F483713

General Info

Members Datasets Scaffolds Average Seq Length
857 478 761 332

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221714|2644631522
Length 400
Sequence ILGLGRIGAFHAETLFGLDAVESLVVADPFAEAAKTAAERFGAEVADSPEAVLAAGVDGVVIAAATDAHPGLILAAVEAGVPVFCEKPVARTMAEGVEVLKAVQGSPVPIQIGYNRRFDAGFVAARAAVQTGELGTLHTVRSTTLDPAPPPAAYVAASGGIFRDCSVHDFDIIRWVTGREVSEVYAVGGNRGADYIKAAGDADTTGAILTLDDGTIAVVSNSRHNARGYDVRMEIHGFTDSIAVGLEDKLPLRSVEPGATFPAGTPHDFFMDRFTAAYRAELTAFTEVVAGTRPSPCTIEDALEAGWIAEACTLSLHEHRPVTIAEVRXXXXXXARPGPGRPPRAHRPWRIATWSGAQASRAGSRGVAGRSCTGPRGFTHRGATSSPRRRLRGEVEDVVR

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2643221647 Streptomyces sp. Root369 Isolate Unclassified
6 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
7 2643221711 Terrabacter sp. Root85 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
10 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
11 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
12 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
13 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
14 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606448 Streptomyces sp. 193411 Isolate Unclassified
21 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
22 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
23 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
24 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
25 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
26 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
27 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
28 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
29 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
30 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
31 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
32 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
33 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
34 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
35 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
36 2867369537 Streptomyces sp. Z26 Isolate Unclassified
37 2867428634 Streptomyces sp. RP5T Isolate Unclassified
38 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
39 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
40 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
41 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
42 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
43 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
44 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
45 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
46 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
47 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
48 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
49 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
50 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
51 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
52 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
53 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
54 2920879853 Kocuria salina CV6 Isolate Unclassified
55 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
56 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
57 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
58 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
59 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
60 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
61 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
62 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
63 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
64 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
65 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
66 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
67 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
68 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
69 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
70 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
71 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
72 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
73 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
74 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
75 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
76 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
77 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
78 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
79 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
80 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
81 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
82 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
83 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
84 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
85 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
86 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
87 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
88 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
89 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
90 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
91 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
92 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
93 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
94 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
95 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
96 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
98 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
99 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
100 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
101 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
102 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
103 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
104 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
107 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
108 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
109 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
110 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
111 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
114 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
115 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
116 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
117 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
118 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
119 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
120 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
121 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
122 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
127 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
128 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
129 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
130 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
131 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
132 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
133 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
134 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
135 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
136 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
137 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
138 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
139 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
140 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
148 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
149 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
150 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
151 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
152 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
153 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
154 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
155 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
156 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
157 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
158 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
159 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
160 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
161 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
162 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
163 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
164 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
165 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
166 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
167 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
168 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
169 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
170 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
171 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
172 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
173 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
174 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
175 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
176 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
177 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
178 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
179 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
185 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
186 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
187 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
188 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
189 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
190 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
191 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
192 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
193 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
194 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
195 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
196 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
197 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
198 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
199 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
256 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
257 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
258 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
261 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
262 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
263 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
267 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
268 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
269 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
275 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
276 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
277 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
281 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
282 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
283 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
284 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
285 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
286 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
298 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
299 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
300 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
301 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
302 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
303 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
304 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
305 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
306 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
307 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
308 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
309 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
310 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
311 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
312 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
313 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
314 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
315 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
316 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
317 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
318 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
321 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
322 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
341 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
342 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
346 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
347 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
352 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
361 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
362 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
363 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
364 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
365 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
366 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
367 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
368 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
371 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
372 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
373 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
374 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
375 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
379 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
380 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
381 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
382 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
383 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
384 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
385 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
386 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
387 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
388 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
389 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
390 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
391 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
392 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
393 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
394 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
395 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
396 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
397 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
401 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
402 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
403 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
421 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
422 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
423 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
424 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
425 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
426 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
427 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
428 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
429 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
430 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
433 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
438 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
439 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
440 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
441 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
442 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
443 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
444 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
447 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
451 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
452 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
453 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
454 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
455 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
456 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
457 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
458 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
459 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
460 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
463 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
464 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
465 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
466 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
467 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
468 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
469 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
470 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
471 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
472 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
473 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
474 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
475 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
476 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
477 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
478 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.45
Metatranscriptomes 0.35
Isolates 11.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 2.92
Nodule 0.35
Rhizoplane 8.63
Rhizosphere 78.41
Stem 0
Stem Tuber 0
Unclassified 9.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001384 3300000546 Bacteria 3500
2 LJNas_1007449 3300000546 Bacteria 1180
3 LJQas_1000385 3300000549 Bacteria 7479
4 JGI24746J21847_1002055 3300001977 Bacteria 3213
5 JGI24747J21853_1000411 3300001978 Bacteria 2592
6 JGI24739J22299_10042354 3300001989 Bacteria 1510
