F483713
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 857 | 478 | 761 | 332 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221714|2644631522 |
| Length | 400 |
| Sequence | ILGLGRIGAFHAETLFGLDAVESLVVADPFAEAAKTAAERFGAEVADSPEAVLAAGVDGVVIAAATDAHPGLILAAVEAGVPVFCEKPVARTMAEGVEVLKAVQGSPVPIQIGYNRRFDAGFVAARAAVQTGELGTLHTVRSTTLDPAPPPAAYVAASGGIFRDCSVHDFDIIRWVTGREVSEVYAVGGNRGADYIKAAGDADTTGAILTLDDGTIAVVSNSRHNARGYDVRMEIHGFTDSIAVGLEDKLPLRSVEPGATFPAGTPHDFFMDRFTAAYRAELTAFTEVVAGTRPSPCTIEDALEAGWIAEACTLSLHEHRPVTIAEVRXXXXXXARPGPGRPPRAHRPWRIATWSGAQASRAGSRGVAGRSCTGPRGFTHRGATSSPRRRLRGEVEDVVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 5 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 6 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 7 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 8 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 9 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 10 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 11 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 12 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 13 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 14 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 15 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 16 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 17 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 18 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 19 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 20 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 21 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 22 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 23 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 24 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 25 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 26 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 27 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 28 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 29 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 30 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 31 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 32 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 33 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 34 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 35 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 36 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 37 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 38 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 39 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 40 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 41 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 42 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 43 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 44 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 45 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 46 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 47 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 48 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 49 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 50 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 51 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 52 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 53 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 54 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 55 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 56 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 57 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 58 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 59 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 60 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 61 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 62 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 63 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 64 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 65 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 66 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 67 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 68 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 69 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 70 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 71 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 72 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 73 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 74 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 75 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 76 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 77 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 78 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 79 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 80 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 81 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 82 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 83 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 84 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 85 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 86 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 87 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 88 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 89 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 90 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 91 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 92 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 93 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 94 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 95 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 96 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 98 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 99 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 103 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 105 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 107 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 114 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 127 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 130 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 137 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 138 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 140 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 141 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 142 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 143 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 144 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 148 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 149 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 150 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 151 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 152 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 154 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 157 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 158 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 159 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 160 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 161 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 162 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 163 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 164 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 165 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 167 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 168 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 169 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 195 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 198 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 199 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 256 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 