F483802

General Info

Members Datasets Scaffolds Average Seq Length
860 574 1720 189

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100128647|Ga0070686_1001286473
Length 225
Sequence MHLERWEIPGRPFLSGPSATLSALATGQHFYWRCAMTTYKVGYLIGSLAKQSINRKLAKALIRLAPETLKFTEISFSDLPLYSYDYDDDYPEVARTFKAAIKGSDAILFVTPEYNRSIPGGLKNAIDWASRPYGTNAFTRKPSAVIGTSPGPIGTALAQQSLRSVLSFCNSPQMNAVEAYIQFTPGMITDHGEITVESTEAFLRTYMKEFHDFIVRVRLALPPED

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
204 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
205 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
206 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
209 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
213 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
301 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
302 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
303 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
304 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
305 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
306 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
307 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
308 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
309 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
310 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
311 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
312 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
313 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
314 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
315 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
316 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
317 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
318 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
319 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
320 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
321 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
322 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
323 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
324 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
325 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
326 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
327 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
328 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
329 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
330 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
331 2718217882 Rhizobium sp. N741 Isolate Nodule
332 2718217927 Rhizobium sp. N324 Isolate Nodule
333 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
334 2718218009 Rhizobium sp. N561 Isolate Nodule
335 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
336 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
337 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
338 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
339 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
340 2718218363 Rhizobium sp. N113 Isolate Nodule
341 2718218366 Rhizobium sp. N621 Isolate Nodule
342 2718218423 Rhizobium sp. N941 Isolate Nodule
343 2721755514 Rhizobium sp. N6212 Isolate Nodule
344 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
345 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
346 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
347 2721755809 Rhizobium sp. N541 Isolate Nodule
348 2721755810 Rhizobium sp. N871 Isolate Nodule
349 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
350 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
351 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
352 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
353 2728369365 Rhizobium sp. N1341 Isolate Nodule
354 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
355 2738543024 Aminobacter sp. AP02 Isolate Unclassified
356 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
357 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
358 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
359 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
360 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
361 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
362 2791355256 Rhizobium sp. M10 Isolate Nodule
363 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
364 2791355262 Rhizobium sp. M1 Isolate Nodule
365 2791355264 Rhizobium sp. S9 Isolate Nodule
366 2791355265 Rhizobium sp. H4 Isolate Nodule
367 2791355267 Rhizobium sp. L18 Isolate Nodule
368 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
369 2802429633 Rhizobium anhuiense J3 Isolate Nodule
370 2802429634 Rhizobium anhuiense S10 Isolate Nodule
371 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
372 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
373 2802429637 Rhizobium anhuiense C15 Isolate Nodule
374 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
375 2838048938 Rhizobium pisi 27/80 Isolate Nodule
376 2838061910 Rhizobium phaseoli L15 Isolate Nodule
377 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
378 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
379 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
380 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
381 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
382 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
383 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
384 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
385 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
386 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
387 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
388 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
389 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
390 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
391 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
392 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
393 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
394 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
395 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
396 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
397 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
398 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
399 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
400 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
401 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
402 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
403 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
404 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
405 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
406 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
407 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
408 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
409 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
410 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
411 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
412 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
413 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
414 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
415 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
416 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
417 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
418 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
419 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
420 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
421 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
422 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
423 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
424 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
425 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
426 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
427 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
428 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
429 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
430 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
431 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
432 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
433 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
434 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
435 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
436 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
437 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
438 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
439 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
440 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
441 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
442 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
443 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
444 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
445 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
446 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
447 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
448 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
449 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
450 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
451 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
452 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
453 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
454 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
