 14431
169 Ga0081540_1246568 3300005983 Bacteria 625
170 Ga0075365_10008060 3300006038 Bacteria 5949
171 Ga0075365_10038896 3300006038 Bacteria 3094
172 Ga0075368_10493295 3300006042 Bacteria 546
173 Ga0075364_10606184 3300006051 Bacteria 748
174 Ga0075364_10795905 3300006051 Bacteria 644
175 Ga0075432_10031100 3300006058 Bacteria 1848
176 Ga0075432_10343442 3300006058 Bacteria 631
177 Ga0075432_10479138 3300006058 Bacteria 551
178 Ga0070715_10005351 3300006163 Bacteria 4274
179 Ga0070716_100009658 3300006173 Bacteria 4813
180 Ga0070716_100196025 3300006173 Bacteria 1338
181 Ga0070716_101752405 3300006173 Bacteria 513
182 Ga0070712_100157957 3300006175 Bacteria 1748
183 Ga0070712_100313748 3300006175 Bacteria 1273
184 Ga0075362_10018081 3300006177 Bacteria 2912
185 Ga0075367_10019210 3300006178 Bacteria 3787
186 Ga0075367_10232577 3300006178 Bacteria 1154
187 Ga0075367_10297691 3300006178 Bacteria 1015
188 Ga0075366_10644056 3300006195 Bacteria 657
189 Ga0097621_100087867 3300006237 Bacteria 2597
190 Ga0097621_100143369 3300006237 Bacteria 2043
191 Ga0097621_100584244 3300006237 Bacteria 1020
192 Ga0068871_100159144 3300006358 Bacteria 1930
193 Ga0068871_100183370 3300006358 Bacteria 1800
194 Ga0068871_101624110 3300006358 Bacteria 612
195 Ga0068871_102109836 3300006358 Bacteria 537
196 Ga0075428_100134900 3300006844 Bacteria 2684
197 Ga0075430_100083006 3300006846 Bacteria 2685
198 Ga0075430_100250036 3300006846 Bacteria 1469
199 Ga0075430_100293822 3300006846 Bacteria 1344
200 Ga0075431_100086661 3300006847 Bacteria 3231
201 Ga0075431_100293807 3300006847 Bacteria 1643
202 Ga0075433_10023305 3300006852 Bacteria 5209
203 Ga0075434_100217241 3300006871 Bacteria 1932
204 Ga0075434_100248932 3300006871 Bacteria 1796
205 Ga0075429_100013020 3300006880 Bacteria 7217
206 Ga0068865_100000998 3300006881 Bacteria 16239
207 Ga0068865_100016090 3300006881 Bacteria 4777
208 Ga0068865_100039849 3300006881 Bacteria 3189
209 Ga0068865_100104860 3300006881 Bacteria 2076
210 Ga0068865_100486353 3300006881 Bacteria 1027
211 Ga0075436_100001919 3300006914 Bacteria 14276
212 Ga0075436_100029757 3300006914 Bacteria 3755
213 Ga0097620_100064579 3300006931 Bacteria 3693
214 Ga0097620_100076276 3300006931 Bacteria 3393
215 Ga0097620_100177719 3300006931 Bacteria 2211
216 Ga0097620_100799058 3300006931 Bacteria 1031
217 Ga0075435_100014216 3300007076 Bacteria 5943
218 Ga0075435_100239964 3300007076 Bacteria 1541
219 Ga0105251_10207926 3300009011 Bacteria 881
220 Ga0105244_10158062 3300009036 Bacteria 1083
221 Ga0105250_10036408 3300009092 Bacteria 1975
222 Ga0105250_10612003 3300009092 Bacteria 506
223 Ga0105240_10163181 3300009093 Bacteria 2645
224 Ga0105240_10741588 3300009093 Bacteria 1068
225 Ga0111539_10345317 3300009094 Bacteria 1732
226 Ga0111539_10430467 3300009094 Bacteria 1536
227 Ga0105245_10012027 3300009098 Bacteria 7526
228 Ga0105245_10939953 3300009098 Bacteria 907
229 Ga0105245_11777469 3300009098 Bacteria 669
230 Ga0105245_11842500 3300009098 Bacteria 658
231 Ga0105247_10004362 3300009101 Bacteria 9038
232 Ga0105247_10023200 3300009101 Bacteria 3738
233 Ga0105247_10030449 3300009101 Bacteria 3271
234 Ga0105247_10326034 3300009101 Bacteria 1073
235 Ga0114129_12955773 3300009147 Bacteria 560
236 Ga0105243_10015731 3300009148 Bacteria 5721
237 Ga0105243_10017246 3300009148 Bacteria 5461
238 Ga0105243_10100184 3300009148 Bacteria 2403
239 Ga0105243_10119858 3300009148 Bacteria 2216
240 Ga0105243_10135857 3300009148 Bacteria 2092
241 Ga0105243_10302127 3300009148 Bacteria 1451
242 Ga0105243_10469839 3300009148 Bacteria 1184
243 Ga0105241_10005348 3300009174 Bacteria 9486
244 Ga0105241_10872527 3300009174 Bacteria 834
245 Ga0105242_10021809 3300009176 Bacteria 5033
246 Ga0105242_10065504 3300009176 Bacteria 2997
247 Ga0105242_10129369 3300009176 Bacteria 2177
248 Ga0105242_10855383 3300009176 Bacteria 905
249 Ga0105242_10989053 3300009176 Bacteria 848
250 Ga0105248_10041042 3300009177 Bacteria 5187
251 Ga0105248_10148167 3300009177 Bacteria 2648
252 Ga0105248_11120679 3300009177 Bacteria 889
253 Ga0105248_11685533 3300009177 Bacteria 719
254 Ga0105237_10007474 3300009545 Bacteria 11954
255 Ga0105237_12000541 3300009545 Bacteria 588
256 Ga0105238_10015339 3300009551 Bacteria 7759
257 Ga0105238_10459940 3300009551 Bacteria 1270
258 Ga0105238_10714578 3300009551 Bacteria 1014
259 Ga0105249_10024240 3300009553 Bacteria 5452
260 Ga0105249_10029576 3300009553 Bacteria 4949
261 Ga0105249_10159371 3300009553 Bacteria 2179
262 Ga0105249_10403148 3300009553 Bacteria 1398
263 Ga0105239_10045891 3300010375 Bacteria 4788
264 Ga0105239_10138120 3300010375 Bacteria 2714
265 Ga0105239_10284723 3300010375 Bacteria 1861
266 Ga0105239_12413558 3300010375 Bacteria 612
267 Ga0105239_13615712 3300010375 Bacteria 502
268 Ga0105246_10054859 3300011119 Bacteria 2748
269 Ga0105246_10159010 3300011119 Bacteria 1719
270 Ga0105246_10317114 3300011119 Bacteria 1265
271 Ga0105246_10630934 3300011119 Bacteria 930
272 Ga0157337_1002251 3300012483 Bacteria 1076
273 Ga0157341_1037117 3300012494 Bacteria 551
274 Ga0157316_1023906 3300012510 Bacteria 691
275 Ga0157373_10084195 3300013100 Bacteria 2242
276 Ga0157373_11551358 3300013100 Bacteria 506
277 Ga0157371_10003206 3300013102 Bacteria 15027
278 Ga0157371_10471891 3300013102 Bacteria 924
279 Ga0157369_10001593 3300013105 Bacteria 27785
280 Ga0157374_10214798 3300013296 Bacteria 1886
281 Ga0157374_11105310 3300013296 Bacteria 813
282 Ga0157374_11281924 3300013296 Bacteria 755
283 Ga0157378_10036344 3300013297 Bacteria 4359
284 Ga0157378_10085711 3300013297 Bacteria 2854
285 Ga0157378_10186086 3300013297 Bacteria 1956
286 Ga0157378_10241763 3300013297 Bacteria 1725
287 Ga0157378_11717341 3300013297 Bacteria 675
288 Ga0163162_10002904 3300013306 Bacteria 16323
289 Ga0163162_11024713 3300013306 Bacteria 934
290 Ga0163162_11452917 3300013306 Bacteria 781
291 Ga0163162_11582814 3300013306 Bacteria 747
292 Ga0157372_10040181 3300013307 Bacteria 5165
293 Ga0157372_10429835 3300013307 Bacteria 1539
294 Ga0157372_10979473 3300013307 Bacteria 980
295 Ga0157372_11098674 3300013307 Bacteria 920
296 Ga0157375_10010582 3300013308 Bacteria 8121
297 Ga0157375_10027601 3300013308 Bacteria 5308
298 Ga0157375_10028166 3300013308 Bacteria 5261
299 Ga0157375_11374802 3300013308 Bacteria 831
300 Ga0157375_11454595 3300013308 Bacteria 808
301 Ga0163163_10063241 3300014325 Bacteria 3669
302 Ga0163163_10107625 3300014325 Bacteria 2814
303 Ga0163163_10393705 3300014325 Bacteria 1443
304 Ga0163163_11829712 3300014325 Bacteria 667
305 Ga0157380_10007507 3300014326 Bacteria 7744
306 Ga0157380_10018172 3300014326 Bacteria 5216
307 Ga0157380_10302218 3300014326 Bacteria 1475
308 Ga0157380_10416284 3300014326 Bacteria 1280
309 Ga0157380_10637002 3300014326 Bacteria 1061
310 Ga0157377_10021414 3300014745 Bacteria 3400
311 Ga0157377_11062925 3300014745 Bacteria 617
312 Ga0157379_10013548 3300014968 Bacteria 7146
313 Ga0157379_10508135 3300014968 Bacteria 1117
314 Ga0157379_10755635 3300014968 Bacteria 915
315 Ga0157376_10013476 3300014969 Bacteria 6101
316 Ga0157376_10072385 3300014969 Bacteria 2932
317 Ga0157376_10652569 3300014969 Bacteria 1053
318 Ga0157376_10885532 3300014969 Bacteria 910
319 Ga0163161_10008920 3300017792 Bacteria 6932
320 Ga0163161_10056704 3300017792 Bacteria 2846
321 Ga0213874_10020258 3300021377 Bacteria 1821
322 Ga0213876_10006369 3300021384 Bacteria 6433
323 Ga0213876_10077112 3300021384 Bacteria 1760
324 Ga0213875_10197640 3300021388 Bacteria 946
325 Ga0209758_1025921 3300025297 Bacteria 2557
326 Ga0207697_10044785 3300025315 Bacteria 1821
327 Ga0207656_10030214 3300025321 Bacteria 2237
328 Ga0207696_1099964 3300025711 Bacteria 790
329 Ga0207653_10027500 3300025885 Bacteria 1827
330 Ga0207692_10027209 3300025898 Bacteria 2692
331 Ga0207642_10463120 3300025899 Bacteria 770
332 Ga0207710_10023415 3300025900 Bacteria 2654
333 Ga0207710_10033842 3300025900 Bacteria 2243
334 Ga0207688_10001879 3300025901 Bacteria 11244
335 Ga0207688_10146973 3300025901 Bacteria 1390
336 Ga0207688_10305616 3300025901 Bacteria 973
337 Ga0207680_10035235 3300025903 Bacteria 2871
338 Ga0207647_10285172 3300025904 Bacteria 942
339 Ga0207685_10012642 3300025905 Bacteria 2583
340 Ga0207685_10154312 3300025905 Bacteria 1042
341 Ga0207685_10247036 3300025905 Bacteria 861
342 Ga0207699_10016553 3300025906 Bacteria 3859
343 Ga0207699_10459905 3300025906 Bacteria 914
344 Ga0207645_10023305 3300025907 Bacteria 4024
345 Ga0207645_10218030 3300025907 Bacteria 1257
346 Ga0207643_10100900 3300025908 Bacteria 1693
347 Ga0207643_10148085 3300025908 Bacteria 1406
348 Ga0207643_10693610 3300025908 Bacteria 658
349 Ga0207684_10550803 3300025910 Bacteria 987
350 Ga0207654_10115847 3300025911 Bacteria 1675
351 Ga0207654_10841459 3300025911 Bacteria 664
352 Ga0207707_10561414 3300025912 Bacteria 969
353 Ga0207707_11506509 3300025912 Bacteria 533
354 Ga0207671_10079776 3300025914 Bacteria 2453
355 Ga0207693_10001954 3300025915 Bacteria 18068
356 Ga0207693_10283705 3300025915 Bacteria 1298
357 Ga0207693_10872796 3300025915 Bacteria 691
358 Ga0207663_10080345 3300025916 Bacteria 2132
359 Ga0207663_10152629 3300025916 Bacteria 1622
360 Ga0207663_10463002 3300025916 Bacteria 979
361 Ga0207660_10393411 3300025917 Bacteria 1115
362 Ga0207662_10001539 3300025918 Bacteria 11250
363 Ga0207662_10595848 3300025918 Bacteria 769
364 Ga0207662_10847787 3300025918 Bacteria 646
365 Ga0207657_10003469 3300025919 Bacteria 16828
366 Ga0207657_10727962 3300025919 Bacteria 769
367 Ga0207649_10039470 3300025920 Bacteria 2863
368 Ga0207652_10059743 3300025921 Bacteria 3287
369 Ga0207681_11012806 3300025923 Bacteria 697
370 Ga0207650_10134837 3300025925 Bacteria 1936
371 Ga0207659_10074550 3300025926 Bacteria 2487
372 Ga0207687_10097210 3300025927 Bacteria 2160
373 Ga0207687_10475962 3300025927 Bacteria 1039
374 Ga0207700_10258811 3300025928 Bacteria 1489
375 Ga0207664_10805038 3300025929 Bacteria 845
376 Ga0207644_10065280 3300025931 Bacteria 2646
377 Ga0207690_10032064 3300025932 Bacteria 3368
378 Ga0207690_10044640 3300025932 Bacteria 2923
379 Ga0207706_10000505 3300025933 Bacteria 41538
380 Ga0207706_10236896 3300025933 Bacteria 1596
381 Ga0207706_10489200 3300025933 Bacteria 1063
382 Ga0207706_11252863 3300025933 Bacteria 614
383 Ga0207686_10009659 3300025934 Bacteria 5239
384 Ga0207686_10148722 3300025934 Bacteria 1628
385 Ga0207686_10424519 3300025934 Bacteria 1018
386 Ga0207686_10951209 3300025934 Bacteria 695
387 Ga0207709_10055094 3300025935 Bacteria 2455
388 Ga0207709_10070652 3300025935 Bacteria 2214
389 Ga0207709_10359418 3300025935 Bacteria 1102
390 Ga0207709_10380399 3300025935 Bacteria 1074
391 Ga0207670_10117314 3300025936 Bacteria 1929
392 Ga0207670_10146308 3300025936 Bacteria 1748
393 Ga0207669_10083184 3300025937 Bacteria 2057
394 Ga0207669_10127152 3300025937 Bacteria 1743
395 Ga0207669_10273833 3300025937 Bacteria 1269