257 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 258 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 259 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 260 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 261 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 262 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 263 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 267 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 268 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 269 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 270 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 275 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 276 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 277 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 278 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 279 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 291 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 292 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 293 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 294 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 295 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 296 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 297 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 298 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 299 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 300 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 301 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 302 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 303 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 304 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 305 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 306 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 307 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 308 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 309 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 310 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 311 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 312 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 313 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 314 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 315 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 316 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 317 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 318 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 319 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 320 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 321 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 322 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 323 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 324 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 325 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 332 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 391 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 392 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 393 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 394 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 395 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 396 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 399 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 400 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 401 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 402 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 403 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 404 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 405 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 428 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 434 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 435 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 436 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 450 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 452 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 453 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 454 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 455 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 458 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 460 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 461 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 463 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 465 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 466 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 467 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 468 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 469 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 470 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 471 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 472 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 473 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 474 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 475 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 476 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 477 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 478 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.45 |
| Metatranscriptomes | 0.35 |
| Isolates | 11.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 2.92 |
| Nodule | 0.35 |
| Rhizoplane | 8.63 |
| Rhizosphere | 78.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001384 | 3300000546 | Bacteria | 3500 |
| 2 | LJNas_1007449 | 3300000546 | Bacteria | 1180 |
| 3 | LJQas_1000385 | 3300000549 | Bacteria | 7479 |
| 4 | JGI24746J21847_1002055 | 3300001977 | Bacteria | 3213 |
| 5 | JGI24747J21853_1000411 | 3300001978 | Bacteria | 2592 |
| 6 | JGI24739J22299_10042354 | 3300001989 | Bacteria | 1510 |
| 7 | JGI24737J22298_10031649 | 3300001990 | Bacteria | 1651 |
| 8 | JGI24737J22298_10056929 | 3300001990 | Bacteria | 1180 |
| 9 | JGI24743J22301_10001318 | 3300001991 | Bacteria | 3399 |
| 10 | JGI24735J21928_10020495 | 3300002067 | Bacteria | 2024 |
| 11 | JGI24750J21931_1002461 | 3300002070 | Bacteria | 2231 |
| 12 | JGI24745J21846_1000765 | 3300002073 | Bacteria | 2934 |
| 13 | JGI24745J21846_1000984 | 3300002073 | Bacteria | 2666 |
| 14 | JGI24748J21848_1002241 | 3300002074 | Bacteria | 2169 |
| 15 | JGI24748J21848_1006431 | 3300002074 | Bacteria | 1367 |
| 16 | JGI24744J21845_10001076 | 3300002077 | Bacteria | 5283 |
| 17 | JGI24744J21845_10001784 | 3300002077 | Bacteria | 4320 |
| 18 | JGI24034J26672_10010189 | 3300002239 | Bacteria | 1393 |
| 19 | JGI24742J22300_10001076 | 3300002244 | Bacteria | 4217 |
| 20 | JGI25406J46586_10017256 | 3300003203 | Bacteria | 2989 |
| 21 | rootH1_10000180 | 3300003316 | Bacteria | 19593 |
| 22 | Ga0006562J51391_1090646 | 3300003578 | Bacteria | 3979 |
| 23 | Ga0006562J51391_1090648 | 3300003578 | Bacteria | 3370 |
| 24 | Ga0070658_10002817 | 3300005327 | Bacteria | 14445 |
| 25 | Ga0070658_10208076 | 3300005327 | Bacteria | 1652 |
| 26 | Ga0070676_10172681 | 3300005328 | Bacteria | 1399 |
| 27 | Ga0070683_100116116 | 3300005329 | Bacteria | 2527 |
| 28 | Ga0070690_100021466 | 3300005330 | Bacteria | 3943 |
| 29 | Ga0070690_100116958 | 3300005330 | Bacteria | 1785 |
| 30 | Ga0070677_10037016 | 3300005333 | Bacteria | 1901 |
| 31 | Ga0068869_100062168 | 3300005334 | Bacteria | 2740 |
| 32 | Ga0068869_100074067 | 3300005334 | Bacteria | 2527 |
| 33 | Ga0070682_100095268 | 3300005337 | Bacteria | 1954 |
| 34 | Ga0070689_100170067 | 3300005340 | Bacteria | 1765 |
| 35 | Ga0070687_100042717 | 3300005343 | Bacteria | 2299 |
| 36 | Ga0070669_100026548 | 3300005353 | Bacteria | 4166 |
| 37 | Ga0070669_100348477 | 3300005353 | Bacteria | 1202 |
| 38 | Ga0070675_100202827 | 3300005354 | Bacteria | 1721 |
| 39 | Ga0070671_100106988 | 3300005355 | Bacteria | 2348 |
| 40 | Ga0070674_100061062 | 3300005356 | Bacteria | 2629 |
| 41 | Ga0070673_100156160 | 3300005364 | Bacteria | 1936 |