455 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
456 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
457 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
458 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
459 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
460 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
461 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
462 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
463 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
464 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
465 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
466 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
467 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
468 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
469 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
470 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
471 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
472 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
473 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
474 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
475 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
476 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
477 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
478 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
479 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
480 2933599457 Rhizobium phaseoli M3 Isolate Nodule
481 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
482 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
483 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
484 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
485 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
486 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
487 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
488 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
489 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
490 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
491 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
492 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
493 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
494 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
495 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
496 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
497 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
498 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
499 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
500 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
501 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
502 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
503 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
504 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
505 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
506 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
507 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
508 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
509 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
510 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
511 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
512 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
513 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
514 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
515 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
516 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
517 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
518 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
519 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
520 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
521 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
522 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
523 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
524 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
525 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
526 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
527 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
528 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
529 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
530 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
531 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
532 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
533 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
534 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
535 2996893221 Rhizobium sp. R635 Isolate Nodule
536 3004167301 Mesorhizobium loti 582 Isolate Unclassified
537 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
538 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
539 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
540 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
541 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
542 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
543 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
544 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
545 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
546 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
547 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
548 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
549 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
550 8005275841 Rhizobium sp. N4311 Isolate Nodule
551 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
552 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
553 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
554 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
555 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
556 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
557 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
558 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
559 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
560 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
561 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
562 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
563 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
564 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
565 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
566 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
567 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
568 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
569 8018176218 Rhizobium sp. N122 Isolate Nodule
570 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
571 8024501048 Rhizobium sp. H4 Isolate Nodule
572 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
573 8056382006 Rhizobium croatiense 13T Isolate Nodule
574 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.98
Metatranscriptomes 0.47
Isolates 32.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.84
Nodule 29.07
Rhizoplane 1.51
Rhizosphere 56.51
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100128647 3300005544 Bacteria 1748
2 SwRhRL2b_contig_592195 2162886007 Bacteria 4193
3 JGI25152J39213_1024530 3300002773 Bacteria 1011
4 JGI25151J46595_10001427 3300003187 Bacteria 16288
5 JGI25165J46597_1000219 3300003214 Bacteria 79946
6 JGI25153J46596_10002705 3300003215 Bacteria 10107
7 JGI25153J46596_10010575 3300003215 Bacteria 4160
8 JGI25160J50197_1008499 3300003354 Bacteria 3907
9 JGI25407J50210_10120086 3300003373 Bacteria 647
10 JGI25161J50226_1005999 3300003374 Bacteria 2259
11 Ga0055526_1001668 3300003771 Bacteria 15563
12 Ga0055524_1001184 3300003775 Bacteria 15563
13 Ga0055524_1049701 3300003775 Bacteria 964
14 Ga0055528_1000187 3300003790 Bacteria 52646
15 Ga0055528_1001313 3300003790 Bacteria 15563
16 Ga0055528_1016373 3300003790 Bacteria 2626
17 Ga0055528_1025590 3300003790 Bacteria 1726
18 Ga0055540_1000368 3300003792 Bacteria 37939
19 Ga0055540_1019281 3300003792 Bacteria 1840
20 Ga0055540_1053660 3300003792 Bacteria 824
21 Ga0055543_1002022 3300004625 Bacteria 7152
22 Ga0065165_1021977 3300005262 Bacteria 2201
23 Ga0065712_10181587 3300005290 Bacteria 1150
24 Ga0070658_10025900 3300005327 Bacteria 4704
25 Ga0070658_10418695 3300005327 Bacteria 1152
26 Ga0070658_10551572 3300005327 Bacteria 997
27 Ga0070676_10002377 3300005328 Bacteria 9630
28 Ga0070683_100053441 3300005329 Bacteria 3743
29 Ga0070690_100213502 3300005330 Bacteria 1349
30 Ga0070670_100063188 3300005331 Bacteria 3178
31 Ga0070670_100297550 3300005331 Bacteria 1411
32 Ga0070670_100723953 3300005331 Bacteria 896
33 Ga0070670_100847092 3300005331 Bacteria 827
34 Ga0068869_100163719 3300005334 Bacteria 1733
35 Ga0068869_100284206 3300005334 Bacteria 1331
36 Ga0070680_100002784 3300005336 Bacteria 12979
37 Ga0070680_100382463 3300005336 Bacteria 1198
38 Ga0070682_101022240 3300005337 Bacteria 687
39 Ga0068868_100294000 3300005338 Bacteria 1378
40 Ga0070660_100001232 3300005339 Bacteria 17375
41 Ga0070660_100077939 3300005339 Bacteria 2598
42 Ga0070660_100106556 3300005339 Bacteria 2226
43 Ga0070689_100526590 3300005340 Bacteria 1015
44 Ga0070691_10000681 3300005341 Bacteria 13246
45 Ga0070661_100001528 3300005344 Bacteria 16112
46 Ga0070661_100223118 3300005344 Bacteria 1446
47 Ga0070661_100482251 3300005344 Bacteria 990
48 Ga0070692_10000839 3300005345 Bacteria 10317
49 Ga0070692_10043089 3300005345 Bacteria 2320
50 Ga0070692_10423626 3300005345 Bacteria 846
51 Ga0070668_100000298 3300005347 Bacteria 32492
52 Ga0070668_100061191 3300005347 Bacteria 2916