7 JGI24737J22298_10031649 3300001990 Bacteria 1651
8 JGI24737J22298_10056929 3300001990 Bacteria 1180
9 JGI24743J22301_10001318 3300001991 Bacteria 3399
10 JGI24735J21928_10020495 3300002067 Bacteria 2024
11 JGI24750J21931_1002461 3300002070 Bacteria 2231
12 JGI24745J21846_1000765 3300002073 Bacteria 2934
13 JGI24745J21846_1000984 3300002073 Bacteria 2666
14 JGI24748J21848_1002241 3300002074 Bacteria 2169
15 JGI24748J21848_1006431 3300002074 Bacteria 1367
16 JGI24744J21845_10001076 3300002077 Bacteria 5283
17 JGI24744J21845_10001784 3300002077 Bacteria 4320
18 JGI24034J26672_10010189 3300002239 Bacteria 1393
19 JGI24742J22300_10001076 3300002244 Bacteria 4217
20 JGI25406J46586_10017256 3300003203 Bacteria 2989
21 rootH1_10000180 3300003316 Bacteria 19593
22 Ga0006562J51391_1090646 3300003578 Bacteria 3979
23 Ga0006562J51391_1090648 3300003578 Bacteria 3370
24 Ga0070658_10002817 3300005327 Bacteria 14445
25 Ga0070658_10208076 3300005327 Bacteria 1652
26 Ga0070676_10172681 3300005328 Bacteria 1399
27 Ga0070683_100116116 3300005329 Bacteria 2527
28 Ga0070690_100021466 3300005330 Bacteria 3943
29 Ga0070690_100116958 3300005330 Bacteria 1785
30 Ga0070677_10037016 3300005333 Bacteria 1901
31 Ga0068869_100062168 3300005334 Bacteria 2740
32 Ga0068869_100074067 3300005334 Bacteria 2527
33 Ga0070682_100095268 3300005337 Bacteria 1954
34 Ga0070689_100170067 3300005340 Bacteria 1765
35 Ga0070687_100042717 3300005343 Bacteria 2299
36 Ga0070669_100026548 3300005353 Bacteria 4166
37 Ga0070669_100348477 3300005353 Bacteria 1202
38 Ga0070675_100202827 3300005354 Bacteria 1721
39 Ga0070671_100106988 3300005355 Bacteria 2348
40 Ga0070674_100061062 3300005356 Bacteria 2629
41 Ga0070673_100156160 3300005364 Bacteria 1936
42 Ga0070673_100245491 3300005364 Bacteria 1558
43 Ga0070688_100011804 3300005365 Bacteria 4870
44 Ga0070659_100195575 3300005366 Bacteria 1663
45 Ga0070659_100225772 3300005366 Bacteria 1547
46 Ga0070667_100101417 3300005367 Bacteria 2486
47 Ga0070667_100516903 3300005367 Bacteria 1095
48 Ga0070703_10007190 3300005406 Bacteria 3126
49 Ga0070714_100020361 3300005435 Bacteria 5417
50 Ga0070714_100353973 3300005435 Bacteria 1379
51 Ga0070710_10073448 3300005437 Bacteria 1977
52 Ga0070710_10147698 3300005437 Bacteria 1447
53 Ga0070705_100064350 3300005440 Bacteria 2190
54 Ga0070700_100110958 3300005441 Bacteria 1823
55 Ga0070694_100245795 3300005444 Bacteria 1351
56 Ga0070708_100010999 3300005445 Bacteria 7354
57 Ga0070663_100227384 3300005455 Bacteria 1467
58 Ga0070678_100030815 3300005456 Bacteria 3691
59 Ga0070678_100049687 3300005456 Bacteria 3028
60 Ga0070678_100280559 3300005456 Bacteria 1409
61 Ga0070662_100388748 3300005457 Bacteria 1149
62 Ga0068867_100043517 3300005459 Bacteria 3287
63 Ga0068867_100163794 3300005459 Bacteria 1755
64 Ga0068867_100439913 3300005459 Bacteria 1108
65 Ga0070685_10067743 3300005466 Bacteria 2106
66 Ga0070685_10079032 3300005466 Bacteria 1968
67 Ga0070707_100158662 3300005468 Bacteria 2203
68 Ga0068853_100058607 3300005539 Bacteria 3324
69 Ga0070672_100189323 3300005543 Bacteria 1717
70 Ga0070695_100297049 3300005545 Bacteria 1192
71 Ga0070696_100101390 3300005546 Bacteria 2063
72 Ga0070693_100235145 3300005547 Bacteria 1207
73 Ga0070704_100133556 3300005549 Bacteria 1927
74 Ga0070704_100298433 3300005549 Bacteria 1341
75 Ga0070664_100531464 3300005564 Bacteria 1086
76 Ga0068854_100069553 3300005578 Bacteria 2570
77 Ga0068856_100021793 3300005614 Bacteria 6227
78 Ga0068856_100100307 3300005614 Bacteria 2887
79 Ga0070702_100030685 3300005615 Bacteria 2932
80 Ga0070702_100184407 3300005615 Bacteria 1368
81 Ga0068852_100181218 3300005616 Bacteria 1981
82 Ga0068859_100130301 3300005617 Bacteria 2586
83 Ga0068864_100036323 3300005618 Bacteria 4199
84 Ga0068866_10059848 3300005718 Bacteria 1972
85 Ga0068866_10152799 3300005718 Bacteria 1338
86 Ga0068866_10191066 3300005718 Bacteria 1217
87 Ga0068861_100076648 3300005719 Bacteria 2606
88 Ga0068870_10037494 3300005840 Bacteria 2499
89 Ga0068870_10067519 3300005840 Bacteria 1940
90 Ga0068863_100071447 3300005841 Bacteria 3283
91 Ga0068858_100106930 3300005842 Bacteria 2611
92 Ga0068858_100363881 3300005842 Bacteria 1386
93 Ga0068860_100137333 3300005843 Bacteria 2348
94 Ga0068860_100410211 3300005843 Bacteria 1341
95 Ga0068862_100078615 3300005844 Bacteria 2858
96 Ga0068862_100607825 3300005844 Bacteria 1050
97 Ga0081455_10031783 3300005937 Bacteria 4768
98 Ga0081538_10007282 3300005981 Bacteria 9590
99 Ga0081538_10013417 3300005981 Bacteria 6488
100 Ga0081538_10020096 3300005981 Bacteria 4933
101 Ga0081539_10001911 3300005985 Bacteria 32260
102 Ga0081539_10002039 3300005985 Bacteria 30434
103 Ga0081539_10005602 3300005985 Bacteria 12656
104 Ga0081539_10028201 3300005985 Bacteria 3535
105 Ga0070717_10083515 3300006028 Bacteria 2686
106 Ga0070717_10111601 3300006028 Bacteria 2333
107 Ga0070717_10323305 3300006028 Bacteria 1375
108 Ga0070717_10421529 3300006028 Bacteria 1200
109 Ga0075363_100001332 3300006048 Bacteria 9260
110 Ga0075363_100175879 3300006048 Bacteria 1216
111 Ga0070715_10004891 3300006163 Bacteria 4439
112 Ga0070716_100019475 3300006173 Bacteria 3547
113 Ga0070716_100054233 3300006173 Bacteria 2289
114 Ga0068871_100098224 3300006358 Bacteria 2449
115 Ga0075428_100002335 3300006844 Bacteria 20588
116 Ga0075428_100051364 3300006844 Bacteria 4521
117 Ga0075430_100026112 3300006846 Bacteria 4969
118 Ga0075430_100072408 3300006846 Bacteria 2890
119 Ga0075430_100202626 3300006846 Bacteria 1647
120 Ga0075431_100201619 3300006847 Bacteria 2035
121 Ga0075433_10016326 3300006852 Bacteria 6115
122 Ga0075434_100019077 3300006871 Bacteria 6628
123 Ga0075429_100090918 3300006880 Bacteria 2662
124 Ga0068865_100083333 3300006881 Bacteria 2301
125 Ga0075436_100240410 3300006914 Bacteria 1288
126 Ga0097620_100130309 3300006931 Bacteria 2586
127 Ga0099826_10112892 3300006948 Bacteria 1615
128 Ga0075435_100017358 3300007076 Bacteria 5447
129 Ga0099795_10032564 3300007788 Bacteria 1803
130 Ga0105244_10027672 3300009036 Bacteria 3053
131 Ga0105244_10035787 3300009036 Bacteria 2606
132 Ga0105250_10014173 3300009092 Bacteria 3279
133 Ga0105240_10232985 3300009093 Bacteria 2139
134 Ga0111539_10201896 3300009094 Bacteria 2318
135 Ga0111539_10425385 3300009094 Bacteria 1547
136 Ga0105245_10095034 3300009098 Bacteria 2749
137 Ga0105245_10293825 3300009098 Bacteria 1592
138 Ga0105247_10094430 3300009101 Bacteria 1903
139 Ga0114129_10002238 3300009147 Bacteria 26708
140 Ga0114129_10006340 3300009147 Bacteria 16774
141 Ga0114129_10121840 3300009147 Bacteria 3589
142 Ga0114129_10248132 3300009147 Bacteria 2391
143 Ga0105243_10211219 3300009148 Bacteria 1709
144 Ga0105243_10313558 3300009148 Bacteria 1426
145 Ga0105241_10190504 3300009174 Bacteria 1707
146 Ga0105242_10193803 3300009176 Bacteria 1801
147 Ga0105248_10120250 3300009177 Bacteria 2963
148 Ga0105238_10155910 3300009551 Bacteria 2259
149 Ga0105238_10229048 3300009551 Bacteria 1835
150 Ga0105238_10267275 3300009551 Bacteria 1691
151 Ga0105249_10377205 3300009553 Bacteria 1443
152 Ga0105239_10210791 3300010375 Bacteria 2178
153 Ga0105239_10244205 3300010375 Bacteria 2015
154 Ga0105239_10272667 3300010375 Bacteria 1903
155 Ga0105246_10010978 3300011119 Bacteria 5615
156 Ga0105246_10136270 3300011119 Bacteria 1840
157 Ga0157371_10054782 3300013102 Bacteria 2831
158 Ga0157370_10014391 3300013104 Bacteria 8089
159 Ga0157370_10140937 3300013104 Bacteria 2246
160 Ga0157369_10007585 3300013105 Bacteria 12486
161 Ga0157369_10063572 3300013105 Bacteria 3976
162 Ga0157369_10193114 3300013105 Bacteria 2138
163 Ga0157374_10252055 3300013296 Bacteria 1737
164 Ga0157378_10228658 3300013297 Bacteria 1771
165 Ga0163162_10041447 3300013306 Bacteria 4607
166 Ga0163162_10185644 3300013306 Bacteria 2206
167 Ga0163162_10187843 3300013306 Bacteria 2193
168 Ga0157372_10304107 3300013307 Bacteria 1855
169 Ga0157372_10429327 3300013307 Bacteria 1540
170 Ga0157375_10008683 3300013308 Bacteria 8905
171 Ga0157375_10304096 3300013308 Bacteria 1758
172 Ga0157375_10357746 3300013308 Bacteria 1626
173 Ga0163163_10361280 3300014325 Bacteria 1508
174 Ga0157380_10044779 3300014326 Bacteria 3469
175 Ga0157380_10087454 3300014326 Bacteria 2562
176 Ga0182008_10001253 3300014497 Bacteria 17425
177 Ga0182008_10092955 3300014497 Bacteria 1488
178 Ga0157377_10038572 3300014745 Bacteria 2639
179 Ga0157379_10129161 3300014968 Bacteria 2274
180 Ga0182007_10009486 3300015262 Bacteria 3918
181 Ga0183367_1001 3300015688 Bacteria 1225545
182 Ga0163161_10059058 3300017792 Bacteria 2788
183 Ga0209051_1011931 3300025303 Bacteria 4244
184 Ga0207697_10001554 3300025315 Bacteria 12403
185 Ga0207697_10013957 3300025315 Bacteria 3344
186 Ga0207656_10100562 3300025321 Bacteria 1325
187 Ga0207655_1027201 3300025728 Bacteria 2730
188 Ga0207653_10005382 3300025885 Bacteria 4000
189 Ga0207682_10036006 3300025893 Bacteria 2001
190 Ga0207692_10016241 3300025898 Bacteria 3291
191 Ga0207692_10025252 3300025898 Bacteria 2772
192 Ga0207692_10146736 3300025898 Bacteria 1347
193 Ga0207688_10041511 3300025901 Bacteria 2559
194 Ga0207688_10058232 3300025901 Bacteria 2174
195 Ga0207688_10145964 3300025901 Bacteria 1395
196 Ga0207680_10212010 3300025903 Bacteria 1324
197 Ga0207647_10148132 3300025904 Bacteria 1373
198 Ga0207699_10069689 3300025906 Bacteria 2145
199 Ga0207699_10299085 3300025906 Bacteria 1123
200 Ga0207645_10003084 3300025907 Bacteria 12788
201 Ga0207645_10031073 3300025907 Bacteria 3439
202 Ga0207643_10008448 3300025908 Bacteria 5526
203 Ga0207705_10001278 3300025909 Bacteria 20175
204 Ga0207705_10163159 3300025909 Bacteria 1675
205 Ga0207693_10266846 3300025915 Bacteria 1342
206 Ga0207693_10307924 3300025915 Bacteria 1240
207 Ga0207663_10267341 3300025916 Bacteria 1265
208 Ga0207662_10066950 3300025918 Bacteria 2165
209 Ga0207657_10062162 3300025919 Bacteria 3199
210 Ga0207652_10072244 3300025921 Bacteria 3000
211 Ga0207646_10043317 3300025922 Bacteria 4043
212 Ga0207681_10037972 3300025923 Bacteria 3187
213 Ga0207681_10071132 3300025923 Bacteria 2425
214 Ga0207659_10028255 3300025926 Bacteria 3810
215 Ga0207687_10018087 3300025927 Bacteria 4650
216 Ga0207687_10063449 3300025927 Bacteria 2616
217 Ga0207687_10118163 3300025927 Bacteria 1979
218 Ga0207700_10095231 3300025928 Bacteria 2361
219 Ga0207664_10040745 3300025929 Bacteria 3614
220 Ga0207664_10043723 3300025929 Bacteria 3506
221 Ga0207706_10284058 3300025933 Bacteria 1443
222 Ga0207686_10075145 3300025934 Bacteria 2186
223 Ga0207709_10055200 3300025935 Bacteria 2453
224 Ga0207670_10276531 3300025936 Bacteria 1307
225 Ga0207704_10012717 3300025938 Bacteria 4183
226 Ga0207665_10290453 3300025939 Bacteria 1219
227 Ga0207691_10000469 3300025940 Bacteria 39908
228 Ga0207691_10109193 3300025940 Bacteria 2461
229 Ga0207689_10079381 3300025942 Bacteria 2697
230 Ga0207689_10247867 3300025942 Bacteria 1473
231 Ga0207661_10065810 3300025944 Bacteria 2943
232 Ga0207661_10133411 3300025944 Bacteria 2130
233 Ga0207651_10035277 3300025960 Bacteria 3250
234 Ga0207651_10109454 3300025960 Bacteria 2070
235 Ga0207712_10210608 3300025961 Bacteria 1548
236 Ga0207712_10225569 3300025961 Bacteria 1501
237 Ga0207668_10023437 3300025972 Bacteria 3967
238 Ga0207640_10091970 3300025981 Bacteria 2103
239 Ga0207658_10030161 3300025986 Bacteria 3837
240 Ga0207677_10072049 3300026023 Bacteria 2441
241 Ga0207677_10103413 3300026023 Bacteria 2103
242 Ga0207703_10067941 3300026035 Bacteria 2935
243 Ga0207703_10195047 3300026035 Bacteria 1796
244 Ga0207678_10006777 3300026067 Bacteria 10154
245 Ga0207678_10164005 3300026067 Bacteria 1897
246 Ga0207678_10269127 3300026067 Bacteria 1461
247 Ga0207678_10315368 3300026067 Bacteria 1345
248 Ga0207708_10018814 3300026075 Bacteria 5203
249 Ga0207708_10088421 3300026075 Bacteria 2386
250 Ga0207702_10020919 3300026078 Bacteria 5414
251 Ga0207702_10319612 3300026078 Bacteria 1478
252 Ga0207648_10156802 3300026089 Bacteria 2009
253 Ga0207676_10010413 3300026095 Bacteria 6620
254 Ga0207674_10117417 3300026116 Bacteria 2631
255 Ga0207675_100158503 3300026118 Bacteria 2158
256 Ga0207675_100283651 3300026118 Bacteria 1610
257 Ga0207683_10104334 3300026121 Bacteria 2533
258 Ga0207683_10151673 3300026121 Bacteria 2092
259 Ga0207683_10214345 3300026121 Bacteria 1753
260 Ga0207683_10313682 3300026121 Bacteria 1436
261 Ga0207683_10345990 3300026121 Bacteria 1364
262 Ga0207698_10109210 3300026142 Bacteria 2314
263 Ga0207698_10148117 3300026142 Bacteria 2033
264 Ga0207698_10232836 3300026142 Bacteria 1673
265 Ga0207698_10619034 3300026142 Bacteria 1069
266 Ga0209813_10066393 3300027866 Bacteria 1164
267 Ga0207428_10005972 3300027907 Bacteria 11274
268 Ga0268266_10107051 3300028379 Bacteria 2472
269 Ga0268265_10036321 3300028380 Bacteria 3608
270 Ga0268264_10292426 3300028381 Bacteria 1530
271 Ga0268264_10437633 3300028381 Bacteria 1264
272 Ga0307517_10004208 3300028786 Bacteria 22182
273 Ga0307515_10000046 3300028794 Bacteria 293319
274 Ga0307515_10000149 3300028794 Bacteria 169663
275 Ga0307515_10034314 3300028794 Bacteria 8314
276 Ga0307511_10004532 3300030521 Bacteria 14170
277 Ga0307511_10026828 3300030521 Bacteria 5277
278 Ga0307512_10009639 3300030522 Bacteria 9284
279 Ga0307512_10065667 3300030522 Bacteria 2748
280 Ga0307512_10116292 3300030522 Bacteria 1738
281 Ga0307513_10008529 3300031456 Bacteria 13096
282 Ga0307513_10086968 3300031456 Bacteria 3202
283 Ga0307509_10018697 3300031507 Bacteria 7936
284 Ga0307509_10051169 3300031507 Bacteria 4420
285 Ga0307509_10099927 3300031507 Bacteria 2941
286 Ga0307408_100001087 3300031548 Bacteria 20790
287 Ga0307408_100013603 3300031548 Bacteria 5403
288 Ga0307408_100015963 3300031548 Bacteria 5007
289 Ga0307408_100037920 3300031548 Bacteria 3397
290 Ga0307408_100074614 3300031548 Bacteria 2517
291 Ga0307408_100328078 3300031548 Bacteria 1291
292 Ga0307508_10005047 3300031616 Bacteria 12676
293 Ga0307508_10007365 3300031616 Bacteria 10252
294 Ga0307508_10011478 3300031616 Bacteria 8091
295 Ga0307508_10124426 3300031616 Bacteria 2181
296 Ga0307508_10142436 3300031616 Bacteria 2001
297 Ga0307514_10006879 3300031649 Bacteria 9846
298 Ga0307514_10173395 3300031649 Bacteria 1404
299 Ga0307516_10010982 3300031730 Bacteria 9898
300 Ga0307516_10013623 3300031730 Bacteria 8642
301 Ga0307516_10020452 3300031730 Bacteria 6838
302 Ga0307405_10002066 3300031731 Bacteria 8739
303 Ga0307405_10006030 3300031731 Bacteria 5922
304 Ga0307405_10007947 3300031731 Bacteria 5347
305 Ga0307405_10019009 3300031731 Bacteria 3805
306 Ga0307405_10043060 3300031731 Bacteria 2751
307 Ga0307405_10051669 3300031731 Bacteria 2551
308 Ga0307405_10062249 3300031731 Bacteria 2362
309 Ga0307405_10075179 3300031731 Bacteria 2187
310 Ga0307413_10036545 3300031824 Bacteria 2828
311 Ga0307413_10038517 3300031824 Bacteria 2772
312 Ga0307413_10074884 3300031824 Bacteria 2146
313 Ga0307413_10078030 3300031824 Bacteria 2111
314 Ga0307413_10306170 3300031824 Bacteria 1207
315 Ga0307518_10098538 3300031838 Bacteria 2095
316 Ga0307518_10143289 3300031838 Bacteria 1663
317 Ga0307518_10144341 3300031838 Bacteria 1655
318 Ga0307410_10001911 3300031852 Bacteria 9755
319 Ga0307410_10002556 3300031852 Bacteria 8816
320 Ga0307410_10002873 3300031852 Bacteria 8474
321 Ga0307410_10004357 3300031852 Bacteria 7305
322 Ga0307410_10008843 3300031852 Bacteria 5614
323 Ga0307410_10017872 3300031852 Bacteria 4270
324 Ga0307410_10032306 3300031852 Bacteria 3366
325 Ga0307410_10071187 3300031852 Bacteria 2411
326 Ga0307410_10110484 3300031852 Bacteria 1988
327 Ga0307406_10000246 3300031901 Bacteria 32799
328 Ga0307406_10022105 3300031901 Bacteria 3771
329 Ga0307406_10042293 3300031901 Bacteria 2844
330 Ga0307406_10068658 3300031901 Bacteria 2315
331 Ga0307406_10103248 3300031901 Bacteria 1946
332 Ga0307407_10010005 3300031903 Bacteria 4450
333 Ga0307407_10015923 3300031903 Bacteria 3731
334 Ga0307407_10028538 3300031903 Bacteria 2984
335 Ga0307407_10071207 3300031903 Bacteria 2069
336 Ga0307407_10121535 3300031903 Bacteria 1656
337 Ga0307412_10000650 3300031911 Bacteria 20172
338 Ga0307412_10007944 3300031911 Bacteria 6047
339 Ga0307412_10029499 3300031911 Bacteria 3443
340 Ga0307412_10063896 3300031911 Bacteria 2485
341 Ga0307412_10146149 3300031911 Bacteria 1738
342 Ga0307409_100000284 3300031995 Bacteria 20526
343 Ga0307409_100000345 3300031995 Bacteria 19238
344 Ga0307409_100001116 3300031995 Bacteria 12709
345 Ga0307409_100006051 3300031995 Bacteria 7062
346 Ga0307409_100045288 3300031995 Bacteria 3320
347 Ga0307409_100052036 3300031995 Bacteria 3137
348 Ga0307409_100080596 3300031995 Bacteria 2627
349 Ga0307409_100207043 3300031995 Bacteria 1760
350 Ga0307409_100230855 3300031995 Bacteria 1677
351 Ga0307416_100000283 3300032002 Bacteria 26909
352 Ga0307416_100013462 3300032002 Bacteria 5560
353 Ga0307416_100022366 3300032002 Bacteria 4562
354 Ga0307416_100028781 3300032002 Bacteria 4138
355 Ga0307416_100030951 3300032002 Bacteria 4022
356 Ga0307416_100051065 3300032002 Bacteria 3300
357 Ga0307416_100065519 3300032002 Bacteria 2986
358 Ga0307416_100086492 3300032002 Bacteria 2672
359 Ga0307416_100111683 3300032002 Bacteria 2410
360 Ga0307416_100148632 3300032002 Bacteria 2144
361 Ga0307416_100172751 3300032002 Bacteria 2014
362 Ga0307416_100224953 3300032002 Bacteria 1803
363 Ga0307416_100258020 3300032002 Bacteria 1702
364 Ga0307416_100366314 3300032002 Bacteria 1465
365 Ga0307416_100445977 3300032002 Bacteria 1345
366 Ga0307414_10006263 3300032004 Bacteria 6623
367 Ga0307414_10071803 3300032004 Bacteria 2498
368 Ga0307414_10278033 3300032004 Bacteria 1405
369 Ga0307411_10028810 3300032005 Bacteria 3381
370 Ga0307411_10030404 3300032005 Bacteria 3310
371 Ga0307411_10165807 3300032005 Bacteria 1660
372 Ga0307415_100000587 3300032126 Bacteria 15854
373 Ga0307415_100000874 3300032126 Bacteria 13768
374 Ga0307415_100011275 3300032126 Bacteria 5108
375 Ga0307415_100092963 3300032126 Bacteria 2189
376 Ga0307415_100313106 3300032126 Bacteria 1305
377 Ga0307507_10015481 3300033179 Bacteria 8966
378 Ga0307507_10047057 3300033179 Bacteria 4219
379 Ga0307510_10005834 3300033180 Bacteria 14683