| 42 | Ga0070673_100245491 | 3300005364 | Bacteria | 1558 |
| 43 | Ga0070688_100011804 | 3300005365 | Bacteria | 4870 |
| 44 | Ga0070659_100195575 | 3300005366 | Bacteria | 1663 |
| 45 | Ga0070659_100225772 | 3300005366 | Bacteria | 1547 |
| 46 | Ga0070667_100101417 | 3300005367 | Bacteria | 2486 |
| 47 | Ga0070667_100516903 | 3300005367 | Bacteria | 1095 |
| 48 | Ga0070703_10007190 | 3300005406 | Bacteria | 3126 |
| 49 | Ga0070714_100020361 | 3300005435 | Bacteria | 5417 |
| 50 | Ga0070714_100353973 | 3300005435 | Bacteria | 1379 |
| 51 | Ga0070710_10073448 | 3300005437 | Bacteria | 1977 |
| 52 | Ga0070710_10147698 | 3300005437 | Bacteria | 1447 |
| 53 | Ga0070705_100064350 | 3300005440 | Bacteria | 2190 |
| 54 | Ga0070700_100110958 | 3300005441 | Bacteria | 1823 |
| 55 | Ga0070694_100245795 | 3300005444 | Bacteria | 1351 |
| 56 | Ga0070708_100010999 | 3300005445 | Bacteria | 7354 |
| 57 | Ga0070663_100227384 | 3300005455 | Bacteria | 1467 |
| 58 | Ga0070678_100030815 | 3300005456 | Bacteria | 3691 |
| 59 | Ga0070678_100049687 | 3300005456 | Bacteria | 3028 |
| 60 | Ga0070678_100280559 | 3300005456 | Bacteria | 1409 |
| 61 | Ga0070662_100388748 | 3300005457 | Bacteria | 1149 |
| 62 | Ga0068867_100043517 | 3300005459 | Bacteria | 3287 |
| 63 | Ga0068867_100163794 | 3300005459 | Bacteria | 1755 |
| 64 | Ga0068867_100439913 | 3300005459 | Bacteria | 1108 |
| 65 | Ga0070685_10067743 | 3300005466 | Bacteria | 2106 |
| 66 | Ga0070685_10079032 | 3300005466 | Bacteria | 1968 |
| 67 | Ga0070707_100158662 | 3300005468 | Bacteria | 2203 |
| 68 | Ga0068853_100058607 | 3300005539 | Bacteria | 3324 |
| 69 | Ga0070672_100189323 | 3300005543 | Bacteria | 1717 |
| 70 | Ga0070695_100297049 | 3300005545 | Bacteria | 1192 |
| 71 | Ga0070696_100101390 | 3300005546 | Bacteria | 2063 |
| 72 | Ga0070693_100235145 | 3300005547 | Bacteria | 1207 |
| 73 | Ga0070704_100133556 | 3300005549 | Bacteria | 1927 |
| 74 | Ga0070704_100298433 | 3300005549 | Bacteria | 1341 |
| 75 | Ga0070664_100531464 | 3300005564 | Bacteria | 1086 |
| 76 | Ga0068854_100069553 | 3300005578 | Bacteria | 2570 |
| 77 | Ga0068856_100021793 | 3300005614 | Bacteria | 6227 |
| 78 | Ga0068856_100100307 | 3300005614 | Bacteria | 2887 |
| 79 | Ga0070702_100030685 | 3300005615 | Bacteria | 2932 |
| 80 | Ga0070702_100184407 | 3300005615 | Bacteria | 1368 |
| 81 | Ga0068852_100181218 | 3300005616 | Bacteria | 1981 |
| 82 | Ga0068859_100130301 | 3300005617 | Bacteria | 2586 |
| 83 | Ga0068864_100036323 | 3300005618 | Bacteria | 4199 |
| 84 | Ga0068866_10059848 | 3300005718 | Bacteria | 1972 |
| 85 | Ga0068866_10152799 | 3300005718 | Bacteria | 1338 |
| 86 | Ga0068866_10191066 | 3300005718 | Bacteria | 1217 |
| 87 | Ga0068861_100076648 | 3300005719 | Bacteria | 2606 |
| 88 | Ga0068870_10037494 | 3300005840 | Bacteria | 2499 |
| 89 | Ga0068870_10067519 | 3300005840 | Bacteria | 1940 |
| 90 | Ga0068863_100071447 | 3300005841 | Bacteria | 3283 |
| 91 | Ga0068858_100106930 | 3300005842 | Bacteria | 2611 |
| 92 | Ga0068858_100363881 | 3300005842 | Bacteria | 1386 |
| 93 | Ga0068860_100137333 | 3300005843 | Bacteria | 2348 |
| 94 | Ga0068860_100410211 | 3300005843 | Bacteria | 1341 |
| 95 | Ga0068862_100078615 | 3300005844 | Bacteria | 2858 |
| 96 | Ga0068862_100607825 | 3300005844 | Bacteria | 1050 |
| 97 | Ga0081455_10031783 | 3300005937 | Bacteria | 4768 |
| 98 | Ga0081538_10007282 | 3300005981 | Bacteria | 9590 |
| 99 | Ga0081538_10013417 | 3300005981 | Bacteria | 6488 |
| 100 | Ga0081538_10020096 | 3300005981 | Bacteria | 4933 |
| 101 | Ga0081539_10001911 | 3300005985 | Bacteria | 32260 |
| 102 | Ga0081539_10002039 | 3300005985 | Bacteria | 30434 |
| 103 | Ga0081539_10005602 | 3300005985 | Bacteria | 12656 |
| 104 | Ga0081539_10028201 | 3300005985 | Bacteria | 3535 |
| 105 | Ga0070717_10083515 | 3300006028 | Bacteria | 2686 |
| 106 | Ga0070717_10111601 | 3300006028 | Bacteria | 2333 |
| 107 | Ga0070717_10323305 | 3300006028 | Bacteria | 1375 |
| 108 | Ga0070717_10421529 | 3300006028 | Bacteria | 1200 |
| 109 | Ga0075363_100001332 | 3300006048 | Bacteria | 9260 |
| 110 | Ga0075363_100175879 | 3300006048 | Bacteria | 1216 |
| 111 | Ga0070715_10004891 | 3300006163 | Bacteria | 4439 |
| 112 | Ga0070716_100019475 | 3300006173 | Bacteria | 3547 |
| 113 | Ga0070716_100054233 | 3300006173 | Bacteria | 2289 |
| 114 | Ga0068871_100098224 | 3300006358 | Bacteria | 2449 |
| 115 | Ga0075428_100002335 | 3300006844 | Bacteria | 20588 |
| 116 | Ga0075428_100051364 | 3300006844 | Bacteria | 4521 |
| 117 | Ga0075430_100026112 | 3300006846 | Bacteria | 4969 |
| 118 | Ga0075430_100072408 | 3300006846 | Bacteria | 2890 |
| 119 | Ga0075430_100202626 | 3300006846 | Bacteria | 1647 |
| 120 | Ga0075431_100201619 | 3300006847 | Bacteria | 2035 |
| 121 | Ga0075433_10016326 | 3300006852 | Bacteria | 6115 |
| 122 | Ga0075434_100019077 | 3300006871 | Bacteria | 6628 |
| 123 | Ga0075429_100090918 | 3300006880 | Bacteria | 2662 |
| 124 | Ga0068865_100083333 | 3300006881 | Bacteria | 2301 |
| 125 | Ga0075436_100240410 | 3300006914 | Bacteria | 1288 |
| 126 | Ga0097620_100130309 | 3300006931 | Bacteria | 2586 |
| 127 | Ga0099826_10112892 | 3300006948 | Bacteria | 1615 |
| 128 | Ga0075435_100017358 | 3300007076 | Bacteria | 5447 |
| 129 | Ga0099795_10032564 | 3300007788 | Bacteria | 1803 |
| 130 | Ga0105244_10027672 | 3300009036 | Bacteria | 3053 |
| 131 | Ga0105244_10035787 | 3300009036 | Bacteria | 2606 |
| 132 | Ga0105250_10014173 | 3300009092 | Bacteria | 3279 |
| 133 | Ga0105240_10232985 | 3300009093 | Bacteria | 2139 |
| 134 | Ga0111539_10201896 | 3300009094 | Bacteria | 2318 |
| 135 | Ga0111539_10425385 | 3300009094 | Bacteria | 1547 |
| 136 | Ga0105245_10095034 | 3300009098 | Bacteria | 2749 |
| 137 | Ga0105245_10293825 | 3300009098 | Bacteria | 1592 |
| 138 | Ga0105247_10094430 | 3300009101 | Bacteria | 1903 |
| 139 | Ga0114129_10002238 | 3300009147 | Bacteria | 26708 |
| 140 | Ga0114129_10006340 | 3300009147 | Bacteria | 16774 |
| 141 | Ga0114129_10121840 | 3300009147 | Bacteria | 3589 |
| 142 | Ga0114129_10248132 | 3300009147 | Bacteria | 2391 |
| 143 | Ga0105243_10211219 | 3300009148 | Bacteria | 1709 |
| 144 | Ga0105243_10313558 | 3300009148 | Bacteria | 1426 |
| 145 | Ga0105241_10190504 | 3300009174 | Bacteria | 1707 |
| 146 | Ga0105242_10193803 | 3300009176 | Bacteria | 1801 |
| 147 | Ga0105248_10120250 | 3300009177 | Bacteria | 2963 |
| 148 | Ga0105238_10155910 | 3300009551 | Bacteria | 2259 |
| 149 | Ga0105238_10229048 | 3300009551 | Bacteria | 1835 |
| 150 | Ga0105238_10267275 | 3300009551 | Bacteria | 1691 |
| 151 | Ga0105249_10377205 | 3300009553 | Bacteria | 1443 |
| 152 | Ga0105239_10210791 | 3300010375 | Bacteria | 2178 |
| 153 | Ga0105239_10244205 | 3300010375 | Bacteria | 2015 |
| 154 | Ga0105239_10272667 | 3300010375 | Bacteria | 1903 |
| 155 | Ga0105246_10010978 | 3300011119 | Bacteria | 5615 |
| 156 | Ga0105246_10136270 | 3300011119 | Bacteria | 1840 |
| 157 | Ga0157371_10054782 | 3300013102 | Bacteria | 2831 |
| 158 | Ga0157370_10014391 | 3300013104 | Bacteria | 8089 |
| 159 | Ga0157370_10140937 | 3300013104 | Bacteria | 2246 |
| 160 | Ga0157369_10007585 | 3300013105 | Bacteria | 12486 |
| 161 | Ga0157369_10063572 | 3300013105 | Bacteria | 3976 |
| 162 | Ga0157369_10193114 | 3300013105 | Bacteria | 2138 |
| 163 | Ga0157374_10252055 | 3300013296 | Bacteria | 1737 |
| 164 | Ga0157378_10228658 | 3300013297 | Bacteria | 1771 |
| 165 | Ga0163162_10041447 | 3300013306 | Bacteria | 4607 |
| 166 | Ga0163162_10185644 | 3300013306 | Bacteria | 2206 |
| 167 | Ga0163162_10187843 | 3300013306 | Bacteria | 2193 |
| 168 | Ga0157372_10304107 | 3300013307 | Bacteria | 1855 |
| 169 | Ga0157372_10429327 | 3300013307 | Bacteria | 1540 |
| 170 | Ga0157375_10008683 | 3300013308 | Bacteria | 8905 |
| 171 | Ga0157375_10304096 | 3300013308 | Bacteria | 1758 |
| 172 | Ga0157375_10357746 | 3300013308 | Bacteria | 1626 |
| 173 | Ga0163163_10361280 | 3300014325 | Bacteria | 1508 |
| 174 | Ga0157380_10044779 | 3300014326 | Bacteria | 3469 |