53 Ga0070668_100087698 3300005347 Bacteria 2449
54 Ga0070668_100314009 3300005347 Bacteria 1318
55 Ga0070669_100004356 3300005353 Bacteria 10216
56 Ga0070669_100047209 3300005353 Bacteria 3141
57 Ga0070669_100082014 3300005353 Bacteria 2404
58 Ga0070669_100101718 3300005353 Bacteria 2169
59 Ga0070675_100022444 3300005354 Bacteria 5044
60 Ga0070675_100044840 3300005354 Bacteria 3617
61 Ga0070675_100228029 3300005354 Bacteria 1624
62 Ga0070675_100509389 3300005354 Bacteria 1085
63 Ga0070671_100629804 3300005355 Bacteria 928
64 Ga0070674_100514824 3300005356 Bacteria 999
65 Ga0070674_100661046 3300005356 Bacteria 889
66 Ga0070673_100170676 3300005364 Bacteria 1856
67 Ga0070673_100399682 3300005364 Bacteria 1228
68 Ga0070688_100328108 3300005365 Unclassified 1114
69 Ga0070659_100002114 3300005366 Bacteria 14152
70 Ga0070659_100007184 3300005366 Bacteria 8081
71 Ga0070667_100112328 3300005367 Bacteria 2363
72 Ga0070667_100202897 3300005367 Bacteria 1760
73 Ga0070667_100213417 3300005367 Bacteria 1716
74 Ga0070667_100280684 3300005367 Unclassified 1495
75 Ga0070667_100347734 3300005367 Bacteria 1342
76 Ga0070714_100082784 3300005435 Bacteria 2797
77 Ga0070714_100177954 3300005435 Bacteria 1934
78 Ga0070714_101294174 3300005435 Bacteria 712
79 Ga0070713_100309608 3300005436 Bacteria 1456
80 Ga0070700_100200104 3300005441 Bacteria 1403
81 Ga0070700_100756941 3300005441 Bacteria 778
82 Ga0070694_100739985 3300005444 Bacteria 802
83 Ga0070663_100000850 3300005455 Bacteria 16533
84 Ga0070663_100382270 3300005455 Bacteria 1147
85 Ga0070678_100554024 3300005456 Bacteria 1021
86 Ga0070662_100001567 3300005457 Bacteria 14137
87 Ga0070662_100051627 3300005457 Bacteria 2970
88 Ga0070662_100086458 3300005457 Bacteria 2345
89 Ga0070662_100274445 3300005457 Bacteria 1362
90 Ga0070662_100698712 3300005457 Bacteria 858
91 Ga0070662_100792572 3300005457 Bacteria 805
92 Ga0070681_10042370 3300005458 Bacteria 4562
93 Ga0070681_10080111 3300005458 Bacteria 3222
94 Ga0070681_10105093 3300005458 Bacteria 2766
95 Ga0070681_11016938 3300005458 Bacteria 749
96 Ga0068867_100169724 3300005459 Bacteria 1727
97 Ga0070679_100021107 3300005530 Bacteria 6355
98 Ga0070679_100307767 3300005530 Bacteria 1535
99 Ga0070684_100004714 3300005535 Bacteria 10416
100 Ga0068853_100001983 3300005539 Bacteria 15099
101 Ga0070696_100000540 3300005546 Bacteria 24036
102 Ga0070696_100017290 3300005546 Bacteria 4868
103 Ga0070696_100200909 3300005546 Bacteria 1488
104 Ga0070696_100204384 3300005546 Bacteria 1476
105 Ga0070696_100386627 3300005546 Bacteria 1092
106 Ga0070693_100032071 3300005547 Bacteria 2885
107 Ga0070665_100086262 3300005548 Bacteria 3145
108 Ga0070665_100314085 3300005548 Bacteria 1571
109 Ga0070665_100435695 3300005548 Bacteria 1320
110 Ga0070704_101034513 3300005549 Bacteria 744
111 Ga0068855_100030935 3300005563 Bacteria 6397
112 Ga0068855_100046662 3300005563 Bacteria 5120
113 Ga0068855_101242460 3300005563 Unclassified 773
114 Ga0070664_100007090 3300005564 Bacteria 9043
115 Ga0070664_100014927 3300005564 Bacteria 6337
116 Ga0070664_100133056 3300005564 Bacteria 2185
117 Ga0068857_100043204 3300005577 Bacteria 3998
118 Ga0068857_100051205 3300005577 Bacteria 3662
119 Ga0068854_100333192 3300005578 Bacteria 1237
120 Ga0068856_100006182 3300005614 Bacteria 11751
121 Ga0068856_100155844 3300005614 Bacteria 2294
122 Ga0068852_100009249 3300005616 Bacteria 7300
123 Ga0068852_100544815 3300005616 Bacteria 1160
124 Ga0068852_101070280 3300005616 Bacteria 826
125 Ga0068859_101003682 3300005617 Bacteria 917
126 Ga0068864_100020967 3300005618 Bacteria 5473
127 Ga0068864_100262110 3300005618 Bacteria 1608
128 Ga0068866_10210387 3300005718 Bacteria 1167
129 Ga0068861_100000129 3300005719 Bacteria 38855
130 Ga0068861_100002725 3300005719 Bacteria 11576
131 Ga0068851_10034611 3300005834 Bacteria 2522
132 Ga0068870_10207398 3300005840 Bacteria 1192
133 Ga0068863_100072720 3300005841 Bacteria 3253
134 Ga0068863_100370810 3300005841 Bacteria 1397
135 Ga0068863_100444300 3300005841 Bacteria 1272
136 Ga0068863_100709479 3300005841 Bacteria 1000
137 Ga0068858_100222793 3300005842 Bacteria 1787
138 Ga0068858_100224231 3300005842 Bacteria 1781
139 Ga0068860_100098471 3300005843 Bacteria 2789
140 Ga0068862_100000218 3300005844 Bacteria 63913
141 Ga0068862_100526044 3300005844 Bacteria 1126
142 Ga0068862_100699555 3300005844 Bacteria 982
143 Ga0068862_101034672 3300005844 Bacteria 813
144 Ga0068862_101304800 3300005844 Bacteria 727
145 Ga0081538_10021013 3300005981 Bacteria 4785
146 Ga0075365_10005980 3300006038 Bacteria 6639
147 Ga0075365_10038039 3300006038 Bacteria 3125
148 Ga0075368_10016556 3300006042 Bacteria 2749
149 Ga0075368_10093701 3300006042 Bacteria 1230
150 Ga0075363_100072666 3300006048 Bacteria 1871
151 Ga0075363_100095869 3300006048 Bacteria 1637
152 Ga0075362_10002515 3300006177 Bacteria 6173
153 Ga0075367_10033179 3300006178 Bacteria 2974
154 Ga0075367_10076961 3300006178 Bacteria 2014
155 Ga0075367_10211565 3300006178 Bacteria 1212
156 Ga0075367_10399083 3300006178 Bacteria 870
157 Ga0075369_10003580 3300006186 Bacteria 5661
158 Ga0075369_10019518 3300006186 Bacteria 2768
159 Ga0075366_10010354 3300006195 Bacteria 5235
160 Ga0075366_10068147 3300006195 Bacteria 2118
161 Ga0075366_10100445 3300006195 Bacteria 1736
162 Ga0097621_100438271 3300006237 Bacteria 1175
163 Ga0075370_10021922 3300006353 Bacteria 3503
164 Ga0075428_100022338 3300006844 Bacteria 7004
165 Ga0075428_100057286 3300006844 Bacteria 4266
166 Ga0075428_100062789 3300006844 Bacteria 4066
167 Ga0075428_100448077 3300006844 Bacteria 1383
168 Ga0075430_100010466 3300006846 Bacteria 7854
169 Ga0075430_100027930 3300006846 Bacteria 4793
170 Ga0075430_100685392 3300006846 Bacteria 845
171 Ga0075431_100004757 3300006847 Bacteria 13350
172 Ga0075431_100009489 3300006847 Bacteria 9770
173 Ga0075431_100174829 3300006847 Bacteria 2206
174 Ga0075431_100183845 3300006847 Bacteria 2144
175 Ga0075431_100203803 3300006847 Bacteria 2023
176 Ga0075431_100252312 3300006847 Bacteria 1792
177 Ga0075431_100505316 3300006847 Bacteria 1199
178 Ga0075434_100541899 3300006871 Bacteria 1184
179 Ga0075429_100002889 3300006880 Bacteria 14559
180 Ga0075429_100009609 3300006880 Bacteria 8388
181 Ga0075429_100131104 3300006880 Bacteria 2193
182 Ga0068865_100356276 3300006881 Bacteria 1187
183 Ga0097620_101003537 3300006931 Bacteria 917
184 Ga0105240_10027910 3300009093 Bacteria 7384
185 Ga0105240_10083841 3300009093 Bacteria 3910
186 Ga0105240_10091395 3300009093 Bacteria 3718
187 Ga0105240_10475838 3300009093 Bacteria 1393
188 Ga0105240_10750900 3300009093 Bacteria 1061
189 Ga0111539_10000435 3300009094 Bacteria 52742
190 Ga0111539_10001318 3300009094 Bacteria 33146
191 Ga0111539_10022301 3300009094 Bacteria 7782
192 Ga0111539_10028074 3300009094 Bacteria 6870
193 Ga0111539_10037062 3300009094 Bacteria 5892
194 Ga0111539_10227988 3300009094 Bacteria 2170
195 Ga0111539_10617230 3300009094 Bacteria 1263
196 Ga0111539_10960664 3300009094 Bacteria 994
197 Ga0105245_11854251 3300009098 Bacteria 656
198 Ga0114129_10026544 3300009147 Bacteria 8202
199 Ga0114129_10212505 3300009147 Bacteria 2614
200 Ga0114129_10570840 3300009147 Bacteria 1469
201 Ga0105243_10151303 3300009148 Bacteria 1991
202 Ga0105243_10338858 3300009148 Bacteria 1377
203 Ga0105248_10093275 3300009177 Unclassified 3390
204 Ga0105248_10203928 3300009177 Bacteria 2228
205 Ga0105248_10379725 3300009177 Bacteria 1591
206 Ga0105248_11058106 3300009177 Bacteria 917
207 Ga0105237_10311908 3300009545 Bacteria 1576
208 Ga0105238_10061513 3300009551 Bacteria 3757
209 Ga0105238_10442449 3300009551 Bacteria 1296
210 Ga0105238_10780856 3300009551 Bacteria 970
211 Ga0105249_10033487 3300009553 Bacteria 4652
212 Ga0105249_10670247 3300009553 Bacteria 1096
213 Ga0105249_10873051 3300009553 Bacteria 966
214 Ga0105249_11277103 3300009553 Bacteria 806
215 Ga0105249_11312688 3300009553 Bacteria 795
216 Ga0123341_1031173 3300009765 Bacteria 3979
217 Ga0105239_10012339 3300010375 Bacteria 9516
218 Ga0105239_10989612 3300010375 Bacteria 967
219 Ga0105246_10222745 3300011119 Bacteria 1480
220 Ga0105246_10402088 3300011119 Bacteria 1138
221 Ga0105246_10942608 3300011119 Bacteria 777
222 Ga0157322_1000447 3300012490 Bacteria 1527
223 Ga0157373_10004455 3300013100 Bacteria 10538
224 Ga0157371_10127004 3300013102 Bacteria 1814
225 Ga0157371_10151606 3300013102 Bacteria 1654
226 Ga0157370_10001370 3300013104 Bacteria 30160
227 Ga0157370_10007301 3300013104 Bacteria 12058
228 Ga0157370_10035249 3300013104 Bacteria 4866
229 Ga0157370_10055494 3300013104 Bacteria 3773
230 Ga0157370_10370139 3300013104 Bacteria 1320
231 Ga0157370_10393468 3300013104 Bacteria 1276
232 Ga0157369_10099975 3300013105 Bacteria 3092
233 Ga0157369_10143758 3300013105 Bacteria 2523
234 Ga0157369_10812350 3300013105 Bacteria 960
235 Ga0157374_10013094 3300013296 Bacteria 7234
236 Ga0157374_10146372 3300013296 Bacteria 2295
237 Ga0157374_10951467 3300013296 Bacteria 877
238 Ga0163162_10441705 3300013306 Bacteria 1433
239 Ga0163162_10840544 3300013306 Bacteria 1034
240 Ga0163162_11355161 3300013306 Unclassified 809
241 Ga0163162_11474569 3300013306 Bacteria 775
242 Ga0157372_10015585 3300013307 Bacteria 8150
243 Ga0157372_10053016 3300013307 Bacteria 4519
244 Ga0157372_10080705 3300013307 Bacteria 3681
245 Ga0157372_10483530 3300013307 Bacteria 1444
246 Ga0157372_10760235 3300013307 Bacteria 1127
247 Ga0157375_10220975 3300013308 Bacteria 2053
248 Ga0157380_10163826 3300014326 Bacteria 1935
249 Ga0157380_10340933 3300014326 Bacteria 1398