380 Ga0307510_10040367 3300033180 Bacteria 5123
381 Ga0307510_10188532 3300033180 Bacteria 1614
382 Ga0373940_0005970 3300035088 Bacteria 2674
383 Ga0373949_0037053 3300035090 Bacteria 1185
384 Ga0373951_0000019 3300035091 Bacteria 63710
385 Ga0373952_0025795 3300035092 Bacteria 1272
386 Ga0373932_0005473 3300035112 Bacteria 2988
387 Ga0373941_0002472 3300035115 Bacteria 4075
388 Ga0373942_0010964 3300035207 Bacteria 2141
389 Ga0373962_0030264 3300035242 Bacteria 1480
390 Ga0373931_0106548 3300035691 Bacteria 1584
391 Ga0373933_0141066 3300035724 Bacteria 1521
392 Ga0373937_0068047 3300036401 Bacteria 3282
393 Ga0372808_010586 3300036459 Bacteria 1299
394 Ga0395899_0029025 3300037312 Bacteria 4161
395 Ga0395899_0048530 3300037312 Bacteria 3159
396 Ga0395899_0112409 3300037312 Bacteria 1957
397 Ga0395900_0011877 3300037418 Bacteria 8906
398 Ga0395900_0031797 3300037418 Bacteria 5424
399 Ga0395900_0038477 3300037418 Bacteria 4930
400 Ga0395900_0059154 3300037418 Bacteria 3945
401 Ga0395900_0154470 3300037418 Bacteria 2344
402 Ga0395900_0202646 3300037418 Bacteria 2007
403 Ga0395898_0011687 3300037466 Bacteria 9106
404 Ga0395898_0036719 3300037466 Bacteria 4864
405 Ga0395898_0048221 3300037466 Bacteria 4178
406 Ga0395898_0203521 3300037466 Bacteria 1889
407 Ga0395898_0218205 3300037466 Bacteria 1819
408 Ga0395898_0334844 3300037466 Bacteria 1443
409 Ga0395905_0013363 3300037471 Bacteria 7867
410 Ga0395905_0090804 3300037471 Bacteria 2864
411 Ga0395905_0161863 3300037471 Bacteria 2103
412 Ga0395905_0351820 3300037471 Bacteria 1365
413 Ga0436364_0980706 3300037853 Bacteria 3197
414 Ga0395901_0027568 3300038443 Bacteria 5838
415 Ga0395901_0075983 3300038443 Bacteria 3504
416 Ga0395901_0178063 3300038443 Bacteria 2230
417 Ga0395901_0395959 3300038443 Bacteria 1419
418 Ga0395901_0521874 3300038443 Bacteria 1206
419 Ga0436363_1613141 3300039450 Bacteria 2364
420 Ga0439436_0000890 3300041404 Bacteria 8176
421 Ga0439436_0001737 3300041404 Bacteria 6385
422 Ga0439436_0032572 3300041404 Bacteria 1511
423 Ga0439466_0048903 3300041411 Bacteria 1390
424 Ga0451837_1508489 3300041494 Bacteria 1301
425 Ga0451853_0498644 3300041512 Bacteria 1523
426 Ga0451853_3326361 3300041512 Bacteria 7161
427 Ga0439433_0001547 3300041999 Bacteria 4765
428 Ga0439448_0027207 3300042005 Bacteria 1801
429 Ga0439448_0027541 3300042005 Bacteria 1792
430 Ga0439449_0001011 3300042007 Bacteria 11090
431 Ga0439449_0001639 3300042007 Bacteria 8773
432 Ga0439449_0003409 3300042007 Bacteria 6184
433 Ga0439455_0021323 3300042012 Bacteria 1544
434 Ga0439457_000317 3300042014 Bacteria 13318
435 Ga0439457_001433 3300042014 Bacteria 7172
436 Ga0439462_0002416 3300042015 Bacteria 4336
437 Ga0439462_0027327 3300042015 Bacteria 1506
438 Ga0450894_000335 3300042131 Bacteria 8295
439 Ga0450896_001171 3300042133 Bacteria 3138
440 Ga0450898_002836 3300042134 Bacteria 2439
441 Ga0450899_000754 3300042135 Bacteria 3693
442 Ga0450903_000618 3300042138 Bacteria 7184
443 Ga0439458_0001937 3300042157 Bacteria 5133
444 Ga0439458_0002826 3300042157 Bacteria 4179
445 Ga0439458_0033476 3300042157 Bacteria 1231
446 Ga0450908_006312 3300042184 Bacteria 2255
447 Ga0439434_0035638 3300042435 Bacteria 1521
448 Ga0439444_0005125 3300042437 Bacteria 1935
449 Ga0439460_0026898 3300042461 Bacteria 1612
450 Ga0439440_0010269 3300042993 Bacteria 1953
451 Ga0466969_0033377 3300044656 Bacteria 2613
452 Ga0466965_0000288 3300044683 Bacteria 16687
453 Ga0466965_0001958 3300044683 Bacteria 8611
454 Ga0466966_0002830 3300044684 Bacteria 11416
455 Ga0466961_0012755 3300044693 Bacteria 5381
456 Ga0466961_0023127 3300044693 Bacteria 3996
457 Ga0466961_0108287 3300044693 Bacteria 1749
458 Ga0466963_0001177 3300044694 Bacteria 13738
459 Ga0466963_0025611 3300044694 Bacteria 3764
460 Ga0466964_0001884 3300044706 Bacteria 7323
461 Ga0466971_0001045 3300044719 Bacteria 11476
462 Ga0466971_0004284 3300044719 Bacteria 6150
463 Ga0466968_0015344 3300044735 Bacteria 3035
464 Ga0466970_0015696 3300044765 Bacteria 3899
465 Ga0466970_0021714 3300044765 Bacteria 3345
466 Ga0466970_0032738 3300044765 Bacteria 2747
467 Ga0466957_0009571 3300044842 Bacteria 5534
468 Ga0466960_0002703 3300044901 Bacteria 6701
469 Ga0466960_0102429 3300044901 Bacteria 1476
470 Ga0466959_0008657 3300045049 Bacteria 7203
471 Ga0466959_0008896 3300045049 Bacteria 7120
472 Ga0466958_0001015 3300045836 Bacteria 12747
473 Ga0466967_0017691 3300045976 Bacteria 5670
474 Ga0466967_0029886 3300045976 Bacteria 4566
475 Ga0495592_0064011 3300046454 Bacteria 2696
476 Ga0495592_0107800 3300046454 Bacteria 1975
477 Ga0495603_0101371 3300046455 Bacteria 1681
478 Ga0495629_0001242 3300046459 Bacteria 20032
479 Ga0495638_0023679 3300046460 Bacteria 4012
480 Ga0495638_0049225 3300046460 Bacteria 2635
481 Ga0495641_0011219 3300046461 Bacteria 5125
482 Ga0495651_0013761 3300046462 Bacteria 6255
483 Ga0495651_0020708 3300046462 Bacteria 5106
484 Ga0495653_0006973 3300046463 Bacteria 9278
485 Ga0495653_0014112 3300046463 Bacteria 6514
486 Ga0495650_0030033 3300046471 Bacteria 2468
487 Ga0495580_0010354 3300046472 Bacteria 7269
488 Ga0495582_0049898 3300046473 Bacteria 2305
489 Ga0495582_0058050 3300046473 Bacteria 2134
490 Ga0495582_0088840 3300046473 Bacteria 1722
491 Ga0495662_0000305 3300046476 Bacteria 21349
492 Ga0495662_0002045 3300046476 Bacteria 10107
493 Ga0495664_0000787 3300046477 Bacteria 16209
494 Ga0495664_0062036 3300046477 Bacteria 2226
495 Ga0495594_0208080 3300046499 Bacteria 1115
496 Ga0495583_0073461 3300046506 Bacteria 1499
497 Ga0495608_0004232 3300046511 Bacteria 10289
498 Ga0495608_0231526 3300046511 Bacteria 1156
499 Ga0495618_0053782 3300046514 Bacteria 2546
500 Ga0495628_0008624 3300046516 Bacteria 8734
501 Ga0495628_0044866 3300046516 Bacteria 3515
502 Ga0495630_0027130 3300046517 Bacteria 4245
503 Ga0495666_0009586 3300046526 Bacteria 4840
504 Ga0495652_0000478 3300046529 Bacteria 46945
505 Ga0495652_0047462 3300046529 Bacteria 3682
506 Ga0495652_0064012 3300046529 Bacteria 3095
507 Ga0495665_0027028 3300046531 Bacteria 3081
508 Ga0495665_0032757 3300046531 Bacteria 2780
509 Ga0495640_0007509 3300046533 Bacteria 8567
510 Ga0495640_0016128 3300046533 Bacteria 5594
511 Ga0495640_0083092 3300046533 Bacteria 2126
512 Ga0495586_0001649 3300046535 Bacteria 12250
513 Ga0495586_0004174 3300046535 Bacteria 7739
514 Ga0495587_0003178 3300046536 Bacteria 10984
515 Ga0495645_0038329 3300046543 Bacteria 3496
516 Ga0495645_0175166 3300046543 Bacteria 1474
517 Ga0495656_0002914 3300046615 Bacteria 5732
518 Ga0495656_0010283 3300046615 Bacteria 3396
519 Ga0495668_0017386 3300046616 Bacteria 4171
520 Ga0495634_0014249 3300046642 Bacteria 5736
521 Ga0495634_0054241 3300046642 Bacteria 2684
522 Ga0495634_0092780 3300046642 Bacteria 1958
523 Ga0495625_0072160 3300046660 Bacteria 2421
524 Ga0495635_0005045 3300046663 Bacteria 9181
525 Ga0495635_0037566 3300046663 Bacteria 3352
526 Ga0495635_0039076 3300046663 Bacteria 3285
527 Ga0495659_0014425 3300046664 Bacteria 2586
528 Ga0495588_0002246 3300046674 Bacteria 8268
529 Ga0495588_0014737 3300046674 Bacteria 3748
530 Ga0495657_0029330 3300046675 Bacteria 3859
531 Ga0495599_0023853 3300046678 Bacteria 3824
532 Ga0495623_0014038 3300046679 Bacteria 5190
533 Ga0495623_0076761 3300046679 Bacteria 2073
534 Ga0495646_0006479 3300046680 Bacteria 7428
535 Ga0495646_0015364 3300046680 Bacteria 4859
536 Ga0495646_0029621 3300046680 Bacteria 3421
537 Ga0495658_0052702 3300046683 Bacteria 2309
538 Ga0495658_0137347 3300046683 Bacteria 1493
539 Ga0495613_0011479 3300046689 Bacteria 6588
540 Ga0495613_0012535 3300046689 Bacteria 6300
541 Ga0495613_0016742 3300046689 Bacteria 5459
542 Ga0495624_0157423 3300046690 Bacteria 1388
543 Ga0495670_0003869 3300046691 Bacteria 7354
544 Ga0495670_0115866 3300046691 Bacteria 1389
545 Ga0495670_0257325 3300046691 Bacteria 931
546 Ga0495671_0073198 3300046692 Bacteria 1682
547 Ga0495589_0026127 3300046794 Bacteria 2960
548 Ga0495600_0015054 3300046809 Bacteria 4884
549 Ga0495600_0034379 3300046809 Bacteria 3290
550 Ga0495581_0001698 3300047315 Bacteria 12258
551 Ga0495581_0055951 3300047315 Bacteria 2277
552 Ga0495581_0073781 3300047315 Bacteria 1974
553 Ga0495604_0000491 3300047317 Bacteria 34687
554 Ga0495604_0000811 3300047317 Bacteria 26210
555 Ga0495604_0187915 3300047317 Bacteria 1441
556 Ga0495674_0013289 3300047319 Bacteria 7742
557 Ga0495674_0069188 3300047319 Bacteria 3053
558 Ga0495674_0104386 3300047319 Bacteria 2409
559 Ga0495676_0052067 3300047321 Bacteria 3271
560 Ga0495676_0106092 3300047321 Bacteria 2070
561 Ga0495676_0165950 3300047321 Bacteria 1558
562 Ga0495680_0029374 3300047322 Bacteria 4502
563 Ga0495687_001428 3300047443 Bacteria 21988
564 Ga0495687_011432 3300047443 Bacteria 4775
565 Ga0495687_013341 3300047443 Bacteria 4299
566 Ga0495687_013809 3300047443 Bacteria 4191
567 Ga0495675_0081073 3300047444 Bacteria 2043
568 Ga0495685_002934 3300047447 Bacteria 5394
569 Ga0495685_013905 3300047447 Bacteria 2731
570 Ga0495685_031108 3300047447 Bacteria 1835
571 Ga0495681_0014664 3300047470 Bacteria 4479
572 Ga0495684_0029444 3300047471 Bacteria 4214
573 Ga0495684_0202687 3300047471 Bacteria 1462
574 Ga0495593_0003017 3300047673 Bacteria 10141
575 Ga0495614_0005221 3300048089 Bacteria 5859
576 Ga0495614_0032534 3300048089 Bacteria 2245
577 Ga0496100_0017676 3300048903 Bacteria 4216
578 Ga0496100_0019713 3300048903 Bacteria 4029
579 Ga0496100_0174559 3300048903 Bacteria 1550
580 Ga0496101_0006250 3300048904 Bacteria 7662
581 Ga0496101_0037432 3300048904 Bacteria 3441
582 Ga0496102_0017330 3300048905 Bacteria 6308
583 Ga0496102_0042309 3300048905 Bacteria 4128
584 Ga0496102_0081798 3300048905 Bacteria 2978
585 Ga0496102_0131030 3300048905 Bacteria 2347
586 Ga0496102_0138120 3300048905 Bacteria 2284
587 Ga0496103_0004152 3300048906 Bacteria 8795
588 Ga0496103_0014625 3300048906 Bacteria 4663
589 Ga0496103_0138594 3300048906 Bacteria 1555
590 Ga0496103_0202118 3300048906 Bacteria 1278
591 Ga0496103_0244184 3300048906 Bacteria 1155
592 Ga0496104_0034413 3300048907 Bacteria 4724
593 Ga0496104_0054109 3300048907 Bacteria 3793
594 Ga0496104_0114339 3300048907 Bacteria 2588
595 Ga0496104_0152172 3300048907 Bacteria 2220
596 Ga0496104_0162145 3300048907 Bacteria 2144
597 Ga0496104_0498523 3300048907 Bacteria 1129
598 Ga0496105_0030685 3300048908 Bacteria 4404
599 Ga0496105_0036895 3300048908 Bacteria 4027
600 Ga0496105_0087609 3300048908 Bacteria 2572
601 Ga0496105_0176717 3300048908 Bacteria 1749
602 Ga0496105_0337965 3300048908 Bacteria 1204
603 Ga0496106_0010795 3300048909 Bacteria 6752
604 Ga0496106_0018727 3300048909 Bacteria 5128
605 Ga0496106_0177977 3300048909 Bacteria 1688
606 Ga0496106_0192120 3300048909 Bacteria 1624
607 Ga0496106_0254309 3300048909 Bacteria 1405
608 Ga0496107_0030794 3300048910 Bacteria 3826
609 Ga0496108_0000589 3300048911 Bacteria 28452
610 Ga0496108_0010745 3300048911 Bacteria 7433
611 Ga0496108_0144228 3300048911 Bacteria 2052
612 Ga0496108_0184540 3300048911 Bacteria 1807
613 Ga0496108_0232607 3300048911 Bacteria 1603
614 Ga0496108_0354496 3300048911 Bacteria 1280
615 Ga0496108_0415896 3300048911 Bacteria 1174
616 Ga0496108_0440146 3300048911 Bacteria 1139
617 Ga0496109_0008180 3300048912 Bacteria 8873
618 Ga0496109_0019238 3300048912 Bacteria 6016
619 Ga0496109_0084490 3300048912 Bacteria 2929
620 Ga0496109_0096411 3300048912 Bacteria 2740
621 Ga0496109_0146228 3300048912 Bacteria 2211
622 Ga0496109_0180149 3300048912 Bacteria 1984
623 Ga0496109_0313909 3300048912 Bacteria 1479
624 Ga0496109_0353657 3300048912 Bacteria 1388
625 Ga0496110_0008537 3300048913 Bacteria 8248
626 Ga0496110_0050548 3300048913 Bacteria 3650
627 Ga0496110_0189898 3300048913 Bacteria 1866
628 Ga0496110_0211866 3300048913 Bacteria 1762
629 Ga0496110_0690939 3300048913 Bacteria 921
630 Ga0496111_0041567 3300048914 Bacteria 3299
631 Ga0496111_0062441 3300048914 Bacteria 2701
632 Ga0496111_0121854 3300048914 Bacteria 1926
633 Ga0496111_0180410 3300048914 Bacteria 1569
634 Ga0496112_0060387 3300048915 Bacteria 3736
635 Ga0496112_0066132 3300048915 Bacteria 3567
636 Ga0496112_0066474 3300048915 Bacteria 3557
637 Ga0496112_0234308 3300048915 Bacteria 1790
638 Ga0496113_0014186 3300048916 Bacteria 5427
639 Ga0496113_0028343 3300048916 Bacteria 4027
640 Ga0496113_0102913 3300048916 Bacteria 2215
641 Ga0496114_0006529 3300048917 Bacteria 9191
642 Ga0496114_0024038 3300048917 Bacteria 4972
643 Ga0496114_0035253 3300048917 Bacteria 4131
644 Ga0496114_0064913 3300048917 Bacteria 3058
645 Ga0496114_0065976 3300048917 Bacteria 3033
646 Ga0496114_0294108 3300048917 Bacteria 1433
647 Ga0496115_0013550 3300048918 Bacteria 6169
648 Ga0496115_0163649 3300048918 Bacteria 1839
649 Ga0496115_0196843 3300048918 Bacteria 1665
650 Ga0496124_0161139 3300048927 Bacteria 1748
651 Ga0501031_0006068 3300049568 Bacteria 7889
652 Ga0501031_0012103 3300049568 Bacteria 5624
653 Ga0501031_0177555 3300049568 Bacteria 1391
654 Ga0501032_0009390 3300049569 Bacteria 7085
655 Ga0501032_0016570 3300049569 Bacteria 5182
656 Ga0501033_0039189 3300049570 Bacteria 3540
657 Ga0501033_0045356 3300049570 Bacteria 3271
658 Ga0501033_0095834 3300049570 Bacteria 2168
659 Ga0501033_0218449 3300049570 Bacteria 1357
660 Ga0501034_0000112 3300049571 Bacteria 150146
661 Ga0501034_0006804 3300049571 Bacteria 12228
662 Ga0501034_0031681 3300049571 Bacteria 5371
663 Ga0501034_0035780 3300049571 Bacteria 5033
664 Ga0501036_0009835 3300049572 Bacteria 7874
665 Ga0501036_0016707 3300049572 Bacteria 6129
666 Ga0501036_0017920 3300049572 Bacteria 5928
667 Ga0501036_0035037 3300049572 Bacteria 4246
668 Ga0501036_0222747 3300049572 Bacteria 1584
669 Ga0501037_0004673 3300049573 Bacteria 9946
670 Ga0501037_0056311 3300049573 Bacteria 2872
671 Ga0501037_0132606 3300049573 Bacteria 1786
672 Ga0501037_0140121 3300049573 Bacteria 1731
673 Ga0501038_0000531 3300049574 Bacteria 33483
674 Ga0501038_0041961 3300049574 Bacteria 3987
675 Ga0501038_0054915 3300049574 Bacteria 3424
676 Ga0501038_0059346 3300049574 Bacteria 3277
677 Ga0501039_0002511 3300049575 Bacteria 13672
678 Ga0501040_0007779 3300049576 Bacteria 6939
679 Ga0501041_0010646 3300049577 Bacteria 5423
680 Ga0501042_0004136 3300049578 Bacteria 9225
681 Ga0501042_0195056 3300049578 Bacteria 1460
682 Ga0501043_0002652 3300049579 Bacteria 15046
683 Ga0501043_0016086 3300049579 Bacteria 5867
684 Ga0501043_0082019 3300049579 Bacteria 2534
685 Ga0501046_0025985 3300049580 Bacteria 4785
686 Ga0501046_0043617 3300049580 Bacteria 3570
687 Ga0501047_0083898 3300049581 Bacteria 3062
688 Ga0501047_0102281 3300049581 Bacteria 2744
689 Ga0501048_0000718 3300049582 Bacteria 24244
690 Ga0501048_0021390 3300049582 Bacteria 4736
691 Ga0501068_0038171 3300049584 Bacteria 2877
692 Ga0501070_0001683 3300049586 Bacteria 19591
693 Ga0501071_0000581 3300049587 Bacteria 18895
694 Ga0501073_0237498 3300049589 Bacteria 1259
695 Ga0501074_0011845 3300049590 Bacteria 6341
696 Ga0501074_0027069 3300049590 Bacteria 4155
697 Ga0501075_0018654 3300049591 Bacteria 5023
698 Ga0501077_0061039 3300049593 Bacteria 2392
699 Ga0501202_018009 3300049652 Bacteria 1384
700 Ga0501079_0011500 3300049741 Bacteria 6755
701 Ga0501080_0122212 3300049742 Bacteria 2412
702 Ga0501035_0019778 3300049822 Bacteria 6186
703 Ga0501035_0027151 3300049822 Bacteria 5234
704 Ga0501035_0029689 3300049822 Bacteria 4986
705 Ga0501044_0026941 3300049823 Bacteria 6081
706 Ga0501044_0079634 3300049823 Bacteria 3319
707 Ga0501044_0128852 3300049823 Bacteria 2525
708 Ga0501045_0001415 3300049824 Bacteria 16012
709 Ga0501045_0110852 3300049824 Bacteria 2035
710 nmdc:mga03n38_23039_c1 3300050490 Bacteria 2529
711 nmdc:mga03n38_7358_c1 3300050490 Bacteria 3892
712 nmdc:mga00v17_29651_c1 3300050491 Bacteria 3212
713 nmdc:mga0yw44_189835_c1 3300050492 Bacteria 1355
714 nmdc:mga06z11_3783_c1 3300050494 Bacteria 5889
715 nmdc:mga05p37_13318_c1 3300050507 Bacteria 9850
716 nmdc:mga05p37_42469_c1 3300050507 Bacteria 5587
717 nmdc:mga05p37_4636_c1 3300050507 Bacteria 16078
718 nmdc:mga05p37_73219_c1 3300050507 Bacteria 4216
719 nmdc:mga09592_80800_c1 3300050508 Bacteria 2769
720 nmdc:mga0qj67_18337_c1 3300050509 Bacteria 5334
721 nmdc:mga0qj67_46691_c1 3300050509 Bacteria 3420
722 nmdc:mga0qj67_62106_c1 3300050509 Bacteria 2969
723 nmdc:mga06r32_177344_c1 3300050510 Bacteria 2116
724 nmdc:mga06r32_87637_c1 3300050510 Bacteria 3038
725 nmdc:mga08y16_40577_c1 3300050511 Bacteria 4877
726 nmdc:mga08y16_533362_c1 3300050511 Bacteria 1189
727 nmdc:mga08y16_593918_c1 3300050511 Bacteria 1116
728 nmdc:mga0n895_65935_c1 3300050512 Bacteria 3585
729 nmdc:mga08x19_187122_c1 3300050514 Bacteria 1415
730 nmdc:mga0a205_17567_c1 3300050515 Bacteria 6711
731 nmdc:mga0sz30_31789_c1 3300050516 Bacteria 1826
732 Ga0495601_0016594 3300053077 Bacteria 4464
733 Ga0495601_0063693 3300053077 Bacteria 2343
734 Ga0495612_0008777 3300053078 Bacteria 4097
735 Ga0495612_0015629 3300053078 Bacteria 3043
736 Ga0495619_0010276 3300053085 Bacteria 5893
737 Ga0495619_0031981 3300053085 Bacteria 3412
738 Ga0495619_0059496 3300053085 Bacteria 2538
739 Ga0495619_0135766 3300053085 Bacteria 1692
740 Ga0495619_0152323 3300053085 Bacteria 1595
741 Ga0500578_0073202 3300053086 Bacteria 2182
742 Ga0500644_0041293 3300053088 Bacteria 1531
743 Ga0500583_0035487 3300053092 Bacteria 2226
744 Ga0500583_0106408 3300053092 Bacteria 1378
745 Ga0500640_034651 3300053095 Bacteria 2217
746 Ga0500560_004346 3300053107 Bacteria 3005
747 Ga0500560_015854 3300053107 Bacteria 2044
748 Ga0500652_013987 3300053131 Bacteria 2858
749 Ga0500658_0017085 3300053134 Bacteria 2707
750 Ga0500561_0000666 3300053137 Bacteria 5441
751 Ga0500573_0011060 3300053140 Bacteria 5047
752 Ga0500616_0000495 3300053153 Bacteria 50619
753 Ga0500616_0032244 3300053153 Bacteria 2864
754 Ga0500624_008844 3300053157 Bacteria 1419
755 Ga0500587_005064 3300053739 Bacteria 1787
756 Ga0501084_0018638 3300054114 Bacteria 5778
757 Ga0590075_010080 3300059424 Bacteria 2272
758 Ga0501082_0007900 3300060353 Bacteria 9186
759 Ga0466962_0006897 3300061719 Bacteria 5445
760 Ga0466962_0010113 3300061719 Bacteria 4528
761 Ga0466962_0021927 3300061719 Bacteria 3067