396 Ga0207669_10365290 3300025937 Bacteria 1120
397 Ga0207704_10017796 3300025938 Bacteria 3695
398 Ga0207704_10155653 3300025938 Bacteria 1619
399 Ga0207704_10684986 3300025938 Bacteria 847
400 Ga0207704_11558721 3300025938 Bacteria 567
401 Ga0207665_10000279 3300025939 Bacteria 35535
402 Ga0207665_10028507 3300025939 Bacteria 3688
403 Ga0207665_10037094 3300025939 Bacteria 3243
404 Ga0207691_10048425 3300025940 Bacteria 3897
405 Ga0207711_10184993 3300025941 Bacteria 1896
406 Ga0207711_10492437 3300025941 Bacteria 1142
407 Ga0207689_10197488 3300025942 Bacteria 1660
408 Ga0207661_10254250 3300025944 Bacteria 1563
409 Ga0207679_10161833 3300025945 Bacteria 1833
410 Ga0207667_10066389 3300025949 Bacteria 3760
411 Ga0207667_10437479 3300025949 Bacteria 1330
412 Ga0207651_10104557 3300025960 Bacteria 2110
413 Ga0207651_10212441 3300025960 Bacteria 1558
414 Ga0207651_10622422 3300025960 Bacteria 946
415 Ga0207651_12028490 3300025960 Bacteria 517
416 Ga0207712_10004588 3300025961 Bacteria 8721
417 Ga0207712_10033910 3300025961 Bacteria 3455
418 Ga0207712_10075883 3300025961 Bacteria 2431
419 Ga0207712_10623882 3300025961 Bacteria 935
420 Ga0207668_10031602 3300025972 Bacteria 3489
421 Ga0207668_10039053 3300025972 Bacteria 3191
422 Ga0207668_11521886 3300025972 Bacteria 604
423 Ga0207640_10051924 3300025981 Bacteria 2667
424 Ga0207658_10146117 3300025986 Bacteria 1921
425 Ga0207658_10390219 3300025986 Bacteria 1221
426 Ga0207658_11732547 3300025986 Bacteria 570
427 Ga0207677_10078964 3300026023 Bacteria 2352
428 Ga0207677_10132733 3300026023 Bacteria 1894
429 Ga0207677_11137124 3300026023 Bacteria 713
430 Ga0207677_11641751 3300026023 Bacteria 595
431 Ga0207703_10023879 3300026035 Bacteria 4809
432 Ga0207703_10030555 3300026035 Bacteria 4259
433 Ga0207703_10540465 3300026035 Bacteria 1098
434 Ga0207703_11131682 3300026035 Bacteria 752
435 Ga0207639_10024061 3300026041 Bacteria 4403
436 Ga0207639_10228144 3300026041 Bacteria 1612
437 Ga0207639_10257470 3300026041 Bacteria 1525
438 Ga0207678_10000649 3300026067 Bacteria 32026
439 Ga0207678_10045189 3300026067 Bacteria 3809
440 Ga0207678_10052318 3300026067 Bacteria 3524
441 Ga0207708_10040182 3300026075 Bacteria 3566
442 Ga0207708_10130590 3300026075 Bacteria 1964
443 Ga0207708_10602993 3300026075 Bacteria 930
444 Ga0207702_10244567 3300026078 Bacteria 1682
445 Ga0207702_11199078 3300026078 Bacteria 753
446 Ga0207641_10298130 3300026088 Bacteria 1522
447 Ga0207641_10854305 3300026088 Bacteria 902
448 Ga0207648_10048532 3300026089 Bacteria 3716
449 Ga0207648_10214466 3300026089 Bacteria 1709
450 Ga0207648_10268950 3300026089 Bacteria 1522
451 Ga0207648_10361204 3300026089 Bacteria 1310
452 Ga0207676_11697285 3300026095 Bacteria 630
453 Ga0207676_11759858 3300026095 Bacteria 618
454 Ga0207674_10020971 3300026116 Bacteria 7049
455 Ga0207674_10586627 3300026116 Bacteria 1077
456 Ga0207675_100000985 3300026118 Bacteria 28260
457 Ga0207675_100015450 3300026118 Bacteria 7121
458 Ga0207675_100044704 3300026118 Bacteria 4139
459 Ga0207675_100199765 3300026118 Bacteria 1920
460 Ga0207683_10002194 3300026121 Bacteria 17161
461 Ga0207683_10051649 3300026121 Bacteria 3602
462 Ga0207683_10747827 3300026121 Bacteria 907
463 Ga0207683_11175887 3300026121 Bacteria 711
464 Ga0207698_10127066 3300026142 Bacteria 2170
465 Ga0209998_10098885 3300027717 Bacteria 721
466 Ga0209813_10411481 3300027866 Bacteria 547
467 Ga0207428_10096598 3300027907 Bacteria 2288
468 Ga0268266_10059838 3300028379 Bacteria 3282
469 Ga0268266_10074683 3300028379 Bacteria 2944
470 Ga0268266_10552562 3300028379 Bacteria 1103
471 Ga0268266_11983132 3300028379 Bacteria 556
472 Ga0268265_10023030 3300028380 Bacteria 4386
473 Ga0268265_10112188 3300028380 Bacteria 2228
474 Ga0268265_10124979 3300028380 Bacteria 2127
475 Ga0268265_10922945 3300028380 Bacteria 858
476 Ga0268265_11750371 3300028380 Bacteria 628
477 Ga0268264_10076817 3300028381 Bacteria 2842
478 Ga0268264_10077878 3300028381 Bacteria 2825
479 Ga0268264_10408921 3300028381 Bacteria 1306
480 Ga0268264_10670583 3300028381 Bacteria 1028
481 Ga0265325_10468076 3300031241 Bacteria 548
482 Ga0265329_10301536 3300031242 Bacteria 542
483 Ga0265340_10144092 3300031247 Bacteria 1089
484 Ga0265340_10399998 3300031247 Bacteria 606
485 Ga0307513_10173346 3300031456 Bacteria 2031
486 Ga0307408_100789957 3300031548 Bacteria 861
487 Ga0265313_10047971 3300031595 Bacteria 2064
488 Ga0316575_10004895 3300031665 Bacteria 4732
489 Ga0316579_10058729 3300031691 Bacteria 1807
490 Ga0316576_10207929 3300031727 Bacteria 1473
491 Ga0307405_11189713 3300031731 Bacteria 659
492 Ga0316577_10056669 3300031733 Bacteria 2187
493 Ga0307413_10494820 3300031824 Bacteria 980
494 Ga0307413_11024229 3300031824 Bacteria 709
495 Ga0307410_10324225 3300031852 Bacteria 1223
496 Ga0307406_10509595 3300031901 Bacteria 977
497 Ga0307412_12215963 3300031911 Bacteria 512
498 Ga0307409_100345302 3300031995 Bacteria 1402
499 Ga0307409_100414078 3300031995 Bacteria 1291
500 Ga0307409_100910454 3300031995 Bacteria 894
501 Ga0307409_101548714 3300031995 Bacteria 691
502 Ga0307416_101480355 3300032002 Bacteria 785
503 Ga0307414_10206262 3300032004 Bacteria 1603
504 Ga0307411_10011190 3300032005 Bacteria 4828
505 Ga0307411_12253575 3300032005 Bacteria 511
506 Ga0307415_100301164 3300032126 Bacteria 1328
507 Ga0316583_10022510 3300032133 Bacteria 2255
508 Ga0316585_10023764 3300032137 Bacteria 1892
509 Ga0316580_10030001 3300032139 Bacteria 1683
510 Ga0316593_10028564 3300032168 Bacteria 1798
511 Ga0307510_10096709 3300033180 Bacteria 2767
512 Ga0373930_0004849 3300034816 Bacteria 2210
513 Ga0373958_0092834 3300034819 Bacteria 699
514 Ga0373938_0066839 3300034957 Bacteria 852
515 Ga0373926_0166696 3300035083 Bacteria 842
516 Ga0373928_0126157 3300035084 Bacteria 690
517 Ga0373944_0414027 3300035089 Bacteria 521
518 Ga0373952_0284728 3300035092 Bacteria 510
519 Ga0373932_0007779 3300035112 Bacteria 2558
520 Ga0373939_0184898 3300035114 Bacteria 779
521 Ga0373941_0032315 3300035115 Bacteria 1566
522 Ga0373945_0049713 3300035116 Bacteria 1539
523 Ga0373945_0087401 3300035116 Bacteria 1202
524 Ga0373960_0011292 3300035121 Bacteria 2198
525 Ga0373960_0135534 3300035121 Bacteria 829
526 Ga0373943_0070087 3300035170 Bacteria 1773
527 Ga0373946_0055664 3300035171 Bacteria 1668
528 Ga0373942_0057060 3300035207 Bacteria 1110
529 Ga0373961_0063510 3300035241 Bacteria 1127
530 Ga0373961_0085572 3300035241 Bacteria 999
531 Ga0316574_0250114 3300035398 Bacteria 1132
532 Ga0373931_0013327 3300035691 Bacteria 4001
533 Ga0373931_0064636 3300035691 Bacteria 1981
534 Ga0373927_0029439 3300035695 Bacteria 3579
535 Ga0373947_0017366 3300035725 Bacteria 4139
536 Ga0316582_0245048 3300036647 Bacteria 1228
537 Ga0316584_0097468 3300036712 Bacteria 2201
538 Ga0373925_0007361 3300037068 Bacteria 8031
539 Ga0395900_0064855 3300037418 Bacteria 3752
540 Ga0395898_0033273 3300037466 Bacteria 5146
541 Ga0395905_0002526 3300037471 Bacteria 20182
542 Ga0436364_0857246 3300037853 Bacteria 529
543 Ga0436364_1190915 3300037853 Bacteria 4917
544 Ga0395901_0016472 3300038443 Bacteria 7531
545 Ga0395901_1802119 3300038443 Bacteria 561
546 Ga0242420_003812 3300038996 Bacteria 2248
547 Ga0400483_017169 3300039062 Bacteria 12778
548 Ga0400483_232856 3300039062 Bacteria 4763
549 Ga0436365_0605653 3300039437 Bacteria 55706
550 Ga0436365_0624031 3300039437 Bacteria 1190
551 Ga0436365_0675144 3300039437 Bacteria 2654
552 Ga0436360_0700895 3300039438 Bacteria 1048
553 Ga0436363_0156265 3300039450 Bacteria 1202
554 Ga0436363_0580065 3300039450 Bacteria 40060
555 Ga0439465_0183145 3300041413 Bacteria 758
556 Ga0451807_0639680 3300041486 Bacteria 755
557 Ga0451835_0177526 3300041492 Bacteria 588
558 Ga0451841_0234897 3300041498 Bacteria 696
559 Ga0451853_1699730 3300041512 Bacteria 1570
560 Ga0439459_0188092 3300042438 Bacteria 558
561 Ga0495603_0000148 3300046455 Bacteria 34900
562 Ga0495603_0686298 3300046455 Bacteria 586
563 Ga0495629_0000108 3300046459 Bacteria 73826
564 Ga0495638_0164821 3300046460 Bacteria 1276
565 Ga0495638_0398733 3300046460 Bacteria 714
566 Ga0495641_0004971 3300046461 Bacteria 9186
567 Ga0495580_0000631 3300046472 Bacteria 29831
568 Ga0495582_0001363 3300046473 Bacteria 13741
569 Ga0495639_0001765 3300046475 Bacteria 9584
570 Ga0495584_0060037 3300046491 Bacteria 1912
571 Ga0495594_0000184 3300046499 Bacteria 30383
572 Ga0495616_0087516 3300046513 Bacteria 1480
573 Ga0495631_0342093 3300046518 Bacteria 637
574 Ga0495637_0090107 3300046520 Bacteria 1211
575 Ga0495637_0139440 3300046520 Bacteria 921
576 Ga0495644_0071623 3300046523 Bacteria 1303
577 Ga0495644_0247376 3300046523 Bacteria 692
578 Ga0495644_0254740 3300046523 Bacteria 682
579 Ga0495666_0073821 3300046526 Bacteria 1618
580 Ga0495642_0237425 3300046528 Bacteria 796
581 Ga0495598_0154550 3300046537 Bacteria 803
582 Ga0495622_0005648 3300046557 Bacteria 5801
583 Ga0495667_0176463 3300046559 Bacteria 1372
584 Ga0495656_0176444 3300046615 Bacteria 1048
585 Ga0495656_0224219 3300046615 Bacteria 941
586 Ga0495668_0475313 3300046616 Bacteria 688
587 Ga0495634_0035977 3300046642 Bacteria 3388
588 Ga0495625_0145654 3300046660 Bacteria 1595
589 Ga0495625_0842655 3300046660 Bacteria 530
590 Ga0495659_0014153 3300046664 Bacteria 2607
591 Ga0495659_0292844 3300046664 Bacteria 686
592 Ga0495659_0354024 3300046664 Bacteria 628
593 Ga0495588_0050724 3300046674 Bacteria 2135
594 Ga0495647_0017965 3300046681 Bacteria 2510
595 Ga0495658_0001757 3300046683 Bacteria 11192
596 Ga0495613_0010164 3300046689 Bacteria 6992
597 Ga0495624_0768145 3300046690 Bacteria 570
598 Ga0495671_0129113 3300046692 Bacteria 1233
599 Ga0495581_0000791 3300047315 Bacteria 16789
600 Ga0495581_0354730 3300047315 Bacteria 856
601 Ga0495636_0033357 3300047318 Bacteria 2115
602 Ga0495676_0020611 3300047321 Bacteria 5779
603 Ga0495680_0027004 3300047322 Bacteria 4724
604 Ga0495683_0297785 3300047323 Bacteria 694
605 Ga0495593_0000532 3300047673 Bacteria 21592
606 Ga0495614_0004704 3300048089 Bacteria 6156
607 Ga0496100_0008884 3300048903 Bacteria 5621
608 Ga0496100_0038441 3300048903 Bacteria 3032
609 Ga0496100_0222197 3300048903 Bacteria 1387
610 Ga0496100_0288584 3300048903 Bacteria 1225
611 Ga0496101_0044884 3300048904 Bacteria 3164
612 Ga0496101_0072460 3300048904 Bacteria 2528
613 Ga0496101_0075993 3300048904 Bacteria 2473
614 Ga0496101_0186270 3300048904 Bacteria 1600
615 Ga0496101_0326509 3300048904 Bacteria 1204
616 Ga0496101_0725830 3300048904 Bacteria 784
617 Ga0496102_0124358 3300048905 Bacteria 2410
618 Ga0496102_0147845 3300048905 Bacteria 2206
619 Ga0496102_0583991 3300048905 Bacteria 1040
620 Ga0496102_1115674 3300048905 Bacteria 708
621 Ga0496103_0013161 3300048906 Bacteria 4905
622 Ga0496103_0021332 3300048906 Bacteria 3896
623 Ga0496103_0135224 3300048906 Bacteria 1575
624 Ga0496103_0798128 3300048906 Bacteria 595
625 Ga0496104_0002041 3300048907 Bacteria 17532
626 Ga0496104_0036056 3300048907 Bacteria 4620