250 Ga0157380_10341512 3300014326 Bacteria 1397
251 Ga0157379_11040542 3300014968 Bacteria 782
252 Ga0163161_10197528 3300017792 Bacteria 1549
253 Ga0207425_1001421 3300025245 Bacteria 10044
254 Ga0209129_1000484 3300025258 Bacteria 29054
255 Ga0209129_1022630 3300025258 Bacteria 1133
256 Ga0209233_1000258 3300025261 Bacteria 80118
257 Ga0209673_1000022 3300025273 Bacteria 413125
258 Ga0209673_1000105 3300025273 Bacteria 186267
259 Ga0209673_1000248 3300025273 Bacteria 102571
260 Ga0209673_1001831 3300025273 Bacteria 17401
261 Ga0209673_1020509 3300025273 Bacteria 2338
262 Ga0209025_1000841 3300025294 Bacteria 48653
263 Ga0209564_1000163 3300025295 Bacteria 162077
264 Ga0209564_1001320 3300025295 Bacteria 26550
265 Ga0209564_1032506 3300025295 Bacteria 1570
266 Ga0209758_1000844 3300025297 Bacteria 42741
267 Ga0209758_1003738 3300025297 Bacteria 13477
268 Ga0209050_1008993 3300025298 Bacteria 5204
269 Ga0209256_1000281 3300025299 Bacteria 89636
270 Ga0209256_1000551 3300025299 Bacteria 53825
271 Ga0207426_1000109 3300025302 Bacteria 238665
272 Ga0209051_1000027 3300025303 Bacteria 412172
273 Ga0209051_1001011 3300025303 Bacteria 26986
274 Ga0209051_1009468 3300025303 Bacteria 5018
275 Ga0207656_10059387 3300025321 Bacteria 1673
276 Ga0207682_10249799 3300025893 Bacteria 825
277 Ga0207647_10005171 3300025904 Bacteria 9598
278 Ga0207645_10036297 3300025907 Bacteria 3165
279 Ga0207645_10079997 3300025907 Bacteria 2095
280 Ga0207643_10045892 3300025908 Bacteria 2469
281 Ga0207643_10383181 3300025908 Bacteria 887
282 Ga0207705_10002814 3300025909 Bacteria 13300
283 Ga0207705_10134043 3300025909 Bacteria 1845
284 Ga0207654_10260818 3300025911 Bacteria 1165
285 Ga0207707_10135242 3300025912 Bacteria 2155
286 Ga0207707_10233019 3300025912 Bacteria 1602
287 Ga0207707_10282018 3300025912 Bacteria 1439
288 Ga0207695_10049216 3300025913 Bacteria 4445
289 Ga0207695_10702585 3300025913 Bacteria 892
290 Ga0207671_10434423 3300025914 Bacteria 1045
291 Ga0207660_10276713 3300025917 Bacteria 1331
292 Ga0207660_10341582 3300025917 Bacteria 1198
293 Ga0207662_10311132 3300025918 Bacteria 1049
294 Ga0207657_10003267 3300025919 Bacteria 17353
295 Ga0207657_10006281 3300025919 Bacteria 12350
296 Ga0207657_10047751 3300025919 Bacteria 3741
297 Ga0207657_10075982 3300025919 Bacteria 2835
298 Ga0207657_10083205 3300025919 Bacteria 2685
299 Ga0207657_10723271 3300025919 Bacteria 772
300 Ga0207657_10770810 3300025919 Bacteria 745
301 Ga0207649_10070130 3300025920 Bacteria 2234
302 Ga0207652_10469364 3300025921 Bacteria 1134
303 Ga0207652_11028311 3300025921 Bacteria 723
304 Ga0207681_10003227 3300025923 Bacteria 10229
305 Ga0207681_10025651 3300025923 Bacteria 3794
306 Ga0207681_10083514 3300025923 Bacteria 2261
307 Ga0207681_10401343 3300025923 Bacteria 1107
308 Ga0207694_10582417 3300025924 Bacteria 940
309 Ga0207650_10264760 3300025925 Bacteria 1395
310 Ga0207659_10006018 3300025926 Bacteria 7401
311 Ga0207659_10169050 3300025926 Bacteria 1723
312 Ga0207659_10198983 3300025926 Bacteria 1599
313 Ga0207687_11020089 3300025927 Bacteria 710
314 Ga0207700_10428149 3300025928 Bacteria 1163
315 Ga0207644_10209941 3300025931 Unclassified 1539
316 Ga0207690_10002285 3300025932 Bacteria 11688
317 Ga0207690_10098129 3300025932 Bacteria 2086
318 Ga0207690_10535154 3300025932 Bacteria 951
319 Ga0207690_10652214 3300025932 Bacteria 862
320 Ga0207706_10001707 3300025933 Bacteria 21650
321 Ga0207706_10061896 3300025933 Bacteria 3296
322 Ga0207706_10087259 3300025933 Bacteria 2743
323 Ga0207706_10616348 3300025933 Bacteria 931
324 Ga0207686_10083794 3300025934 Bacteria 2087
325 Ga0207709_10094416 3300025935 Bacteria 1963
326 Ga0207709_10433189 3300025935 Bacteria 1012
327 Ga0207670_10229594 3300025936 Bacteria 1425
328 Ga0207669_10486176 3300025937 Bacteria 985
329 Ga0207691_10166099 3300025940 Bacteria 1934
330 Ga0207691_10438972 3300025940 Bacteria 1111
331 Ga0207689_10247438 3300025942 Bacteria 1474
332 Ga0207661_10014877 3300025944 Bacteria 5708
333 Ga0207679_10007246 3300025945 Bacteria 7031
334 Ga0207679_10010454 3300025945 Bacteria 5976
335 Ga0207679_10149440 3300025945 Bacteria 1899
336 Ga0207667_10005252 3300025949 Bacteria 15801
337 Ga0207667_10042605 3300025949 Bacteria 4824
338 Ga0207667_10101259 3300025949 Bacteria 2972
339 Ga0207667_10678328 3300025949 Bacteria 1034
340 Ga0207667_10922757 3300025949 Bacteria 864
341 Ga0207712_10544933 3300025961 Bacteria 997
342 Ga0207712_10706047 3300025961 Bacteria 880
343 Ga0207712_10898432 3300025961 Bacteria 783
344 Ga0207668_10002278 3300025972 Bacteria 11199
345 Ga0207640_10061902 3300025981 Bacteria 2481
346 Ga0207658_11498295 3300025986 Bacteria 617
347 Ga0207703_10499024 3300026035 Bacteria 1142
348 Ga0207639_10023071 3300026041 Bacteria 4489
349 Ga0207639_10186197 3300026041 Bacteria 1770
350 Ga0207639_10454117 3300026041 Bacteria 1164
351 Ga0207678_10002168 3300026067 Bacteria 17748
352 Ga0207678_10347892 3300026067 Bacteria 1278
353 Ga0207708_10166477 3300026075 Bacteria 1743
354 Ga0207702_10015552 3300026078 Bacteria 6298
355 Ga0207641_10569390 3300026088 Bacteria 1106
356 Ga0207648_10077349 3300026089 Bacteria 2900
357 Ga0207676_10018821 3300026095 Bacteria 5028
358 Ga0207674_10057186 3300026116 Bacteria 3954
359 Ga0207674_10127275 3300026116 Bacteria 2512
360 Ga0207675_100000114 3300026118 Bacteria 65080
361 Ga0207683_10557292 3300026121 Bacteria 1060
362 Ga0207698_10143218 3300026142 Bacteria 2063
363 Ga0207698_10883163 3300026142 Bacteria 900
364 Ga0207698_11318689 3300026142 Bacteria 736
365 Ga0210000_1008357 3300027462 Bacteria 1518
366 Ga0209999_1011694 3300027543 Bacteria 1589
367 Ga0209983_1004019 3300027665 Bacteria 3108
368 Ga0209971_1024256 3300027682 Bacteria 1448
369 Ga0209971_1029907 3300027682 Bacteria 1304
370 Ga0209966_1006990 3300027695 Bacteria 1972
371 Ga0209998_10073780 3300027717 Bacteria 818
372 Ga0209974_10012192 3300027876 Bacteria 2877
373 Ga0209974_10110043 3300027876 Bacteria 969
374 Ga0207428_10006737 3300027907 Bacteria 10544
375 Ga0207428_10010289 3300027907 Bacteria 8361
376 Ga0207428_10010362 3300027907 Bacteria 8332
377 Ga0207428_10045459 3300027907 Bacteria 3536
378 Ga0207428_10046176 3300027907 Unclassified 3503
379 Ga0207428_10085485 3300027907 Bacteria 2456
380 Ga0268266_10114583 3300028379 Bacteria 2392
381 Ga0268266_10303115 3300028379 Bacteria 1491
382 Ga0268265_10001884 3300028380 Bacteria 16677
383 Ga0268265_10050021 3300028380 Bacteria 3147
384 Ga0268265_10571719 3300028380 Bacteria 1076
385 Ga0307408_100102478 3300031548 Bacteria 2183
386 Ga0307408_100137205 3300031548 Bacteria 1915
387 Ga0307408_101332203 3300031548 Bacteria 674
388 Ga0307405_10014107 3300031731 Bacteria 4286
389 Ga0307405_11071953 3300031731 Bacteria 691
390 Ga0307413_10090617 3300031824 Bacteria 1990
391 Ga0307413_10411116 3300031824 Bacteria 1063
392 Ga0307413_10422426 3300031824 Bacteria 1050
393 Ga0307413_10562668 3300031824 Bacteria 927
394 Ga0307410_10023881 3300031852 Bacteria 3811
395 Ga0307410_10031545 3300031852 Bacteria 3402
396 Ga0307410_10103522 3300031852 Bacteria 2045
397 Ga0307410_10555473 3300031852 Bacteria 952
398 Ga0307410_10562121 3300031852 Bacteria 947
399 Ga0307410_10814143 3300031852 Bacteria 795
400 Ga0307406_10276012 3300031901 Bacteria 1279
401 Ga0307406_10389220 3300031901 Bacteria 1102
402 Ga0307407_10016022 3300031903 Bacteria 3723
403 Ga0307407_10349742 3300031903 Bacteria 1046
404 Ga0307409_100148118 3300031995 Bacteria 2033
405 Ga0307409_100296826 3300031995 Bacteria 1501
406 Ga0307409_101308104 3300031995 Bacteria 750
407 Ga0307416_100002216 3300032002 Bacteria 11062
408 Ga0307416_100086854 3300032002 Bacteria 2668
409 Ga0307416_100304200 3300032002 Bacteria 1587
410 Ga0307414_10039059 3300032004 Bacteria 3194
411 Ga0307414_10187719 3300032004 Bacteria 1669
412 Ga0307414_10359300 3300032004 Bacteria 1253
413 Ga0307414_11321718 3300032004 Bacteria 669
414 Ga0307411_10247499 3300032005 Bacteria 1400
415 Ga0307411_11149894 3300032005 Bacteria 702
416 Ga0307415_100000104 3300032126 Bacteria 35540
417 Ga0395899_0185945 3300037312 Bacteria 1456
418 Ga0395900_0008833 3300037418 Bacteria 10350
419 Ga0395900_0255497 3300037418 Bacteria 1752
420 Ga0395900_0516387 3300037418 Bacteria 1143
421 Ga0395900_0830190 3300037418 Bacteria 851
422 Ga0395898_0021333 3300037466 Bacteria 6570
423 Ga0395898_0085384 3300037466 Bacteria 3042
424 Ga0395905_0007436 3300037471 Bacteria 10891
425 Ga0395905_0039663 3300037471 Bacteria 4418
426 Ga0395905_0213755 3300037471 Bacteria 1806
427 Ga0395905_1042862 3300037471 Bacteria 721
428 Ga0395901_0010917 3300038443 Bacteria 9205
429 Ga0395901_0014654 3300038443 Bacteria 7968
430 Ga0395901_0440445 3300038443 Bacteria 1334
431 Ga0395901_0953296 3300038443 Bacteria 837
432 Ga0439461_0008350 3300041410 Bacteria 1852
433 Ga0451807_0112694 3300041486 Bacteria 737
434 Ga0451837_1615948 3300041494 Bacteria 1140
435 Ga0451839_1163093 3300041496 Bacteria 904
436 Ga0451847_0100678 3300041503 Bacteria 1272
437 Ga0451849_1258375 3300041505 Bacteria 1730
438 Ga0451851_0919440 3300041507 Bacteria 1461
439 Ga0451855_0413049 3300041511 Bacteria 1893
440 Ga0451853_2339943 3300041512 Bacteria 788
441 Ga0439431_0038209 3300041997 Bacteria 1214
442 Ga0439433_0027373 3300041999 Bacteria 1293
443 Ga0439445_0139682 3300042004 Bacteria 702
444 Ga0439448_0031645 3300042005 Bacteria 1681
445 Ga0450896_006390 3300042133 Bacteria 1616
446 Ga0450896_050069 3300042133 Bacteria 664
447 Ga0450906_016675 3300042145 Bacteria 1328
448 Ga0439446_0014440 3300042156 Bacteria 2180
449 Ga0439434_0000760 3300042435 Bacteria 9271