| 175 | Ga0157380_10087454 | 3300014326 | Bacteria | 2562 |
| 176 | Ga0182008_10001253 | 3300014497 | Bacteria | 17425 |
| 177 | Ga0182008_10092955 | 3300014497 | Bacteria | 1488 |
| 178 | Ga0157377_10038572 | 3300014745 | Bacteria | 2639 |
| 179 | Ga0157379_10129161 | 3300014968 | Bacteria | 2274 |
| 180 | Ga0182007_10009486 | 3300015262 | Bacteria | 3918 |
| 181 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 182 | Ga0163161_10059058 | 3300017792 | Bacteria | 2788 |
| 183 | Ga0209051_1011931 | 3300025303 | Bacteria | 4244 |
| 184 | Ga0207697_10001554 | 3300025315 | Bacteria | 12403 |
| 185 | Ga0207697_10013957 | 3300025315 | Bacteria | 3344 |
| 186 | Ga0207656_10100562 | 3300025321 | Bacteria | 1325 |
| 187 | Ga0207655_1027201 | 3300025728 | Bacteria | 2730 |
| 188 | Ga0207653_10005382 | 3300025885 | Bacteria | 4000 |
| 189 | Ga0207682_10036006 | 3300025893 | Bacteria | 2001 |
| 190 | Ga0207692_10016241 | 3300025898 | Bacteria | 3291 |
| 191 | Ga0207692_10025252 | 3300025898 | Bacteria | 2772 |
| 192 | Ga0207692_10146736 | 3300025898 | Bacteria | 1347 |
| 193 | Ga0207688_10041511 | 3300025901 | Bacteria | 2559 |
| 194 | Ga0207688_10058232 | 3300025901 | Bacteria | 2174 |
| 195 | Ga0207688_10145964 | 3300025901 | Bacteria | 1395 |
| 196 | Ga0207680_10212010 | 3300025903 | Bacteria | 1324 |
| 197 | Ga0207647_10148132 | 3300025904 | Bacteria | 1373 |
| 198 | Ga0207699_10069689 | 3300025906 | Bacteria | 2145 |
| 199 | Ga0207699_10299085 | 3300025906 | Bacteria | 1123 |
| 200 | Ga0207645_10003084 | 3300025907 | Bacteria | 12788 |
| 201 | Ga0207645_10031073 | 3300025907 | Bacteria | 3439 |
| 202 | Ga0207643_10008448 | 3300025908 | Bacteria | 5526 |
| 203 | Ga0207705_10001278 | 3300025909 | Bacteria | 20175 |
| 204 | Ga0207705_10163159 | 3300025909 | Bacteria | 1675 |
| 205 | Ga0207693_10266846 | 3300025915 | Bacteria | 1342 |
| 206 | Ga0207693_10307924 | 3300025915 | Bacteria | 1240 |
| 207 | Ga0207663_10267341 | 3300025916 | Bacteria | 1265 |
| 208 | Ga0207662_10066950 | 3300025918 | Bacteria | 2165 |
| 209 | Ga0207657_10062162 | 3300025919 | Bacteria | 3199 |
| 210 | Ga0207652_10072244 | 3300025921 | Bacteria | 3000 |
| 211 | Ga0207646_10043317 | 3300025922 | Bacteria | 4043 |
| 212 | Ga0207681_10037972 | 3300025923 | Bacteria | 3187 |
| 213 | Ga0207681_10071132 | 3300025923 | Bacteria | 2425 |
| 214 | Ga0207659_10028255 | 3300025926 | Bacteria | 3810 |
| 215 | Ga0207687_10018087 | 3300025927 | Bacteria | 4650 |
| 216 | Ga0207687_10063449 | 3300025927 | Bacteria | 2616 |
| 217 | Ga0207687_10118163 | 3300025927 | Bacteria | 1979 |
| 218 | Ga0207700_10095231 | 3300025928 | Bacteria | 2361 |
| 219 | Ga0207664_10040745 | 3300025929 | Bacteria | 3614 |
| 220 | Ga0207664_10043723 | 3300025929 | Bacteria | 3506 |
| 221 | Ga0207706_10284058 | 3300025933 | Bacteria | 1443 |
| 222 | Ga0207686_10075145 | 3300025934 | Bacteria | 2186 |
| 223 | Ga0207709_10055200 | 3300025935 | Bacteria | 2453 |
| 224 | Ga0207670_10276531 | 3300025936 | Bacteria | 1307 |
| 225 | Ga0207704_10012717 | 3300025938 | Bacteria | 4183 |
| 226 | Ga0207665_10290453 | 3300025939 | Bacteria | 1219 |
| 227 | Ga0207691_10000469 | 3300025940 | Bacteria | 39908 |
| 228 | Ga0207691_10109193 | 3300025940 | Bacteria | 2461 |
| 229 | Ga0207689_10079381 | 3300025942 | Bacteria | 2697 |
| 230 | Ga0207689_10247867 | 3300025942 | Bacteria | 1473 |
| 231 | Ga0207661_10065810 | 3300025944 | Bacteria | 2943 |
| 232 | Ga0207661_10133411 | 3300025944 | Bacteria | 2130 |
| 233 | Ga0207651_10035277 | 3300025960 | Bacteria | 3250 |
| 234 | Ga0207651_10109454 | 3300025960 | Bacteria | 2070 |
| 235 | Ga0207712_10210608 | 3300025961 | Bacteria | 1548 |
| 236 | Ga0207712_10225569 | 3300025961 | Bacteria | 1501 |
| 237 | Ga0207668_10023437 | 3300025972 | Bacteria | 3967 |
| 238 | Ga0207640_10091970 | 3300025981 | Bacteria | 2103 |
| 239 | Ga0207658_10030161 | 3300025986 | Bacteria | 3837 |
| 240 | Ga0207677_10072049 | 3300026023 | Bacteria | 2441 |
| 241 | Ga0207677_10103413 | 3300026023 | Bacteria | 2103 |
| 242 | Ga0207703_10067941 | 3300026035 | Bacteria | 2935 |
| 243 | Ga0207703_10195047 | 3300026035 | Bacteria | 1796 |
| 244 | Ga0207678_10006777 | 3300026067 | Bacteria | 10154 |
| 245 | Ga0207678_10164005 | 3300026067 | Bacteria | 1897 |
| 246 | Ga0207678_10269127 | 3300026067 | Bacteria | 1461 |
| 247 | Ga0207678_10315368 | 3300026067 | Bacteria | 1345 |
| 248 | Ga0207708_10018814 | 3300026075 | Bacteria | 5203 |
| 249 | Ga0207708_10088421 | 3300026075 | Bacteria | 2386 |
| 250 | Ga0207702_10020919 | 3300026078 | Bacteria | 5414 |
| 251 | Ga0207702_10319612 | 3300026078 | Bacteria | 1478 |
| 252 | Ga0207648_10156802 | 3300026089 | Bacteria | 2009 |
| 253 | Ga0207676_10010413 | 3300026095 | Bacteria | 6620 |
| 254 | Ga0207674_10117417 | 3300026116 | Bacteria | 2631 |
| 255 | Ga0207675_100158503 | 3300026118 | Bacteria | 2158 |
| 256 | Ga0207675_100283651 | 3300026118 | Bacteria | 1610 |
| 257 | Ga0207683_10104334 | 3300026121 | Bacteria | 2533 |
| 258 | Ga0207683_10151673 | 3300026121 | Bacteria | 2092 |
| 259 | Ga0207683_10214345 | 3300026121 | Bacteria | 1753 |
| 260 | Ga0207683_10313682 | 3300026121 | Bacteria | 1436 |
| 261 | Ga0207683_10345990 | 3300026121 | Bacteria | 1364 |
| 262 | Ga0207698_10109210 | 3300026142 | Bacteria | 2314 |
| 263 | Ga0207698_10148117 | 3300026142 | Bacteria | 2033 |
| 264 | Ga0207698_10232836 | 3300026142 | Bacteria | 1673 |
| 265 | Ga0207698_10619034 | 3300026142 | Bacteria | 1069 |
| 266 | Ga0209813_10066393 | 3300027866 | Bacteria | 1164 |
| 267 | Ga0207428_10005972 | 3300027907 | Bacteria | 11274 |
| 268 | Ga0268266_10107051 | 3300028379 | Bacteria | 2472 |
| 269 | Ga0268265_10036321 | 3300028380 | Bacteria | 3608 |
| 270 | Ga0268264_10292426 | 3300028381 | Bacteria | 1530 |
| 271 | Ga0268264_10437633 | 3300028381 | Bacteria | 1264 |
| 272 | Ga0307517_10004208 | 3300028786 | Bacteria | 22182 |
| 273 | Ga0307515_10000046 | 3300028794 | Bacteria | 293319 |
| 274 | Ga0307515_10000149 | 3300028794 | Bacteria | 169663 |
| 275 | Ga0307515_10034314 | 3300028794 | Bacteria | 8314 |
| 276 | Ga0307511_10004532 | 3300030521 | Bacteria | 14170 |
| 277 | Ga0307511_10026828 | 3300030521 | Bacteria | 5277 |
| 278 | Ga0307512_10009639 | 3300030522 | Bacteria | 9284 |
| 279 | Ga0307512_10065667 | 3300030522 | Bacteria | 2748 |
| 280 | Ga0307512_10116292 | 3300030522 | Bacteria | 1738 |
| 281 | Ga0307513_10008529 | 3300031456 | Bacteria | 13096 |
| 282 | Ga0307513_10086968 | 3300031456 | Bacteria | 3202 |
| 283 | Ga0307509_10018697 | 3300031507 | Bacteria | 7936 |
| 284 | Ga0307509_10051169 | 3300031507 | Bacteria | 4420 |
| 285 | Ga0307509_10099927 | 3300031507 | Bacteria | 2941 |
| 286 | Ga0307408_100001087 | 3300031548 | Bacteria | 20790 |
| 287 | Ga0307408_100013603 | 3300031548 | Bacteria | 5403 |
| 288 | Ga0307408_100015963 | 3300031548 | Bacteria | 5007 |
| 289 | Ga0307408_100037920 | 3300031548 | Bacteria | 3397 |
| 290 | Ga0307408_100074614 | 3300031548 | Bacteria | 2517 |
| 291 | Ga0307408_100328078 | 3300031548 | Bacteria | 1291 |
| 292 | Ga0307508_10005047 | 3300031616 | Bacteria | 12676 |
| 293 | Ga0307508_10007365 | 3300031616 | Bacteria | 10252 |
| 294 | Ga0307508_10011478 | 3300031616 | Bacteria | 8091 |
| 295 | Ga0307508_10124426 | 3300031616 | Bacteria | 2181 |
| 296 | Ga0307508_10142436 | 3300031616 | Bacteria | 2001 |
| 297 | Ga0307514_10006879 | 3300031649 | Bacteria | 9846 |
| 298 | Ga0307514_10173395 | 3300031649 | Bacteria | 1404 |
| 299 | Ga0307516_10010982 | 3300031730 | Bacteria | 9898 |
| 300 | Ga0307516_10013623 | 3300031730 | Bacteria | 8642 |
| 301 | Ga0307516_10020452 | 3300031730 | Bacteria | 6838 |
| 302 | Ga0307405_10002066 | 3300031731 | Bacteria | 8739 |
| 303 | Ga0307405_10006030 | 3300031731 | Bacteria | 5922 |
| 304 | Ga0307405_10007947 | 3300031731 | Bacteria | 5347 |
| 305 | Ga0307405_10019009 | 3300031731 | Bacteria | 3805 |
| 306 | Ga0307405_10043060 | 3300031731 | Bacteria | 2751 |
| 307 | Ga0307405_10051669 | 3300031731 | Bacteria | 2551 |
| 308 | Ga0307405_10062249 | 3300031731 | Bacteria | 2362 |