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0690939 Ga0496110_0690939_14_835 263
2 3300049578 Ga0501042_0195056 Ga0501042_0195056_10_876 265
3 3300013104 Ga0157370_10140937 Ga0157370_101409373 267
4 3300048911 Ga0496108_0144228 Ga0496108_0144228_1197_2036 268
5 3300000549 LJQas_1000385 LJQas_10003855 269
6 3300046499 Ga0495594_0208080 Ga0495594_0208080_70_954 285
7 3300046691 Ga0495670_0257325 Ga0495670_0257325_19_903 285
8 3300025303 Ga0209051_1011931 Ga0209051_10119314 295
9 3300031456 Ga0307513_10086968 Ga0307513_100869683 300
10 3300005985 Ga0081539_10005602 Ga0081539_100056024 302
11 3300005353 Ga0070669_100026548 Ga0070669_1000265484 309
12 3300005456 Ga0070678_100030815 Ga0070678_1000308154 309
13 3300009036 Ga0105244_10035787 Ga0105244_100357872 309
14 3300009094 Ga0111539_10425385 Ga0111539_104253851 309
15 3300009101 Ga0105247_10094430 Ga0105247_100944302 309
16 3300013105 Ga0157369_10063572 Ga0157369_100635725 309
17 3300025903 Ga0207680_10212010 Ga0207680_102120101 309
18 3300025907 Ga0207645_10003084 Ga0207645_1000308411 309
19 3300025940 Ga0207691_10000469 Ga0207691_100004697 309
20 3300025960 Ga0207651_10035277 Ga0207651_100352772 309
21 3300046664 Ga0495659_0014425 Ga0495659_0014425_1584_2570 309
22 3300048912 Ga0496109_0084490 Ga0496109_0084490_306_1292 309
23 3300048914 Ga0496111_0062441 Ga0496111_0062441_404_1390 309
24 3300048927 Ga0496124_0161139 Ga0496124_0161139_94_1080 309
25 3300050511 nmdc:mga08y16_593918_c1 nmdc:mga08y16_593918_c1_127_1098 309
26 iso_pu_bacteria 2891395885 2891397905 309
27 3300049741 Ga0501079_0011500 Ga0501079_0011500_1978_2982 310
28 3300013102 Ga0157371_10054782 Ga0157371_100547822 311
29 3300013104 Ga0157370_10014391 Ga0157370_100143918 311
30 3300046689 Ga0495613_0011479 Ga0495613_0011479_2641_3645 311
31 3300049568 Ga0501031_0012103 Ga0501031_0012103_1358_2362 311
32 3300049570 Ga0501033_0039189 Ga0501033_0039189_1914_2918 311
33 3300049572 Ga0501036_0035037 Ga0501036_0035037_513_1517 311
34 3300049574 Ga0501038_0059346 Ga0501038_0059346_683_1687 311
35 3300049575 Ga0501039_0002511 Ga0501039_0002511_3599_4603 311
36 3300049576 Ga0501040_0007779 Ga0501040_0007779_3846_4850 311
37 3300049577 Ga0501041_0010646 Ga0501041_0010646_3096_4100 311
38 3300049582 Ga0501048_0000718 Ga0501048_0000718_2889_3893 311
39 3300049584 Ga0501068_0038171 Ga0501068_0038171_1574_2578 311
40 3300049587 Ga0501071_0000581 Ga0501071_0000581_17810_18814 311
41 3300049590 Ga0501074_0027069 Ga0501074_0027069_2812_3816 311
42 3300049591 Ga0501075_0018654 Ga0501075_0018654_3298_4302 311
43 3300049593 Ga0501077_0061039 Ga0501077_0061039_1340_2344 311
44 3300049822 Ga0501035_0019778 Ga0501035_0019778_3663_4667 311
45 3300049824 Ga0501045_0001415 Ga0501045_0001415_13082_14086 311
46 3300054114 Ga0501084_0018638 Ga0501084_0018638_3786_4790 311
47 3300060353 Ga0501082_0007900 Ga0501082_0007900_6843_7847 311
48 3300044765 Ga0466970_0015696 Ga0466970_0015696_131_1135 312
49 3300049570 Ga0501033_0095834 Ga0501033_0095834_987_1991 312
50 3300049823 Ga0501044_0079634 Ga0501044_0079634_429_1415 312
51 3300053077 Ga0495601_0063693 Ga0495601_0063693_10_972 312
52 3300061719 Ga0466962_0021927 Ga0466962_0021927_459_1463 312
53 3300005456 Ga0070678_100280559 Ga0070678_1002805592 313
54 3300013297 Ga0157378_10228658 Ga0157378_102286582 313
55 3300025898 Ga0207692_10146736 Ga0207692_101467362 313
56 3300025906 Ga0207699_10069689 Ga0207699_100696893 313
57 3300025928 Ga0207700_10095231 Ga0207700_100952312 313
58 3300035112 Ga0373932_0005473 Ga0373932_0005473_1902_2903 313
59 3300048909 Ga0496106_0177977 Ga0496106_0177977_625_1629 313
60 3300048917 Ga0496114_0064913 Ga0496114_0064913_1088_2089 313
61 3300049823 Ga0501044_0128852 Ga0501044_0128852_703_1707 313
62 iso_pu_bacteria 2675903059 2676485659 313
63 3300005435 Ga0070714_100353973 Ga0070714_1003539732 314
64 3300005614 Ga0068856_100021793 Ga0068856_1000217931 314
65 3300005615 Ga0070702_100184407 Ga0070702_1001844071 314
66 3300006028 Ga0070717_10111601 Ga0070717_101116012 314
67 3300025898 Ga0207692_10016241 Ga0207692_100162413 314
68 3300025916 Ga0207663_10267341 Ga0207663_102673412 314
69 3300026078 Ga0207702_10020919 Ga0207702_100209193 314
70 3300035088 Ga0373940_0005970 Ga0373940_0005970_1047_2048 314
71 3300035090 Ga0373949_0037053 Ga0373949_0037053_163_1164 314
72 3300035115 Ga0373941_0002472 Ga0373941_0002472_2745_3746 314
73 3300048903 Ga0496100_0174559 Ga0496100_0174559_175_1176 314
74 3300048913 Ga0496110_0189898 Ga0496110_0189898_135_1136 314
75 3300048918 Ga0496115_0163649 Ga0496115_0163649_87_1088 314
76 iso_pu_bacteria 2873314349 2873316795 314
77 iso_pu_bacteria 8055066027 8055074352 314
78 iso_pu_bacteria 8055172936 8055174687 314
79 3300031838 Ga0307518_10144341 Ga0307518_101443412 315
80 3300049570 Ga0501033_0218449 Ga0501033_0218449_113_1117 315
81 3300049571 Ga0501034_0031681 Ga0501034_0031681_1783_2787 315
82 3300049574 Ga0501038_0041961 Ga0501038_0041961_1212_2216 315
83 3300053092 Ga0500583_0035487 Ga0500583_0035487_1083_2057 315
84 3300037312 Ga0395899_0029025 Ga0395899_0029025_49_1086 316
85 3300037418 Ga0395900_0031797 Ga0395900_0031797_2472_3527 316
86 3300037418 Ga0395900_0154470 Ga0395900_0154470_517_1554 316
87 3300037466 Ga0395898_0048221 Ga0395898_0048221_903_1940 316
88 3300037471 Ga0395905_0013363 Ga0395905_0013363_1362_2417 316
89 3300037471 Ga0395905_0351820 Ga0395905_0351820_76_1113 316
90 3300038443 Ga0395901_0521874 Ga0395901_0521874_35_1072 316
91 3300046794 Ga0495589_0026127 Ga0495589_0026127_1922_2926 316
92 3300047447 Ga0495685_031108 Ga0495685_031108_484_1488 316
93 3300006914 Ga0075436_100240410 Ga0075436_1002404102 318
94 3300007076 Ga0075435_100017358 Ga0075435_1000173584 318
95 3300026035 Ga0207703_10067941 Ga0207703_100679412 318
96 3300028794 Ga0307515_10000149 Ga0307515_1000014926 318
97 3300035092 Ga0373952_0025795 Ga0373952_0025795_162_1163 318
98 3300038443 Ga0395901_0178063 Ga0395901_0178063_179_1216 318
99 3300050514 nmdc:mga08x19_187122_c1 nmdc:mga08x19_187122_c1_287_1288 318
100 iso_pu_bacteria 2537561592 2537900371 318
101 iso_pu_bacteria 2887443736 2887443961 318
102 iso_pu_bacteria 8004021418 8004024289 318
103 iso_pu_bacteria 8004025490 8004025736 318
104 iso_pu_bacteria 2643221711 2644610006 319
105 iso_pu_bacteria 2811994882 2812374458 319
106 iso_pu_bacteria 2816332119 2816423966 319
107 iso_pu_bacteria 2818991318 2819425457 319
108 iso_pu_bacteria 2818991458 2819667833 319
109 iso_pu_bacteria 2818991469 2819730433 319
110 iso_pu_bacteria 2904776348 2904778229 319
111 iso_pu_bacteria 2919034639 2919035602 319
112 iso_pu_bacteria 2919059106 2919060260 319
113 iso_pu_bacteria 2939647034 2939650226 319
114 3300005616 Ga0068852_100181218 Ga0068852_1001812182 320
115 3300010375 Ga0105239_10272667 Ga0105239_102726672 320
116 3300026116 Ga0207674_10117417 Ga0207674_101174173 320
117 3300026142 Ga0207698_10232836 Ga0207698_102328362 320
118 3300028381 Ga0268264_10292426 Ga0268264_102924262 320
119 3300030522 Ga0307512_10009639 Ga0307512_1000963911 320
120 3300031548 Ga0307408_100328078 Ga0307408_1003280782 320
121 3300031616 Ga0307508_10007365 Ga0307508_100073652 320
122 3300031852 Ga0307410_10110484 Ga0307410_101104842 320
123 3300032004 Ga0307414_10278033 Ga0307414_102780332 320
124 3300041404 Ga0439436_0001737 Ga0439436_0001737_1995_3005 320
125 3300042014 Ga0439457_000317 Ga0439457_000317_1548_2558 320
126 3300042015 Ga0439462_0027327 Ga0439462_0027327_163_1173 320
127 3300042184 Ga0450908_006312 Ga0450908_006312_1032_2027 320
128 3300046463 Ga0495653_0014112 Ga0495653_0014112_2439_3428 320
129 3300046476 Ga0495662_0002045 Ga0495662_0002045_634_1623 320
130 3300046511 Ga0495608_0004232 Ga0495608_0004232_438_1427 320
131 3300046516 Ga0495628_0008624 Ga0495628_0008624_3524_4513 320
132 3300046517 Ga0495630_0027130 Ga0495630_0027130_2819_3808 320
133 3300046526 Ga0495666_0009586 Ga0495666_0009586_2556_3545 320
134 3300046529 Ga0495652_0047462 Ga0495652_0047462_265_1254 320
135 3300046531 Ga0495665_0032757 Ga0495665_0032757_849_1838 320
136 3300046533 Ga0495640_0016128 Ga0495640_0016128_2166_3155 320
137 3300046535 Ga0495586_0004174 Ga0495586_0004174_6737_7726 320
138 3300046642 Ga0495634_0092780 Ga0495634_0092780_747_1736 320
139 3300046663 Ga0495635_0037566 Ga0495635_0037566_2312_3301 320
140 3300046675 Ga0495657_0029330 Ga0495657_0029330_52_1041 320
141 3300046678 Ga0495599_0023853 Ga0495599_0023853_396_1385 320
142 3300046679 Ga0495623_0014038 Ga0495623_0014038_4150_5139 320
143 3300046680 Ga0495646_0015364 Ga0495646_0015364_265_1254 320
144 3300046689 Ga0495613_0012535 Ga0495613_0012535_180_1169 320
145 3300046809 Ga0495600_0015054 Ga0495600_0015054_619_1608 320
146 3300047317 Ga0495604_0000491 Ga0495604_0000491_20286_21275 320
147 3300047319 Ga0495674_0013289 Ga0495674_0013289_6628_7617 320
148 3300047444 Ga0495675_0081073 Ga0495675_0081073_875_1864 320
149 3300047471 Ga0495684_0029444 Ga0495684_0029444_180_1169 320
150 3300048912 Ga0496109_0353657 Ga0496109_0353657_218_1204 320
151 3300053077 Ga0495601_0016594 Ga0495601_0016594_2593_3582 320
152 3300053085 Ga0495619_0010276 Ga0495619_0010276_1276_2265 320
153 iso_pu_bacteria 2728369276 2729909076 320
154 iso_pu_bacteria 2997600082 2997601805 320
155 3300000546 LJNas_1007449 LJNas_10074492 321
156 3300009036 Ga0105244_10027672 Ga0105244_100276722 321
157 3300009148 Ga0105243_10211219 Ga0105243_102112192 321
158 3300025315 Ga0207697_10013957 Ga0207697_100139572 321
159 3300025935 Ga0207709_10055200 Ga0207709_100552002 321
160 3300032002 Ga0307416_100111683 Ga0307416_1001116833 321
161 3300037466 Ga0395898_0334844 Ga0395898_0334844_73_1098 321
162 3300046471 Ga0495650_0030033 Ga0495650_0030033_1314_2306 321
163 3300048915 Ga0496112_0234308 Ga0496112_0234308_486_1493 321
164 3300049569 Ga0501032_0009390 Ga0501032_0009390_584_1606 321
165 3300049571 Ga0501034_0000112 Ga0501034_0000112_76968_77990 321
166 iso_pu_bacteria 2547132111 2547412332 321
167 iso_pu_bacteria 2582581313 2585304192 321
168 iso_pu_bacteria 2582581314 2585319067 321
169 iso_pu_bacteria 2643221647 2644270411 321
170 iso_pu_bacteria 2643221678 2644440917 321
171 iso_pu_bacteria 2643221711 2644607662 321
172 iso_pu_bacteria 2643221714 2644631522 321
173 iso_pu_bacteria 2690315906 2691512817 321
174 iso_pu_bacteria 2784132148 2784591996 321
175 iso_pu_bacteria 2784746763 2785339939 321
176 iso_pu_bacteria 2784746768 2785373256 321
177 iso_pu_bacteria 2786546132 2786674727 321
178 iso_pu_bacteria 2791355406 2793978636 321
179 iso_pu_bacteria 2808606359 2808845360 321
180 iso_pu_bacteria 2808606375 2808915113 321
181 iso_pu_bacteria 2808606448 2809235632 321
182 iso_pu_bacteria 2811994879 2812354325 321
183 iso_pu_bacteria 2811994917 2812482857 321
184 iso_pu_bacteria 2816332139 2816509983 321
185 iso_pu_bacteria 2818991462 2819692358 321
186 iso_pu_bacteria 2852635781 2852635945 321
187 iso_pu_bacteria 2857740372 2857742528 321
188 iso_pu_bacteria 2862281513 2862282990 321
189 iso_pu_bacteria 2862382967 2862387537 321
190 iso_pu_bacteria 2862507626 2862507680 321
191 iso_pu_bacteria 2863404153 2863410062 321
192 iso_pu_bacteria 2867369537 2867370332 321
193 iso_pu_bacteria 2867428634 2867430004 321
194 iso_pu_bacteria 2870782633 2870785610 321
195 iso_pu_bacteria 2877676314 2877677655 321
196 iso_pu_bacteria 2904497146 2904498386 321
197 iso_pu_bacteria 2910809715 2910811541 321
198 iso_pu_bacteria 2912715099 2912715864 321
199 iso_pu_bacteria 2912723979 2912728913 321
200 iso_pu_bacteria 2919051321 2919054045 321
201 iso_pu_bacteria 2919391150 2919391232 321
202 iso_pu_bacteria 2919468124 2919475139 321
203 iso_pu_bacteria 2932426870 2932428191 321
204 iso_pu_bacteria 2933418574 2933421013 321
205 iso_pu_bacteria 2939598168 2939599416 321
206 iso_pu_bacteria 2939674588 2939675345 321
207 iso_pu_bacteria 2945941187 2945944426 321
208 iso_pu_bacteria 2946059875 2946060548 321
209 iso_pu_bacteria 2946064051 2946071376 321
210 iso_pu_bacteria 2946072368 2946079220 321
211 iso_pu_bacteria 2947224130 2947225360 321
212 iso_pu_bacteria 2954002825 2954009585 321
213 iso_pu_bacteria 2954380949 2954382415 321
214 iso_pu_bacteria 2954673503 2954680674 321
215 iso_pu_bacteria 2954682443 2954683479 321
216 iso_pu_bacteria 2954691527 2954693220 321
217 iso_pu_bacteria 2954701450 2954708317 321
218 iso_pu_bacteria 2954711539 2954712893 321
219 iso_pu_bacteria 2954721474 2954722851 321
220 iso_pu_bacteria 2954731030 2954738978 321
221 iso_pu_bacteria 2954740390 2954741762 321
222 iso_pu_bacteria 2954749733 2954757836 321
223 iso_pu_bacteria 2954759201 2954760741 321
224 iso_pu_bacteria 2990059506 2990065421 321
225 iso_pu_bacteria 3006393351 3006395561 321
226 iso_pu_bacteria 8008558824 8008564079 321
227 iso_pu_bacteria 8008574985 8008575823 321
228 iso_pu_bacteria 8023623736 8023624178 321
229 iso_pu_bacteria 8047893842 8047902947 321
230 iso_pu_bacteria 8048127548 8048135439 321
231 iso_pu_bacteria 8048369669 8048370743 321