627 Ga0496104_0058885 3300048907 Bacteria 3636
628 Ga0496104_0093438 3300048907 Bacteria 2877
629 Ga0496104_0132150 3300048907 Bacteria 2398
630 Ga0496104_1172335 3300048907 Bacteria 671
631 Ga0496105_0003656 3300048908 Bacteria 11431
632 Ga0496105_0124092 3300048908 Bacteria 2129
633 Ga0496105_0134091 3300048908 Bacteria 2041
634 Ga0496105_0145860 3300048908 Bacteria 1946
635 Ga0496105_0487136 3300048908 Bacteria 969
636 Ga0496106_0005509 3300048909 Bacteria 9361
637 Ga0496106_0019071 3300048909 Bacteria 5084
638 Ga0496106_0026054 3300048909 Bacteria 4351
639 Ga0496106_0126504 3300048909 Bacteria 2001
640 Ga0496106_0365307 3300048909 Bacteria 1159
641 Ga0496107_0002100 3300048910 Bacteria 12758
642 Ga0496107_0015213 3300048910 Bacteria 5390
643 Ga0496107_0030382 3300048910 Bacteria 3850
644 Ga0496107_0077990 3300048910 Bacteria 2413
645 Ga0496107_0167234 3300048910 Bacteria 1631
646 Ga0496108_0074343 3300048911 Bacteria 2869
647 Ga0496108_0076405 3300048911 Bacteria 2831
648 Ga0496108_0125673 3300048911 Bacteria 2201
649 Ga0496109_0056608 3300048912 Bacteria 3578
650 Ga0496109_0062095 3300048912 Bacteria 3416
651 Ga0496109_0182005 3300048912 Bacteria 1974
652 Ga0496109_0216032 3300048912 Bacteria 1803
653 Ga0496109_0288681 3300048912 Bacteria 1546
654 Ga0496109_0315550 3300048912 Bacteria 1475
655 Ga0496109_0611203 3300048912 Bacteria 1026
656 Ga0496109_1731241 3300048912 Bacteria 559
657 Ga0496110_0047501 3300048913 Bacteria 3759
658 Ga0496110_0194503 3300048913 Bacteria 1842
659 Ga0496110_0224059 3300048913 Bacteria 1710
660 Ga0496110_1367548 3300048913 Bacteria 617
661 Ga0496111_0046706 3300048914 Bacteria 3118
662 Ga0496111_0383590 3300048914 Bacteria 1039
663 Ga0496111_0835196 3300048914 Bacteria 665
664 Ga0496112_0005268 3300048915 Bacteria 11147
665 Ga0496112_0021265 3300048915 Bacteria 6167
666 Ga0496112_0361505 3300048915 Bacteria 1393
667 Ga0496112_1066364 3300048915 Bacteria 727
668 Ga0496113_0020982 3300048916 Bacteria 4603
669 Ga0496113_0115870 3300048916 Bacteria 2090
670 Ga0496113_0146790 3300048916 Bacteria 1859
671 Ga0496113_0288667 3300048916 Bacteria 1312
672 Ga0496114_0002432 3300048917 Bacteria 14201
673 Ga0496114_0035057 3300048917 Bacteria 4142
674 Ga0496114_0105089 3300048917 Bacteria 2415
675 Ga0496114_0851670 3300048917 Bacteria 792
676 Ga0496115_0009593 3300048918 Bacteria 7195
677 Ga0496115_0066964 3300048918 Bacteria 2903
678 Ga0496115_0156515 3300048918 Bacteria 1883
679 Ga0496115_0243852 3300048918 Bacteria 1481
680 Ga0496115_0807762 3300048918 Bacteria 729
681 Ga0501031_0052882 3300049568 Bacteria 2646
682 Ga0501032_0271591 3300049569 Bacteria 1099
683 Ga0501032_0408411 3300049569 Bacteria 872
684 Ga0501032_0835801 3300049569 Bacteria 581
685 Ga0501033_0072638 3300049570 Bacteria 2526
686 Ga0501033_0090562 3300049570 Bacteria 2238
687 Ga0501034_1396173 3300049571 Bacteria 575
688 Ga0501036_0079357 3300049572 Bacteria 2776
689 Ga0501036_0703256 3300049572 Bacteria 835
690 Ga0501037_0038417 3300049573 Bacteria 3527
691 Ga0501037_0236580 3300049573 Bacteria 1281
692 Ga0501038_0081297 3300049574 Bacteria 2730
693 Ga0501038_1185629 3300049574 Bacteria 555
694 Ga0501039_0094995 3300049575 Bacteria 2324
695 Ga0501039_0145735 3300049575 Bacteria 1861
696 Ga0501039_0246737 3300049575 Bacteria 1404
697 Ga0501040_0166222 3300049576 Bacteria 1561
698 Ga0501040_0167790 3300049576 Bacteria 1553
699 Ga0501040_0234172 3300049576 Bacteria 1308
700 Ga0501040_0523547 3300049576 Bacteria 855
701 Ga0501041_0041028 3300049577 Bacteria 2811
702 Ga0501041_0086437 3300049577 Bacteria 1934
703 Ga0501041_0372876 3300049577 Bacteria 903
704 Ga0501041_0969256 3300049577 Bacteria 547
705 Ga0501042_0031007 3300049578 Bacteria 3782
706 Ga0501042_0072129 3300049578 Bacteria 2471
707 Ga0501042_0097051 3300049578 Bacteria 2118
708 Ga0501042_0168740 3300049578 Bacteria 1579
709 Ga0501042_0284805 3300049578 Bacteria 1194
710 Ga0501042_0365726 3300049578 Bacteria 1044
711 Ga0501042_0904361 3300049578 Bacteria 643
712 Ga0501043_0082488 3300049579 Bacteria 2527
713 Ga0501043_0613251 3300049579 Bacteria 803
714 Ga0501046_0108044 3300049580 Bacteria 2128
715 Ga0501046_0136611 3300049580 Bacteria 1857
716 Ga0501046_0287798 3300049580 Bacteria 1202
717 Ga0501047_0172522 3300049581 Bacteria 2031
718 Ga0501048_0054602 3300049582 Bacteria 2838
719 Ga0501048_0144873 3300049582 Bacteria 1680
720 Ga0501048_0234973 3300049582 Bacteria 1301
721 Ga0501048_0243093 3300049582 Bacteria 1277
722 Ga0501048_0582328 3300049582 Bacteria 803
723 Ga0501067_0016955 3300049583 Bacteria 4024
724 Ga0501068_0121080 3300049584 Bacteria 1631
725 Ga0501068_0467554 3300049584 Bacteria 817
726 Ga0501069_0112830 3300049585 Bacteria 1549
727 Ga0501069_0272967 3300049585 Bacteria 989
728 Ga0501070_0041065 3300049586 Bacteria 3854
729 Ga0501070_0129742 3300049586 Bacteria 2083
730 Ga0501070_0271165 3300049586 Bacteria 1386
731 Ga0501071_0117457 3300049587 Bacteria 1970
732 Ga0501071_0166028 3300049587 Bacteria 1652
733 Ga0501071_0483985 3300049587 Bacteria 949
734 Ga0501071_1254694 3300049587 Bacteria 573
735 Ga0501072_0105720 3300049588 Bacteria 2238
736 Ga0501072_0118318 3300049588 Bacteria 2111
737 Ga0501072_0800746 3300049588 Bacteria 738
738 Ga0501073_0220123 3300049589 Bacteria 1311
739 Ga0501074_0007373 3300049590 Bacteria 7952
740 Ga0501074_0113667 3300049590 Bacteria 1937
741 Ga0501074_0137770 3300049590 Bacteria 1746
742 Ga0501074_0150390 3300049590 Bacteria 1664
743 Ga0501075_0014554 3300049591 Bacteria 5639
744 Ga0501075_0161931 3300049591 Bacteria 1707
745 Ga0501075_0251811 3300049591 Bacteria 1346
746 Ga0501075_0614201 3300049591 Bacteria 829
747 Ga0501076_0007256 3300049592 Bacteria 8063
748 Ga0501076_0175326 3300049592 Bacteria 1747
749 Ga0501076_0231154 3300049592 Bacteria 1512
750 Ga0501076_0977355 3300049592 Bacteria 698
751 Ga0501076_1685064 3300049592 Bacteria 520
752 Ga0501077_0386231 3300049593 Bacteria 894
753 Ga0501217_140471 3300049661 Bacteria 715
754 Ga0501079_0027934 3300049741 Bacteria 4328
755 Ga0501079_0126525 3300049741 Bacteria 1988
756 Ga0501079_0496974 3300049741 Bacteria 959
757 Ga0501079_0514294 3300049741 Bacteria 941
758 Ga0501080_0034100 3300049742 Bacteria 4751
759 Ga0501080_0109437 3300049742 Bacteria 2561
760 Ga0501080_0113110 3300049742 Bacteria 2516
761 Ga0501080_0186053 3300049742 Bacteria 1910
762 Ga0501081_0034225 3300049743 Bacteria 3456
763 Ga0501081_0081757 3300049743 Bacteria 2263
764 Ga0501081_0110175 3300049743 Bacteria 1953
765 Ga0501081_0120753 3300049743 Bacteria 1866
766 Ga0501081_0206238 3300049743 Bacteria 1426
767 Ga0501081_0223037 3300049743 Bacteria 1371
768 Ga0501081_0410723 3300049743 Bacteria 1003
769 Ga0501081_0572780 3300049743 Bacteria 844
770 Ga0501083_0071736 3300049744 Bacteria 2302
771 Ga0501083_0093175 3300049744 Bacteria 1989
772 Ga0501083_0189095 3300049744 Bacteria 1344
773 Ga0501083_0206016 3300049744 Bacteria 1282
774 Ga0501035_0253567 3300049822 Bacteria 1493
775 Ga0501045_0009046 3300049824 Bacteria 6956
776 Ga0501045_0010366 3300049824 Bacteria 6526
777 Ga0501045_0070295 3300049824 Bacteria 2575
778 Ga0501045_0324274 3300049824 Bacteria 1146
779 Ga0501045_0675290 3300049824 Bacteria 763
780 Ga0501045_0775796 3300049824 Bacteria 706
781 nmdc:mga03683_15964_c1 3300050489 Bacteria 2812
782 nmdc:mga03n38_68501_c1 3300050490 Bacteria 1636
783 nmdc:mga00v17_139972_c1 3300050491 Bacteria 1551
784 nmdc:mga00v17_169270_c1 3300050491 Bacteria 1408
785 nmdc:mga0yw44_20189_c1 3300050492 Bacteria 3692
786 nmdc:mga0yw44_547_c1 3300050492 Bacteria 13523
787 nmdc:mga0yw44_925302_c1 3300050492 Bacteria 591
788 nmdc:mga0k408_429986_c1 3300050493 Bacteria 785
789 nmdc:mga06z11_261251_c1 3300050494 Bacteria 1022
790 nmdc:mga06z11_95534_c1 3300050494 Bacteria 1621
791 nmdc:mga04h51_448451_c1 3300050495 Bacteria 546
792 nmdc:mga05p37_1304921_c1 3300050507 Bacteria 740
793 nmdc:mga05p37_441578_c1 3300050507 Bacteria 1509
794 nmdc:mga09592_145331_c1 3300050508 Bacteria 2045
795 nmdc:mga0qj67_308275_c1 3300050509 Bacteria 1282
796 nmdc:mga06r32_211664_c1 3300050510 Bacteria 1926
797 nmdc:mga06r32_219887_c1 3300050510 Bacteria 1888
798 nmdc:mga06r32_73600_c1 3300050510 Bacteria 3310
799 nmdc:mga08y16_1161108_c1 3300050511 Bacteria 745
800 nmdc:mga08y16_1905337_c1 3300050511 Bacteria 545
801 nmdc:mga0n895_427870_c1 3300050512 Bacteria 1338
802 nmdc:mga0n895_49893_c1 3300050512 Bacteria 4103
803 nmdc:mga0rr50_134099_c1 3300050513 Bacteria 1986
804 nmdc:mga0rr50_47369_c1 3300050513 Bacteria 3171
805 nmdc:mga0rr50_96219_c1 3300050513 Bacteria 2316
806 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
807 nmdc:mga08x19_27763_c1 3300050514 Bacteria 3542
808 nmdc:mga0a205_170480_c1 3300050515 Bacteria 2073
809 Ga0495655_0001031 3300053083 Bacteria 4299
810 Ga0495619_0003279 3300053085 Bacteria 10467
811 Ga0500643_018592 3300053087 Bacteria 2303
812 Ga0500644_0024700 3300053088 Bacteria 1840
813 Ga0500646_0003069 3300053090 Bacteria 4281
814 Ga0500646_0016337 3300053090 Bacteria 1938
815 Ga0500583_0122296 3300053092 Bacteria 1288
816 Ga0500650_0234769 3300053098 Bacteria 826
817 Ga0500562_022493 3300053108 Bacteria 1643
818 Ga0500593_070115 3300053117 Bacteria 1522
819 Ga0500594_0025695 3300053118 Bacteria 1511
820 Ga0500594_0141893 3300053118 Bacteria 767
821 Ga0500614_170082 3300053123 Bacteria 663
822 Ga0500614_261551 3300053123 Bacteria 540
823 Ga0500642_0227476 3300053130 Bacteria 862
824 Ga0500642_0355745 3300053130 Bacteria 649
825 Ga0500658_0049180 3300053134 Bacteria 1717
826 Ga0500568_0000059 3300053139 Bacteria 108096
827 Ga0500568_0225875 3300053139 Bacteria 683
828 Ga0500577_0236977 3300053142 Bacteria 791
829 Ga0500588_0209785 3300053146 Bacteria 723
830 Ga0500604_0045189 3300053151 Bacteria 1343
831 Ga0500616_0004149 3300053153 Bacteria 10466
832 Ga0500622_0188200 3300053156 Bacteria 948
833 Ga0500633_0246841 3300053160 Bacteria 663
834 Ga0500611_010983 3300053727 Bacteria 1484
835 Ga0500609_000984 3300053731 Bacteria 4262
836 Ga0500587_064367 3300053739 Bacteria 566
837 Ga0501084_0046221 3300054114 Bacteria 3646
838 Ga0501084_0060586 3300054114 Bacteria 3168
839 Ga0501084_0083027 3300054114 Bacteria 2689
840 Ga0501084_0158583 3300054114 Bacteria 1909
841 Ga0501084_0210098 3300054114 Bacteria 1642
842 Ga0501084_0320876 3300054114 Bacteria 1308
843 Ga0501084_0795499 3300054114 Bacteria 797
844 Ga0501084_1422262 3300054114 Bacteria 581
845 Ga0587076_180618 3300059645 Bacteria 531
846 Ga0501082_0064175 3300060353 Bacteria 3163
847 Ga0501082_0108225 3300060353 Bacteria 2405
848 Ga0501082_0206670 3300060353 Bacteria 1708
849 Ga0501082_0227710 3300060353 Bacteria 1623
850 Ga0501082_0284411 3300060353 Bacteria 1440
851 Ga0501082_0417794 3300060353 Bacteria 1171
852 Ga0501082_0437280 3300060353 Bacteria 1143
853 Ga0501082_0460171 3300060353 Bacteria 1112
854 Ga0501082_0561493 3300060353 Bacteria 998
855 Ga0501082_0933486 3300060353 Bacteria 759