450 Ga0439434_0126839 3300042435 Bacteria 835
451 Ga0439444_0000555 3300042437 Bacteria 4256
452 Ga0439464_0068407 3300042439 Bacteria 1048
453 Ga0439460_0007545 3300042461 Bacteria 2725
454 Ga0451577_0990299 3300042876 Bacteria 755
455 Ga0466972_0031989 3300044658 Bacteria 2585
456 Ga0466972_0197467 3300044658 Bacteria 942
457 Ga0453684_0121138 3300044712 Bacteria 3158
458 Ga0466957_0693853 3300044842 Bacteria 718
459 Ga0466960_0011387 3300044901 Bacteria 3721
460 Ga0466967_0361490 3300045976 Bacteria 1407
461 Ga0495580_0541172 3300046472 Bacteria 774
462 Ga0495596_0056927 3300046500 Bacteria 1526
463 Ga0495607_0067970 3300046501 Bacteria 2000
464 Ga0495606_0025336 3300046507 Bacteria 4250
465 Ga0495618_0272785 3300046514 Bacteria 1057
466 Ga0495620_0033835 3300046515 Bacteria 2315
467 Ga0495631_0143059 3300046518 Bacteria 1027
468 Ga0495643_0030970 3300046522 Bacteria 2981
469 Ga0495663_0112155 3300046525 Bacteria 907
470 Ga0495609_0090975 3300046538 Bacteria 1327
471 Ga0495621_0205014 3300046539 Bacteria 794
472 Ga0495633_0188465 3300046558 Bacteria 948
473 Ga0495656_0200847 3300046615 Bacteria 989
474 Ga0495611_0241803 3300046648 Bacteria 838
475 Ga0495625_0054212 3300046660 Bacteria 2864
476 Ga0495670_0080922 3300046691 Bacteria 1655
477 Ga0495649_0274698 3300046694 Bacteria 862
478 Ga0495660_0055464 3300046810 Bacteria 2145
479 Ga0495636_0012351 3300047318 Bacteria 3381
480 Ga0495681_0058697 3300047470 Bacteria 1782
481 Ga0496100_0236371 3300048903 Bacteria 1347
482 Ga0496102_0030317 3300048905 Bacteria 4841
483 Ga0496105_0253353 3300048908 Bacteria 1426
484 Ga0496106_0455519 3300048909 Bacteria 1028
485 Ga0496109_0863509 3300048912 Bacteria 843
486 Ga0496110_0276785 3300048913 Bacteria 1528
487 Ga0496110_0354308 3300048913 Bacteria 1337
488 Ga0496112_0075012 3300048915 Bacteria 3345
489 Ga0496113_0032278 3300048916 Bacteria 3806
490 Ga0496113_0822986 3300048916 Bacteria 737
491 Ga0496116_0385456 3300048919 Bacteria 627
492 Ga0496117_0194891 3300048920 Bacteria 1150
493 Ga0496119_0100660 3300048922 Bacteria 1623
494 Ga0496120_0001687 3300048923 Bacteria 25349
495 Ga0496125_0139901 3300048928 Bacteria 1685
496 Ga0496126_0075958 3300048929 Bacteria 2981
497 Ga0501031_0264498 3300049568 Bacteria 1117
498 Ga0501033_0024345 3300049570 Bacteria 4567
499 Ga0501033_0832858 3300049570 Bacteria 623
500 Ga0501034_0040989 3300049571 Bacteria 4685
501 Ga0501034_0238719 3300049571 Bacteria 1764
502 Ga0501034_0368456 3300049571 Bacteria 1363
503 Ga0501034_0526940 3300049571 Bacteria 1093
504 Ga0501038_0409960 3300049574 Bacteria 1047
505 Ga0501039_0184756 3300049575 Bacteria 1639
506 Ga0501041_0034163 3300049577 Bacteria 3078
507 Ga0501042_0042657 3300049578 Bacteria 3230
508 Ga0501043_0420908 3300049579 Bacteria 1007
509 Ga0501043_0686263 3300049579 Bacteria 749
510 Ga0501047_0012679 3300049581 Bacteria 7984
511 Ga0501047_0063112 3300049581 Bacteria 3574
512 Ga0501069_0071048 3300049585 Bacteria 1951
513 Ga0501070_0028516 3300049586 Bacteria 4683
514 Ga0501071_0078394 3300049587 Bacteria 2414
515 Ga0501071_0668099 3300049587 Bacteria 800
516 Ga0501072_0106547 3300049588 Bacteria 2229
517 Ga0501075_0049238 3300049591 Bacteria 3167
518 Ga0501257_007730 3300049686 Bacteria 2405
519 Ga0501079_0154125 3300049741 Bacteria 1791
520 Ga0501080_0242491 3300049742 Bacteria 1645
521 Ga0501080_0363885 3300049742 Bacteria 1305
522 Ga0501083_0200946 3300049744 Bacteria 1300
523 Ga0501035_0087765 3300049822 Bacteria 2741
524 Ga0501035_0348134 3300049822 Bacteria 1240
525 Ga0501044_0207025 3300049823 Bacteria 1918
526 Ga0501044_0281945 3300049823 Bacteria 1595
527 Ga0501044_0498630 3300049823 Bacteria 1119
528 nmdc:mga03683_126964_c1 3300050489 Bacteria 1138
529 nmdc:mga03683_14469_c1 3300050489 Bacteria 927
530 nmdc:mga03n38_138619_c1 3300050490 Bacteria 1213
531 nmdc:mga03n38_86060_c1 3300050490 Bacteria 1487
532 nmdc:mga0yw44_148304_c1 3300050492 Bacteria 1529
533 nmdc:mga0yw44_46669_c1 3300050492 Bacteria 2603
534 nmdc:mga0k408_166159_c1 3300050493 Bacteria 1315
535 nmdc:mga0k408_238124_c1 3300050493 Bacteria 1087
536 nmdc:mga0k408_396912_c1 3300050493 Bacteria 821
537 nmdc:mga06z11_15656_c1 3300050494 Bacteria 2684
538 nmdc:mga06z11_195842_c1 3300050494 Bacteria 1171
539 nmdc:mga04h51_195951_c1 3300050495 Bacteria 792
540 nmdc:mga07m45_42876_c1 3300050496 Bacteria 2537
541 nmdc:mga07m45_49297_c1 3300050496 Bacteria 2370
542 nmdc:mga05p37_25909_c1 3300050507 Bacteria 7130
543 nmdc:mga05p37_472221_c1 3300050507 Bacteria 1447
544 nmdc:mga05p37_520262_c1 3300050507 Bacteria 1361
545 nmdc:mga05p37_5879_c1 3300050507 Bacteria 14427
546 nmdc:mga05p37_638675_c1 3300050507 Bacteria 1194
547 nmdc:mga09592_1928_c1 3300050508 Bacteria 16677
548 nmdc:mga09592_3525_c1 3300050508 Bacteria 12643
549 nmdc:mga09592_87199_c1 3300050508 Bacteria 2664
550 nmdc:mga0qj67_118300_c1 3300050509 Bacteria 2142
551 nmdc:mga0qj67_590250_c1 3300050509 Bacteria 889
552 nmdc:mga0qj67_8543_c1 3300050509 Bacteria 7602
553 nmdc:mga06r32_13216_c1 3300050510 Bacteria 7477
554 nmdc:mga06r32_169031_c1 3300050510 Bacteria 2170
555 nmdc:mga06r32_171526_c1 3300050510 Bacteria 2153
556 nmdc:mga06r32_275375_c1 3300050510 Bacteria 1670
557 nmdc:mga06r32_51520_c1 3300050510 Bacteria 3940
558 nmdc:mga06r32_755945_c1 3300050510 Bacteria 935
559 nmdc:mga06r32_939_c1 3300050510 Bacteria 25941
560 nmdc:mga08y16_10214_c1 3300050511 Bacteria 9854
561 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
562 nmdc:mga08y16_20504_c1 3300050511 Bacteria 6977
563 nmdc:mga08y16_222535_c1 3300050511 Bacteria 1953
564 nmdc:mga08y16_24562_c1 3300050511 Bacteria 6360
565 nmdc:mga08y16_275125_c1 3300050511 Unclassified 1738
566 nmdc:mga08y16_43637_c1 3300050511 Bacteria 4700
567 nmdc:mga08y16_712418_c1 3300050511 Bacteria 1002
568 nmdc:mga08y16_82870_c1 3300050511 Bacteria 3343
569 nmdc:mga08y16_944554_c1 3300050511 Bacteria 846
570 nmdc:mga0sz30_39222_c1 3300050516 Bacteria 1987
571 nmdc:mga0sz30_75569_c1 3300050516 Bacteria 1108
572 Ga0500569_061619 3300053109 Bacteria 1159
573 Ga0500658_0000169 3300053134 Bacteria 30993
574 Ga0501084_0018763 3300054114 Bacteria 5759
575 Ga0590077_034170 3300059426 Bacteria 1117
576 Ga0587073_0014610 3300059492 Bacteria 1401
577 Ga0587073_0021304 3300059492 Bacteria 1246
578 Ga0587088_012497 3300059508 Bacteria 1285
579 Ga0587076_031781 3300059645 Bacteria 940
580 Ga0501082_0764310 3300060353 Bacteria 846
581 2509115306 2508501123 Bacteria 6283661
582 2509372465 2509276018 Bacteria 6910194
583 2509397452 2509276022 Bacteria 6200534
584 2509442122 2509276033 Bacteria 7180565
585 2510136291 2510065019 Bacteria 6903379
586 2510892700 2510461076 Bacteria 8618824
587 2513579779 2513237085 Bacteria 7695351
588 2513630549 2513237093 Bacteria 7545552
589 2513712121 2513237103 Bacteria 7647401
590 2513904754 2513237143 Bacteria 6664116
591 2513910234 2513237144 Bacteria 7530820
592 2514001792 2513237159 Bacteria 6810126
593 2515108771 2515075009 Bacteria 7288508
594 2515632639 2515154113 Bacteria 7807172
595 2515640416 2515154114 Bacteria 7848616
596 2515656510 2515154116 Bacteria 7552979
597 2515738277 2515154134 Bacteria 7220242
598 2517040702 2516653077 Bacteria 7555578
599 2517080321 2516653085 Bacteria 7346596
600 2517098326 2517093000 Bacteria 7412387
601 2524462929 2524023209 Bacteria 6679728
602 2585526648 2585427526 Bacteria 7258840
603 2585543249 2585427528 Bacteria 6842387
604 2585841609 2585427593 Bacteria 7141551
605 2616297243 2615840624 Bacteria 6557588
606 2643986799 2643221595 Bacteria 6565519
607 2644133056 2643221623 Bacteria 5239945
608 2644157644 2643221627 Bacteria 6761570
609 2688599854 2687453392 Bacteria 6880454
610 2694633897 2693429783 Bacteria 7019804
611 2694637698 2693429784 Bacteria 7241525
612 2719184717 2718217882 Bacteria 6556348
613 2719389375 2718217927 Bacteria 6972593
614 2719668715 2718217997 Bacteria 6740740
615 2719728737 2718218009 Bacteria 6478651
616 2720489408 2718218199 Bacteria 6740745
617 2720610080 2718218232 Bacteria 6720332
618 2720617504 2718218233 Bacteria 6662049
619 2720628651 2718218235 Bacteria 6630699
620 2720772601 2718218269 Bacteria 6906114
621 2721144428 2718218363 Bacteria 6524337
622 2721161798 2718218366 Bacteria 6425255
623 2721402141 2718218423 Bacteria 6438183
624 2722842943 2721755514 Bacteria 6424414
625 2723030040 2721755556 Bacteria 6745503
626 2723564445 2721755684 Bacteria 6859907
627 2723569915 2721755685 Bacteria 6704835
628 2724035974 2721755809 Bacteria 6438790
629 2724041762 2721755810 Bacteria 6479005
630 2724092630 2721755819 Bacteria 6906405
631 2724101462 2721755822 Bacteria 6726041
632 2724113014 2721755823 Bacteria 6752556
633 2730110573 2728369352 Bacteria 6745171
634 2730160832 2728369365 Bacteria 6555560
635 2739035297 2738541333 Bacteria 7106503
636 2739306318 2738543024 Bacteria 5603683
637 2756675577 2756170246 Bacteria 7451806
638 2765465341 2765235802 Bacteria 5618596
639 2770197409 2767802442 Bacteria 5747986
640 2776271033 2775506902 Bacteria 6208009
641 2776282925 2775506904 Bacteria 5954060
642 2792746715 2791355123 Bacteria 8049106
643 2793297862 2791355256 Bacteria 6798008
644 2793315170 2791355259 Bacteria 7254731
645 2793334003 2791355262 Bacteria 6774204
646 2793345608 2791355264 Bacteria 6429314
647 2793354290 2791355265 Bacteria 6539969
648 2793368601 2791355267 Bacteria 7222458
649 2805934304 2802429606 Bacteria 6346811
650 2806048009 2802429633 Bacteria 7341974
651 2806054734 2802429634 Bacteria 7083200
652 2806060742 2802429635 Bacteria 7650140
653 2806069318 2802429636 Bacteria 7597525
654 2806077043 2802429637 Bacteria 7067217