232 iso_pu_bacteria 8048379754 8048388679 321
233 iso_pu_bacteria 8048406513 8048410904 321
234 iso_pu_bacteria 8056829672 8056836150 321
235 3300048908 Ga0496105_0176717 Ga0496105_0176717_279_1280 322
236 3300005327 Ga0070658_10002817 Ga0070658_1000281714 323
237 3300005366 Ga0070659_100225772 Ga0070659_1002257722 323
238 3300006846 Ga0075430_100202626 Ga0075430_1002026262 323
239 3300006847 Ga0075431_100201619 Ga0075431_1002016192 323
240 3300009147 Ga0114129_10002238 Ga0114129_1000223810 323
241 3300009551 Ga0105238_10155910 Ga0105238_101559103 323
242 3300014326 Ga0157380_10087454 Ga0157380_100874542 323
243 3300025909 Ga0207705_10001278 Ga0207705_100012788 323
244 3300025927 Ga0207687_10118163 Ga0207687_101181632 323
245 3300026078 Ga0207702_10319612 Ga0207702_103196122 323
246 3300031730 Ga0307516_10020452 Ga0307516_100204527 323
247 3300031995 Ga0307409_100207043 Ga0307409_1002070431 323
248 3300035091 Ga0373951_0000019 Ga0373951_0000019_51144_52139 323
249 3300037418 Ga0395900_0011877 Ga0395900_0011877_352_1356 323
250 3300037418 Ga0395900_0202646 Ga0395900_0202646_676_1680 323
251 3300037466 Ga0395898_0036719 Ga0395898_0036719_1511_2515 323
252 3300046461 Ga0495641_0011219 Ga0495641_0011219_3510_4514 323
253 3300046543 Ga0495645_0175166 Ga0495645_0175166_127_1158 323
254 3300046683 Ga0495658_0137347 Ga0495658_0137347_358_1362 323
255 3300047321 Ga0495676_0052067 Ga0495676_0052067_1796_2800 323
256 3300047322 Ga0495680_0029374 Ga0495680_0029374_2931_3935 323
257 3300048903 Ga0496100_0017676 Ga0496100_0017676_122_1126 323
258 3300048903 Ga0496100_0019713 Ga0496100_0019713_1806_2810 323
259 3300048904 Ga0496101_0006250 Ga0496101_0006250_2719_3723 323
260 3300048905 Ga0496102_0017330 Ga0496102_0017330_4105_5109 323
261 3300048905 Ga0496102_0138120 Ga0496102_0138120_686_1690 323
262 3300048906 Ga0496103_0014625 Ga0496103_0014625_2102_3106 323
263 3300048906 Ga0496103_0138594 Ga0496103_0138594_418_1449 323
264 3300048907 Ga0496104_0054109 Ga0496104_0054109_2269_3273 323
265 3300048907 Ga0496104_0162145 Ga0496104_0162145_642_1646 323
266 3300048907 Ga0496104_0498523 Ga0496104_0498523_49_1053 323
267 3300048908 Ga0496105_0036895 Ga0496105_0036895_947_1951 323
268 3300048908 Ga0496105_0337965 Ga0496105_0337965_147_1151 323
269 3300048911 Ga0496108_0415896 Ga0496108_0415896_38_1042 323
270 3300048912 Ga0496109_0180149 Ga0496109_0180149_703_1707 323
271 3300048913 Ga0496110_0050548 Ga0496110_0050548_2066_3070 323
272 3300048914 Ga0496111_0041567 Ga0496111_0041567_1283_2287 323
273 3300048914 Ga0496111_0180410 Ga0496111_0180410_176_1180 323
274 3300048916 Ga0496113_0014186 Ga0496113_0014186_1173_2177 323
275 3300048916 Ga0496113_0102913 Ga0496113_0102913_967_1971 323
276 3300048917 Ga0496114_0024038 Ga0496114_0024038_585_1589 323
277 3300048917 Ga0496114_0065976 Ga0496114_0065976_1907_2911 323
278 3300048917 Ga0496114_0294108 Ga0496114_0294108_79_1083 323
279 3300050507 nmdc:mga05p37_4636_c1 nmdc:mga05p37_4636_c1_587_1588 323
280 3300050509 nmdc:mga0qj67_46691_c1 nmdc:mga0qj67_46691_c1_1989_2990 323
281 3300050510 nmdc:mga06r32_87637_c1 nmdc:mga06r32_87637_c1_194_1195 323
282 3300053085 Ga0495619_0059496 Ga0495619_0059496_1238_2242 323
283 iso_pu_bacteria 2738543034 2739366871 323
284 iso_pu_bacteria 2904535858 2904538578 323
285 iso_pu_bacteria 2920879853 2920883368 323
286 3300005328 Ga0070676_10172681 Ga0070676_101726812 324
287 3300005329 Ga0070683_100116116 Ga0070683_1001161162 324
288 3300005333 Ga0070677_10037016 Ga0070677_100370161 324
289 3300005364 Ga0070673_100156160 Ga0070673_1001561601 324
290 3300009177 Ga0105248_10120250 Ga0105248_101202504 324
291 3300011119 Ga0105246_10010978 Ga0105246_100109786 324
292 3300025315 Ga0207697_10001554 Ga0207697_100015542 324
293 3300025728 Ga0207655_1027201 Ga0207655_10272013 324
294 3300025893 Ga0207682_10036006 Ga0207682_100360061 324
295 3300025923 Ga0207681_10037972 Ga0207681_100379723 324
296 3300025944 Ga0207661_10065810 Ga0207661_100658102 324
297 3300026067 Ga0207678_10269127 Ga0207678_102691272 324
298 3300026121 Ga0207683_10104334 Ga0207683_101043343 324
299 3300027907 Ga0207428_10005972 Ga0207428_100059729 324
300 3300031548 Ga0307408_100001087 Ga0307408_10000108711 324
301 3300031548 Ga0307408_100037920 Ga0307408_1000379202 324
302 3300031548 Ga0307408_100074614 Ga0307408_1000746142 324
303 3300031731 Ga0307405_10002066 Ga0307405_100020667 324
304 3300031731 Ga0307405_10007947 Ga0307405_100079473 324
305 3300031731 Ga0307405_10019009 Ga0307405_100190094 324
306 3300031731 Ga0307405_10051669 Ga0307405_100516692 324
307 3300031731 Ga0307405_10075179 Ga0307405_100751792 324
308 3300031824 Ga0307413_10036545 Ga0307413_100365453 324
309 3300031824 Ga0307413_10078030 Ga0307413_100780302 324
310 3300031824 Ga0307413_10306170 Ga0307413_103061701 324
311 3300031852 Ga0307410_10002873 Ga0307410_100028732 324
312 3300031852 Ga0307410_10008843 Ga0307410_100088434 324
313 3300031852 Ga0307410_10017872 Ga0307410_100178723 324
314 3300031852 Ga0307410_10032306 Ga0307410_100323063 324
315 3300031901 Ga0307406_10042293 Ga0307406_100422932 324
316 3300031901 Ga0307406_10068658 Ga0307406_100686582 324
317 3300031903 Ga0307407_10015923 Ga0307407_100159234 324
318 3300031911 Ga0307412_10000650 Ga0307412_1000065010 324
319 3300031911 Ga0307412_10007944 Ga0307412_100079443 324
320 3300031911 Ga0307412_10029499 Ga0307412_100294992 324
321 3300031911 Ga0307412_10063896 Ga0307412_100638962 324
322 3300031911 Ga0307412_10146149 Ga0307412_101461492 324
323 3300031995 Ga0307409_100006051 Ga0307409_1000060512 324
324 3300031995 Ga0307409_100080596 Ga0307409_1000805963 324
325 3300031995 Ga0307409_100230855 Ga0307409_1002308552 324
326 3300032002 Ga0307416_100028781 Ga0307416_1000287813 324
327 3300032002 Ga0307416_100030951 Ga0307416_1000309513 324
328 3300032002 Ga0307416_100051065 Ga0307416_1000510653 324
329 3300032002 Ga0307416_100065519 Ga0307416_1000655193 324
330 3300032002 Ga0307416_100172751 Ga0307416_1001727512 324
331 3300032002 Ga0307416_100224953 Ga0307416_1002249532 324
332 3300032002 Ga0307416_100258020 Ga0307416_1002580202 324
333 3300032002 Ga0307416_100445977 Ga0307416_1004459772 324
334 3300032004 Ga0307414_10006263 Ga0307414_100062636 324
335 3300032005 Ga0307411_10165807 Ga0307411_101658071 324
336 3300032126 Ga0307415_100011275 Ga0307415_1000112753 324
337 3300032126 Ga0307415_100092963 Ga0307415_1000929632 324
338 3300037312 Ga0395899_0048530 Ga0395899_0048530_1851_2885 324
339 3300037466 Ga0395898_0218205 Ga0395898_0218205_288_1322 324
340 3300038443 Ga0395901_0027568 Ga0395901_0027568_2823_3857 324
341 3300041404 Ga0439436_0000890 Ga0439436_0000890_5088_6122 324
342 3300041999 Ga0439433_0001547 Ga0439433_0001547_729_1763 324
343 3300042007 Ga0439449_0001011 Ga0439449_0001011_3873_4907 324
344 3300042007 Ga0439449_0001639 Ga0439449_0001639_2367_3401 324
345 3300042014 Ga0439457_001433 Ga0439457_001433_2637_3671 324
346 3300042015 Ga0439462_0002416 Ga0439462_0002416_661_1695 324
347 3300042435 Ga0439434_0035638 Ga0439434_0035638_194_1228 324
348 3300046472 Ga0495580_0010354 Ga0495580_0010354_341_1375 324
349 3300046531 Ga0495665_0027028 Ga0495665_0027028_1520_2554 324
350 3300046535 Ga0495586_0001649 Ga0495586_0001649_10272_11306 324
351 3300046615 Ga0495656_0002914 Ga0495656_0002914_2845_3879 324
352 3300046615 Ga0495656_0010283 Ga0495656_0010283_1509_2543 324
353 3300046616 Ga0495668_0017386 Ga0495668_0017386_287_1321 324
354 3300046674 Ga0495588_0014737 Ga0495588_0014737_1575_2609 324
355 3300046691 Ga0495670_0003869 Ga0495670_0003869_5439_6473 324
356 3300046691 Ga0495670_0115866 Ga0495670_0115866_160_1194 324
357 3300047315 Ga0495581_0073781 Ga0495581_0073781_410_1444 324
358 3300048905 Ga0496102_0081798 Ga0496102_0081798_1782_2822 324
359 3300048909 Ga0496106_0010795 Ga0496106_0010795_5695_6729 324
360 3300048909 Ga0496106_0254309 Ga0496106_0254309_310_1344 324
361 3300048911 Ga0496108_0440146 Ga0496108_0440146_50_1048 324
362 3300048912 Ga0496109_0096411 Ga0496109_0096411_1057_2091 324
363 3300048915 Ga0496112_0066132 Ga0496112_0066132_1961_3001 324
364 3300048918 Ga0496115_0196843 Ga0496115_0196843_436_1470 324
365 3300049573 Ga0501037_0056311 Ga0501037_0056311_1046_2089 324
366 3300059424 Ga0590075_010080 Ga0590075_010080_972_2006 324
367 iso_pu_bacteria 8054107350 8054109104 324
368 3300001978 JGI24747J21853_1000411 JGI24747J21853_10004112 325
369 3300001990 JGI24737J22298_10056929 JGI24737J22298_100569292 325
370 3300002067 JGI24735J21928_10020495 JGI24735J21928_100204952 325
371 3300002070 JGI24750J21931_1002461 JGI24750J21931_10024612 325
372 3300002074 JGI24748J21848_1002241 JGI24748J21848_10022412 325
373 3300002077 JGI24744J21845_10001784 JGI24744J21845_100017844 325
374 3300002244 JGI24742J22300_10001076 JGI24742J22300_100010766 325
375 3300003203 JGI25406J46586_10017256 JGI25406J46586_100172562 325
376 3300003316 rootH1_10000180 rootH1_1000018017 325
377 3300003578 Ga0006562J51391_1090646 Ga0006562J51391_10906463 325
378 3300003578 Ga0006562J51391_1090648 Ga0006562J51391_10906482 325
379 3300005330 Ga0070690_100021466 Ga0070690_1000214666 325
380 3300005334 Ga0068869_100062168 Ga0068869_1000621681 325
381 3300005343 Ga0070687_100042717 Ga0070687_1000427172 325
382 3300005353 Ga0070669_100348477 Ga0070669_1003484771 325
383 3300005355 Ga0070671_100106988 Ga0070671_1001069882 325
384 3300005365 Ga0070688_100011804 Ga0070688_1000118043 325
385 3300005367 Ga0070667_100516903 Ga0070667_1005169031 325
386 3300005406 Ga0070703_10007190 Ga0070703_100071902 325
387 3300005435 Ga0070714_100020361 Ga0070714_1000203612 325
388 3300005437 Ga0070710_10073448 Ga0070710_100734482 325
389 3300005437 Ga0070710_10147698 Ga0070710_101476982 325
390 3300005440 Ga0070705_100064350 Ga0070705_1000643502 325
391 3300005445 Ga0070708_100010999 Ga0070708_1000109991 325
392 3300005457 Ga0070662_100388748 Ga0070662_1003887482 325
393 3300005459 Ga0068867_100043517 Ga0068867_1000435174 325
394 3300005459 Ga0068867_100439913 Ga0068867_1004399131 325
395 3300005466 Ga0070685_10067743 Ga0070685_100677431 325
396 3300005468 Ga0070707_100158662 Ga0070707_1001586622 325
397 3300005539 Ga0068853_100058607 Ga0068853_1000586073 325
398 3300005543 Ga0070672_100189323 Ga0070672_1001893232 325
399 3300005546 Ga0070696_100101390 Ga0070696_1001013902 325
400 3300005549 Ga0070704_100298433 Ga0070704_1002984332 325
401 3300005614 Ga0068856_100100307 Ga0068856_1001003072 325
402 3300005718 Ga0068866_10059848 Ga0068866_100598482 325
403 3300005718 Ga0068866_10152799 Ga0068866_101527992 325
404 3300005718 Ga0068866_10191066 Ga0068866_101910661 325
405 3300005843 Ga0068860_100410211 Ga0068860_1004102112 325
406 3300005981 Ga0081538_10007282 Ga0081538_100072823 325
407 3300005981 Ga0081538_10013417 Ga0081538_100134173 325
408 3300005981 Ga0081538_10020096 Ga0081538_100200967 325
409 3300005985 Ga0081539_10001911 Ga0081539_100019118 325
410 3300005985 Ga0081539_10002039 Ga0081539_1000203918 325
411 3300005985 Ga0081539_10028201 Ga0081539_100282013 325
412 3300006028 Ga0070717_10083515 Ga0070717_100835153 325
413 3300006028 Ga0070717_10323305 Ga0070717_103233051 325
414 3300006028 Ga0070717_10421529 Ga0070717_104215291 325
415 3300006173 Ga0070716_100019475 Ga0070716_1000194754 325
416 3300006173 Ga0070716_100054233 Ga0070716_1000542332 325
417 3300006358 Ga0068871_100098224 Ga0068871_1000982242 325
418 3300006844 Ga0075428_100051364 Ga0075428_1000513643 325
419 3300006846 Ga0075430_100072408 Ga0075430_1000724083 325
420 3300006852 Ga0075433_10016326 Ga0075433_100163267 325
421 3300006871 Ga0075434_100019077 Ga0075434_1000190777 325
422 3300006880 Ga0075429_100090918 Ga0075429_1000909183 325
423 3300006948 Ga0099826_10112892 Ga0099826_101128922 325
424 3300009092 Ga0105250_10014173 Ga0105250_100141734 325
425 3300009093 Ga0105240_10232985 Ga0105240_102329852 325
426 3300009094 Ga0111539_10201896 Ga0111539_102018963 325
427 3300009147 Ga0114129_10121840 Ga0114129_101218403 325
428 3300009147 Ga0114129_10248132 Ga0114129_102481323 325
429 3300009174 Ga0105241_10190504 Ga0105241_101905042 325
430 3300009551 Ga0105238_10229048 Ga0105238_102290482 325
431 3300009551 Ga0105238_10267275 Ga0105238_102672752 325
432 3300010375 Ga0105239_10244205 Ga0105239_102442052 325
433 3300013105 Ga0157369_10007585 Ga0157369_100075858 325
434 3300013306 Ga0163162_10187843 Ga0163162_101878433 325
435 3300013307 Ga0157372_10429327 Ga0157372_104293273 325
436 3300013308 Ga0157375_10008683 Ga0157375_100086834 325
437 3300013308 Ga0157375_10357746 Ga0157375_103577462 325
438 3300014497 Ga0182008_10001253 Ga0182008_1000125310 325
439 3300014497 Ga0182008_10092955 Ga0182008_100929551 325
440 3300015262 Ga0182007_10009486 Ga0182007_100094861 325
441 3300015688 Ga0183367_1001 Ga0183367_1001982 325
442 3300017792 Ga0163161_10059058 Ga0163161_100590583 325
443 3300025885 Ga0207653_10005382 Ga0207653_100053823 325