856 Ga0530510_0046257 3300061734 Bacteria 3144
857 Ga0530510_0138527 3300061734 Bacteria 1792
858 Ga0530510_0142456 3300061734 Bacteria 1767
859 Ga0530510_0205656 3300061734 Bacteria 1463
860 Ga0530510_0589594 3300061734 Bacteria 845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0639680 Ga0451807_0639680_185_517 105
2 3300005367 Ga0070667_100599628 Ga0070667_1005996281 106
3 3300006358 Ga0068871_102109836 Ga0068871_1021098361 106
4 3300028379 Ga0268266_11983132 Ga0268266_119831322 106
5 3300049576 Ga0501040_0166222 Ga0501040_0166222_1067_1393 106
6 3300049578 Ga0501042_0031007 Ga0501042_0031007_110_436 106
7 3300049592 Ga0501076_1685064 Ga0501076_1685064_130_456 106
8 3300049741 Ga0501079_0126525 Ga0501079_0126525_478_804 106
9 3300049743 Ga0501081_0572780 Ga0501081_0572780_225_551 106
10 3300060353 Ga0501082_0460171 Ga0501082_0460171_318_644 106
11 3300061734 Ga0530510_0589594 Ga0530510_0589594_127_453 106
12 3300031901 Ga0307406_10509595 Ga0307406_105095952 107
13 3300049575 Ga0501039_0094995 Ga0501039_0094995_382_708 107
14 3300049577 Ga0501041_0041028 Ga0501041_0041028_2388_2714 107
15 3300049580 Ga0501046_0287798 Ga0501046_0287798_488_814 107
16 3300049582 Ga0501048_0582328 Ga0501048_0582328_360_686 107
17 3300049741 Ga0501079_0514294 Ga0501079_0514294_364_690 107
18 3300049743 Ga0501081_0110175 Ga0501081_0110175_22_348 107
19 3300050510 nmdc:mga06r32_211664_c1 nmdc:mga06r32_211664_c1_436_762 107
20 3300054114 Ga0501084_0158583 Ga0501084_0158583_1019_1345 107
21 3300060353 Ga0501082_0417794 Ga0501082_0417794_769_1095 107
22 3300005355 Ga0070671_100010429 Ga0070671_1000104295 108
23 3300005364 Ga0070673_101658838 Ga0070673_1016588381 108
24 3300005455 Ga0070663_100372111 Ga0070663_1003721112 108
25 3300005459 Ga0068867_100615406 Ga0068867_1006154062 108
26 3300005615 Ga0070702_100197804 Ga0070702_1001978041 108
27 3300009098 Ga0105245_10939953 Ga0105245_109399532 108
28 3300009148 Ga0105243_10469839 Ga0105243_104698392 108
29 3300011119 Ga0105246_10159010 Ga0105246_101590101 108
30 3300013100 Ga0157373_11551358 Ga0157373_115513581 108
31 3300013297 Ga0157378_11717341 Ga0157378_117173412 108
32 3300014969 Ga0157376_10885532 Ga0157376_108855321 108
33 3300026023 Ga0207677_11137124 Ga0207677_111371242 108
34 3300026067 Ga0207678_10045189 Ga0207678_100451893 108
35 3300026075 Ga0207708_10602993 Ga0207708_106029932 108
36 3300031242 Ga0265329_10301536 Ga0265329_103015361 108
37 3300031247 Ga0265340_10399998 Ga0265340_103999981 108
38 3300031824 Ga0307413_11024229 Ga0307413_110242292 108
39 3300035116 Ga0373945_0087401 Ga0373945_0087401_866_1192 108
40 3300046537 Ga0495598_0154550 Ga0495598_0154550_343_693 108
41 3300046615 Ga0495656_0176444 Ga0495656_0176444_632_964 108
42 3300046664 Ga0495659_0292844 Ga0495659_0292844_229_579 108
43 3300048903 Ga0496100_0222197 Ga0496100_0222197_1017_1367 108
44 3300049574 Ga0501038_1185629 Ga0501038_1185629_40_369 108
45 3300049576 Ga0501040_0234172 Ga0501040_0234172_207_536 108
46 3300049577 Ga0501041_0372876 Ga0501041_0372876_228_557 108
47 3300049578 Ga0501042_0284805 Ga0501042_0284805_690_1019 108
48 3300049588 Ga0501072_0800746 Ga0501072_0800746_67_399 108
49 3300049591 Ga0501075_0251811 Ga0501075_0251811_489_818 108
50 3300049661 Ga0501217_140471 Ga0501217_140471_26_370 108
51 3300049743 Ga0501081_0223037 Ga0501081_0223037_389_718 108
52 3300053117 Ga0500593_070115 Ga0500593_070115_866_1192 108
53 3300053153 Ga0500616_0004149 Ga0500616_0004149_8704_9036 108
54 3300053156 Ga0500622_0188200 Ga0500622_0188200_552_878 108
55 3300060353 Ga0501082_0227710 Ga0501082_0227710_1267_1596 108
56 3300060353 Ga0501082_0933486 Ga0501082_0933486_39_380 108
57 3300001978 JGI24747J21853_1028925 JGI24747J21853_10289251 109
58 3300001990 JGI24737J22298_10019086 JGI24737J22298_100190862 109
59 3300001991 JGI24743J22301_10044562 JGI24743J22301_100445621 109
60 3300002070 JGI24750J21931_1003524 JGI24750J21931_10035241 109
61 3300002074 JGI24748J21848_1033234 JGI24748J21848_10332341 109
62 3300002075 JGI24738J21930_10011766 JGI24738J21930_100117662 109
63 3300002239 JGI24034J26672_10089043 JGI24034J26672_100890431 109
64 3300002459 JGI24751J29686_10020519 JGI24751J29686_100205191 109
65 3300005290 Ga0065712_10322409 Ga0065712_103224091 109
66 3300005293 Ga0065715_10702056 Ga0065715_107020561 109
67 3300005328 Ga0070676_10015391 Ga0070676_100153913 109
68 3300005328 Ga0070676_10468819 Ga0070676_104688191 109
69 3300005330 Ga0070690_100001376 Ga0070690_1000013767 109
70 3300005331 Ga0070670_100003133 Ga0070670_1000031338 109
71 3300005334 Ga0068869_100009339 Ga0068869_1000093394 109
72 3300005335 Ga0070666_10013599 Ga0070666_100135994 109
73 3300005336 Ga0070680_101789962 Ga0070680_1017899621 109
74 3300005337 Ga0070682_100010755 Ga0070682_1000107553 109
75 3300005337 Ga0070682_100293650 Ga0070682_1002936501 109
76 3300005338 Ga0068868_100020199 Ga0068868_1000201993 109
77 3300005338 Ga0068868_100500519 Ga0068868_1005005192 109
78 3300005339 Ga0070660_100014281 Ga0070660_1000142814 109
79 3300005340 Ga0070689_100006899 Ga0070689_1000068998 109
80 3300005341 Ga0070691_10052775 Ga0070691_100527753 109
81 3300005343 Ga0070687_100012882 Ga0070687_1000128822 109
82 3300005343 Ga0070687_100523210 Ga0070687_1005232102 109
83 3300005344 Ga0070661_100021198 Ga0070661_1000211983 109
84 3300005345 Ga0070692_10056845 Ga0070692_100568453 109
85 3300005347 Ga0070668_100008205 Ga0070668_1000082052 109
86 3300005347 Ga0070668_100160307 Ga0070668_1001603072 109
87 3300005347 Ga0070668_100166489 Ga0070668_1001664892 109
88 3300005353 Ga0070669_100008028 Ga0070669_1000080284 109
89 3300005353 Ga0070669_100870649 Ga0070669_1008706491 109
90 3300005354 Ga0070675_100042420 Ga0070675_1000424203 109
91 3300005354 Ga0070675_101786589 Ga0070675_1017865891 109
92 3300005355 Ga0070671_100041032 Ga0070671_1000410323 109
93 3300005356 Ga0070674_100000275 Ga0070674_1000002759 109
94 3300005356 Ga0070674_100036192 Ga0070674_1000361923 109
95 3300005356 Ga0070674_100323462 Ga0070674_1003234622 109
96 3300005356 Ga0070674_100630857 Ga0070674_1006308572 109
97 3300005364 Ga0070673_100011614 Ga0070673_1000116143 109
98 3300005364 Ga0070673_100092401 Ga0070673_1000924012 109
99 3300005364 Ga0070673_100521341 Ga0070673_1005213412 109
100 3300005364 Ga0070673_102035744 Ga0070673_1020357441 109
101 3300005365 Ga0070688_100001437 Ga0070688_1000014378 109
102 3300005365 Ga0070688_100080151 Ga0070688_1000801512 109
103 3300005365 Ga0070688_100224016 Ga0070688_1002240162 109
104 3300005366 Ga0070659_100003374 Ga0070659_1000033742 109
105 3300005366 Ga0070659_100108937 Ga0070659_1001089373 109
106 3300005366 Ga0070659_100952906 Ga0070659_1009529062 109
107 3300005366 Ga0070659_100960362 Ga0070659_1009603621 109
108 3300005367 Ga0070667_100006020 Ga0070667_1000060206 109
109 3300005367 Ga0070667_100240388 Ga0070667_1002403882 109
110 3300005367 Ga0070667_100284840 Ga0070667_1002848402 109
111 3300005367 Ga0070667_101593120 Ga0070667_1015931201 109
112 3300005406 Ga0070703_10045473 Ga0070703_100454732 109
113 3300005434 Ga0070709_10035104 Ga0070709_100351042 109
114 3300005434 Ga0070709_10205860 Ga0070709_102058602 109
115 3300005435 Ga0070714_100256997 Ga0070714_1002569971 109
116 3300005436 Ga0070713_101878632 Ga0070713_1018786321 109
117 3300005437 Ga0070710_10018648 Ga0070710_100186483 109
118 3300005439 Ga0070711_100037622 Ga0070711_1000376223 109
119 3300005439 Ga0070711_100174404 Ga0070711_1001744042 109
120 3300005439 Ga0070711_100304202 Ga0070711_1003042022 109
121 3300005440 Ga0070705_100009505 Ga0070705_1000095053 109
122 3300005440 Ga0070705_101469308 Ga0070705_1014693081 109
123 3300005441 Ga0070700_100025249 Ga0070700_1000252493 109
124 3300005441 Ga0070700_100625970 Ga0070700_1006259701 109
125 3300005444 Ga0070694_100004982 Ga0070694_1000049824 109
126 3300005444 Ga0070694_100135372 Ga0070694_1001353723 109
127 3300005445 Ga0070708_101746795 Ga0070708_1017467951 109
128 3300005455 Ga0070663_100020001 Ga0070663_1000200014 109
129 3300005455 Ga0070663_100146754 Ga0070663_1001467543 109
130 3300005456 Ga0070678_100099477 Ga0070678_1000994772 109
131 3300005456 Ga0070678_100292966 Ga0070678_1002929662 109
132 3300005456 Ga0070678_101002156 Ga0070678_1010021561 109
133 3300005456 Ga0070678_101312387 Ga0070678_1013123871 109
134 3300005457 Ga0070662_100004091 Ga0070662_1000040914 109
135 3300005458 Ga0070681_10247498 Ga0070681_102474982 109
136 3300005458 Ga0070681_10626746 Ga0070681_106267461 109
137 3300005459 Ga0068867_100031811 Ga0068867_1000318112 109
138 3300005459 Ga0068867_100078175 Ga0068867_1000781752 109
139 3300005459 Ga0068867_100242022 Ga0068867_1002420222 109
140 3300005459 Ga0068867_100473618 Ga0068867_1004736182 109
141 3300005466 Ga0070685_10016452 Ga0070685_100164522 109
142 3300005467 Ga0070706_100212586 Ga0070706_1002125863 109
143 3300005467 Ga0070706_101149242 Ga0070706_1011492422 109
144 3300005518 Ga0070699_100070865 Ga0070699_1000708652 109
145 3300005530 Ga0070679_100039265 Ga0070679_1000392655 109
146 3300005530 Ga0070679_101741481 Ga0070679_1017414812 109
147 3300005535 Ga0070684_100018150 Ga0070684_1000181502 109
148 3300005536 Ga0070697_100013631 Ga0070697_1000136315 109
149 3300005536 Ga0070697_100028741 Ga0070697_1000287413 109
150 3300005536 Ga0070697_100231453 Ga0070697_1002314532 109
151 3300005539 Ga0068853_100020087 Ga0068853_1000200874 109
152 3300005539 Ga0068853_100171394 Ga0068853_1001713942 109
153 3300005539 Ga0068853_100282295 Ga0068853_1002822952 109
154 3300005543 Ga0070672_100094945 Ga0070672_1000949453 109
155 3300005543 Ga0070672_100245114 Ga0070672_1002451142 109
156 3300005544 Ga0070686_100003128 Ga0070686_1000031284 109
157 3300005544 Ga0070686_100584165 Ga0070686_1005841652 109
158 3300005544 Ga0070686_100694308 Ga0070686_1006943081 109
159 3300005545 Ga0070695_100007641 Ga0070695_1000076412 109
160 3300005545 Ga0070695_100057449 Ga0070695_1000574492 109
161 3300005545 Ga0070695_100095923 Ga0070695_1000959232 109
162 3300005545 Ga0070695_100405651 Ga0070695_1004056512 109
163 3300005545 Ga0070695_100521152 Ga0070695_1005211522 109
164 3300005546 Ga0070696_100016995 Ga0070696_1000169953 109
165 3300005546 Ga0070696_100128204 Ga0070696_1001282042 109
166 3300005546 Ga0070696_100162157 Ga0070696_1001621572 109
167 3300005546 Ga0070696_100724426 Ga0070696_1007244262 109
168 3300005547 Ga0070693_100007741 Ga0070693_1000077413 109
169 3300005548 Ga0070665_100075206 Ga0070665_1000752064 109
170 3300005548 Ga0070665_100305492 Ga0070665_1003054922 109
171 3300005548 Ga0070665_101654487 Ga0070665_1016544871 109
172 3300005549 Ga0070704_100001792 Ga0070704_1000017923 109
173 3300005549 Ga0070704_100019287 Ga0070704_1000192875 109
174 3300005549 Ga0070704_100024362 Ga0070704_1000243623 109
175 3300005549 Ga0070704_100950432 Ga0070704_1009504321 109
176 3300005563 Ga0068855_100171842 Ga0068855_1001718423 109
177 3300005564 Ga0070664_100030826 Ga0070664_1000308263 109