| 309 | Ga0307405_10075179 | 3300031731 | Bacteria | 2187 |
| 310 | Ga0307413_10036545 | 3300031824 | Bacteria | 2828 |
| 311 | Ga0307413_10038517 | 3300031824 | Bacteria | 2772 |
| 312 | Ga0307413_10074884 | 3300031824 | Bacteria | 2146 |
| 313 | Ga0307413_10078030 | 3300031824 | Bacteria | 2111 |
| 314 | Ga0307413_10306170 | 3300031824 | Bacteria | 1207 |
| 315 | Ga0307518_10098538 | 3300031838 | Bacteria | 2095 |
| 316 | Ga0307518_10143289 | 3300031838 | Bacteria | 1663 |
| 317 | Ga0307518_10144341 | 3300031838 | Bacteria | 1655 |
| 318 | Ga0307410_10001911 | 3300031852 | Bacteria | 9755 |
| 319 | Ga0307410_10002556 | 3300031852 | Bacteria | 8816 |
| 320 | Ga0307410_10002873 | 3300031852 | Bacteria | 8474 |
| 321 | Ga0307410_10004357 | 3300031852 | Bacteria | 7305 |
| 322 | Ga0307410_10008843 | 3300031852 | Bacteria | 5614 |
| 323 | Ga0307410_10017872 | 3300031852 | Bacteria | 4270 |
| 324 | Ga0307410_10032306 | 3300031852 | Bacteria | 3366 |
| 325 | Ga0307410_10071187 | 3300031852 | Bacteria | 2411 |
| 326 | Ga0307410_10110484 | 3300031852 | Bacteria | 1988 |
| 327 | Ga0307406_10000246 | 3300031901 | Bacteria | 32799 |
| 328 | Ga0307406_10022105 | 3300031901 | Bacteria | 3771 |
| 329 | Ga0307406_10042293 | 3300031901 | Bacteria | 2844 |
| 330 | Ga0307406_10068658 | 3300031901 | Bacteria | 2315 |
| 331 | Ga0307406_10103248 | 3300031901 | Bacteria | 1946 |
| 332 | Ga0307407_10010005 | 3300031903 | Bacteria | 4450 |
| 333 | Ga0307407_10015923 | 3300031903 | Bacteria | 3731 |
| 334 | Ga0307407_10028538 | 3300031903 | Bacteria | 2984 |
| 335 | Ga0307407_10071207 | 3300031903 | Bacteria | 2069 |
| 336 | Ga0307407_10121535 | 3300031903 | Bacteria | 1656 |
| 337 | Ga0307412_10000650 | 3300031911 | Bacteria | 20172 |
| 338 | Ga0307412_10007944 | 3300031911 | Bacteria | 6047 |
| 339 | Ga0307412_10029499 | 3300031911 | Bacteria | 3443 |
| 340 | Ga0307412_10063896 | 3300031911 | Bacteria | 2485 |
| 341 | Ga0307412_10146149 | 3300031911 | Bacteria | 1738 |
| 342 | Ga0307409_100000284 | 3300031995 | Bacteria | 20526 |
| 343 | Ga0307409_100000345 | 3300031995 | Bacteria | 19238 |
| 344 | Ga0307409_100001116 | 3300031995 | Bacteria | 12709 |
| 345 | Ga0307409_100006051 | 3300031995 | Bacteria | 7062 |
| 346 | Ga0307409_100045288 | 3300031995 | Bacteria | 3320 |
| 347 | Ga0307409_100052036 | 3300031995 | Bacteria | 3137 |
| 348 | Ga0307409_100080596 | 3300031995 | Bacteria | 2627 |
| 349 | Ga0307409_100207043 | 3300031995 | Bacteria | 1760 |
| 350 | Ga0307409_100230855 | 3300031995 | Bacteria | 1677 |
| 351 | Ga0307416_100000283 | 3300032002 | Bacteria | 26909 |
| 352 | Ga0307416_100013462 | 3300032002 | Bacteria | 5560 |
| 353 | Ga0307416_100022366 | 3300032002 | Bacteria | 4562 |
| 354 | Ga0307416_100028781 | 3300032002 | Bacteria | 4138 |
| 355 | Ga0307416_100030951 | 3300032002 | Bacteria | 4022 |
| 356 | Ga0307416_100051065 | 3300032002 | Bacteria | 3300 |
| 357 | Ga0307416_100065519 | 3300032002 | Bacteria | 2986 |
| 358 | Ga0307416_100086492 | 3300032002 | Bacteria | 2672 |
| 359 | Ga0307416_100111683 | 3300032002 | Bacteria | 2410 |
| 360 | Ga0307416_100148632 | 3300032002 | Bacteria | 2144 |
| 361 | Ga0307416_100172751 | 3300032002 | Bacteria | 2014 |
| 362 | Ga0307416_100224953 | 3300032002 | Bacteria | 1803 |
| 363 | Ga0307416_100258020 | 3300032002 | Bacteria | 1702 |
| 364 | Ga0307416_100366314 | 3300032002 | Bacteria | 1465 |
| 365 | Ga0307416_100445977 | 3300032002 | Bacteria | 1345 |
| 366 | Ga0307414_10006263 | 3300032004 | Bacteria | 6623 |
| 367 | Ga0307414_10071803 | 3300032004 | Bacteria | 2498 |
| 368 | Ga0307414_10278033 | 3300032004 | Bacteria | 1405 |
| 369 | Ga0307411_10028810 | 3300032005 | Bacteria | 3381 |
| 370 | Ga0307411_10030404 | 3300032005 | Bacteria | 3310 |
| 371 | Ga0307411_10165807 | 3300032005 | Bacteria | 1660 |
| 372 | Ga0307415_100000587 | 3300032126 | Bacteria | 15854 |
| 373 | Ga0307415_100000874 | 3300032126 | Bacteria | 13768 |
| 374 | Ga0307415_100011275 | 3300032126 | Bacteria | 5108 |
| 375 | Ga0307415_100092963 | 3300032126 | Bacteria | 2189 |
| 376 | Ga0307415_100313106 | 3300032126 | Bacteria | 1305 |
| 377 | Ga0307507_10015481 | 3300033179 | Bacteria | 8966 |
| 378 | Ga0307507_10047057 | 3300033179 | Bacteria | 4219 |
| 379 | Ga0307510_10005834 | 3300033180 | Bacteria | 14683 |
| 380 | Ga0307510_10040367 | 3300033180 | Bacteria | 5123 |
| 381 | Ga0307510_10188532 | 3300033180 | Bacteria | 1614 |
| 382 | Ga0373940_0005970 | 3300035088 | Bacteria | 2674 |
| 383 | Ga0373949_0037053 | 3300035090 | Bacteria | 1185 |
| 384 | Ga0373951_0000019 | 3300035091 | Bacteria | 63710 |
| 385 | Ga0373952_0025795 | 3300035092 | Bacteria | 1272 |
| 386 | Ga0373932_0005473 | 3300035112 | Bacteria | 2988 |
| 387 | Ga0373941_0002472 | 3300035115 | Bacteria | 4075 |
| 388 | Ga0373942_0010964 | 3300035207 | Bacteria | 2141 |
| 389 | Ga0373962_0030264 | 3300035242 | Bacteria | 1480 |
| 390 | Ga0373931_0106548 | 3300035691 | Bacteria | 1584 |
| 391 | Ga0373933_0141066 | 3300035724 | Bacteria | 1521 |
| 392 | Ga0373937_0068047 | 3300036401 | Bacteria | 3282 |
| 393 | Ga0372808_010586 | 3300036459 | Bacteria | 1299 |
| 394 | Ga0395899_0029025 | 3300037312 | Bacteria | 4161 |
| 395 | Ga0395899_0048530 | 3300037312 | Bacteria | 3159 |
| 396 | Ga0395899_0112409 | 3300037312 | Bacteria | 1957 |
| 397 | Ga0395900_0011877 | 3300037418 | Bacteria | 8906 |
| 398 | Ga0395900_0031797 | 3300037418 | Bacteria | 5424 |
| 399 | Ga0395900_0038477 | 3300037418 | Bacteria | 4930 |
| 400 | Ga0395900_0059154 | 3300037418 | Bacteria | 3945 |
| 401 | Ga0395900_0154470 | 3300037418 | Bacteria | 2344 |
| 402 | Ga0395900_0202646 | 3300037418 | Bacteria | 2007 |
| 403 | Ga0395898_0011687 | 3300037466 | Bacteria | 9106 |
| 404 | Ga0395898_0036719 | 3300037466 | Bacteria | 4864 |
| 405 | Ga0395898_0048221 | 3300037466 | Bacteria | 4178 |
| 406 | Ga0395898_0203521 | 3300037466 | Bacteria | 1889 |
| 407 | Ga0395898_0218205 | 3300037466 | Bacteria | 1819 |
| 408 | Ga0395898_0334844 | 3300037466 | Bacteria | 1443 |
| 409 | Ga0395905_0013363 | 3300037471 | Bacteria | 7867 |
| 410 | Ga0395905_0090804 | 3300037471 | Bacteria | 2864 |
| 411 | Ga0395905_0161863 | 3300037471 | Bacteria | 2103 |
| 412 | Ga0395905_0351820 | 3300037471 | Bacteria | 1365 |
| 413 | Ga0436364_0980706 | 3300037853 | Bacteria | 3197 |
| 414 | Ga0395901_0027568 | 3300038443 | Bacteria | 5838 |
| 415 | Ga0395901_0075983 | 3300038443 | Bacteria | 3504 |
| 416 | Ga0395901_0178063 | 3300038443 | Bacteria | 2230 |
| 417 | Ga0395901_0395959 | 3300038443 | Bacteria | 1419 |
| 418 | Ga0395901_0521874 | 3300038443 | Bacteria | 1206 |
| 419 | Ga0436363_1613141 | 3300039450 | Bacteria | 2364 |
| 420 | Ga0439436_0000890 | 3300041404 | Bacteria | 8176 |
| 421 | Ga0439436_0001737 | 3300041404 | Bacteria | 6385 |
| 422 | Ga0439436_0032572 | 3300041404 | Bacteria | 1511 |
| 423 | Ga0439466_0048903 | 3300041411 | Bacteria | 1390 |
| 424 | Ga0451837_1508489 | 3300041494 | Bacteria | 1301 |
| 425 | Ga0451853_0498644 | 3300041512 | Bacteria | 1523 |
| 426 | Ga0451853_3326361 | 3300041512 | Bacteria | 7161 |
| 427 | Ga0439433_0001547 | 3300041999 | Bacteria | 4765 |
| 428 | Ga0439448_0027207 | 3300042005 | Bacteria | 1801 |
| 429 | Ga0439448_0027541 | 3300042005 | Bacteria | 1792 |
| 430 | Ga0439449_0001011 | 3300042007 | Bacteria | 11090 |
| 431 | Ga0439449_0001639 | 3300042007 | Bacteria | 8773 |
| 432 | Ga0439449_0003409 | 3300042007 | Bacteria | 6184 |
| 433 | Ga0439455_0021323 | 3300042012 | Bacteria | 1544 |
| 434 | Ga0439457_000317 | 3300042014 | Bacteria | 13318 |
| 435 | Ga0439457_001433 | 3300042014 | Bacteria | 7172 |
| 436 | Ga0439462_0002416 | 3300042015 | Bacteria | 4336 |
| 437 | Ga0439462_0027327 | 3300042015 | Bacteria | 1506 |
| 438 | Ga0450894_000335 | 3300042131 | Bacteria | 8295 |
| 439 | Ga0450896_001171 | 3300042133 | Bacteria | 3138 |
| 440 | Ga0450898_002836 | 3300042134 | Bacteria | 2439 |
| 441 | Ga0450899_000754 | 3300042135 | Bacteria | 3693 |
| 442 | Ga0450903_000618 | 3300042138 | Bacteria | 7184 |