444 3300025898 Ga0207692_10025252 Ga0207692_100252523 325
445 3300025901 Ga0207688_10058232 Ga0207688_100582322 325
446 3300025904 Ga0207647_10148132 Ga0207647_101481322 325
447 3300025906 Ga0207699_10299085 Ga0207699_102990851 325
448 3300025915 Ga0207693_10307924 Ga0207693_103079242 325
449 3300025918 Ga0207662_10066950 Ga0207662_100669502 325
450 3300025921 Ga0207652_10072244 Ga0207652_100722443 325
451 3300025922 Ga0207646_10043317 Ga0207646_100433171 325
452 3300025923 Ga0207681_10071132 Ga0207681_100711322 325
453 3300025927 Ga0207687_10018087 Ga0207687_100180873 325
454 3300025929 Ga0207664_10040745 Ga0207664_100407451 325
455 3300025929 Ga0207664_10043723 Ga0207664_100437233 325
456 3300025934 Ga0207686_10075145 Ga0207686_100751452 325
457 3300025938 Ga0207704_10012717 Ga0207704_100127174 325
458 3300025939 Ga0207665_10290453 Ga0207665_102904532 325
459 3300025940 Ga0207691_10109193 Ga0207691_101091932 325
460 3300025942 Ga0207689_10079381 Ga0207689_100793811 325
461 3300025942 Ga0207689_10247867 Ga0207689_102478671 325
462 3300025972 Ga0207668_10023437 Ga0207668_100234376 325
463 3300026023 Ga0207677_10103413 Ga0207677_101034133 325
464 3300026035 Ga0207703_10195047 Ga0207703_101950472 325
465 3300026067 Ga0207678_10315368 Ga0207678_103153682 325
466 3300026075 Ga0207708_10018814 Ga0207708_100188143 325
467 3300026118 Ga0207675_100158503 Ga0207675_1001585032 325
468 3300026118 Ga0207675_100283651 Ga0207675_1002836512 325
469 3300026121 Ga0207683_10151673 Ga0207683_101516732 325
470 3300026121 Ga0207683_10313682 Ga0207683_103136822 325
471 3300027866 Ga0209813_10066393 Ga0209813_100663931 325
472 3300028381 Ga0268264_10437633 Ga0268264_104376332 325
473 3300028786 Ga0307517_10004208 Ga0307517_1000420812 325
474 3300028794 Ga0307515_10000046 Ga0307515_10000046311 325
475 3300028794 Ga0307515_10034314 Ga0307515_100343144 325
476 3300030521 Ga0307511_10004532 Ga0307511_100045323 325
477 3300030521 Ga0307511_10026828 Ga0307511_100268282 325
478 3300030522 Ga0307512_10065667 Ga0307512_100656672 325
479 3300030522 Ga0307512_10116292 Ga0307512_101162921 325
480 3300031456 Ga0307513_10008529 Ga0307513_100085291 325
481 3300031507 Ga0307509_10018697 Ga0307509_100186976 325
482 3300031507 Ga0307509_10099927 Ga0307509_100999271 325
483 3300031548 Ga0307408_100013603 Ga0307408_1000136035 325
484 3300031548 Ga0307408_100015963 Ga0307408_1000159633 325
485 3300031616 Ga0307508_10005047 Ga0307508_100050476 325
486 3300031616 Ga0307508_10011478 Ga0307508_100114781 325
487 3300031616 Ga0307508_10124426 Ga0307508_101244262 325
488 3300031649 Ga0307514_10006879 Ga0307514_100068796 325
489 3300031649 Ga0307514_10173395 Ga0307514_101733952 325
490 3300031730 Ga0307516_10010982 Ga0307516_100109826 325
491 3300031730 Ga0307516_10013623 Ga0307516_100136232 325
492 3300031731 Ga0307405_10006030 Ga0307405_100060303 325
493 3300031731 Ga0307405_10043060 Ga0307405_100430603 325
494 3300031731 Ga0307405_10062249 Ga0307405_100622492 325
495 3300031824 Ga0307413_10038517 Ga0307413_100385172 325
496 3300031824 Ga0307413_10074884 Ga0307413_100748842 325
497 3300031838 Ga0307518_10098538 Ga0307518_100985382 325
498 3300031838 Ga0307518_10143289 Ga0307518_101432892 325
499 3300031852 Ga0307410_10001911 Ga0307410_1000191110 325
500 3300031852 Ga0307410_10002556 Ga0307410_100025568 325
501 3300031852 Ga0307410_10004357 Ga0307410_100043574 325
502 3300031852 Ga0307410_10071187 Ga0307410_100711873 325
503 3300031901 Ga0307406_10000246 Ga0307406_1000024621 325
504 3300031901 Ga0307406_10022105 Ga0307406_100221052 325
505 3300031901 Ga0307406_10103248 Ga0307406_101032482 325
506 3300031903 Ga0307407_10010005 Ga0307407_100100052 325
507 3300031903 Ga0307407_10028538 Ga0307407_100285383 325
508 3300031903 Ga0307407_10071207 Ga0307407_100712072 325
509 3300031903 Ga0307407_10121535 Ga0307407_101215352 325
510 3300031995 Ga0307409_100000284 Ga0307409_1000002845 325
511 3300031995 Ga0307409_100000345 Ga0307409_1000003452 325
512 3300031995 Ga0307409_100001116 Ga0307409_1000011162 325
513 3300031995 Ga0307409_100045288 Ga0307409_1000452883 325
514 3300031995 Ga0307409_100052036 Ga0307409_1000520362 325
515 3300032002 Ga0307416_100000283 Ga0307416_10000028318 325
516 3300032002 Ga0307416_100013462 Ga0307416_1000134622 325
517 3300032002 Ga0307416_100022366 Ga0307416_1000223664 325
518 3300032002 Ga0307416_100086492 Ga0307416_1000864922 325
519 3300032002 Ga0307416_100148632 Ga0307416_1001486323 325
520 3300032002 Ga0307416_100366314 Ga0307416_1003663142 325
521 3300032004 Ga0307414_10071803 Ga0307414_100718033 325
522 3300032005 Ga0307411_10028810 Ga0307411_100288103 325
523 3300032005 Ga0307411_10030404 Ga0307411_100304044 325
524 3300032126 Ga0307415_100000587 Ga0307415_1000005877 325
525 3300032126 Ga0307415_100000874 Ga0307415_10000087410 325
526 3300032126 Ga0307415_100313106 Ga0307415_1003131061 325
527 3300033179 Ga0307507_10015481 Ga0307507_100154814 325
528 3300033179 Ga0307507_10047057 Ga0307507_100470573 325
529 3300033180 Ga0307510_10005834 Ga0307510_100058345 325
530 3300033180 Ga0307510_10040367 Ga0307510_100403672 325
531 3300033180 Ga0307510_10188532 Ga0307510_101885322 325
532 3300035207 Ga0373942_0010964 Ga0373942_0010964_1060_2067 325
533 3300035242 Ga0373962_0030264 Ga0373962_0030264_127_1128 325
534 3300035724 Ga0373933_0141066 Ga0373933_0141066_193_1197 325
535 3300036401 Ga0373937_0068047 Ga0373937_0068047_2136_3140 325
536 3300037312 Ga0395899_0112409 Ga0395899_0112409_839_1840 325
537 3300037418 Ga0395900_0038477 Ga0395900_0038477_550_1551 325
538 3300037418 Ga0395900_0059154 Ga0395900_0059154_1143_2144 325
539 3300037466 Ga0395898_0011687 Ga0395898_0011687_5762_6766 325
540 3300037466 Ga0395898_0203521 Ga0395898_0203521_644_1645 325
541 3300037471 Ga0395905_0090804 Ga0395905_0090804_299_1300 325
542 3300037471 Ga0395905_0161863 Ga0395905_0161863_1010_2011 325
543 3300037853 Ga0436364_0980706 Ga0436364_0980706_548_1552 325
544 3300038443 Ga0395901_0075983 Ga0395901_0075983_2146_3147 325
545 3300038443 Ga0395901_0395959 Ga0395901_0395959_254_1255 325
546 3300039450 Ga0436363_1613141 Ga0436363_1613141_726_1730 325
547 3300041404 Ga0439436_0032572 Ga0439436_0032572_237_1262 325
548 3300041411 Ga0439466_0048903 Ga0439466_0048903_265_1290 325
549 3300041494 Ga0451837_1508489 Ga0451837_1508489_129_1133 325
550 3300041512 Ga0451853_0498644 Ga0451853_0498644_214_1242 325
551 3300041512 Ga0451853_3326361 Ga0451853_3326361_1484_2488 325
552 3300042005 Ga0439448_0027207 Ga0439448_0027207_185_1186 325
553 3300042005 Ga0439448_0027541 Ga0439448_0027541_619_1623 325
554 3300042007 Ga0439449_0003409 Ga0439449_0003409_1960_2964 325
555 3300042012 Ga0439455_0021323 Ga0439455_0021323_521_1522 325
556 3300042131 Ga0450894_000335 Ga0450894_000335_1730_2740 325
557 3300042133 Ga0450896_001171 Ga0450896_001171_507_1517 325
558 3300042134 Ga0450898_002836 Ga0450898_002836_1044_2054 325
559 3300042135 Ga0450899_000754 Ga0450899_000754_2206_3216 325
560 3300042138 Ga0450903_000618 Ga0450903_000618_1352_2356 325
561 3300042157 Ga0439458_0001937 Ga0439458_0001937_1422_2426 325
562 3300042157 Ga0439458_0002826 Ga0439458_0002826_2046_3050 325
563 3300042157 Ga0439458_0033476 Ga0439458_0033476_142_1143 325
564 3300042437 Ga0439444_0005125 Ga0439444_0005125_372_1373 325
565 3300042461 Ga0439460_0026898 Ga0439460_0026898_381_1382 325
566 3300042993 Ga0439440_0010269 Ga0439440_0010269_266_1267 325
567 3300044656 Ga0466969_0033377 Ga0466969_0033377_795_1799 325
568 3300044683 Ga0466965_0000288 Ga0466965_0000288_9846_10850 325
569 3300044684 Ga0466966_0002830 Ga0466966_0002830_1215_2219 325
570 3300044693 Ga0466961_0012755 Ga0466961_0012755_3698_4702 325
571 3300044693 Ga0466961_0023127 Ga0466961_0023127_1343_2347 325
572 3300044693 Ga0466961_0108287 Ga0466961_0108287_78_1082 325
573 3300044694 Ga0466963_0001177 Ga0466963_0001177_1215_2219 325
574 3300044694 Ga0466963_0025611 Ga0466963_0025611_329_1336 325
575 3300044706 Ga0466964_0001884 Ga0466964_0001884_6081_7085 325
576 3300044719 Ga0466971_0001045 Ga0466971_0001045_9044_10048 325
577 3300044719 Ga0466971_0004284 Ga0466971_0004284_2379_3383 325
578 3300044735 Ga0466968_0015344 Ga0466968_0015344_1181_2185 325
579 3300044765 Ga0466970_0021714 Ga0466970_0021714_160_1164 325
580 3300044765 Ga0466970_0032738 Ga0466970_0032738_964_1968 325
581 3300044842 Ga0466957_0009571 Ga0466957_0009571_165_1169 325
582 3300044901 Ga0466960_0102429 Ga0466960_0102429_454_1458 325
583 3300045049 Ga0466959_0008657 Ga0466959_0008657_1215_2219 325
584 3300045049 Ga0466959_0008896 Ga0466959_0008896_2364_3368 325
585 3300045836 Ga0466958_0001015 Ga0466958_0001015_2785_3789 325
586 3300045976 Ga0466967_0017691 Ga0466967_0017691_270_1274 325
587 3300045976 Ga0466967_0029886 Ga0466967_0029886_3510_4514 325
588 3300046454 Ga0495592_0107800 Ga0495592_0107800_235_1239 325
589 3300046455 Ga0495603_0101371 Ga0495603_0101371_595_1596 325
590 3300046459 Ga0495629_0001242 Ga0495629_0001242_19014_20018 325
591 3300046460 Ga0495638_0023679 Ga0495638_0023679_402_1403 325
592 3300046460 Ga0495638_0049225 Ga0495638_0049225_1266_2282 325
593 3300046462 Ga0495651_0020708 Ga0495651_0020708_3035_4039 325
594 3300046463 Ga0495653_0006973 Ga0495653_0006973_5277_6281 325
595 3300046473 Ga0495582_0058050 Ga0495582_0058050_555_1559 325
596 3300046476 Ga0495662_0000305 Ga0495662_0000305_17494_18498 325
597 3300046477 Ga0495664_0000787 Ga0495664_0000787_12473_13477 325
598 3300046506 Ga0495583_0073461 Ga0495583_0073461_96_1100 325
599 3300046511 Ga0495608_0231526 Ga0495608_0231526_142_1146 325
600 3300046514 Ga0495618_0053782 Ga0495618_0053782_935_1939 325
601 3300046516 Ga0495628_0044866 Ga0495628_0044866_1592_2596 325
602 3300046529 Ga0495652_0064012 Ga0495652_0064012_1047_2051 325
603 3300046536 Ga0495587_0003178 Ga0495587_0003178_990_1994 325
604 3300046543 Ga0495645_0038329 Ga0495645_0038329_1440_2444 325
605 3300046642 Ga0495634_0014249 Ga0495634_0014249_1070_2074 325
606 3300046660 Ga0495625_0072160 Ga0495625_0072160_1221_2225 325
607 3300046663 Ga0495635_0005045 Ga0495635_0005045_1456_2460 325
608 3300046674 Ga0495588_0002246 Ga0495588_0002246_1461_2465 325
609 3300046680 Ga0495646_0029621 Ga0495646_0029621_467_1471 325
610 3300046683 Ga0495658_0052702 Ga0495658_0052702_350_1354 325
611 3300046689 Ga0495613_0016742 Ga0495613_0016742_3423_4427 325
612 3300046690 Ga0495624_0157423 Ga0495624_0157423_172_1188 325
613 3300046692 Ga0495671_0073198 Ga0495671_0073198_610_1626 325
614 3300047315 Ga0495581_0001698 Ga0495581_0001698_1042_2046 325
615 3300047317 Ga0495604_0000811 Ga0495604_0000811_11568_12572 325
616 3300047317 Ga0495604_0187915 Ga0495604_0187915_401_1405 325
617 3300047319 Ga0495674_0104386 Ga0495674_0104386_412_1416 325
618 3300047321 Ga0495676_0106092 Ga0495676_0106092_387_1391 325
619 3300047443 Ga0495687_001428 Ga0495687_001428_9785_10789 325
620 3300047443 Ga0495687_011432 Ga0495687_011432_938_1954 325
621 3300047443 Ga0495687_013341 Ga0495687_013341_64_1068 325
622 3300047443 Ga0495687_013809 Ga0495687_013809_115_1131 325
623 3300047447 Ga0495685_002934 Ga0495685_002934_3676_4692 325
624 3300047447 Ga0495685_013905 Ga0495685_013905_155_1159 325
625 3300047470 Ga0495681_0014664 Ga0495681_0014664_940_1956 325
626 3300047471 Ga0495684_0202687 Ga0495684_0202687_83_1087 325
627 3300047673 Ga0495593_0003017 Ga0495593_0003017_8078_9082 325
628 3300048089 Ga0495614_0005221 Ga0495614_0005221_3221_4225 325
629 3300048089 Ga0495614_0032534 Ga0495614_0032534_153_1157 325
630 3300048904 Ga0496101_0037432 Ga0496101_0037432_1655_2662 325
631 3300048905 Ga0496102_0131030 Ga0496102_0131030_1147_2163 325
632 3300048906 Ga0496103_0004152 Ga0496103_0004152_5636_6643 325
633 3300048906 Ga0496103_0202118 Ga0496103_0202118_104_1105 325
634 3300048907 Ga0496104_0114339 Ga0496104_0114339_604_1632 325
635 3300048907 Ga0496104_0152172 Ga0496104_0152172_142_1149 325
636 3300048908 Ga0496105_0030685 Ga0496105_0030685_1879_2883 325
637 3300048909 Ga0496106_0018727 Ga0496106_0018727_2410_3417 325
638 3300048910 Ga0496107_0030794 Ga0496107_0030794_2581_3588 325
639 3300048911 Ga0496108_0184540 Ga0496108_0184540_751_1755 325
640 3300048911 Ga0496108_0232607 Ga0496108_0232607_278_1288 325
641 3300048911 Ga0496108_0354496 Ga0496108_0354496_61_1062 325
642 3300048912 Ga0496109_0146228 Ga0496109_0146228_759_1763 325
643 3300048912 Ga0496109_0313909 Ga0496109_0313909_11_1039 325
644 3300048914 Ga0496111_0121854 Ga0496111_0121854_452_1456 325
645 3300048917 Ga0496114_0006529 Ga0496114_0006529_5628_6635 325
646 3300048917 Ga0496114_0035253 Ga0496114_0035253_1641_2645 325
647 3300048918 Ga0496115_0013550 Ga0496115_0013550_3168_4175 325
648 3300049568 Ga0501031_0006068 Ga0501031_0006068_2954_3961 325
649 3300049568 Ga0501031_0177555 Ga0501031_0177555_353_1357 325
650 3300049569 Ga0501032_0016570 Ga0501032_0016570_2123_3130 325
651 3300049570 Ga0501033_0045356 Ga0501033_0045356_1115_2119 325
652 3300049571 Ga0501034_0006804 Ga0501034_0006804_3989_4993 325