178 3300005564 Ga0070664_100834048 Ga0070664_1008340482 109
179 3300005577 Ga0068857_100055332 Ga0068857_1000553322 109
180 3300005577 Ga0068857_100599180 Ga0068857_1005991802 109
181 3300005578 Ga0068854_100065826 Ga0068854_1000658262 109
182 3300005614 Ga0068856_100013416 Ga0068856_1000134164 109
183 3300005615 Ga0070702_100000445 Ga0070702_1000004452 109
184 3300005615 Ga0070702_100014153 Ga0070702_1000141532 109
185 3300005615 Ga0070702_100137911 Ga0070702_1001379112 109
186 3300005615 Ga0070702_100339213 Ga0070702_1003392132 109
187 3300005616 Ga0068852_100023924 Ga0068852_1000239243 109
188 3300005617 Ga0068859_100064579 Ga0068859_1000645793 109
189 3300005617 Ga0068859_100076272 Ga0068859_1000762722 109
190 3300005617 Ga0068859_100177712 Ga0068859_1001777122 109
191 3300005617 Ga0068859_100798925 Ga0068859_1007989251 109
192 3300005618 Ga0068864_100014642 Ga0068864_1000146424 109
193 3300005618 Ga0068864_101067139 Ga0068864_1010671392 109
194 3300005618 Ga0068864_101911486 Ga0068864_1019114861 109
195 3300005718 Ga0068866_10010484 Ga0068866_100104843 109
196 3300005718 Ga0068866_10025658 Ga0068866_100256583 109
197 3300005718 Ga0068866_10526646 Ga0068866_105266462 109
198 3300005719 Ga0068861_100002085 Ga0068861_1000020857 109
199 3300005719 Ga0068861_100170318 Ga0068861_1001703182 109
200 3300005834 Ga0068851_10049757 Ga0068851_100497572 109
201 3300005840 Ga0068870_10554701 Ga0068870_105547012 109
202 3300005840 Ga0068870_10942265 Ga0068870_109422652 109
203 3300005841 Ga0068863_100055445 Ga0068863_1000554451 109
204 3300005841 Ga0068863_100180491 Ga0068863_1001804912 109
205 3300005842 Ga0068858_100042027 Ga0068858_1000420273 109
206 3300005842 Ga0068858_100157551 Ga0068858_1001575512 109
207 3300005842 Ga0068858_100469326 Ga0068858_1004693262 109
208 3300005842 Ga0068858_100520498 Ga0068858_1005204982 109
209 3300005843 Ga0068860_100032669 Ga0068860_1000326694 109
210 3300005843 Ga0068860_100040580 Ga0068860_1000405803 109
211 3300005843 Ga0068860_100379516 Ga0068860_1003795162 109
212 3300005843 Ga0068860_100873544 Ga0068860_1008735441 109
213 3300005843 Ga0068860_101457422 Ga0068860_1014574221 109
214 3300005844 Ga0068862_100039283 Ga0068862_1000392832 109
215 3300005844 Ga0068862_100111456 Ga0068862_1001114562 109
216 3300005844 Ga0068862_100178168 Ga0068862_1001781682 109
217 3300005844 Ga0068862_100697580 Ga0068862_1006975802 109
218 3300005937 Ga0081455_10005133 Ga0081455_100051338 109
219 3300005983 Ga0081540_1246568 Ga0081540_12465682 109
220 3300006038 Ga0075365_10008060 Ga0075365_100080602 109
221 3300006038 Ga0075365_10038896 Ga0075365_100388962 109
222 3300006042 Ga0075368_10493295 Ga0075368_104932952 109
223 3300006051 Ga0075364_10606184 Ga0075364_106061842 109
224 3300006051 Ga0075364_10795905 Ga0075364_107959051 109
225 3300006058 Ga0075432_10031100 Ga0075432_100311001 109
226 3300006058 Ga0075432_10343442 Ga0075432_103434422 109
227 3300006058 Ga0075432_10479138 Ga0075432_104791382 109
228 3300006163 Ga0070715_10005351 Ga0070715_100053512 109
229 3300006173 Ga0070716_100009658 Ga0070716_1000096583 109
230 3300006173 Ga0070716_100196025 Ga0070716_1001960252 109
231 3300006173 Ga0070716_101752405 Ga0070716_1017524051 109
232 3300006175 Ga0070712_100157957 Ga0070712_1001579572 109
233 3300006175 Ga0070712_100313748 Ga0070712_1003137482 109
234 3300006177 Ga0075362_10018081 Ga0075362_100180812 109
235 3300006178 Ga0075367_10019210 Ga0075367_100192103 109
236 3300006178 Ga0075367_10232577 Ga0075367_102325771 109
237 3300006178 Ga0075367_10297691 Ga0075367_102976912 109
238 3300006195 Ga0075366_10644056 Ga0075366_106440561 109
239 3300006237 Ga0097621_100087867 Ga0097621_1000878673 109
240 3300006237 Ga0097621_100143369 Ga0097621_1001433692 109
241 3300006237 Ga0097621_100584244 Ga0097621_1005842442 109
242 3300006358 Ga0068871_100159144 Ga0068871_1001591442 109
243 3300006358 Ga0068871_100183370 Ga0068871_1001833702 109
244 3300006358 Ga0068871_101624110 Ga0068871_1016241101 109
245 3300006844 Ga0075428_100134900 Ga0075428_1001349003 109
246 3300006846 Ga0075430_100083006 Ga0075430_1000830062 109
247 3300006846 Ga0075430_100250036 Ga0075430_1002500362 109
248 3300006846 Ga0075430_100293822 Ga0075430_1002938222 109
249 3300006847 Ga0075431_100086661 Ga0075431_1000866612 109
250 3300006847 Ga0075431_100293807 Ga0075431_1002938072 109
251 3300006852 Ga0075433_10023305 Ga0075433_100233054 109
252 3300006871 Ga0075434_100217241 Ga0075434_1002172413 109
253 3300006871 Ga0075434_100248932 Ga0075434_1002489322 109
254 3300006880 Ga0075429_100013020 Ga0075429_1000130203 109
255 3300006881 Ga0068865_100000998 Ga0068865_1000009989 109
256 3300006881 Ga0068865_100016090 Ga0068865_1000160904 109
257 3300006881 Ga0068865_100039849 Ga0068865_1000398493 109
258 3300006881 Ga0068865_100104860 Ga0068865_1001048603 109
259 3300006881 Ga0068865_100486353 Ga0068865_1004863532 109
260 3300006914 Ga0075436_100001919 Ga0075436_1000019197 109
261 3300006914 Ga0075436_100029757 Ga0075436_1000297574 109
262 3300006931 Ga0097620_100064579 Ga0097620_1000645793 109
263 3300006931 Ga0097620_100076276 Ga0097620_1000762763 109
264 3300006931 Ga0097620_100177719 Ga0097620_1001777192 109
265 3300006931 Ga0097620_100799058 Ga0097620_1007990581 109
266 3300007076 Ga0075435_100014216 Ga0075435_1000142164 109
267 3300007076 Ga0075435_100239964 Ga0075435_1002399642 109
268 3300009011 Ga0105251_10207926 Ga0105251_102079262 109
269 3300009036 Ga0105244_10158062 Ga0105244_101580621 109
270 3300009092 Ga0105250_10036408 Ga0105250_100364083 109
271 3300009092 Ga0105250_10612003 Ga0105250_106120031 109
272 3300009093 Ga0105240_10163181 Ga0105240_101631812 109
273 3300009093 Ga0105240_10741588 Ga0105240_107415882 109
274 3300009094 Ga0111539_10345317 Ga0111539_103453172 109
275 3300009094 Ga0111539_10430467 Ga0111539_104304672 109
276 3300009098 Ga0105245_10012027 Ga0105245_100120278 109
277 3300009098 Ga0105245_11777469 Ga0105245_117774691 109
278 3300009098 Ga0105245_11842500 Ga0105245_118425001 109
279 3300009101 Ga0105247_10004362 Ga0105247_100043623 109
280 3300009101 Ga0105247_10023200 Ga0105247_100232002 109
281 3300009101 Ga0105247_10030449 Ga0105247_100304492 109
282 3300009101 Ga0105247_10326034 Ga0105247_103260342 109
283 3300009147 Ga0114129_12955773 Ga0114129_129557731 109
284 3300009148 Ga0105243_10015731 Ga0105243_100157313 109
285 3300009148 Ga0105243_10017246 Ga0105243_100172464 109
286 3300009148 Ga0105243_10100184 Ga0105243_101001841 109
287 3300009148 Ga0105243_10119858 Ga0105243_101198582 109
288 3300009148 Ga0105243_10135857 Ga0105243_101358572 109
289 3300009148 Ga0105243_10302127 Ga0105243_103021272 109
290 3300009174 Ga0105241_10005348 Ga0105241_100053485 109
291 3300009174 Ga0105241_10872527 Ga0105241_108725272 109
292 3300009176 Ga0105242_10021809 Ga0105242_100218092 109
293 3300009176 Ga0105242_10065504 Ga0105242_100655041 109
294 3300009176 Ga0105242_10129369 Ga0105242_101293692 109
295 3300009176 Ga0105242_10855383 Ga0105242_108553832 109
296 3300009176 Ga0105242_10989053 Ga0105242_109890532 109
297 3300009177 Ga0105248_10041042 Ga0105248_100410423 109
298 3300009177 Ga0105248_10148167 Ga0105248_101481673 109
299 3300009177 Ga0105248_11120679 Ga0105248_111206792 109
300 3300009177 Ga0105248_11685533 Ga0105248_116855332 109
301 3300009545 Ga0105237_10007474 Ga0105237_100074744 109
302 3300009545 Ga0105237_12000541 Ga0105237_120005411 109
303 3300009551 Ga0105238_10015339 Ga0105238_100153394 109
304 3300009551 Ga0105238_10459940 Ga0105238_104599402 109
305 3300009551 Ga0105238_10714578 Ga0105238_107145782 109
306 3300009553 Ga0105249_10024240 Ga0105249_100242406 109
307 3300009553 Ga0105249_10029576 Ga0105249_100295763 109
308 3300009553 Ga0105249_10159371 Ga0105249_101593712 109
309 3300009553 Ga0105249_10403148 Ga0105249_104031482 109
310 3300010375 Ga0105239_10045891 Ga0105239_100458913 109
311 3300010375 Ga0105239_10138120 Ga0105239_101381203 109
312 3300010375 Ga0105239_10284723 Ga0105239_102847232 109
313 3300010375 Ga0105239_12413558 Ga0105239_124135582 109
314 3300010375 Ga0105239_13615712 Ga0105239_136157121 109
315 3300011119 Ga0105246_10054859 Ga0105246_100548592 109
316 3300011119 Ga0105246_10317114 Ga0105246_103171142 109
317 3300011119 Ga0105246_10630934 Ga0105246_106309341 109
318 3300012483 Ga0157337_1002251 Ga0157337_10022512 109
319 3300012494 Ga0157341_1037117 Ga0157341_10371171 109
320 3300012510 Ga0157316_1023906 Ga0157316_10239062 109
321 3300013100 Ga0157373_10084195 Ga0157373_100841952 109
322 3300013102 Ga0157371_10003206 Ga0157371_100032069 109
323 3300013102 Ga0157371_10471891 Ga0157371_104718912 109
324 3300013105 Ga0157369_10001593 Ga0157369_100015934 109
325 3300013296 Ga0157374_10214798 Ga0157374_102147983 109
326 3300013296 Ga0157374_11105310 Ga0157374_111053102 109
327 3300013296 Ga0157374_11281924 Ga0157374_112819242 109
328 3300013297 Ga0157378_10036344 Ga0157378_100363442 109
329 3300013297 Ga0157378_10085711 Ga0157378_100857113 109
330 3300013297 Ga0157378_10186086 Ga0157378_101860862 109
331 3300013297 Ga0157378_10241763 Ga0157378_102417632 109
332 3300013306 Ga0163162_10002904 Ga0163162_100029049 109
333 3300013306 Ga0163162_11024713 Ga0163162_110247132 109
334 3300013306 Ga0163162_11452917 Ga0163162_114529171 109
335 3300013306 Ga0163162_11582814 Ga0163162_115828142 109
336 3300013307 Ga0157372_10040181 Ga0157372_100401813 109
337 3300013307 Ga0157372_10429835 Ga0157372_104298352 109
338 3300013307 Ga0157372_10979473 Ga0157372_109794732 109
339 3300013307 Ga0157372_11098674 Ga0157372_110986742 109
340 3300013308 Ga0157375_10010582 Ga0157375_100105825 109
341 3300013308 Ga0157375_10027601 Ga0157375_100276012 109
342 3300013308 Ga0157375_10028166 Ga0157375_100281663 109
343 3300013308 Ga0157375_11374802 Ga0157375_113748021 109
344 3300013308 Ga0157375_11454595 Ga0157375_114545952 109
345 3300014325 Ga0163163_10063241 Ga0163163_100632412 109
346 3300014325 Ga0163163_10107625 Ga0163163_101076253 109
347 3300014325 Ga0163163_10393705 Ga0163163_103937052 109
348 3300014325 Ga0163163_11829712 Ga0163163_118297121 109
349 3300014326 Ga0157380_10007507 Ga0157380_100075074 109
350 3300014326 Ga0157380_10018172 Ga0157380_100181722 109
351 3300014326 Ga0157380_10302218 Ga0157380_103022182 109
352 3300014326 Ga0157380_10416284 Ga0157380_104162842 109
353 3300014326 Ga0157380_10637002 Ga0157380_106370022 109
354 3300014745 Ga0157377_10021414 Ga0157377_100214142 109
355 3300014745 Ga0157377_11062925 Ga0157377_110629252 109
356 3300014968 Ga0157379_10013548 Ga0157379_100135483 109
357 3300014968 Ga0157379_10508135 Ga0157379_105081352 109
358 3300014968 Ga0157379_10755635 Ga0157379_107556351 109
359 3300014969 Ga0157376_10013476 Ga0157376_100134764 109
360 3300014969 Ga0157376_10072385 Ga0157376_100723853 109
361 3300014969 Ga0157376_10652569 Ga0157376_106525692 109
362 3300017792 Ga0163161_10008920 Ga0163161_100089204 109