| 443 | Ga0439458_0001937 | 3300042157 | Bacteria | 5133 |
| 444 | Ga0439458_0002826 | 3300042157 | Bacteria | 4179 |
| 445 | Ga0439458_0033476 | 3300042157 | Bacteria | 1231 |
| 446 | Ga0450908_006312 | 3300042184 | Bacteria | 2255 |
| 447 | Ga0439434_0035638 | 3300042435 | Bacteria | 1521 |
| 448 | Ga0439444_0005125 | 3300042437 | Bacteria | 1935 |
| 449 | Ga0439460_0026898 | 3300042461 | Bacteria | 1612 |
| 450 | Ga0439440_0010269 | 3300042993 | Bacteria | 1953 |
| 451 | Ga0466969_0033377 | 3300044656 | Bacteria | 2613 |
| 452 | Ga0466965_0000288 | 3300044683 | Bacteria | 16687 |
| 453 | Ga0466965_0001958 | 3300044683 | Bacteria | 8611 |
| 454 | Ga0466966_0002830 | 3300044684 | Bacteria | 11416 |
| 455 | Ga0466961_0012755 | 3300044693 | Bacteria | 5381 |
| 456 | Ga0466961_0023127 | 3300044693 | Bacteria | 3996 |
| 457 | Ga0466961_0108287 | 3300044693 | Bacteria | 1749 |
| 458 | Ga0466963_0001177 | 3300044694 | Bacteria | 13738 |
| 459 | Ga0466963_0025611 | 3300044694 | Bacteria | 3764 |
| 460 | Ga0466964_0001884 | 3300044706 | Bacteria | 7323 |
| 461 | Ga0466971_0001045 | 3300044719 | Bacteria | 11476 |
| 462 | Ga0466971_0004284 | 3300044719 | Bacteria | 6150 |
| 463 | Ga0466968_0015344 | 3300044735 | Bacteria | 3035 |
| 464 | Ga0466970_0015696 | 3300044765 | Bacteria | 3899 |
| 465 | Ga0466970_0021714 | 3300044765 | Bacteria | 3345 |
| 466 | Ga0466970_0032738 | 3300044765 | Bacteria | 2747 |
| 467 | Ga0466957_0009571 | 3300044842 | Bacteria | 5534 |
| 468 | Ga0466960_0002703 | 3300044901 | Bacteria | 6701 |
| 469 | Ga0466960_0102429 | 3300044901 | Bacteria | 1476 |
| 470 | Ga0466959_0008657 | 3300045049 | Bacteria | 7203 |
| 471 | Ga0466959_0008896 | 3300045049 | Bacteria | 7120 |
| 472 | Ga0466958_0001015 | 3300045836 | Bacteria | 12747 |
| 473 | Ga0466967_0017691 | 3300045976 | Bacteria | 5670 |
| 474 | Ga0466967_0029886 | 3300045976 | Bacteria | 4566 |
| 475 | Ga0495592_0064011 | 3300046454 | Bacteria | 2696 |
| 476 | Ga0495592_0107800 | 3300046454 | Bacteria | 1975 |
| 477 | Ga0495603_0101371 | 3300046455 | Bacteria | 1681 |
| 478 | Ga0495629_0001242 | 3300046459 | Bacteria | 20032 |
| 479 | Ga0495638_0023679 | 3300046460 | Bacteria | 4012 |
| 480 | Ga0495638_0049225 | 3300046460 | Bacteria | 2635 |
| 481 | Ga0495641_0011219 | 3300046461 | Bacteria | 5125 |
| 482 | Ga0495651_0013761 | 3300046462 | Bacteria | 6255 |
| 483 | Ga0495651_0020708 | 3300046462 | Bacteria | 5106 |
| 484 | Ga0495653_0006973 | 3300046463 | Bacteria | 9278 |
| 485 | Ga0495653_0014112 | 3300046463 | Bacteria | 6514 |
| 486 | Ga0495650_0030033 | 3300046471 | Bacteria | 2468 |
| 487 | Ga0495580_0010354 | 3300046472 | Bacteria | 7269 |
| 488 | Ga0495582_0049898 | 3300046473 | Bacteria | 2305 |
| 489 | Ga0495582_0058050 | 3300046473 | Bacteria | 2134 |
| 490 | Ga0495582_0088840 | 3300046473 | Bacteria | 1722 |
| 491 | Ga0495662_0000305 | 3300046476 | Bacteria | 21349 |
| 492 | Ga0495662_0002045 | 3300046476 | Bacteria | 10107 |
| 493 | Ga0495664_0000787 | 3300046477 | Bacteria | 16209 |
| 494 | Ga0495664_0062036 | 3300046477 | Bacteria | 2226 |
| 495 | Ga0495594_0208080 | 3300046499 | Bacteria | 1115 |
| 496 | Ga0495583_0073461 | 3300046506 | Bacteria | 1499 |
| 497 | Ga0495608_0004232 | 3300046511 | Bacteria | 10289 |
| 498 | Ga0495608_0231526 | 3300046511 | Bacteria | 1156 |
| 499 | Ga0495618_0053782 | 3300046514 | Bacteria | 2546 |
| 500 | Ga0495628_0008624 | 3300046516 | Bacteria | 8734 |
| 501 | Ga0495628_0044866 | 3300046516 | Bacteria | 3515 |
| 502 | Ga0495630_0027130 | 3300046517 | Bacteria | 4245 |
| 503 | Ga0495666_0009586 | 3300046526 | Bacteria | 4840 |
| 504 | Ga0495652_0000478 | 3300046529 | Bacteria | 46945 |
| 505 | Ga0495652_0047462 | 3300046529 | Bacteria | 3682 |
| 506 | Ga0495652_0064012 | 3300046529 | Bacteria | 3095 |
| 507 | Ga0495665_0027028 | 3300046531 | Bacteria | 3081 |
| 508 | Ga0495665_0032757 | 3300046531 | Bacteria | 2780 |
| 509 | Ga0495640_0007509 | 3300046533 | Bacteria | 8567 |
| 510 | Ga0495640_0016128 | 3300046533 | Bacteria | 5594 |
| 511 | Ga0495640_0083092 | 3300046533 | Bacteria | 2126 |
| 512 | Ga0495586_0001649 | 3300046535 | Bacteria | 12250 |
| 513 | Ga0495586_0004174 | 3300046535 | Bacteria | 7739 |
| 514 | Ga0495587_0003178 | 3300046536 | Bacteria | 10984 |
| 515 | Ga0495645_0038329 | 3300046543 | Bacteria | 3496 |
| 516 | Ga0495645_0175166 | 3300046543 | Bacteria | 1474 |
| 517 | Ga0495656_0002914 | 3300046615 | Bacteria | 5732 |
| 518 | Ga0495656_0010283 | 3300046615 | Bacteria | 3396 |
| 519 | Ga0495668_0017386 | 3300046616 | Bacteria | 4171 |
| 520 | Ga0495634_0014249 | 3300046642 | Bacteria | 5736 |
| 521 | Ga0495634_0054241 | 3300046642 | Bacteria | 2684 |
| 522 | Ga0495634_0092780 | 3300046642 | Bacteria | 1958 |
| 523 | Ga0495625_0072160 | 3300046660 | Bacteria | 2421 |
| 524 | Ga0495635_0005045 | 3300046663 | Bacteria | 9181 |
| 525 | Ga0495635_0037566 | 3300046663 | Bacteria | 3352 |
| 526 | Ga0495635_0039076 | 3300046663 | Bacteria | 3285 |
| 527 | Ga0495659_0014425 | 3300046664 | Bacteria | 2586 |
| 528 | Ga0495588_0002246 | 3300046674 | Bacteria | 8268 |
| 529 | Ga0495588_0014737 | 3300046674 | Bacteria | 3748 |
| 530 | Ga0495657_0029330 | 3300046675 | Bacteria | 3859 |
| 531 | Ga0495599_0023853 | 3300046678 | Bacteria | 3824 |
| 532 | Ga0495623_0014038 | 3300046679 | Bacteria | 5190 |
| 533 | Ga0495623_0076761 | 3300046679 | Bacteria | 2073 |
| 534 | Ga0495646_0006479 | 3300046680 | Bacteria | 7428 |
| 535 | Ga0495646_0015364 | 3300046680 | Bacteria | 4859 |
| 536 | Ga0495646_0029621 | 3300046680 | Bacteria | 3421 |
| 537 | Ga0495658_0052702 | 3300046683 | Bacteria | 2309 |
| 538 | Ga0495658_0137347 | 3300046683 | Bacteria | 1493 |
| 539 | Ga0495613_0011479 | 3300046689 | Bacteria | 6588 |
| 540 | Ga0495613_0012535 | 3300046689 | Bacteria | 6300 |
| 541 | Ga0495613_0016742 | 3300046689 | Bacteria | 5459 |
| 542 | Ga0495624_0157423 | 3300046690 | Bacteria | 1388 |
| 543 | Ga0495670_0003869 | 3300046691 | Bacteria | 7354 |
| 544 | Ga0495670_0115866 | 3300046691 | Bacteria | 1389 |
| 545 | Ga0495670_0257325 | 3300046691 | Bacteria | 931 |
| 546 | Ga0495671_0073198 | 3300046692 | Bacteria | 1682 |
| 547 | Ga0495589_0026127 | 3300046794 | Bacteria | 2960 |
| 548 | Ga0495600_0015054 | 3300046809 | Bacteria | 4884 |
| 549 | Ga0495600_0034379 | 3300046809 | Bacteria | 3290 |
| 550 | Ga0495581_0001698 | 3300047315 | Bacteria | 12258 |
| 551 | Ga0495581_0055951 | 3300047315 | Bacteria | 2277 |
| 552 | Ga0495581_0073781 | 3300047315 | Bacteria | 1974 |
| 553 | Ga0495604_0000491 | 3300047317 | Bacteria | 34687 |
| 554 | Ga0495604_0000811 | 3300047317 | Bacteria | 26210 |
| 555 | Ga0495604_0187915 | 3300047317 | Bacteria | 1441 |
| 556 | Ga0495674_0013289 | 3300047319 | Bacteria | 7742 |
| 557 | Ga0495674_0069188 | 3300047319 | Bacteria | 3053 |
| 558 | Ga0495674_0104386 | 3300047319 | Bacteria | 2409 |
| 559 | Ga0495676_0052067 | 3300047321 | Bacteria | 3271 |
| 560 | Ga0495676_0106092 | 3300047321 | Bacteria | 2070 |
| 561 | Ga0495676_0165950 | 3300047321 | Bacteria | 1558 |
| 562 | Ga0495680_0029374 | 3300047322 | Bacteria | 4502 |
| 563 | Ga0495687_001428 | 3300047443 | Bacteria | 21988 |
| 564 | Ga0495687_011432 | 3300047443 | Bacteria | 4775 |
| 565 | Ga0495687_013341 | 3300047443 | Bacteria | 4299 |
| 566 | Ga0495687_013809 | 3300047443 | Bacteria | 4191 |
| 567 | Ga0495675_0081073 | 3300047444 | Bacteria | 2043 |
| 568 | Ga0495685_002934 | 3300047447 | Bacteria | 5394 |
| 569 | Ga0495685_013905 | 3300047447 | Bacteria | 2731 |
| 570 | Ga0495685_031108 | 3300047447 | Bacteria | 1835 |
| 571 | Ga0495681_0014664 | 3300047470 | Bacteria | 4479 |
| 572 | Ga0495684_0029444 | 3300047471 | Bacteria | 4214 |
| 573 | Ga0495684_0202687 | 3300047471 | Bacteria | 1462 |
| 574 | Ga0495593_0003017 | 3300047673 | Bacteria | 10141 |
| 575 | Ga0495614_0005221 | 3300048089 | Bacteria | 5859 |
| 576 | Ga0495614_0032534 | 3300048089 | Bacteria | 2245 |
| 577 | Ga0496100_0017676 | 3300048903 | Bacteria | 4216 |
| 578 | Ga0496100_0019713 | 3300048903 | Bacteria | 4029 |