655 2838020360 2838016132 Bacteria 6577831
656 2838049801 2838048938 Bacteria 6044578
657 2838062068 2838061910 Bacteria 6794874
658 2838069575 2838068647 Bacteria 6208656
659 2838669417 2838668709 Bacteria 6671819
660 2838681026 2838680041 Bacteria 6545511
661 2838690664 2838686498 Bacteria 7807632
662 2838694941 2838694306 Bacteria 6853137
663 2838701788 2838701080 Bacteria 6669771
664 2838708317 2838707686 Bacteria 6619912
665 2838735958 2838729681 Bacteria 7400765
666 2838748794 2838742623 Bacteria 7396178
667 2840768838 2840764183 Bacteria 6358399
668 2841855585 2841851746 Bacteria 7532261
669 2841866014 2841864319 Bacteria 6742987
670 2841868734 2841864319 Bacteria 6742987
671 2842080449 2842077413 Bacteria 6508645
672 2842116423 2842110456 Bacteria 7656360
673 2842121068 2842118031 Bacteria 7033875
674 2842160709 2842156927 Bacteria 6894975
675 2842164226 2842163707 Bacteria 6916235
676 2842184325 2842180545 Bacteria 6888678
677 2842196058 2842192696 Bacteria 6147454
678 2842209777 2842205361 Bacteria 6340321
679 2842219839 2842217011 Bacteria 7497767
680 2842231908 2842229732 Bacteria 7475766
681 2842237729 2842237096 Bacteria 6620661
682 2842249765 2842243621 Bacteria 7421798
683 2842251788 2842250916 Bacteria 6579627
684 2842263704 2842257432 Bacteria 7401195
685 2842264951 2842264693 Bacteria 6472963
686 2842275022 2842271015 Bacteria 7807131
687 2842283231 2842278818 Bacteria 6340002
688 2842294108 2842291075 Bacteria 7076806
689 2842303460 2842298080 Bacteria 6123127
690 2842307542 2842304105 Bacteria 7023636
691 2842313092 2842311132 Bacteria 6616990
692 2842341910 2842341865 Bacteria 7003929
693 2842342685 2842341865 Bacteria 7003929
694 2842361945 2842357229 Bacteria 6485165
695 2842363728 2842363717 Bacteria 6844742
696 2842364260 2842363717 Bacteria 6844742
697 2842371489 2842370503 Bacteria 7038661
698 2842380505 2842377471 Bacteria 7140707
699 2842387576 2842384541 Bacteria 7057858
700 2842422766 2842422224 Bacteria 6239196
701 2842428995 2842428310 Bacteria 6767288
702 2842435609 2842434925 Bacteria 6502746
703 2842441530 2842441272 Bacteria 6769273
704 2842448401 2842447887 Bacteria 6754142
705 2842463420 2842462802 Bacteria 6588055
706 2842469939 2842469257 Bacteria 6752936
707 2842489764 2842489311 Bacteria 6620893
708 2842527301 2842521101 Bacteria 6569494
709 2844004612 2844002411 Bacteria 7168230
710 2844006077 2844002411 Bacteria 7168230
711 2844460320 2844454524 Bacteria 7952546
712 2856324691 2856320880 Bacteria 7263508
713 2856333106 2856328259 Bacteria 6528202
714 2856337665 2856334872 Bacteria 7037011
715 2856371081 2856364286 Bacteria 6939991
716 2857355428 2857349434 Bacteria 7926032
717 2857517878 2857516855 Bacteria 7787325
718 2869269252 2869264136 Bacteria 6880765
719 2869273935 2869271264 Bacteria 6908218
720 2869281313 2869278585 Bacteria 7077053
721 2869292026 2869285874 Bacteria 6901219
722 2871435233 2871429161 Bacteria 6547891
723 2871458344 2871451962 Bacteria 7336357
724 2871469626 2871466892 Bacteria 6923287
725 2874136268 2874131515 Bacteria 6820270
726 2874141021 2874139085 Bacteria 7021506
727 2874151157 2874146452 Bacteria 7533118
728 2874161184 2874155637 Bacteria 6724144
729 2874167815 2874162495 Bacteria 6174670
730 2876400490 2876399893 Bacteria 6927900
731 2876408894 2876406927 Bacteria 6191900
732 2876417177 2876413966 Bacteria 6831344
733 2878742801 2878738818 Bacteria 7136951
734 2878752368 2878745973 Bacteria 6867388
735 2878779878 2878774303 Bacteria 6108671
736 2878788249 2878781027 Bacteria 6834456
737 2888341020 2888337043 Bacteria 6629336
738 2888357082 2888350351 Bacteria 7372807
739 2889012095 2889010040 Bacteria 6749192
740 2889022974 2889016732 Bacteria 6700763
741 2894239518 2894232714 Bacteria 8834183
742 2903505459 2903492973 Bacteria 13473544
743 2904581509 2904578770 Bacteria 5302906
744 2906314762 2906308376 Bacteria 6841989
745 2906327934 2906321335 Bacteria 6579571
746 2906361423 2906354277 Bacteria 6991324
747 2906366943 2906363423 Bacteria 6856682
748 2906372756 2906370794 Bacteria 6881062
749 2906386329 2906378014 Bacteria 6911440
750 2906391585 2906386501 Bacteria 5977019
751 2906409532 2906408224 Bacteria 6162342
752 2919122743 2919119836 Bacteria 5208557
753 2921214830 2921208531 Bacteria 6745326
754 2922137937 2922130491 Bacteria 7173936
755 2922157350 2922151315 Bacteria 6902399
756 2922175937 2922172374 Bacteria 6167644
757 2922185545 2922178524 Bacteria 6025201
758 2922190962 2922185730 Bacteria 7113964
759 2924735098 2924733363 Bacteria 7574837
760 2924751534 2924748358 Bacteria 6154725
761 2924780601 2924776078 Bacteria 7492003
762 2933022558 2933016740 Bacteria 6355406
763 2933573802 2933570622 Bacteria 7023390
764 2933592640 2933586486 Bacteria 7667493
765 2933600238 2933599457 Bacteria 5858799
766 2935895463 2935894831 Bacteria 6620579
767 2935903328 2935901341 Bacteria 7341747
768 2936374517 2936367885 Bacteria 7324495
769 2936376047 2936375103 Bacteria 6652732
770 2937821089 2937813078 Bacteria 7783518
771 2937875508 2937868953 Bacteria 6639878
772 2937879897 2937877337 Bacteria 7246526
773 2937974507 2937972304 Bacteria 7532020
774 2938021761 2938014810 Bacteria 6700592
775 2939613611 2939611941 Bacteria 3892017
776 2958037275 2958034702 Bacteria 6989922
777 2958046987 2958041894 Bacteria 13082850
778 2958056437 2958041894 Bacteria 13082850
779 2958067502 2958064165 Bacteria 7158582
780 2958087075 2958084443 Bacteria 7312792
781 2958098220 2958092219 Bacteria 6861151
782 2958107960 2958100919 Bacteria 6800575
783 2958127679 2958122699 Bacteria 7280457
784 2958136426 2958130278 Bacteria 6897202
785 2958143276 2958137437 Bacteria 6050276
786 2958148492 2958144490 Bacteria 6677056
787 2958160373 2958158011 Bacteria 6058449
788 2958178636 2958172287 Bacteria 6716688
789 2958185893 2958179912 Bacteria 6874908
790 2961084374 2961077736 Bacteria 7079850
791 2961141983 2961136820 Bacteria 6775228
792 2965030379 2965025482 Bacteria 6532201
793 2965035622 2965032056 Bacteria 6887443
794 2965044535 2965040258 Bacteria 6855979
795 2965053139 2965047637 Bacteria 6623551
796 2965107090 2965102966 Bacteria 6800987
797 2965111136 2965110997 Bacteria 6693150
798 2965125770 2965119406 Bacteria 6956431
799 2968019906 2968016561 Bacteria 7022047
800 2968123731 2968117919 Bacteria 6536078
801 2970473227 2970469710 Bacteria 6969209
802 2970549095 2970547951 Bacteria 6931819
803 2970595917 2970593180 Bacteria 7073582
804 2977849709 2977843712 Bacteria 6753583
805 2977876030 2977872689 Bacteria 7270173
806 2977922497 2977915119 Bacteria 6829656
807 2977939278 2977935797 Bacteria 6252826
808 2977948933 2977942078 Bacteria 7570577
809 2977956870 2977950692 Bacteria 6893264
810 2977963464 2977957713 Bacteria 6877875
811 2977971631 2977971508 Bacteria 7472917
812 2979711698 2979710463 Bacteria 6785254
813 2979749515 2979742915 Bacteria 7301278
814 2979800757 2979793036 Bacteria 6808957
815 2987640561 2987636660 Bacteria 8088555
816 2987650988 2987645492 Bacteria 6117018
817 2987653768 2987652177 Bacteria 6969023
818 2987675438 2987673487 Bacteria 6884027
819 2996337157 2996336353 Bacteria 5511628
820 2996351671 2996348954 Bacteria 7239054
821 2996897502 2996893221 Bacteria 5823108
822 3004170555 3004167301 Bacteria 8330599
823 3004201201 3004195979 Bacteria 6776956
824 3004208759 3004203850 Bacteria 7307914
825 3004242743 3004239961 Bacteria 6892290
826 3004278371 3004275668 Bacteria 7114440
827 3004292973 3004289098 Bacteria 6135450
828 637076985 637000159 Bacteria 7596297
829 649874333 649633066 Bacteria 6690028
830 8002287648 8002285264 Bacteria 6717907
831 8004302521 8004300914 Bacteria 6132239
832 8004365695 8004361976 Bacteria 6858373
833 8004394994 8004387939 Bacteria 7049250
834 8004699796 8004695233 Bacteria 6731676
835 8004721023 8004714634 Bacteria 6776161
836 8005277718 8005275841 Bacteria 6929066
837 8005285695 8005282627 Bacteria 6675747
838 8005290459 8005289223 Bacteria 6634003
839 8005301122 8005301065 Bacteria 6614431
840 8005308097 8005307578 Bacteria 7395396
841 8005380720 8005376324 Bacteria 6590079
842 8005436719 8005430974 Bacteria 6689030
843 8005467737 8005460587 Bacteria 7157962
844 8005501861 8005497431 Bacteria 6477605
845 8005562486 8005556819 Bacteria 6908598
846 8005566261 8005563573 Bacteria 7153261
847 8005571666 8005570704 Bacteria 6957481
848 8005624105 8005619151 Bacteria 7030230
849 8005629368 8005626139 Bacteria 6534237
850 8005673284 8005668836 Bacteria 6953162
851 8005689064 8005688590 Bacteria 6610080
852 8005697759 8005695170 Bacteria 6912330
853 8018132145 8018127388 Bacteria 7351159
854 8018163534 8018163183 Bacteria 7277977
855 8018176270 8018176218 Bacteria 6896178
856 8024482279 8024479707 Bacteria 6954785
857 8024507292 8024501048 Bacteria 6427847
858 8056377941 8056375014 Bacteria 7006639
859 8056382029 8056382006 Bacteria 6408074
860 8057881497 8057874678 Bacteria 7494653
861 Ga0070686_100128647
862 SwRhRL2b_contig_592195
863 JGI25152J39213_1024530
864 JGI25151J46595_10001427
865 JGI25165J46597_1000219
866 JGI25153J46596_10002705
867 JGI25153J46596_10010575
868 JGI25160J50197_1008499
869 JGI25407J50210_10120086
870 JGI25161J50226_1005999
871 Ga0055526_1001668
872 Ga0055524_1001184
873 Ga0055524_1049701
874 Ga0055528_1000187
875 Ga0055528_1001313
876 Ga0055528_1016373
877 Ga0055528_1025590
878 Ga0055540_1000368
879 Ga0055540_1019281
880 Ga0055540_1053660
881 Ga0055543_1002022
882 Ga0065165_1021977
883 Ga0065712_10181587
884 Ga0070658_10025900
885 Ga0070658_10418695
886 Ga0070658_10551572
887 Ga0070676_10002377
888 Ga0070683_100053441