363 3300017792 Ga0163161_10056704 Ga0163161_100567043 109
364 3300021377 Ga0213874_10020258 Ga0213874_100202582 109
365 3300021384 Ga0213876_10006369 Ga0213876_100063694 109
366 3300021384 Ga0213876_10077112 Ga0213876_100771122 109
367 3300021388 Ga0213875_10197640 Ga0213875_101976401 109
368 3300025297 Ga0209758_1025921 Ga0209758_10259212 109
369 3300025315 Ga0207697_10044785 Ga0207697_100447852 109
370 3300025321 Ga0207656_10030214 Ga0207656_100302143 109
371 3300025711 Ga0207696_1099964 Ga0207696_10999642 109
372 3300025885 Ga0207653_10027500 Ga0207653_100275002 109
373 3300025898 Ga0207692_10027209 Ga0207692_100272092 109
374 3300025899 Ga0207642_10463120 Ga0207642_104631201 109
375 3300025900 Ga0207710_10023415 Ga0207710_100234153 109
376 3300025900 Ga0207710_10033842 Ga0207710_100338423 109
377 3300025901 Ga0207688_10001879 Ga0207688_100018793 109
378 3300025901 Ga0207688_10146973 Ga0207688_101469732 109
379 3300025901 Ga0207688_10305616 Ga0207688_103056162 109
380 3300025903 Ga0207680_10035235 Ga0207680_100352352 109
381 3300025904 Ga0207647_10285172 Ga0207647_102851722 109
382 3300025905 Ga0207685_10012642 Ga0207685_100126422 109
383 3300025905 Ga0207685_10154312 Ga0207685_101543122 109
384 3300025905 Ga0207685_10247036 Ga0207685_102470362 109
385 3300025906 Ga0207699_10016553 Ga0207699_100165532 109
386 3300025906 Ga0207699_10459905 Ga0207699_104599052 109
387 3300025907 Ga0207645_10023305 Ga0207645_100233054 109
388 3300025907 Ga0207645_10218030 Ga0207645_102180302 109
389 3300025908 Ga0207643_10100900 Ga0207643_101009002 109
390 3300025908 Ga0207643_10148085 Ga0207643_101480852 109
391 3300025908 Ga0207643_10693610 Ga0207643_106936102 109
392 3300025910 Ga0207684_10550803 Ga0207684_105508032 109
393 3300025911 Ga0207654_10115847 Ga0207654_101158473 109
394 3300025911 Ga0207654_10841459 Ga0207654_108414592 109
395 3300025912 Ga0207707_10561414 Ga0207707_105614142 109
396 3300025912 Ga0207707_11506509 Ga0207707_115065091 109
397 3300025914 Ga0207671_10079776 Ga0207671_100797762 109
398 3300025915 Ga0207693_10001954 Ga0207693_100019544 109
399 3300025915 Ga0207693_10283705 Ga0207693_102837052 109
400 3300025915 Ga0207693_10872796 Ga0207693_108727961 109
401 3300025916 Ga0207663_10080345 Ga0207663_100803452 109
402 3300025916 Ga0207663_10152629 Ga0207663_101526292 109
403 3300025916 Ga0207663_10463002 Ga0207663_104630022 109
404 3300025917 Ga0207660_10393411 Ga0207660_103934112 109
405 3300025918 Ga0207662_10001539 Ga0207662_100015396 109
406 3300025918 Ga0207662_10595848 Ga0207662_105958482 109
407 3300025918 Ga0207662_10847787 Ga0207662_108477871 109
408 3300025919 Ga0207657_10003469 Ga0207657_1000346910 109
409 3300025919 Ga0207657_10727962 Ga0207657_107279622 109
410 3300025920 Ga0207649_10039470 Ga0207649_100394703 109
411 3300025921 Ga0207652_10059743 Ga0207652_100597433 109
412 3300025923 Ga0207681_11012806 Ga0207681_110128062 109
413 3300025925 Ga0207650_10134837 Ga0207650_101348371 109
414 3300025926 Ga0207659_10074550 Ga0207659_100745502 109
415 3300025927 Ga0207687_10097210 Ga0207687_100972103 109
416 3300025927 Ga0207687_10475962 Ga0207687_104759622 109
417 3300025928 Ga0207700_10258811 Ga0207700_102588112 109
418 3300025929 Ga0207664_10805038 Ga0207664_108050381 109
419 3300025931 Ga0207644_10065280 Ga0207644_100652803 109
420 3300025932 Ga0207690_10032064 Ga0207690_100320643 109
421 3300025932 Ga0207690_10044640 Ga0207690_100446403 109
422 3300025933 Ga0207706_10000505 Ga0207706_1000050518 109
423 3300025933 Ga0207706_10236896 Ga0207706_102368962 109
424 3300025933 Ga0207706_10489200 Ga0207706_104892002 109
425 3300025933 Ga0207706_11252863 Ga0207706_112528631 109
426 3300025934 Ga0207686_10009659 Ga0207686_100096593 109
427 3300025934 Ga0207686_10148722 Ga0207686_101487223 109
428 3300025934 Ga0207686_10424519 Ga0207686_104245192 109
429 3300025934 Ga0207686_10951209 Ga0207686_109512092 109
430 3300025935 Ga0207709_10055094 Ga0207709_100550941 109
431 3300025935 Ga0207709_10070652 Ga0207709_100706522 109
432 3300025935 Ga0207709_10359418 Ga0207709_103594181 109
433 3300025935 Ga0207709_10380399 Ga0207709_103803992 109
434 3300025936 Ga0207670_10117314 Ga0207670_101173142 109
435 3300025936 Ga0207670_10146308 Ga0207670_101463082 109
436 3300025937 Ga0207669_10083184 Ga0207669_100831842 109
437 3300025937 Ga0207669_10127152 Ga0207669_101271522 109
438 3300025937 Ga0207669_10273833 Ga0207669_102738332 109
439 3300025937 Ga0207669_10365290 Ga0207669_103652902 109
440 3300025938 Ga0207704_10017796 Ga0207704_100177963 109
441 3300025938 Ga0207704_10155653 Ga0207704_101556532 109
442 3300025938 Ga0207704_10684986 Ga0207704_106849862 109
443 3300025938 Ga0207704_11558721 Ga0207704_115587211 109
444 3300025939 Ga0207665_10000279 Ga0207665_100002799 109
445 3300025939 Ga0207665_10028507 Ga0207665_100285072 109
446 3300025939 Ga0207665_10037094 Ga0207665_100370943 109
447 3300025940 Ga0207691_10048425 Ga0207691_100484254 109
448 3300025941 Ga0207711_10184993 Ga0207711_101849932 109
449 3300025941 Ga0207711_10492437 Ga0207711_104924372 109
450 3300025942 Ga0207689_10197488 Ga0207689_101974882 109
451 3300025944 Ga0207661_10254250 Ga0207661_102542502 109
452 3300025945 Ga0207679_10161833 Ga0207679_101618332 109
453 3300025949 Ga0207667_10066389 Ga0207667_100663893 109
454 3300025949 Ga0207667_10437479 Ga0207667_104374792 109
455 3300025960 Ga0207651_10104557 Ga0207651_101045573 109
456 3300025960 Ga0207651_10212441 Ga0207651_102124411 109
457 3300025960 Ga0207651_10622422 Ga0207651_106224221 109
458 3300025960 Ga0207651_12028490 Ga0207651_120284901 109
459 3300025961 Ga0207712_10004588 Ga0207712_100045884 109
460 3300025961 Ga0207712_10033910 Ga0207712_100339103 109
461 3300025961 Ga0207712_10075883 Ga0207712_100758833 109
462 3300025961 Ga0207712_10623882 Ga0207712_106238822 109
463 3300025972 Ga0207668_10031602 Ga0207668_100316022 109
464 3300025972 Ga0207668_10039053 Ga0207668_100390531 109
465 3300025972 Ga0207668_11521886 Ga0207668_115218861 109
466 3300025981 Ga0207640_10051924 Ga0207640_100519242 109
467 3300025986 Ga0207658_10146117 Ga0207658_101461172 109
468 3300025986 Ga0207658_10390219 Ga0207658_103902192 109
469 3300025986 Ga0207658_11732547 Ga0207658_117325471 109
470 3300026023 Ga0207677_10078964 Ga0207677_100789643 109
471 3300026023 Ga0207677_10132733 Ga0207677_101327331 109
472 3300026023 Ga0207677_11641751 Ga0207677_116417512 109
473 3300026035 Ga0207703_10023879 Ga0207703_100238791 109
474 3300026035 Ga0207703_10030555 Ga0207703_100305554 109
475 3300026035 Ga0207703_10540465 Ga0207703_105404652 109
476 3300026035 Ga0207703_11131682 Ga0207703_111316822 109
477 3300026041 Ga0207639_10024061 Ga0207639_100240613 109
478 3300026041 Ga0207639_10228144 Ga0207639_102281441 109
479 3300026041 Ga0207639_10257470 Ga0207639_102574702 109
480 3300026067 Ga0207678_10000649 Ga0207678_100006493 109
481 3300026067 Ga0207678_10052318 Ga0207678_100523183 109
482 3300026075 Ga0207708_10040182 Ga0207708_100401822 109
483 3300026075 Ga0207708_10130590 Ga0207708_101305902 109
484 3300026078 Ga0207702_10244567 Ga0207702_102445671 109
485 3300026078 Ga0207702_11199078 Ga0207702_111990781 109
486 3300026088 Ga0207641_10298130 Ga0207641_102981303 109
487 3300026088 Ga0207641_10854305 Ga0207641_108543051 109
488 3300026089 Ga0207648_10048532 Ga0207648_100485323 109
489 3300026089 Ga0207648_10214466 Ga0207648_102144662 109
490 3300026089 Ga0207648_10268950 Ga0207648_102689502 109
491 3300026089 Ga0207648_10361204 Ga0207648_103612042 109
492 3300026095 Ga0207676_11697285 Ga0207676_116972852 109
493 3300026095 Ga0207676_11759858 Ga0207676_117598581 109
494 3300026116 Ga0207674_10020971 Ga0207674_100209714 109
495 3300026116 Ga0207674_10586627 Ga0207674_105866272 109
496 3300026118 Ga0207675_100000985 Ga0207675_1000009854 109
497 3300026118 Ga0207675_100015450 Ga0207675_1000154504 109
498 3300026118 Ga0207675_100044704 Ga0207675_1000447044 109
499 3300026118 Ga0207675_100199765 Ga0207675_1001997653 109
500 3300026121 Ga0207683_10002194 Ga0207683_1000219418 109
501 3300026121 Ga0207683_10051649 Ga0207683_100516493 109
502 3300026121 Ga0207683_10747827 Ga0207683_107478272 109
503 3300026121 Ga0207683_11175887 Ga0207683_111758871 109
504 3300026142 Ga0207698_10127066 Ga0207698_101270661 109
505 3300027717 Ga0209998_10098885 Ga0209998_100988852 109
506 3300027866 Ga0209813_10411481 Ga0209813_104114811 109
507 3300027907 Ga0207428_10096598 Ga0207428_100965983 109
508 3300028379 Ga0268266_10059838 Ga0268266_100598383 109
509 3300028379 Ga0268266_10074683 Ga0268266_100746832 109
510 3300028379 Ga0268266_10552562 Ga0268266_105525622 109
511 3300028380 Ga0268265_10023030 Ga0268265_100230302 109
512 3300028380 Ga0268265_10112188 Ga0268265_101121882 109
513 3300028380 Ga0268265_10124979 Ga0268265_101249792 109
514 3300028380 Ga0268265_10922945 Ga0268265_109229452 109
515 3300028380 Ga0268265_11750371 Ga0268265_117503711 109
516 3300028381 Ga0268264_10076817 Ga0268264_100768172 109
517 3300028381 Ga0268264_10077878 Ga0268264_100778782 109
518 3300028381 Ga0268264_10408921 Ga0268264_104089212 109
519 3300028381 Ga0268264_10670583 Ga0268264_106705832 109
520 3300031241 Ga0265325_10468076 Ga0265325_104680761 109
521 3300031247 Ga0265340_10144092 Ga0265340_101440922 109
522 3300031456 Ga0307513_10173346 Ga0307513_101733463 109
523 3300031548 Ga0307408_100789957 Ga0307408_1007899572 109
524 3300031595 Ga0265313_10047971 Ga0265313_100479712 109
525 3300031665 Ga0316575_10004895 Ga0316575_100048954 109
526 3300031691 Ga0316579_10058729 Ga0316579_100587293 109
527 3300031727 Ga0316576_10207929 Ga0316576_102079292 109
528 3300031731 Ga0307405_11189713 Ga0307405_111897131 109
529 3300031733 Ga0316577_10056669 Ga0316577_100566692 109
530 3300031824 Ga0307413_10494820 Ga0307413_104948202 109
531 3300031852 Ga0307410_10324225 Ga0307410_103242252 109
532 3300031911 Ga0307412_12215963 Ga0307412_122159631 109
533 3300031995 Ga0307409_100345302 Ga0307409_1003453022 109
534 3300031995 Ga0307409_100414078 Ga0307409_1004140782 109
535 3300031995 Ga0307409_100910454 Ga0307409_1009104541 109
536 3300031995 Ga0307409_101548714 Ga0307409_1015487142 109
537 3300032002 Ga0307416_101480355 Ga0307416_1014803551 109
538 3300032004 Ga0307414_10206262 Ga0307414_102062623 109
539 3300032005 Ga0307411_10011190 Ga0307411_100111906 109
540 3300032005 Ga0307411_12253575 Ga0307411_122535751 109
541 3300032126 Ga0307415_100301164 Ga0307415_1003011643 109
542 3300032133 Ga0316583_10022510 Ga0316583_100225101 109
543 3300032137 Ga0316585_10023764 Ga0316585_100237642 109
544 3300032139 Ga0316580_10030001 Ga0316580_100300012 109
545 3300032168 Ga0316593_10028564 Ga0316593_100285643 109
546 3300033180 Ga0307510_10096709 Ga0307510_100967094 109
547 3300034816 Ga0373930_0004849 Ga0373930_0004849_1101_1430 109
548 3300034819 Ga0373958_0092834 Ga0373958_0092834_266_595 109
549 3300034957 Ga0373938_0066839 Ga0373938_0066839_299_628 109
550 3300035083 Ga0373926_0166696 Ga0373926_0166696_325_657 109