| 579 | Ga0496100_0174559 | 3300048903 | Bacteria | 1550 |
| 580 | Ga0496101_0006250 | 3300048904 | Bacteria | 7662 |
| 581 | Ga0496101_0037432 | 3300048904 | Bacteria | 3441 |
| 582 | Ga0496102_0017330 | 3300048905 | Bacteria | 6308 |
| 583 | Ga0496102_0042309 | 3300048905 | Bacteria | 4128 |
| 584 | Ga0496102_0081798 | 3300048905 | Bacteria | 2978 |
| 585 | Ga0496102_0131030 | 3300048905 | Bacteria | 2347 |
| 586 | Ga0496102_0138120 | 3300048905 | Bacteria | 2284 |
| 587 | Ga0496103_0004152 | 3300048906 | Bacteria | 8795 |
| 588 | Ga0496103_0014625 | 3300048906 | Bacteria | 4663 |
| 589 | Ga0496103_0138594 | 3300048906 | Bacteria | 1555 |
| 590 | Ga0496103_0202118 | 3300048906 | Bacteria | 1278 |
| 591 | Ga0496103_0244184 | 3300048906 | Bacteria | 1155 |
| 592 | Ga0496104_0034413 | 3300048907 | Bacteria | 4724 |
| 593 | Ga0496104_0054109 | 3300048907 | Bacteria | 3793 |
| 594 | Ga0496104_0114339 | 3300048907 | Bacteria | 2588 |
| 595 | Ga0496104_0152172 | 3300048907 | Bacteria | 2220 |
| 596 | Ga0496104_0162145 | 3300048907 | Bacteria | 2144 |
| 597 | Ga0496104_0498523 | 3300048907 | Bacteria | 1129 |
| 598 | Ga0496105_0030685 | 3300048908 | Bacteria | 4404 |
| 599 | Ga0496105_0036895 | 3300048908 | Bacteria | 4027 |
| 600 | Ga0496105_0087609 | 3300048908 | Bacteria | 2572 |
| 601 | Ga0496105_0176717 | 3300048908 | Bacteria | 1749 |
| 602 | Ga0496105_0337965 | 3300048908 | Bacteria | 1204 |
| 603 | Ga0496106_0010795 | 3300048909 | Bacteria | 6752 |
| 604 | Ga0496106_0018727 | 3300048909 | Bacteria | 5128 |
| 605 | Ga0496106_0177977 | 3300048909 | Bacteria | 1688 |
| 606 | Ga0496106_0192120 | 3300048909 | Bacteria | 1624 |
| 607 | Ga0496106_0254309 | 3300048909 | Bacteria | 1405 |
| 608 | Ga0496107_0030794 | 3300048910 | Bacteria | 3826 |
| 609 | Ga0496108_0000589 | 3300048911 | Bacteria | 28452 |
| 610 | Ga0496108_0010745 | 3300048911 | Bacteria | 7433 |
| 611 | Ga0496108_0144228 | 3300048911 | Bacteria | 2052 |
| 612 | Ga0496108_0184540 | 3300048911 | Bacteria | 1807 |
| 613 | Ga0496108_0232607 | 3300048911 | Bacteria | 1603 |
| 614 | Ga0496108_0354496 | 3300048911 | Bacteria | 1280 |
| 615 | Ga0496108_0415896 | 3300048911 | Bacteria | 1174 |
| 616 | Ga0496108_0440146 | 3300048911 | Bacteria | 1139 |
| 617 | Ga0496109_0008180 | 3300048912 | Bacteria | 8873 |
| 618 | Ga0496109_0019238 | 3300048912 | Bacteria | 6016 |
| 619 | Ga0496109_0084490 | 3300048912 | Bacteria | 2929 |
| 620 | Ga0496109_0096411 | 3300048912 | Bacteria | 2740 |
| 621 | Ga0496109_0146228 | 3300048912 | Bacteria | 2211 |
| 622 | Ga0496109_0180149 | 3300048912 | Bacteria | 1984 |
| 623 | Ga0496109_0313909 | 3300048912 | Bacteria | 1479 |
| 624 | Ga0496109_0353657 | 3300048912 | Bacteria | 1388 |
| 625 | Ga0496110_0008537 | 3300048913 | Bacteria | 8248 |
| 626 | Ga0496110_0050548 | 3300048913 | Bacteria | 3650 |
| 627 | Ga0496110_0189898 | 3300048913 | Bacteria | 1866 |
| 628 | Ga0496110_0211866 | 3300048913 | Bacteria | 1762 |
| 629 | Ga0496110_0690939 | 3300048913 | Bacteria | 921 |
| 630 | Ga0496111_0041567 | 3300048914 | Bacteria | 3299 |
| 631 | Ga0496111_0062441 | 3300048914 | Bacteria | 2701 |
| 632 | Ga0496111_0121854 | 3300048914 | Bacteria | 1926 |
| 633 | Ga0496111_0180410 | 3300048914 | Bacteria | 1569 |
| 634 | Ga0496112_0060387 | 3300048915 | Bacteria | 3736 |
| 635 | Ga0496112_0066132 | 3300048915 | Bacteria | 3567 |
| 636 | Ga0496112_0066474 | 3300048915 | Bacteria | 3557 |
| 637 | Ga0496112_0234308 | 3300048915 | Bacteria | 1790 |
| 638 | Ga0496113_0014186 | 3300048916 | Bacteria | 5427 |
| 639 | Ga0496113_0028343 | 3300048916 | Bacteria | 4027 |
| 640 | Ga0496113_0102913 | 3300048916 | Bacteria | 2215 |
| 641 | Ga0496114_0006529 | 3300048917 | Bacteria | 9191 |
| 642 | Ga0496114_0024038 | 3300048917 | Bacteria | 4972 |
| 643 | Ga0496114_0035253 | 3300048917 | Bacteria | 4131 |
| 644 | Ga0496114_0064913 | 3300048917 | Bacteria | 3058 |
| 645 | Ga0496114_0065976 | 3300048917 | Bacteria | 3033 |
| 646 | Ga0496114_0294108 | 3300048917 | Bacteria | 1433 |
| 647 | Ga0496115_0013550 | 3300048918 | Bacteria | 6169 |
| 648 | Ga0496115_0163649 | 3300048918 | Bacteria | 1839 |
| 649 | Ga0496115_0196843 | 3300048918 | Bacteria | 1665 |
| 650 | Ga0496124_0161139 | 3300048927 | Bacteria | 1748 |
| 651 | Ga0501031_0006068 | 3300049568 | Bacteria | 7889 |
| 652 | Ga0501031_0012103 | 3300049568 | Bacteria | 5624 |
| 653 | Ga0501031_0177555 | 3300049568 | Bacteria | 1391 |
| 654 | Ga0501032_0009390 | 3300049569 | Bacteria | 7085 |
| 655 | Ga0501032_0016570 | 3300049569 | Bacteria | 5182 |
| 656 | Ga0501033_0039189 | 3300049570 | Bacteria | 3540 |
| 657 | Ga0501033_0045356 | 3300049570 | Bacteria | 3271 |
| 658 | Ga0501033_0095834 | 3300049570 | Bacteria | 2168 |
| 659 | Ga0501033_0218449 | 3300049570 | Bacteria | 1357 |
| 660 | Ga0501034_0000112 | 3300049571 | Bacteria | 150146 |
| 661 | Ga0501034_0006804 | 3300049571 | Bacteria | 12228 |
| 662 | Ga0501034_0031681 | 3300049571 | Bacteria | 5371 |
| 663 | Ga0501034_0035780 | 3300049571 | Bacteria | 5033 |
| 664 | Ga0501036_0009835 | 3300049572 | Bacteria | 7874 |
| 665 | Ga0501036_0016707 | 3300049572 | Bacteria | 6129 |
| 666 | Ga0501036_0017920 | 3300049572 | Bacteria | 5928 |
| 667 | Ga0501036_0035037 | 3300049572 | Bacteria | 4246 |
| 668 | Ga0501036_0222747 | 3300049572 | Bacteria | 1584 |
| 669 | Ga0501037_0004673 | 3300049573 | Bacteria | 9946 |
| 670 | Ga0501037_0056311 | 3300049573 | Bacteria | 2872 |
| 671 | Ga0501037_0132606 | 3300049573 | Bacteria | 1786 |
| 672 | Ga0501037_0140121 | 3300049573 | Bacteria | 1731 |
| 673 | Ga0501038_0000531 | 3300049574 | Bacteria | 33483 |
| 674 | Ga0501038_0041961 | 3300049574 | Bacteria | 3987 |
| 675 | Ga0501038_0054915 | 3300049574 | Bacteria | 3424 |
| 676 | Ga0501038_0059346 | 3300049574 | Bacteria | 3277 |
| 677 | Ga0501039_0002511 | 3300049575 | Bacteria | 13672 |
| 678 | Ga0501040_0007779 | 3300049576 | Bacteria | 6939 |
| 679 | Ga0501041_0010646 | 3300049577 | Bacteria | 5423 |
| 680 | Ga0501042_0004136 | 3300049578 | Bacteria | 9225 |
| 681 | Ga0501042_0195056 | 3300049578 | Bacteria | 1460 |
| 682 | Ga0501043_0002652 | 3300049579 | Bacteria | 15046 |
| 683 | Ga0501043_0016086 | 3300049579 | Bacteria | 5867 |
| 684 | Ga0501043_0082019 | 3300049579 | Bacteria | 2534 |
| 685 | Ga0501046_0025985 | 3300049580 | Bacteria | 4785 |
| 686 | Ga0501046_0043617 | 3300049580 | Bacteria | 3570 |
| 687 | Ga0501047_0083898 | 3300049581 | Bacteria | 3062 |
| 688 | Ga0501047_0102281 | 3300049581 | Bacteria | 2744 |
| 689 | Ga0501048_0000718 | 3300049582 | Bacteria | 24244 |
| 690 | Ga0501048_0021390 | 3300049582 | Bacteria | 4736 |
| 691 | Ga0501068_0038171 | 3300049584 | Bacteria | 2877 |
| 692 | Ga0501070_0001683 | 3300049586 | Bacteria | 19591 |
| 693 | Ga0501071_0000581 | 3300049587 | Bacteria | 18895 |
| 694 | Ga0501073_0237498 | 3300049589 | Bacteria | 1259 |
| 695 | Ga0501074_0011845 | 3300049590 | Bacteria | 6341 |
| 696 | Ga0501074_0027069 | 3300049590 | Bacteria | 4155 |
| 697 | Ga0501075_0018654 | 3300049591 | Bacteria | 5023 |
| 698 | Ga0501077_0061039 | 3300049593 | Bacteria | 2392 |
| 699 | Ga0501202_018009 | 3300049652 | Bacteria | 1384 |
| 700 | Ga0501079_0011500 | 3300049741 | Bacteria | 6755 |
| 701 | Ga0501080_0122212 | 3300049742 | Bacteria | 2412 |
| 702 | Ga0501035_0019778 | 3300049822 | Bacteria | 6186 |
| 703 | Ga0501035_0027151 | 3300049822 | Bacteria | 5234 |
| 704 | Ga0501035_0029689 | 3300049822 | Bacteria | 4986 |
| 705 | Ga0501044_0026941 | 3300049823 | Bacteria | 6081 |
| 706 | Ga0501044_0079634 | 3300049823 | Bacteria | 3319 |
| 707 | Ga0501044_0128852 | 3300049823 | Bacteria | 2525 |
| 708 | Ga0501045_0001415 | 3300049824 | Bacteria | 16012 |
| 709 | Ga0501045_0110852 | 3300049824 | Bacteria | 2035 |
| 710 | nmdc:mga03n38_23039_c1 | 3300050490 | Bacteria | 2529 |
| 711 | nmdc:mga03n38_7358_c1 | 3300050490 | Bacteria | 3892 |
| 712 | nmdc:mga00v17_29651_c1 | 3300050491 | Bacteria | 3212 |
| 713 | nmdc:mga0yw44_189835_c1 | 3300050492 | Bacteria | 1355 |