653 3300049571 Ga0501034_0035780 Ga0501034_0035780_467_1474 325
654 3300049572 Ga0501036_0009835 Ga0501036_0009835_1153_2157 325
655 3300049572 Ga0501036_0016707 Ga0501036_0016707_1961_2968 325
656 3300049572 Ga0501036_0017920 Ga0501036_0017920_3219_4223 325
657 3300049572 Ga0501036_0222747 Ga0501036_0222747_543_1547 325
658 3300049573 Ga0501037_0004673 Ga0501037_0004673_8195_9202 325
659 3300049573 Ga0501037_0132606 Ga0501037_0132606_667_1671 325
660 3300049573 Ga0501037_0140121 Ga0501037_0140121_155_1162 325
661 3300049574 Ga0501038_0000531 Ga0501038_0000531_29929_30933 325
662 3300049574 Ga0501038_0054915 Ga0501038_0054915_49_1056 325
663 3300049578 Ga0501042_0004136 Ga0501042_0004136_3371_4378 325
664 3300049579 Ga0501043_0002652 Ga0501043_0002652_13117_14121 325
665 3300049579 Ga0501043_0016086 Ga0501043_0016086_449_1456 325
666 3300049579 Ga0501043_0082019 Ga0501043_0082019_585_1589 325
667 3300049580 Ga0501046_0025985 Ga0501046_0025985_839_1846 325
668 3300049580 Ga0501046_0043617 Ga0501046_0043617_270_1277 325
669 3300049581 Ga0501047_0083898 Ga0501047_0083898_1969_2976 325
670 3300049581 Ga0501047_0102281 Ga0501047_0102281_1546_2553 325
671 3300049582 Ga0501048_0021390 Ga0501048_0021390_2350_3357 325
672 3300049586 Ga0501070_0001683 Ga0501070_0001683_9050_10054 325
673 3300049589 Ga0501073_0237498 Ga0501073_0237498_95_1102 325
674 3300049590 Ga0501074_0011845 Ga0501074_0011845_1703_2707 325
675 3300049652 Ga0501202_018009 Ga0501202_018009_241_1257 325
676 3300049742 Ga0501080_0122212 Ga0501080_0122212_1204_2208 325
677 3300049822 Ga0501035_0027151 Ga0501035_0027151_4036_5043 325
678 3300049822 Ga0501035_0029689 Ga0501035_0029689_3241_4245 325
679 3300049823 Ga0501044_0026941 Ga0501044_0026941_2124_3131 325
680 3300049824 Ga0501045_0110852 Ga0501045_0110852_742_1749 325
681 3300050490 nmdc:mga03n38_23039_c1 nmdc:mga03n38_23039_c1_652_1656 325
682 3300050492 nmdc:mga0yw44_189835_c1 nmdc:mga0yw44_189835_c1_215_1219 325
683 3300050494 nmdc:mga06z11_3783_c1 nmdc:mga06z11_3783_c1_2811_3815 325
684 3300050507 nmdc:mga05p37_42469_c1 nmdc:mga05p37_42469_c1_1011_2012 325
685 3300050507 nmdc:mga05p37_73219_c1 nmdc:mga05p37_73219_c1_2227_3228 325
686 3300050508 nmdc:mga09592_80800_c1 nmdc:mga09592_80800_c1_993_1994 325
687 3300050509 nmdc:mga0qj67_62106_c1 nmdc:mga0qj67_62106_c1_976_1977 325
688 3300050510 nmdc:mga06r32_177344_c1 nmdc:mga06r32_177344_c1_993_1994 325
689 3300050511 nmdc:mga08y16_40577_c1 nmdc:mga08y16_40577_c1_1900_2901 325
690 3300050511 nmdc:mga08y16_533362_c1 nmdc:mga08y16_533362_c1_151_1161 325
691 3300050512 nmdc:mga0n895_65935_c1 nmdc:mga0n895_65935_c1_1604_2605 325
692 3300050515 nmdc:mga0a205_17567_c1 nmdc:mga0a205_17567_c1_3987_4988 325
693 3300053078 Ga0495612_0015629 Ga0495612_0015629_1166_2170 325
694 3300053085 Ga0495619_0031981 Ga0495619_0031981_440_1444 325
695 3300053086 Ga0500578_0073202 Ga0500578_0073202_75_1091 325
696 3300053088 Ga0500644_0041293 Ga0500644_0041293_82_1086 325
697 3300053092 Ga0500583_0106408 Ga0500583_0106408_242_1246 325
698 3300053095 Ga0500640_034651 Ga0500640_034651_520_1524 325
699 3300053107 Ga0500560_004346 Ga0500560_004346_1930_2934 325
700 3300053107 Ga0500560_015854 Ga0500560_015854_443_1444 325
701 3300053131 Ga0500652_013987 Ga0500652_013987_1008_2024 325
702 3300053134 Ga0500658_0017085 Ga0500658_0017085_1009_2025 325
703 3300053137 Ga0500561_0000666 Ga0500561_0000666_1644_2660 325
704 3300053140 Ga0500573_0011060 Ga0500573_0011060_2928_3932 325
705 3300053153 Ga0500616_0000495 Ga0500616_0000495_21541_22542 325
706 3300053153 Ga0500616_0032244 Ga0500616_0032244_1421_2437 325
707 3300053157 Ga0500624_008844 Ga0500624_008844_341_1345 325
708 3300053739 Ga0500587_005064 Ga0500587_005064_322_1338 325
709 3300061719 Ga0466962_0006897 Ga0466962_0006897_795_1799 325
710 3300061719 Ga0466962_0010113 Ga0466962_0010113_1343_2347 325
711 3300005564 Ga0070664_100531464 Ga0070664_1005314641 326
712 3300005840 Ga0068870_10067519 Ga0068870_100675192 326
713 3300006048 Ga0075363_100001332 Ga0075363_1000013329 326
714 3300006048 Ga0075363_100175879 Ga0075363_1001758791 326
715 3300009098 Ga0105245_10293825 Ga0105245_102938252 326
716 3300013306 Ga0163162_10041447 Ga0163162_100414474 326
717 3300025944 Ga0207661_10133411 Ga0207661_101334112 326
718 3300026067 Ga0207678_10006777 Ga0207678_100067777 326
719 3300026142 Ga0207698_10109210 Ga0207698_101092102 326
720 3300031507 Ga0307509_10051169 Ga0307509_100511693 326
721 3300031616 Ga0307508_10142436 Ga0307508_101424362 326
722 3300044683 Ga0466965_0001958 Ga0466965_0001958_6095_7102 326
723 3300044901 Ga0466960_0002703 Ga0466960_0002703_4798_5805 326
724 3300046454 Ga0495592_0064011 Ga0495592_0064011_1294_2298 326
725 3300046462 Ga0495651_0013761 Ga0495651_0013761_1065_2069 326
726 3300046473 Ga0495582_0049898 Ga0495582_0049898_921_1928 326
727 3300046477 Ga0495664_0062036 Ga0495664_0062036_187_1191 326
728 3300046529 Ga0495652_0000478 Ga0495652_0000478_6779_7783 326
729 3300046533 Ga0495640_0007509 Ga0495640_0007509_1168_2175 326
730 3300046533 Ga0495640_0083092 Ga0495640_0083092_793_1797 326
731 3300046642 Ga0495634_0054241 Ga0495634_0054241_841_1845 326
732 3300046663 Ga0495635_0039076 Ga0495635_0039076_1417_2421 326
733 3300046679 Ga0495623_0076761 Ga0495623_0076761_960_1964 326
734 3300046680 Ga0495646_0006479 Ga0495646_0006479_5424_6428 326
735 3300046809 Ga0495600_0034379 Ga0495600_0034379_1666_2670 326
736 3300047319 Ga0495674_0069188 Ga0495674_0069188_1304_2311 326
737 3300048911 Ga0496108_0010745 Ga0496108_0010745_4082_5089 326
738 3300048912 Ga0496109_0008180 Ga0496109_0008180_6751_7758 326
739 3300048915 Ga0496112_0066474 Ga0496112_0066474_1557_2564 326
740 3300048916 Ga0496113_0028343 Ga0496113_0028343_197_1204 326
741 3300050490 nmdc:mga03n38_7358_c1 nmdc:mga03n38_7358_c1_2150_3157 326
742 3300050491 nmdc:mga00v17_29651_c1 nmdc:mga00v17_29651_c1_95_1102 326
743 3300050516 nmdc:mga0sz30_31789_c1 nmdc:mga0sz30_31789_c1_21_1028 326
744 3300053078 Ga0495612_0008777 Ga0495612_0008777_351_1355 326
745 3300053085 Ga0495619_0135766 Ga0495619_0135766_550_1554 326
746 3300053085 Ga0495619_0152323 Ga0495619_0152323_92_1096 326
747 3300000546 LJNas_1001384 LJNas_10013843 327
748 3300001977 JGI24746J21847_1002055 JGI24746J21847_10020552 327
749 3300001989 JGI24739J22299_10042354 JGI24739J22299_100423543 327
750 3300001990 JGI24737J22298_10031649 JGI24737J22298_100316492 327
751 3300001991 JGI24743J22301_10001318 JGI24743J22301_100013183 327
752 3300002073 JGI24745J21846_1000765 JGI24745J21846_10007653 327
753 3300002073 JGI24745J21846_1000984 JGI24745J21846_10009842 327
754 3300002074 JGI24748J21848_1006431 JGI24748J21848_10064311 327
755 3300002077 JGI24744J21845_10001076 JGI24744J21845_100010765 327
756 3300002239 JGI24034J26672_10010189 JGI24034J26672_100101892 327
757 3300005327 Ga0070658_10208076 Ga0070658_102080762 327
758 3300005330 Ga0070690_100116958 Ga0070690_1001169582 327
759 3300005334 Ga0068869_100074067 Ga0068869_1000740673 327
760 3300005337 Ga0070682_100095268 Ga0070682_1000952681 327
761 3300005340 Ga0070689_100170067 Ga0070689_1001700671 327
762 3300005354 Ga0070675_100202827 Ga0070675_1002028272 327
763 3300005356 Ga0070674_100061062 Ga0070674_1000610623 327
764 3300005364 Ga0070673_100245491 Ga0070673_1002454911 327
765 3300005366 Ga0070659_100195575 Ga0070659_1001955752 327
766 3300005367 Ga0070667_100101417 Ga0070667_1001014171 327
767 3300005441 Ga0070700_100110958 Ga0070700_1001109582 327
768 3300005444 Ga0070694_100245795 Ga0070694_1002457951 327
769 3300005455 Ga0070663_100227384 Ga0070663_1002273842 327
770 3300005456 Ga0070678_100049687 Ga0070678_1000496871 327
771 3300005459 Ga0068867_100163794 Ga0068867_1001637942 327
772 3300005466 Ga0070685_10079032 Ga0070685_100790322 327
773 3300005545 Ga0070695_100297049 Ga0070695_1002970491 327
774 3300005547 Ga0070693_100235145 Ga0070693_1002351452 327
775 3300005549 Ga0070704_100133556 Ga0070704_1001335562 327
776 3300005578 Ga0068854_100069553 Ga0068854_1000695532 327
777 3300005615 Ga0070702_100030685 Ga0070702_1000306853 327
778 3300005617 Ga0068859_100130301 Ga0068859_1001303012 327
779 3300005618 Ga0068864_100036323 Ga0068864_1000363233 327
780 3300005719 Ga0068861_100076648 Ga0068861_1000766482 327
781 3300005840 Ga0068870_10037494 Ga0068870_100374943 327
782 3300005841 Ga0068863_100071447 Ga0068863_1000714472 327
783 3300005842 Ga0068858_100106930 Ga0068858_1001069303 327
784 3300005842 Ga0068858_100363881 Ga0068858_1003638812 327
785 3300005843 Ga0068860_100137333 Ga0068860_1001373333 327
786 3300005844 Ga0068862_100078615 Ga0068862_1000786152 327
787 3300005844 Ga0068862_100607825 Ga0068862_1006078251 327
788 3300005937 Ga0081455_10031783 Ga0081455_100317834 327
789 3300006163 Ga0070715_10004891 Ga0070715_100048913 327
790 3300006844 Ga0075428_100002335 Ga0075428_1000023355 327
791 3300006846 Ga0075430_100026112 Ga0075430_1000261122 327
792 3300006881 Ga0068865_100083333 Ga0068865_1000833332 327
793 3300006931 Ga0097620_100130309 Ga0097620_1001303093 327
794 3300007788 Ga0099795_10032564 Ga0099795_100325642 327
795 3300009098 Ga0105245_10095034 Ga0105245_100950342 327
796 3300009147 Ga0114129_10006340 Ga0114129_100063405 327
797 3300009148 Ga0105243_10313558 Ga0105243_103135582 327
798 3300009176 Ga0105242_10193803 Ga0105242_101938031 327
799 3300009553 Ga0105249_10377205 Ga0105249_103772051 327
800 3300010375 Ga0105239_10210791 Ga0105239_102107913 327
801 3300011119 Ga0105246_10136270 Ga0105246_101362702 327
802 3300013105 Ga0157369_10193114 Ga0157369_101931142 327
803 3300013296 Ga0157374_10252055 Ga0157374_102520552 327
804 3300013306 Ga0163162_10185644 Ga0163162_101856442 327
805 3300013307 Ga0157372_10304107 Ga0157372_103041072 327
806 3300013308 Ga0157375_10304096 Ga0157375_103040962 327
807 3300014325 Ga0163163_10361280 Ga0163163_103612802 327
808 3300014326 Ga0157380_10044779 Ga0157380_100447794 327
809 3300014745 Ga0157377_10038572 Ga0157377_100385722 327
810 3300014968 Ga0157379_10129161 Ga0157379_101291612 327
811 3300025321 Ga0207656_10100562 Ga0207656_101005622 327
812 3300025901 Ga0207688_10041511 Ga0207688_100415113 327
813 3300025901 Ga0207688_10145964 Ga0207688_101459642 327
814 3300025907 Ga0207645_10031073 Ga0207645_100310734 327
815 3300025908 Ga0207643_10008448 Ga0207643_100084483 327
816 3300025909 Ga0207705_10163159 Ga0207705_101631592 327
817 3300025915 Ga0207693_10266846 Ga0207693_102668462 327
818 3300025919 Ga0207657_10062162 Ga0207657_100621623 327
819 3300025926 Ga0207659_10028255 Ga0207659_100282552 327
820 3300025927 Ga0207687_10063449 Ga0207687_100634493 327
821 3300025933 Ga0207706_10284058 Ga0207706_102840583 327
822 3300025936 Ga0207670_10276531 Ga0207670_102765311 327
823 3300025960 Ga0207651_10109454 Ga0207651_101094542 327
824 3300025961 Ga0207712_10210608 Ga0207712_102106082 327
825 3300025961 Ga0207712_10225569 Ga0207712_102255692 327
826 3300025981 Ga0207640_10091970 Ga0207640_100919702 327
827 3300025986 Ga0207658_10030161 Ga0207658_100301612 327
828 3300026023 Ga0207677_10072049 Ga0207677_100720492 327
829 3300026067 Ga0207678_10164005 Ga0207678_101640052 327
830 3300026075 Ga0207708_10088421 Ga0207708_100884213 327
831 3300026089 Ga0207648_10156802 Ga0207648_101568022 327
832 3300026095 Ga0207676_10010413 Ga0207676_100104136 327
833 3300026121 Ga0207683_10214345 Ga0207683_102143452 327
834 3300026121 Ga0207683_10345990 Ga0207683_103459902 327
835 3300026142 Ga0207698_10148117 Ga0207698_101481172 327
836 3300026142 Ga0207698_10619034 Ga0207698_106190341 327
837 3300028379 Ga0268266_10107051 Ga0268266_101070513 327
838 3300028380 Ga0268265_10036321 Ga0268265_100363213 327
839 3300035691 Ga0373931_0106548 Ga0373931_0106548_433_1440 327
840 3300036459 Ga0372808_010586 Ga0372808_010586_46_1077 327
841 3300046473 Ga0495582_0088840 Ga0495582_0088840_145_1152 327
842 3300047315 Ga0495581_0055951 Ga0495581_0055951_577_1584 327
843 3300047321 Ga0495676_0165950 Ga0495676_0165950_485_1492 327
844 3300048905 Ga0496102_0042309 Ga0496102_0042309_1714_2721 327
845 3300048906 Ga0496103_0244184 Ga0496103_0244184_31_1038 327
846 3300048907 Ga0496104_0034413 Ga0496104_0034413_1339_2346 327
847 3300048908 Ga0496105_0087609 Ga0496105_0087609_291_1298 327
848 3300048909 Ga0496106_0192120 Ga0496106_0192120_238_1245 327
849 3300048911 Ga0496108_0000589 Ga0496108_0000589_472_1479 327
850 3300048912 Ga0496109_0019238 Ga0496109_0019238_2706_3713 327
851 3300048913 Ga0496110_0008537 Ga0496110_0008537_2355_3362 327
852 3300048913 Ga0496110_0211866 Ga0496110_0211866_68_1075 327
853 3300048915 Ga0496112_0060387 Ga0496112_0060387_2148_3155 327
854 3300050507 nmdc:mga05p37_13318_c1 nmdc:mga05p37_13318_c1_4526_5533 327
855 3300050509 nmdc:mga0qj67_18337_c1 nmdc:mga0qj67_18337_c1_3198_4205 327
856 iso_pu_bacteria 2974315732 2974318057 327
857 iso_pu_bacteria 2984523437 2984526275 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