551 3300035084 Ga0373928_0126157 Ga0373928_0126157_159_488 109
552 3300035089 Ga0373944_0414027 Ga0373944_0414027_12_344 109
553 3300035092 Ga0373952_0284728 Ga0373952_0284728_40_375 109
554 3300035112 Ga0373932_0007779 Ga0373932_0007779_1316_1645 109
555 3300035114 Ga0373939_0184898 Ga0373939_0184898_327_656 109
556 3300035115 Ga0373941_0032315 Ga0373941_0032315_340_669 109
557 3300035116 Ga0373945_0049713 Ga0373945_0049713_99_431 109
558 3300035121 Ga0373960_0011292 Ga0373960_0011292_1052_1384 109
559 3300035121 Ga0373960_0135534 Ga0373960_0135534_91_420 109
560 3300035170 Ga0373943_0070087 Ga0373943_0070087_575_907 109
561 3300035171 Ga0373946_0055664 Ga0373946_0055664_445_777 109
562 3300035207 Ga0373942_0057060 Ga0373942_0057060_717_1046 109
563 3300035241 Ga0373961_0063510 Ga0373961_0063510_751_1080 109
564 3300035241 Ga0373961_0085572 Ga0373961_0085572_131_460 109
565 3300035398 Ga0316574_0250114 Ga0316574_0250114_724_1056 109
566 3300035691 Ga0373931_0013327 Ga0373931_0013327_2377_2706 109
567 3300035691 Ga0373931_0064636 Ga0373931_0064636_923_1255 109
568 3300035695 Ga0373927_0029439 Ga0373927_0029439_2195_2527 109
569 3300035725 Ga0373947_0017366 Ga0373947_0017366_761_1093 109
570 3300036647 Ga0316582_0245048 Ga0316582_0245048_391_723 109
571 3300036712 Ga0316584_0097468 Ga0316584_0097468_1140_1472 109
572 3300037068 Ga0373925_0007361 Ga0373925_0007361_2334_2666 109
573 3300037418 Ga0395900_0064855 Ga0395900_0064855_2456_2785 109
574 3300037466 Ga0395898_0033273 Ga0395898_0033273_1160_1489 109
575 3300037471 Ga0395905_0002526 Ga0395905_0002526_16019_16348 109
576 3300037853 Ga0436364_0857246 Ga0436364_0857246_145_477 109
577 3300037853 Ga0436364_1190915 Ga0436364_1190915_307_636 109
578 3300038443 Ga0395901_0016472 Ga0395901_0016472_6209_6538 109
579 3300038443 Ga0395901_1802119 Ga0395901_1802119_175_516 109
580 3300038996 Ga0242420_003812 Ga0242420_003812_16_345 109
581 3300039062 Ga0400483_017169 Ga0400483_017169_7357_7689 109
582 3300039062 Ga0400483_232856 Ga0400483_232856_3072_3404 109
583 3300039437 Ga0436365_0605653 Ga0436365_0605653_17496_17825 109
584 3300039437 Ga0436365_0624031 Ga0436365_0624031_426_755 109
585 3300039437 Ga0436365_0675144 Ga0436365_0675144_1515_1850 109
586 3300039438 Ga0436360_0700895 Ga0436360_0700895_526_855 109
587 3300039450 Ga0436363_0156265 Ga0436363_0156265_487_816 109
588 3300039450 Ga0436363_0580065 Ga0436363_0580065_20587_20916 109
589 3300041413 Ga0439465_0183145 Ga0439465_0183145_29_361 109
590 3300041492 Ga0451835_0177526 Ga0451835_0177526_107_487 109
591 3300041498 Ga0451841_0234897 Ga0451841_0234897_12_341 109
592 3300041512 Ga0451853_1699730 Ga0451853_1699730_489_878 109
593 3300042438 Ga0439459_0188092 Ga0439459_0188092_146_475 109
594 3300046455 Ga0495603_0000148 Ga0495603_0000148_11771_12103 109
595 3300046455 Ga0495603_0686298 Ga0495603_0686298_215_547 109
596 3300046459 Ga0495629_0000108 Ga0495629_0000108_18319_18651 109
597 3300046460 Ga0495638_0164821 Ga0495638_0164821_785_1117 109
598 3300046460 Ga0495638_0398733 Ga0495638_0398733_208_615 109
599 3300046461 Ga0495641_0004971 Ga0495641_0004971_4660_4992 109
600 3300046472 Ga0495580_0000631 Ga0495580_0000631_20540_20872 109
601 3300046473 Ga0495582_0001363 Ga0495582_0001363_8556_8888 109
602 3300046475 Ga0495639_0001765 Ga0495639_0001765_3916_4248 109
603 3300046491 Ga0495584_0060037 Ga0495584_0060037_843_1175 109
604 3300046499 Ga0495594_0000184 Ga0495594_0000184_16149_16481 109
605 3300046513 Ga0495616_0087516 Ga0495616_0087516_472_804 109
606 3300046518 Ga0495631_0342093 Ga0495631_0342093_292_624 109
607 3300046520 Ga0495637_0090107 Ga0495637_0090107_537_869 109
608 3300046520 Ga0495637_0139440 Ga0495637_0139440_28_360 109
609 3300046523 Ga0495644_0071623 Ga0495644_0071623_960_1292 109
610 3300046523 Ga0495644_0247376 Ga0495644_0247376_47_379 109
611 3300046523 Ga0495644_0254740 Ga0495644_0254740_125_457 109
612 3300046526 Ga0495666_0073821 Ga0495666_0073821_426_758 109
613 3300046528 Ga0495642_0237425 Ga0495642_0237425_41_373 109
614 3300046557 Ga0495622_0005648 Ga0495622_0005648_3681_4013 109
615 3300046559 Ga0495667_0176463 Ga0495667_0176463_1024_1356 109
616 3300046615 Ga0495656_0224219 Ga0495656_0224219_396_728 109
617 3300046616 Ga0495668_0475313 Ga0495668_0475313_240_572 109
618 3300046642 Ga0495634_0035977 Ga0495634_0035977_2485_2817 109
619 3300046660 Ga0495625_0145654 Ga0495625_0145654_442_849 109
620 3300046660 Ga0495625_0842655 Ga0495625_0842655_76_408 109
621 3300046664 Ga0495659_0014153 Ga0495659_0014153_1448_1780 109
622 3300046664 Ga0495659_0354024 Ga0495659_0354024_21_353 109
623 3300046674 Ga0495588_0050724 Ga0495588_0050724_1101_1433 109
624 3300046681 Ga0495647_0017965 Ga0495647_0017965_894_1226 109
625 3300046683 Ga0495658_0001757 Ga0495658_0001757_4445_4777 109
626 3300046689 Ga0495613_0010164 Ga0495613_0010164_4031_4363 109
627 3300046690 Ga0495624_0768145 Ga0495624_0768145_59_391 109
628 3300046692 Ga0495671_0129113 Ga0495671_0129113_385_717 109
629 3300047315 Ga0495581_0000791 Ga0495581_0000791_6599_6931 109
630 3300047315 Ga0495581_0354730 Ga0495581_0354730_78_416 109
631 3300047318 Ga0495636_0033357 Ga0495636_0033357_883_1215 109
632 3300047321 Ga0495676_0020611 Ga0495676_0020611_3995_4327 109
633 3300047322 Ga0495680_0027004 Ga0495680_0027004_4263_4595 109
634 3300047323 Ga0495683_0297785 Ga0495683_0297785_48_380 109
635 3300047673 Ga0495593_0000532 Ga0495593_0000532_10311_10643 109
636 3300048089 Ga0495614_0004704 Ga0495614_0004704_3899_4231 109
637 3300048903 Ga0496100_0008884 Ga0496100_0008884_1456_1785 109
638 3300048903 Ga0496100_0038441 Ga0496100_0038441_1729_2058 109
639 3300048903 Ga0496100_0288584 Ga0496100_0288584_584_916 109
640 3300048904 Ga0496101_0044884 Ga0496101_0044884_17_349 109
641 3300048904 Ga0496101_0072460 Ga0496101_0072460_871_1200 109
642 3300048904 Ga0496101_0075993 Ga0496101_0075993_1218_1547 109
643 3300048904 Ga0496101_0186270 Ga0496101_0186270_544_879 109
644 3300048904 Ga0496101_0326509 Ga0496101_0326509_782_1114 109
645 3300048904 Ga0496101_0725830 Ga0496101_0725830_400_735 109
646 3300048905 Ga0496102_0124358 Ga0496102_0124358_315_647 109
647 3300048905 Ga0496102_0147845 Ga0496102_0147845_909_1244 109
648 3300048905 Ga0496102_0583991 Ga0496102_0583991_10_342 109
649 3300048905 Ga0496102_1115674 Ga0496102_1115674_242_571 109
650 3300048906 Ga0496103_0013161 Ga0496103_0013161_2226_2555 109
651 3300048906 Ga0496103_0021332 Ga0496103_0021332_2783_3112 109
652 3300048906 Ga0496103_0135224 Ga0496103_0135224_38_370 109
653 3300048906 Ga0496103_0798128 Ga0496103_0798128_26_358 109
654 3300048907 Ga0496104_0002041 Ga0496104_0002041_1586_1921 109
655 3300048907 Ga0496104_0036056 Ga0496104_0036056_1992_2321 109
656 3300048907 Ga0496104_0058885 Ga0496104_0058885_1456_1785 109
657 3300048907 Ga0496104_0093438 Ga0496104_0093438_1235_1570 109
658 3300048907 Ga0496104_0132150 Ga0496104_0132150_1782_2114 109
659 3300048907 Ga0496104_1172335 Ga0496104_1172335_163_492 109
660 3300048908 Ga0496105_0003656 Ga0496105_0003656_4363_4692 109
661 3300048908 Ga0496105_0124092 Ga0496105_0124092_698_1030 109
662 3300048908 Ga0496105_0134091 Ga0496105_0134091_1479_1811 109
663 3300048908 Ga0496105_0145860 Ga0496105_0145860_1273_1608 109
664 3300048908 Ga0496105_0487136 Ga0496105_0487136_267_596 109
665 3300048909 Ga0496106_0005509 Ga0496106_0005509_3492_3821 109
666 3300048909 Ga0496106_0019071 Ga0496106_0019071_644_979 109
667 3300048909 Ga0496106_0026054 Ga0496106_0026054_2745_3074 109
668 3300048909 Ga0496106_0126504 Ga0496106_0126504_597_929 109
669 3300048909 Ga0496106_0365307 Ga0496106_0365307_740_1075 109
670 3300048910 Ga0496107_0002100 Ga0496107_0002100_3725_4054 109
671 3300048910 Ga0496107_0015213 Ga0496107_0015213_3264_3596 109
672 3300048910 Ga0496107_0030382 Ga0496107_0030382_75_404 109
673 3300048910 Ga0496107_0077990 Ga0496107_0077990_1962_2294 109
674 3300048910 Ga0496107_0167234 Ga0496107_0167234_343_678 109
675 3300048911 Ga0496108_0074343 Ga0496108_0074343_510_845 109
676 3300048911 Ga0496108_0076405 Ga0496108_0076405_197_526 109
677 3300048911 Ga0496108_0125673 Ga0496108_0125673_946_1275 109
678 3300048912 Ga0496109_0056608 Ga0496109_0056608_2935_3264 109
679 3300048912 Ga0496109_0062095 Ga0496109_0062095_489_818 109
680 3300048912 Ga0496109_0182005 Ga0496109_0182005_1037_1372 109
681 3300048912 Ga0496109_0216032 Ga0496109_0216032_1126_1461 109
682 3300048912 Ga0496109_0288681 Ga0496109_0288681_799_1131 109
683 3300048912 Ga0496109_0315550 Ga0496109_0315550_28_360 109
684 3300048912 Ga0496109_0611203 Ga0496109_0611203_33_362 109
685 3300048912 Ga0496109_1731241 Ga0496109_1731241_180_512 109
686 3300048913 Ga0496110_0047501 Ga0496110_0047501_690_1019 109
687 3300048913 Ga0496110_0194503 Ga0496110_0194503_26_361 109
688 3300048913 Ga0496110_0224059 Ga0496110_0224059_264_596 109
689 3300048913 Ga0496110_1367548 Ga0496110_1367548_37_366 109
690 3300048914 Ga0496111_0046706 Ga0496111_0046706_1552_1884 109
691 3300048914 Ga0496111_0383590 Ga0496111_0383590_622_951 109
692 3300048914 Ga0496111_0835196 Ga0496111_0835196_91_420 109
693 3300048915 Ga0496112_0005268 Ga0496112_0005268_4276_4605 109
694 3300048915 Ga0496112_0021265 Ga0496112_0021265_5411_5740 109
695 3300048915 Ga0496112_0361505 Ga0496112_0361505_978_1313 109
696 3300048915 Ga0496112_1066364 Ga0496112_1066364_270_605 109
697 3300048916 Ga0496113_0020982 Ga0496113_0020982_3988_4317 109
698 3300048916 Ga0496113_0115870 Ga0496113_0115870_1495_1824 109
699 3300048916 Ga0496113_0146790 Ga0496113_0146790_1035_1367 109
700 3300048916 Ga0496113_0288667 Ga0496113_0288667_246_581 109
701 3300048917 Ga0496114_0002432 Ga0496114_0002432_6611_6940 109
702 3300048917 Ga0496114_0035057 Ga0496114_0035057_2391_2720 109
703 3300048917 Ga0496114_0105089 Ga0496114_0105089_733_1065 109
704 3300048917 Ga0496114_0851670 Ga0496114_0851670_277_612 109
705 3300048918 Ga0496115_0009593 Ga0496115_0009593_5004_5333 109
706 3300048918 Ga0496115_0066964 Ga0496115_0066964_1430_1765 109
707 3300048918 Ga0496115_0156515 Ga0496115_0156515_339_671 109
708 3300048918 Ga0496115_0243852 Ga0496115_0243852_929_1261 109
709 3300048918 Ga0496115_0807762 Ga0496115_0807762_134_463 109
710 3300049568 Ga0501031_0052882 Ga0501031_0052882_553_885 109
711 3300049569 Ga0501032_0271591 Ga0501032_0271591_717_1049 109
712 3300049569 Ga0501032_0408411 Ga0501032_0408411_61_393 109
713 3300049569 Ga0501032_0835801 Ga0501032_0835801_35_373 109
714 3300049570 Ga0501033_0072638 Ga0501033_0072638_1257_1589 109
715 3300049570 Ga0501033_0090562 Ga0501033_0090562_883_1212 109
716 3300049571 Ga0501034_1396173 Ga0501034_1396173_189_527 109
717 3300049572 Ga0501036_0079357 Ga0501036_0079357_1907_2245 109
718 3300049572 Ga0501036_0703256 Ga0501036_0703256_341_673 109
719 3300049573 Ga0501037_0038417 Ga0501037_0038417_2859_3191 109
720 3300049573 Ga0501037_0236580 Ga0501037_0236580_830_1159 109