889 Ga0070690_100213502
890 Ga0070670_100063188
891 Ga0070670_100297550
892 Ga0070670_100723953
893 Ga0070670_100847092
894 Ga0068869_100163719
895 Ga0068869_100284206
896 Ga0070680_100002784
897 Ga0070680_100382463
898 Ga0070682_101022240
899 Ga0068868_100294000
900 Ga0070660_100001232
901 Ga0070660_100077939
902 Ga0070660_100106556
903 Ga0070689_100526590
904 Ga0070691_10000681
905 Ga0070661_100001528
906 Ga0070661_100223118
907 Ga0070661_100482251
908 Ga0070692_10000839
909 Ga0070692_10043089
910 Ga0070692_10423626
911 Ga0070668_100000298
912 Ga0070668_100061191
913 Ga0070668_100087698
914 Ga0070668_100314009
915 Ga0070669_100004356
916 Ga0070669_100047209
917 Ga0070669_100082014
918 Ga0070669_100101718
919 Ga0070675_100022444
920 Ga0070675_100044840
921 Ga0070675_100228029
922 Ga0070675_100509389
923 Ga0070671_100629804
924 Ga0070674_100514824
925 Ga0070674_100661046
926 Ga0070673_100170676
927 Ga0070673_100399682
928 Ga0070688_100328108
929 Ga0070659_100002114
930 Ga0070659_100007184
931 Ga0070667_100112328
932 Ga0070667_100202897
933 Ga0070667_100213417
934 Ga0070667_100280684
935 Ga0070667_100347734
936 Ga0070714_100082784
937 Ga0070714_100177954
938 Ga0070714_101294174
939 Ga0070713_100309608
940 Ga0070700_100200104
941 Ga0070700_100756941
942 Ga0070694_100739985
943 Ga0070663_100000850
944 Ga0070663_100382270
945 Ga0070678_100554024
946 Ga0070662_100001567
947 Ga0070662_100051627
948 Ga0070662_100086458
949 Ga0070662_100274445
950 Ga0070662_100698712
951 Ga0070662_100792572
952 Ga0070681_10042370
953 Ga0070681_10080111
954 Ga0070681_10105093
955 Ga0070681_11016938
956 Ga0068867_100169724
957 Ga0070679_100021107
958 Ga0070679_100307767
959 Ga0070684_100004714
960 Ga0068853_100001983
961 Ga0070696_100000540
962 Ga0070696_100017290
963 Ga0070696_100200909
964 Ga0070696_100204384
965 Ga0070696_100386627
966 Ga0070693_100032071
967 Ga0070665_100086262
968 Ga0070665_100314085
969 Ga0070665_100435695
970 Ga0070704_101034513
971 Ga0068855_100030935
972 Ga0068855_100046662
973 Ga0068855_101242460
974 Ga0070664_100007090
975 Ga0070664_100014927
976 Ga0070664_100133056
977 Ga0068857_100043204
978 Ga0068857_100051205
979 Ga0068854_100333192
980 Ga0068856_100006182
981 Ga0068856_100155844
982 Ga0068852_100009249
983 Ga0068852_100544815
984 Ga0068852_101070280
985 Ga0068859_101003682
986 Ga0068864_100020967
987 Ga0068864_100262110
988 Ga0068866_10210387
989 Ga0068861_100000129
990 Ga0068861_100002725
991 Ga0068851_10034611
992 Ga0068870_10207398
993 Ga0068863_100072720
994 Ga0068863_100370810
995 Ga0068863_100444300
996 Ga0068863_100709479
997 Ga0068858_100222793
998 Ga0068858_100224231
999 Ga0068860_100098471
1000 Ga0068862_100000218
1001 Ga0068862_100526044
1002 Ga0068862_100699555
1003 Ga0068862_101034672
1004 Ga0068862_101304800
1005 Ga0081538_10021013
1006 Ga0075365_10005980
1007 Ga0075365_10038039
1008 Ga0075368_10016556
1009 Ga0075368_10093701
1010 Ga0075363_100072666
1011 Ga0075363_100095869
1012 Ga0075362_10002515
1013 Ga0075367_10033179
1014 Ga0075367_10076961
1015 Ga0075367_10211565
1016 Ga0075367_10399083
1017 Ga0075369_10003580
1018 Ga0075369_10019518
1019 Ga0075366_10010354
1020 Ga0075366_10068147
1021 Ga0075366_10100445
1022 Ga0097621_100438271
1023 Ga0075370_10021922
1024 Ga0075428_100022338
1025 Ga0075428_100057286
1026 Ga0075428_100062789
1027 Ga0075428_100448077
1028 Ga0075430_100010466
1029 Ga0075430_100027930
1030 Ga0075430_100685392
1031 Ga0075431_100004757
1032 Ga0075431_100009489
1033 Ga0075431_100174829
1034 Ga0075431_100183845
1035 Ga0075431_100203803
1036 Ga0075431_100252312
1037 Ga0075431_100505316
1038 Ga0075434_100541899
1039 Ga0075429_100002889
1040 Ga0075429_100009609
1041 Ga0075429_100131104
1042 Ga0068865_100356276
1043 Ga0097620_101003537
1044 Ga0105240_10027910
1045 Ga0105240_10083841
1046 Ga0105240_10091395
1047 Ga0105240_10475838
1048 Ga0105240_10750900
1049 Ga0111539_10000435
1050 Ga0111539_10001318
1051 Ga0111539_10022301
1052 Ga0111539_10028074
1053 Ga0111539_10037062
1054 Ga0111539_10227988
1055 Ga0111539_10617230
1056 Ga0111539_10960664
1057 Ga0105245_11854251
1058 Ga0114129_10026544
1059 Ga0114129_10212505
1060 Ga0114129_10570840
1061 Ga0105243_10151303
1062 Ga0105243_10338858
1063 Ga0105248_10093275
1064 Ga0105248_10203928
1065 Ga0105248_10379725
1066 Ga0105248_11058106
1067 Ga0105237_10311908
1068 Ga0105238_10061513
1069 Ga0105238_10442449
1070 Ga0105238_10780856
1071 Ga0105249_10033487
1072 Ga0105249_10670247
1073 Ga0105249_10873051
1074 Ga0105249_11277103
1075 Ga0105249_11312688
1076 Ga0123341_1031173
1077 Ga0105239_10012339
1078 Ga0105239_10989612
1079 Ga0105246_10222745
1080 Ga0105246_10402088
1081 Ga0105246_10942608
1082 Ga0157322_1000447
1083 Ga0157373_10004455
1084 Ga0157371_10127004
1085 Ga0157371_10151606
1086 Ga0157370_10001370
1087 Ga0157370_10007301
1088 Ga0157370_10035249
1089 Ga0157370_10055494
1090 Ga0157370_10370139
1091 Ga0157370_10393468
1092 Ga0157369_10099975
1093 Ga0157369_10143758
1094 Ga0157369_10812350
1095 Ga0157374_10013094
1096 Ga0157374_10146372
1097 Ga0157374_10951467
1098 Ga0163162_10441705
1099 Ga0163162_10840544
1100 Ga0163162_11355161
1101 Ga0163162_11474569
1102 Ga0157372_10015585
1103 Ga0157372_10053016
1104 Ga0157372_10080705
1105 Ga0157372_10483530
1106 Ga0157372_10760235
1107 Ga0157375_10220975
1108 Ga0157380_10163826
1109 Ga0157380_10340933
1110 Ga0157380_10341512
1111 Ga0157379_11040542
1112 Ga0163161_10197528
1113 Ga0207425_1001421
1114 Ga0209129_1000484
1115 Ga0209129_1022630
1116 Ga0209233_1000258
1117 Ga0209673_1000022
1118 Ga0209673_1000105
1119 Ga0209673_1000248
1120 Ga0209673_1001831
1121 Ga0209673_1020509
1122 Ga0209025_1000841
1123 Ga0209564_1000163
1124 Ga0209564_1001320
1125 Ga0209564_1032506
1126 Ga0209758_1000844
1127 Ga0209758_1003738
1128 Ga0209050_1008993
1129 Ga0209256_1000281
1130 Ga0209256_1000551
1131 Ga0207426_1000109
1132 Ga0209051_1000027
1133 Ga0209051_1001011
1134 Ga0209051_1009468
1135 Ga0207656_10059387
1136 Ga0207682_10249799
1137 Ga0207647_10005171
1138 Ga0207645_10036297
1139 Ga0207645_10079997
1140 Ga0207643_10045892
1141 Ga0207643_10383181
1142 Ga0207705_10002814
1143 Ga0207705_10134043
1144 Ga0207654_10260818
1145 Ga0207707_10135242
1146 Ga0207707_10233019
1147 Ga0207707_10282018
1148 Ga0207695_10049216
1149 Ga0207695_10702585
1150 Ga0207671_10434423
1151 Ga0207660_10276713
1152 Ga0207660_10341582
1153 Ga0207662_10311132
1154 Ga0207657_10003267
1155 Ga0207657_10006281
1156 Ga0207657_10047751
1157 Ga0207657_10075982
1158 Ga0207657_10083205
1159 Ga0207657_10723271
1160 Ga0207657_10770810
1161 Ga0207649_10070130
1162 Ga0207652_10469364
1163 Ga0207652_11028311
1164 Ga0207681_10003227
1165 Ga0207681_10025651
1166 Ga0207681_10083514
1167 Ga0207681_10401343
1168 Ga0207694_10582417
1169 Ga0207650_10264760
1170 Ga0207659_10006018
1171 Ga0207659_10169050
1172 Ga0207659_10198983
1173 Ga0207687_11020089
1174 Ga0207700_10428149
1175 Ga0207644_10209941
1176 Ga0207690_10002285
1177 Ga0207690_10098129
1178 Ga0207690_10535154
1179 Ga0207690_10652214
1180 Ga0207706_10001707
1181 Ga0207706_10061896
1182 Ga0207706_10087259
1183 Ga0207706_10616348
1184 Ga0207686_10083794
1185 Ga0207709_10094416
1186 Ga0207709_10433189
1187 Ga0207670_10229594
1188 Ga0207669_10486176
1189 Ga0207691_10166099
1190 Ga0207691_10438972
1191 Ga0207689_10247438
1192 Ga0207661_10014877
1193 Ga0207679_10007246
1194 Ga0207679_10010454
1195 Ga0207679_10149440
1196 Ga0207667_10005252
1197 Ga0207667_10042605
1198 Ga0207667_10101259
1199 Ga0207667_10678328
1200 Ga0207667_10922757
1201 Ga0207712_10544933
1202 Ga0207712_10706047
1203 Ga0207712_10898432
1204 Ga0207668_10002278
1205 Ga0207640_10061902
1206 Ga0207658_11498295
1207 Ga0207703_10499024
1208 Ga0207639_10023071
1209 Ga0207639_10186197
1210 Ga0207639_10454117
1211 Ga0207678_10002168
1212 Ga0207678_10347892
1213 Ga0207708_10166477
1214 Ga0207702_10015552
1215 Ga0207641_10569390
1216 Ga0207648_10077349
1217 Ga0207676_10018821
1218 Ga0207674_10057186
1219 Ga0207674_10127275
1220 Ga0207675_100000114
1221 Ga0207683_10557292
1222 Ga0207698_10143218
1223 Ga0207698_10883163
1224 Ga0207698_11318689
1225 Ga0210000_1008357
1226 Ga0209999_1011694
1227 Ga0209983_1004019
1228 Ga0209971_1024256
1229 Ga0209971_1029907
1230 Ga0209966_1006990
1231 Ga0209998_10073780
1232 Ga0209974_10012192
1233 Ga0209974_10110043
1234 Ga0207428_10006737
1235 Ga0207428_10010289
1236 Ga0207428_10010362
1237 Ga0207428_10045459
1238 Ga0207428_10046176
1239 Ga0207428_10085485
1240 Ga0268266_10114583
1241 Ga0268266_10303115
1242 Ga0268265_10001884
1243 Ga0268265_10050021
1244 Ga0268265_10571719
1245 Ga0307408_100102478
1246 Ga0307408_100137205
1247 Ga0307408_101332203
1248 Ga0307405_10014107
1249 Ga0307405_11071953
1250 Ga0307413_10090617
1251 Ga0307413_10411116
1252 Ga0307413_10422426
1253 Ga0307413_10562668
1254 Ga0307410_10023881
1255 Ga0307410_10031545
1256 Ga0307410_10103522
1257 Ga0307410_10555473
1258 Ga0307410_10562121
1259 Ga0307410_10814143
1260 Ga0307406_10276012
1261 Ga0307406_10389220
1262 Ga0307407_10016022
1263 Ga0307407_10349742
1264 Ga0307409_100148118
1265 Ga0307409_100296826
1266 Ga0307409_101308104
1267 Ga0307416_100002216
1268 Ga0307416_100086854
1269 Ga0307416_100304200
1270 Ga0307414_10039059
1271 Ga0307414_10187719
1272 Ga0307414_10359300
1273 Ga0307414_11321718
1274 Ga0307411_10247499
1275 Ga0307411_11149894
1276 Ga0307415_100000104
1277 Ga0395899_0185945
1278 Ga0395900_0008833
1279 Ga0395900_0255497
1280 Ga0395900_0516387
1281 Ga0395900_0830190
1282 Ga0395898_0021333
1283 Ga0395898_0085384
1284 Ga0395905_0007436
1285 Ga0395905_0039663
1286 Ga0395905_0213755