1

114

0.96

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

122

243

0.94

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

126

324

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hkt-assembly1.cif.gz_D crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) 0.9175 3 322
3euw-assembly1.cif.gz_B crystal structure of a myo-inositol dehydrogenase from corynebacterium glutamicum atcc 13032 0.9163 1 322
4mkx-assembly1.cif.gz_A crystal structure of apo scyllo-inositol dehydrogenase from lactobacillus casei 0.9075 2 323
3ezy-assembly1.cif.gz_B crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9071 4 325
3ezy-assembly1.cif.gz_C crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.907 4 324
ID Description Score Start End Superfamily
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 3 119 3.40.50.720
af_X1WHF8_40_206_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9293 2 36 3.50.50.60
af_A0A1D8PPX6_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9276 1 116 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9232 3 119 3.40.50.720
1xeaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.914 2 119 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A558HCL1-F1-model_v4 Dehydrogenase 0.9727 1 322 GO:0000166
GO:0016491
AF-A0A1Q2CQZ5-F1-model_v4 Dehydrogenase 0.9706 4 327 GO:0000166
GO:0016491
AF-K6VRP8-F1-model_v4 Putative oxidoreductase 0.9679 2 326 GO:0000166
GO:0016491
AF-K6VRP8-F1-model_v4 Putative oxidoreductase 0.9592 2 326 GO:0000166
GO:0016491
AF-A0A1Q2CQZ5-F1-model_v4 Dehydrogenase 0.959 4 327 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
96.15 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map