721 3300049574 Ga0501038_0081297 Ga0501038_0081297_1960_2292 109
722 3300049575 Ga0501039_0145735 Ga0501039_0145735_276_608 109
723 3300049575 Ga0501039_0246737 Ga0501039_0246737_621_965 109
724 3300049576 Ga0501040_0167790 Ga0501040_0167790_791_1123 109
725 3300049576 Ga0501040_0523547 Ga0501040_0523547_214_546 109
726 3300049577 Ga0501041_0086437 Ga0501041_0086437_1044_1376 109
727 3300049577 Ga0501041_0969256 Ga0501041_0969256_193_531 109
728 3300049578 Ga0501042_0072129 Ga0501042_0072129_1909_2238 109
729 3300049578 Ga0501042_0097051 Ga0501042_0097051_874_1206 109
730 3300049578 Ga0501042_0168740 Ga0501042_0168740_521_853 109
731 3300049578 Ga0501042_0365726 Ga0501042_0365726_525_863 109
732 3300049578 Ga0501042_0904361 Ga0501042_0904361_115_459 109
733 3300049579 Ga0501043_0082488 Ga0501043_0082488_93_425 109
734 3300049579 Ga0501043_0613251 Ga0501043_0613251_365_703 109
735 3300049580 Ga0501046_0108044 Ga0501046_0108044_1555_1887 109
736 3300049580 Ga0501046_0136611 Ga0501046_0136611_168_506 109
737 3300049581 Ga0501047_0172522 Ga0501047_0172522_1033_1371 109
738 3300049582 Ga0501048_0054602 Ga0501048_0054602_464_793 109
739 3300049582 Ga0501048_0144873 Ga0501048_0144873_1317_1649 109
740 3300049582 Ga0501048_0234973 Ga0501048_0234973_806_1144 109
741 3300049582 Ga0501048_0243093 Ga0501048_0243093_319_651 109
742 3300049583 Ga0501067_0016955 Ga0501067_0016955_419_757 109
743 3300049584 Ga0501068_0121080 Ga0501068_0121080_1032_1364 109
744 3300049584 Ga0501068_0467554 Ga0501068_0467554_20_358 109
745 3300049585 Ga0501069_0112830 Ga0501069_0112830_1139_1477 109
746 3300049585 Ga0501069_0272967 Ga0501069_0272967_321_653 109
747 3300049586 Ga0501070_0041065 Ga0501070_0041065_2417_2755 109
748 3300049586 Ga0501070_0129742 Ga0501070_0129742_151_483 109
749 3300049586 Ga0501070_0271165 Ga0501070_0271165_293_622 109
750 3300049587 Ga0501071_0117457 Ga0501071_0117457_1266_1598 109
751 3300049587 Ga0501071_0166028 Ga0501071_0166028_304_636 109
752 3300049587 Ga0501071_0483985 Ga0501071_0483985_232_564 109
753 3300049587 Ga0501071_1254694 Ga0501071_1254694_192_530 109
754 3300049588 Ga0501072_0105720 Ga0501072_0105720_34_366 109
755 3300049588 Ga0501072_0118318 Ga0501072_0118318_70_399 109
756 3300049589 Ga0501073_0220123 Ga0501073_0220123_168_506 109
757 3300049590 Ga0501074_0007373 Ga0501074_0007373_4362_4700 109
758 3300049590 Ga0501074_0113667 Ga0501074_0113667_376_720 109
759 3300049590 Ga0501074_0137770 Ga0501074_0137770_525_854 109
760 3300049590 Ga0501074_0150390 Ga0501074_0150390_784_1116 109
761 3300049591 Ga0501075_0014554 Ga0501075_0014554_1221_1550 109
762 3300049591 Ga0501075_0161931 Ga0501075_0161931_1243_1587 109
763 3300049591 Ga0501075_0614201 Ga0501075_0614201_264_596 109
764 3300049592 Ga0501076_0007256 Ga0501076_0007256_3624_3968 109
765 3300049592 Ga0501076_0175326 Ga0501076_0175326_398_727 109
766 3300049592 Ga0501076_0231154 Ga0501076_0231154_1158_1490 109
767 3300049592 Ga0501076_0977355 Ga0501076_0977355_349_681 109
768 3300049593 Ga0501077_0386231 Ga0501077_0386231_437_769 109
769 3300049741 Ga0501079_0027934 Ga0501079_0027934_3021_3365 109
770 3300049741 Ga0501079_0496974 Ga0501079_0496974_291_623 109
771 3300049742 Ga0501080_0034100 Ga0501080_0034100_4022_4366 109
772 3300049742 Ga0501080_0109437 Ga0501080_0109437_2167_2499 109
773 3300049742 Ga0501080_0113110 Ga0501080_0113110_98_436 109
774 3300049742 Ga0501080_0186053 Ga0501080_0186053_1044_1373 109
775 3300049743 Ga0501081_0034225 Ga0501081_0034225_1568_1900 109
776 3300049743 Ga0501081_0081757 Ga0501081_0081757_561_893 109
777 3300049743 Ga0501081_0120753 Ga0501081_0120753_1374_1703 109
778 3300049743 Ga0501081_0206238 Ga0501081_0206238_923_1255 109
779 3300049743 Ga0501081_0410723 Ga0501081_0410723_586_924 109
780 3300049744 Ga0501083_0071736 Ga0501083_0071736_1166_1504 109
781 3300049744 Ga0501083_0093175 Ga0501083_0093175_458_787 109
782 3300049744 Ga0501083_0189095 Ga0501083_0189095_784_1116 109
783 3300049744 Ga0501083_0206016 Ga0501083_0206016_32_370 109
784 3300049822 Ga0501035_0253567 Ga0501035_0253567_982_1314 109
785 3300049824 Ga0501045_0009046 Ga0501045_0009046_5740_6069 109
786 3300049824 Ga0501045_0010366 Ga0501045_0010366_4197_4529 109
787 3300049824 Ga0501045_0070295 Ga0501045_0070295_1282_1614 109
788 3300049824 Ga0501045_0324274 Ga0501045_0324274_572_904 109
789 3300049824 Ga0501045_0675290 Ga0501045_0675290_98_430 109
790 3300049824 Ga0501045_0775796 Ga0501045_0775796_178_510 109
791 3300050489 nmdc:mga03683_15964_c1 nmdc:mga03683_15964_c1_2035_2415 109
792 3300050490 nmdc:mga03n38_68501_c1 nmdc:mga03n38_68501_c1_950_1330 109
793 3300050491 nmdc:mga00v17_139972_c1 nmdc:mga00v17_139972_c1_663_1043 109
794 3300050491 nmdc:mga00v17_169270_c1 nmdc:mga00v17_169270_c1_858_1193 109
795 3300050492 nmdc:mga0yw44_20189_c1 nmdc:mga0yw44_20189_c1_2389_2724 109
796 3300050492 nmdc:mga0yw44_547_c1 nmdc:mga0yw44_547_c1_8977_9309 109
797 3300050492 nmdc:mga0yw44_925302_c1 nmdc:mga0yw44_925302_c1_10_390 109
798 3300050493 nmdc:mga0k408_429986_c1 nmdc:mga0k408_429986_c1_179_559 109
799 3300050494 nmdc:mga06z11_261251_c1 nmdc:mga06z11_261251_c1_421_801 109
800 3300050494 nmdc:mga06z11_95534_c1 nmdc:mga06z11_95534_c1_776_1111 109
801 3300050495 nmdc:mga04h51_448451_c1 nmdc:mga04h51_448451_c1_11_346 109
802 3300050507 nmdc:mga05p37_1304921_c1 nmdc:mga05p37_1304921_c1_375_704 109
803 3300050507 nmdc:mga05p37_441578_c1 nmdc:mga05p37_441578_c1_504_836 109
804 3300050508 nmdc:mga09592_145331_c1 nmdc:mga09592_145331_c1_1095_1424 109
805 3300050509 nmdc:mga0qj67_308275_c1 nmdc:mga0qj67_308275_c1_232_564 109
806 3300050510 nmdc:mga06r32_219887_c1 nmdc:mga06r32_219887_c1_252_581 109
807 3300050510 nmdc:mga06r32_73600_c1 nmdc:mga06r32_73600_c1_559_891 109
808 3300050511 nmdc:mga08y16_1161108_c1 nmdc:mga08y16_1161108_c1_263_592 109
809 3300050511 nmdc:mga08y16_1905337_c1 nmdc:mga08y16_1905337_c1_115_444 109
810 3300050512 nmdc:mga0n895_427870_c1 nmdc:mga0n895_427870_c1_348_680 109
811 3300050512 nmdc:mga0n895_49893_c1 nmdc:mga0n895_49893_c1_1096_1425 109
812 3300050513 nmdc:mga0rr50_134099_c1 nmdc:mga0rr50_134099_c1_212_547 109
813 3300050513 nmdc:mga0rr50_47369_c1 nmdc:mga0rr50_47369_c1_1549_1878 109
814 3300050513 nmdc:mga0rr50_96219_c1 nmdc:mga0rr50_96219_c1_1647_1979 109
815 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_357237_357572 109
816 3300050514 nmdc:mga08x19_27763_c1 nmdc:mga08x19_27763_c1_791_1120 109
817 3300050515 nmdc:mga0a205_170480_c1 nmdc:mga0a205_170480_c1_847_1176 109
818 3300053083 Ga0495655_0001031 Ga0495655_0001031_2620_2952 109
819 3300053085 Ga0495619_0003279 Ga0495619_0003279_5109_5441 109
820 3300053087 Ga0500643_018592 Ga0500643_018592_929_1336 109
821 3300053088 Ga0500644_0024700 Ga0500644_0024700_34_441 109
822 3300053090 Ga0500646_0003069 Ga0500646_0003069_665_1072 109
823 3300053090 Ga0500646_0016337 Ga0500646_0016337_725_1072 109
824 3300053092 Ga0500583_0122296 Ga0500583_0122296_265_672 109
825 3300053098 Ga0500650_0234769 Ga0500650_0234769_182_589 109
826 3300053108 Ga0500562_022493 Ga0500562_022493_752_1159 109
827 3300053118 Ga0500594_0025695 Ga0500594_0025695_483_851 109
828 3300053118 Ga0500594_0141893 Ga0500594_0141893_236_643 109
829 3300053123 Ga0500614_170082 Ga0500614_170082_20_403 109
830 3300053123 Ga0500614_261551 Ga0500614_261551_185_517 109
831 3300053130 Ga0500642_0227476 Ga0500642_0227476_466_798 109
832 3300053130 Ga0500642_0355745 Ga0500642_0355745_157_522 109
833 3300053134 Ga0500658_0049180 Ga0500658_0049180_202_609 109
834 3300053139 Ga0500568_0000059 Ga0500568_0000059_83729_84061 109
835 3300053139 Ga0500568_0225875 Ga0500568_0225875_237_644 109
836 3300053142 Ga0500577_0236977 Ga0500577_0236977_13_393 109
837 3300053146 Ga0500588_0209785 Ga0500588_0209785_34_441 109
838 3300053151 Ga0500604_0045189 Ga0500604_0045189_734_1141 109
839 3300053160 Ga0500633_0246841 Ga0500633_0246841_211_618 109
840 3300053727 Ga0500611_010983 Ga0500611_010983_614_1021 109
841 3300053731 Ga0500609_000984 Ga0500609_000984_1883_2290 109
842 3300053739 Ga0500587_064367 Ga0500587_064367_76_483 109
843 3300054114 Ga0501084_0046221 Ga0501084_0046221_2666_3004 109
844 3300054114 Ga0501084_0060586 Ga0501084_0060586_2802_3134 109
845 3300054114 Ga0501084_0083027 Ga0501084_0083027_2331_2660 109
846 3300054114 Ga0501084_0210098 Ga0501084_0210098_353_685 109
847 3300054114 Ga0501084_0320876 Ga0501084_0320876_166_504 109
848 3300054114 Ga0501084_0795499 Ga0501084_0795499_325_669 109
849 3300054114 Ga0501084_1422262 Ga0501084_1422262_114_449 109
850 3300059645 Ga0587076_180618 Ga0587076_180618_49_384 109
851 3300060353 Ga0501082_0064175 Ga0501082_0064175_334_678 109
852 3300060353 Ga0501082_0108225 Ga0501082_0108225_1733_2065 109
853 3300060353 Ga0501082_0206670 Ga0501082_0206670_508_837 109
854 3300060353 Ga0501082_0284411 Ga0501082_0284411_561_899 109
855 3300060353 Ga0501082_0437280 Ga0501082_0437280_463_795 109
856 3300060353 Ga0501082_0561493 Ga0501082_0561493_428_766 109
857 3300061734 Ga0530510_0046257 Ga0530510_0046257_1034_1366 109
858 3300061734 Ga0530510_0138527 Ga0530510_0138527_1150_1494 109
859 3300061734 Ga0530510_0142456 Ga0530510_0142456_605_934 109
860 3300061734 Ga0530510_0205656 Ga0530510_0205656_1003_1335 109
861 iso_pu_bacteria 2829745981 2829748695 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08755

YccV-like

Hemimethylated DNA-binding protein YccV like

32

126

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ycq-assembly1.cif.gz_A unique specificity-enhancing factor for the aaa+ lon protease 0.7828 6 91
1nz9-assembly1.cif.gz_A solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus 0.7574 8 78
8p4f-assembly1.cif.gz_Z structural insights into human co-transcriptional capping - structure 6 0.7444 6 79
2xhc-assembly1.cif.gz_A crystal structure of thermotoga maritima n-utilization substance g (nusg) 0.7393 7 78
7yta-assembly1.cif.gz_A crystal structure of ntagdp3 agd1-2 in complex with an h3k9me2 peptide 0.7273 6 78
ID Description Score Start End Superfamily
af_Q7YTU9_87_190_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8627 4 104 2.30.30.390
af_F1M5Q6_492_592_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8526 8 105 2.30.30.390
af_E9QDW7_114_220_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8478 8 105 2.30.30.390
af_Q7YTU9_87_190_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8324 4 104 2.30.30.390
af_F1M5Q6_492_592_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8048 8 105 2.30.30.390
ID Description Score Start End GO Terms
AF-A0A382NR55-F1-model_v4 Hemimethylated DNA-binding domain-containing protein 0.9948 5 70 GO:0003677
AF-A0A318TGI0-F1-model_v4 Heat shock protein HspQ 0.9885 5 71 GO:0003677
AF-A0A530N009-F1-model_v4 deleted 0.9868 5 76
AF-A0A192IKE5-F1-model_v4 deleted 0.9852 6 105
AF-A0A349QEL8-F1-model_v4 deleted 0.9851 5 105

Feature Viewer

pLDDT pTM Quality
86.48 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map