1287 Ga0395905_1042862
1288 Ga0395901_0010917
1289 Ga0395901_0014654
1290 Ga0395901_0440445
1291 Ga0395901_0953296
1292 Ga0439461_0008350
1293 Ga0451807_0112694
1294 Ga0451837_1615948
1295 Ga0451839_1163093
1296 Ga0451847_0100678
1297 Ga0451849_1258375
1298 Ga0451851_0919440
1299 Ga0451855_0413049
1300 Ga0451853_2339943
1301 Ga0439431_0038209
1302 Ga0439433_0027373
1303 Ga0439445_0139682
1304 Ga0439448_0031645
1305 Ga0450896_006390
1306 Ga0450896_050069
1307 Ga0450906_016675
1308 Ga0439446_0014440
1309 Ga0439434_0000760
1310 Ga0439434_0126839
1311 Ga0439444_0000555
1312 Ga0439464_0068407
1313 Ga0439460_0007545
1314 Ga0451577_0990299
1315 Ga0466972_0031989
1316 Ga0466972_0197467
1317 Ga0453684_0121138
1318 Ga0466957_0693853
1319 Ga0466960_0011387
1320 Ga0466967_0361490
1321 Ga0495580_0541172
1322 Ga0495596_0056927
1323 Ga0495607_0067970
1324 Ga0495606_0025336
1325 Ga0495618_0272785
1326 Ga0495620_0033835
1327 Ga0495631_0143059
1328 Ga0495643_0030970
1329 Ga0495663_0112155
1330 Ga0495609_0090975
1331 Ga0495621_0205014
1332 Ga0495633_0188465
1333 Ga0495656_0200847
1334 Ga0495611_0241803
1335 Ga0495625_0054212
1336 Ga0495670_0080922
1337 Ga0495649_0274698
1338 Ga0495660_0055464
1339 Ga0495636_0012351
1340 Ga0495681_0058697
1341 Ga0496100_0236371
1342 Ga0496102_0030317
1343 Ga0496105_0253353
1344 Ga0496106_0455519
1345 Ga0496109_0863509
1346 Ga0496110_0276785
1347 Ga0496110_0354308
1348 Ga0496112_0075012
1349 Ga0496113_0032278
1350 Ga0496113_0822986
1351 Ga0496116_0385456
1352 Ga0496117_0194891
1353 Ga0496119_0100660
1354 Ga0496120_0001687
1355 Ga0496125_0139901
1356 Ga0496126_0075958
1357 Ga0501031_0264498
1358 Ga0501033_0024345
1359 Ga0501033_0832858
1360 Ga0501034_0040989
1361 Ga0501034_0238719
1362 Ga0501034_0368456
1363 Ga0501034_0526940
1364 Ga0501038_0409960
1365 Ga0501039_0184756
1366 Ga0501041_0034163
1367 Ga0501042_0042657
1368 Ga0501043_0420908
1369 Ga0501043_0686263
1370 Ga0501047_0012679
1371 Ga0501047_0063112
1372 Ga0501069_0071048
1373 Ga0501070_0028516
1374 Ga0501071_0078394
1375 Ga0501071_0668099
1376 Ga0501072_0106547
1377 Ga0501075_0049238
1378 Ga0501257_007730
1379 Ga0501079_0154125
1380 Ga0501080_0242491
1381 Ga0501080_0363885
1382 Ga0501083_0200946
1383 Ga0501035_0087765
1384 Ga0501035_0348134
1385 Ga0501044_0207025
1386 Ga0501044_0281945
1387 Ga0501044_0498630
1388 nmdc:mga03683_126964_c1
1389 nmdc:mga03683_14469_c1
1390 nmdc:mga03n38_138619_c1
1391 nmdc:mga03n38_86060_c1
1392 nmdc:mga0yw44_148304_c1
1393 nmdc:mga0yw44_46669_c1
1394 nmdc:mga0k408_166159_c1
1395 nmdc:mga0k408_238124_c1
1396 nmdc:mga0k408_396912_c1
1397 nmdc:mga06z11_15656_c1
1398 nmdc:mga06z11_195842_c1
1399 nmdc:mga04h51_195951_c1
1400 nmdc:mga07m45_42876_c1
1401 nmdc:mga07m45_49297_c1
1402 nmdc:mga05p37_25909_c1
1403 nmdc:mga05p37_472221_c1
1404 nmdc:mga05p37_520262_c1
1405 nmdc:mga05p37_5879_c1
1406 nmdc:mga05p37_638675_c1
1407 nmdc:mga09592_1928_c1
1408 nmdc:mga09592_3525_c1
1409 nmdc:mga09592_87199_c1
1410 nmdc:mga0qj67_118300_c1
1411 nmdc:mga0qj67_590250_c1
1412 nmdc:mga0qj67_8543_c1
1413 nmdc:mga06r32_13216_c1
1414 nmdc:mga06r32_169031_c1
1415 nmdc:mga06r32_171526_c1
1416 nmdc:mga06r32_275375_c1
1417 nmdc:mga06r32_51520_c1
1418 nmdc:mga06r32_755945_c1
1419 nmdc:mga06r32_939_c1
1420 nmdc:mga08y16_10214_c1
1421 nmdc:mga08y16_195_c1
1422 nmdc:mga08y16_20504_c1
1423 nmdc:mga08y16_222535_c1
1424 nmdc:mga08y16_24562_c1
1425 nmdc:mga08y16_275125_c1
1426 nmdc:mga08y16_43637_c1
1427 nmdc:mga08y16_712418_c1
1428 nmdc:mga08y16_82870_c1
1429 nmdc:mga08y16_944554_c1
1430 nmdc:mga0sz30_39222_c1
1431 nmdc:mga0sz30_75569_c1
1432 Ga0500569_061619
1433 Ga0500658_0000169
1434 Ga0501084_0018763
1435 Ga0590077_034170
1436 Ga0587073_0014610
1437 Ga0587073_0021304
1438 Ga0587088_012497
1439 Ga0587076_031781
1440 Ga0501082_0764310
1441 2509115306
1442 2509372465
1443 2509397452
1444 2509442122
1445 2510136291
1446 2510892700
1447 2513579779
1448 2513630549
1449 2513712121
1450 2513904754
1451 2513910234
1452 2514001792
1453 2515108771
1454 2515632639
1455 2515640416
1456 2515656510
1457 2515738277
1458 2517040702
1459 2517080321
1460 2517098326
1461 2524462929
1462 2585526648
1463 2585543249
1464 2585841609
1465 2616297243
1466 2643986799
1467 2644133056
1468 2644157644
1469 2688599854
1470 2694633897
1471 2694637698
1472 2719184717
1473 2719389375
1474 2719668715
1475 2719728737
1476 2720489408
1477 2720610080
1478 2720617504
1479 2720628651
1480 2720772601
1481 2721144428
1482 2721161798
1483 2721402141
1484 2722842943
1485 2723030040
1486 2723564445
1487 2723569915
1488 2724035974
1489 2724041762
1490 2724092630
1491 2724101462
1492 2724113014
1493 2730110573
1494 2730160832
1495 2739035297
1496 2739306318
1497 2756675577
1498 2765465341
1499 2770197409
1500 2776271033
1501 2776282925
1502 2792746715
1503 2793297862
1504 2793315170
1505 2793334003
1506 2793345608
1507 2793354290
1508 2793368601
1509 2805934304
1510 2806048009
1511 2806054734
1512 2806060742
1513 2806069318
1514 2806077043
1515 2838020360
1516 2838049801
1517 2838062068
1518 2838069575
1519 2838669417
1520 2838681026
1521 2838690664
1522 2838694941
1523 2838701788
1524 2838708317
1525 2838735958
1526 2838748794
1527 2840768838
1528 2841855585
1529 2841866014
1530 2841868734
1531 2842080449
1532 2842116423
1533 2842121068
1534 2842160709
1535 2842164226
1536 2842184325
1537 2842196058
1538 2842209777
1539 2842219839
1540 2842231908
1541 2842237729
1542 2842249765
1543 2842251788
1544 2842263704
1545 2842264951
1546 2842275022
1547 2842283231
1548 2842294108
1549 2842303460
1550 2842307542
1551 2842313092
1552 2842341910
1553 2842342685
1554 2842361945
1555 2842363728
1556 2842364260
1557 2842371489
1558 2842380505
1559 2842387576
1560 2842422766
1561 2842428995
1562 2842435609
1563 2842441530
1564 2842448401
1565 2842463420
1566 2842469939
1567 2842489764
1568 2842527301
1569 2844004612
1570 2844006077
1571 2844460320
1572 2856324691
1573 2856333106
1574 2856337665
1575 2856371081
1576 2857355428
1577 2857517878
1578 2869269252
1579 2869273935
1580 2869281313
1581 2869292026
1582 2871435233
1583 2871458344
1584 2871469626
1585 2874136268
1586 2874141021
1587 2874151157
1588 2874161184
1589 2874167815
1590 2876400490
1591 2876408894
1592 2876417177
1593 2878742801
1594 2878752368
1595 2878779878
1596 2878788249
1597 2888341020
1598 2888357082
1599 2889012095
1600 2889022974
1601 2894239518
1602 2903505459
1603 2904581509
1604 2906314762
1605 2906327934
1606 2906361423
1607 2906366943
1608 2906372756
1609 2906386329
1610 2906391585
1611 2906409532
1612 2919122743
1613 2921214830
1614 2922137937
1615 2922157350
1616 2922175937
1617 2922185545
1618 2922190962
1619 2924735098
1620 2924751534
1621 2924780601
1622 2933022558
1623 2933573802
1624 2933592640
1625 2933600238
1626 2935895463
1627 2935903328
1628 2936374517
1629 2936376047
1630 2937821089
1631 2937875508
1632 2937879897
1633 2937974507
1634 2938021761
1635 2939613611
1636 2958037275
1637 2958046987
1638 2958056437
1639 2958067502
1640 2958087075
1641 2958098220
1642 2958107960
1643 2958127679
1644 2958136426
1645 2958143276
1646 2958148492
1647 2958160373
1648 2958178636
1649 2958185893
1650 2961084374
1651 2961141983
1652 2965030379
1653 2965035622
1654 2965044535
1655 2965053139
1656 2965107090
1657 2965111136
1658 2965125770
1659 2968019906
1660 2968123731
1661 2970473227
1662 2970549095
1663 2970595917
1664 2977849709
1665 2977876030
1666 2977922497
1667 2977939278
1668 2977948933
1669 2977956870
1670 2977963464
1671 2977971631
1672 2979711698
1673 2979749515
1674 2979800757
1675 2987640561
1676 2987650988
1677 2987653768
1678 2987675438
1679 2996337157
1680 2996351671
1681 2996897502
1682 3004170555
1683 3004201201
1684 3004208759
1685 3004242743
1686 3004278371
1687 3004292973
1688 637076985
1689 649874333
1690 8002287648
1691 8004302521
1692 8004365695
1693 8004394994
1694 8004699796
1695 8004721023
1696 8005277718
1697 8005285695
1698 8005290459
1699 8005301122
1700 8005308097
1701 8005380720
1702 8005436719
1703 8005467737
1704 8005501861
1705 8005562486
1706 8005566261
1707 8005571666
1708 8005624105
1709 8005629368
1710 8005673284
1711 8005689064
1712 8005697759
1713 8018132145
1714 8018163534
1715 8018176270
1716 8024482279
1717 8024507292
1718 8056377941
1719 8056382029
1720 8057881497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

39

185

0.92

PF02525

Flavodoxin_2

Flavodoxin-like fold

40

191

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.9315 3 181
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.9121 3 181
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.8985 3 180
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8914 5 176
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8866 2 182
ID Description Score Start End Superfamily
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9318 3 181 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9116 3 181 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8986 3 179 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8914 5 176 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8771 5 176 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A848QE11-F1-model_v4 deleted 0.9742 1 114
AF-A0A359KFV0-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9713 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A4S0S2F4-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9712 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A4S0ZQJ0-F1-model_v4 deleted 0.971 1 188
AF-A0A442G4V6-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9705 1 188 GO:0005829
GO:0010181
GO:0016491

Map