| 714 | nmdc:mga06z11_3783_c1 | 3300050494 | Bacteria | 5889 |
| 715 | nmdc:mga05p37_13318_c1 | 3300050507 | Bacteria | 9850 |
| 716 | nmdc:mga05p37_42469_c1 | 3300050507 | Bacteria | 5587 |
| 717 | nmdc:mga05p37_4636_c1 | 3300050507 | Bacteria | 16078 |
| 718 | nmdc:mga05p37_73219_c1 | 3300050507 | Bacteria | 4216 |
| 719 | nmdc:mga09592_80800_c1 | 3300050508 | Bacteria | 2769 |
| 720 | nmdc:mga0qj67_18337_c1 | 3300050509 | Bacteria | 5334 |
| 721 | nmdc:mga0qj67_46691_c1 | 3300050509 | Bacteria | 3420 |
| 722 | nmdc:mga0qj67_62106_c1 | 3300050509 | Bacteria | 2969 |
| 723 | nmdc:mga06r32_177344_c1 | 3300050510 | Bacteria | 2116 |
| 724 | nmdc:mga06r32_87637_c1 | 3300050510 | Bacteria | 3038 |
| 725 | nmdc:mga08y16_40577_c1 | 3300050511 | Bacteria | 4877 |
| 726 | nmdc:mga08y16_533362_c1 | 3300050511 | Bacteria | 1189 |
| 727 | nmdc:mga08y16_593918_c1 | 3300050511 | Bacteria | 1116 |
| 728 | nmdc:mga0n895_65935_c1 | 3300050512 | Bacteria | 3585 |
| 729 | nmdc:mga08x19_187122_c1 | 3300050514 | Bacteria | 1415 |
| 730 | nmdc:mga0a205_17567_c1 | 3300050515 | Bacteria | 6711 |
| 731 | nmdc:mga0sz30_31789_c1 | 3300050516 | Bacteria | 1826 |
| 732 | Ga0495601_0016594 | 3300053077 | Bacteria | 4464 |
| 733 | Ga0495601_0063693 | 3300053077 | Bacteria | 2343 |
| 734 | Ga0495612_0008777 | 3300053078 | Bacteria | 4097 |
| 735 | Ga0495612_0015629 | 3300053078 | Bacteria | 3043 |
| 736 | Ga0495619_0010276 | 3300053085 | Bacteria | 5893 |
| 737 | Ga0495619_0031981 | 3300053085 | Bacteria | 3412 |
| 738 | Ga0495619_0059496 | 3300053085 | Bacteria | 2538 |
| 739 | Ga0495619_0135766 | 3300053085 | Bacteria | 1692 |
| 740 | Ga0495619_0152323 | 3300053085 | Bacteria | 1595 |
| 741 | Ga0500578_0073202 | 3300053086 | Bacteria | 2182 |
| 742 | Ga0500644_0041293 | 3300053088 | Bacteria | 1531 |
| 743 | Ga0500583_0035487 | 3300053092 | Bacteria | 2226 |
| 744 | Ga0500583_0106408 | 3300053092 | Bacteria | 1378 |
| 745 | Ga0500640_034651 | 3300053095 | Bacteria | 2217 |
| 746 | Ga0500560_004346 | 3300053107 | Bacteria | 3005 |
| 747 | Ga0500560_015854 | 3300053107 | Bacteria | 2044 |
| 748 | Ga0500652_013987 | 3300053131 | Bacteria | 2858 |
| 749 | Ga0500658_0017085 | 3300053134 | Bacteria | 2707 |
| 750 | Ga0500561_0000666 | 3300053137 | Bacteria | 5441 |
| 751 | Ga0500573_0011060 | 3300053140 | Bacteria | 5047 |
| 752 | Ga0500616_0000495 | 3300053153 | Bacteria | 50619 |
| 753 | Ga0500616_0032244 | 3300053153 | Bacteria | 2864 |
| 754 | Ga0500624_008844 | 3300053157 | Bacteria | 1419 |
| 755 | Ga0500587_005064 | 3300053739 | Bacteria | 1787 |
| 756 | Ga0501084_0018638 | 3300054114 | Bacteria | 5778 |
| 757 | Ga0590075_010080 | 3300059424 | Bacteria | 2272 |
| 758 | Ga0501082_0007900 | 3300060353 | Bacteria | 9186 |
| 759 | Ga0466962_0006897 | 3300061719 | Bacteria | 5445 |
| 760 | Ga0466962_0010113 | 3300061719 | Bacteria | 4528 |
| 761 | Ga0466962_0021927 | 3300061719 | Bacteria | 3067 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0690939 | Ga0496110_0690939_14_835 | 263 |
| 2 | 3300049578 | Ga0501042_0195056 | Ga0501042_0195056_10_876 | 265 |
| 3 | 3300013104 | Ga0157370_10140937 | Ga0157370_101409373 | 267 |
| 4 | 3300048911 | Ga0496108_0144228 | Ga0496108_0144228_1197_2036 | 268 |
| 5 | 3300000549 | LJQas_1000385 | LJQas_10003855 | 269 |
| 6 | 3300046499 | Ga0495594_0208080 | Ga0495594_0208080_70_954 | 285 |
| 7 | 3300046691 | Ga0495670_0257325 | Ga0495670_0257325_19_903 | 285 |
| 8 | 3300025303 | Ga0209051_1011931 | Ga0209051_10119314 | 295 |
| 9 | 3300031456 | Ga0307513_10086968 | Ga0307513_100869683 | 300 |
| 10 | 3300005985 | Ga0081539_10005602 | Ga0081539_100056024 | 302 |
| 11 | 3300005353 | Ga0070669_100026548 | Ga0070669_1000265484 | 309 |
| 12 | 3300005456 | Ga0070678_100030815 | Ga0070678_1000308154 | 309 |
| 13 | 3300009036 | Ga0105244_10035787 | Ga0105244_100357872 | 309 |
| 14 | 3300009094 | Ga0111539_10425385 | Ga0111539_104253851 | 309 |
| 15 | 3300009101 | Ga0105247_10094430 | Ga0105247_100944302 | 309 |
| 16 | 3300013105 | Ga0157369_10063572 | Ga0157369_100635725 | 309 |
| 17 | 3300025903 | Ga0207680_10212010 | Ga0207680_102120101 | 309 |
| 18 | 3300025907 | Ga0207645_10003084 | Ga0207645_1000308411 | 309 |
| 19 | 3300025940 | Ga0207691_10000469 | Ga0207691_100004697 | 309 |
| 20 | 3300025960 | Ga0207651_10035277 | Ga0207651_100352772 | 309 |
| 21 | 3300046664 | Ga0495659_0014425 | Ga0495659_0014425_1584_2570 | 309 |
| 22 | 3300048912 | Ga0496109_0084490 | Ga0496109_0084490_306_1292 | 309 |
| 23 | 3300048914 | Ga0496111_0062441 | Ga0496111_0062441_404_1390 | 309 |
| 24 | 3300048927 | Ga0496124_0161139 | Ga0496124_0161139_94_1080 | 309 |
| 25 | 3300050511 | nmdc:mga08y16_593918_c1 | nmdc:mga08y16_593918_c1_127_1098 | 309 |
| 26 | iso_pu_bacteria | 2891395885 | 2891397905 | 309 |
| 27 | 3300049741 | Ga0501079_0011500 | Ga0501079_0011500_1978_2982 | 310 |
| 28 | 3300013102 | Ga0157371_10054782 | Ga0157371_100547822 | 311 |
| 29 | 3300013104 | Ga0157370_10014391 | Ga0157370_100143918 | 311 |
| 30 | 3300046689 | Ga0495613_0011479 | Ga0495613_0011479_2641_3645 | 311 |
| 31 | 3300049568 | Ga0501031_0012103 | Ga0501031_0012103_1358_2362 | 311 |
| 32 | 3300049570 | Ga0501033_0039189 | Ga0501033_0039189_1914_2918 | 311 |
| 33 | 3300049572 | Ga0501036_0035037 | Ga0501036_0035037_513_1517 | 311 |
| 34 | 3300049574 | Ga0501038_0059346 | Ga0501038_0059346_683_1687 | 311 |
| 35 | 3300049575 | Ga0501039_0002511 | Ga0501039_0002511_3599_4603 | 311 |
| 36 | 3300049576 | Ga0501040_0007779 | Ga0501040_0007779_3846_4850 | 311 |
| 37 | 3300049577 | Ga0501041_0010646 | Ga0501041_0010646_3096_4100 | 311 |
| 38 | 3300049582 | Ga0501048_0000718 | Ga0501048_0000718_2889_3893 | 311 |
| 39 | 3300049584 | Ga0501068_0038171 | Ga0501068_0038171_1574_2578 | 311 |
| 40 | 3300049587 | Ga0501071_0000581 | Ga0501071_0000581_17810_18814 | 311 |
| 41 | 3300049590 | Ga0501074_0027069 | Ga0501074_0027069_2812_3816 | 311 |
| 42 | 3300049591 | Ga0501075_0018654 | Ga0501075_0018654_3298_4302 | 311 |
| 43 | 3300049593 | Ga0501077_0061039 | Ga0501077_0061039_1340_2344 | 311 |
| 44 | 3300049822 | Ga0501035_0019778 | Ga0501035_0019778_3663_4667 | 311 |
| 45 | 3300049824 | Ga0501045_0001415 | Ga0501045_0001415_13082_14086 | 311 |
| 46 | 3300054114 | Ga0501084_0018638 | Ga0501084_0018638_3786_4790 | 311 |
| 47 | 3300060353 | Ga0501082_0007900 | Ga0501082_0007900_6843_7847 | 311 |
| 48 | 3300044765 | Ga0466970_0015696 | Ga0466970_0015696_131_1135 | 312 |
| 49 | 3300049570 | Ga0501033_0095834 | Ga0501033_0095834_987_1991 | 312 |
| 50 | 3300049823 | Ga0501044_0079634 | Ga0501044_0079634_429_1415 | 312 |
| 51 | 3300053077 | Ga0495601_0063693 | Ga0495601_0063693_10_972 | 312 |
| 52 | 3300061719 | Ga0466962_0021927 | Ga0466962_0021927_459_1463 | 312 |
| 53 | 3300005456 | Ga0070678_100280559 | Ga0070678_1002805592 | 313 |
| 54 | 3300013297 | Ga0157378_10228658 | Ga0157378_102286582 | 313 |
| 55 | 3300025898 | Ga0207692_10146736 | Ga0207692_101467362 | 313 |
| 56 | 3300025906 | Ga0207699_10069689 | Ga0207699_100696893 | 313 |
| 57 | 3300025928 | Ga0207700_10095231 | Ga0207700_100952312 | 313 |
| 58 | 3300035112 | Ga0373932_0005473 | Ga0373932_0005473_1902_2903 | 313 |
| 59 | 3300048909 | Ga0496106_0177977 | Ga0496106_0177977_625_1629 | 313 |
| 60 | 3300048917 | Ga0496114_0064913 | Ga0496114_0064913_1088_2089 | 313 |
| 61 | 3300049823 | Ga0501044_0128852 | Ga0501044_0128852_703_1707 | 313 |
| 62 | iso_pu_bacteria | 2675903059 | 2676485659 | 313 |
| 63 | 3300005435 | Ga0070714_100353973 | Ga0070714_1003539732 | 314 |
| 64 | 3300005614 | Ga0068856_100021793 | Ga0068856_1000217931 | 314 |
| 65 | 3300005615 | Ga0070702_100184407 | Ga0070702_1001844071 | 314 |
| 66 | 3300006028 | Ga0070717_10111601 | Ga0070717_101116012 | 314 |
| 67 | 3300025898 | Ga0207692_10016241 | Ga0207692_100162413 | 314 |
| 68 | 3300025916 | Ga0207663_10267341 | Ga0207663_102673412 | 314 |
| 69 | 3300026078 | Ga0207702_10020919 | Ga0207702_100209193 | 314 |
| 70 | 3300035088 | Ga0373940_0005970 | Ga0373940_0005970_1047_2048 | 314 |
| 71 | 3300035090 | Ga0373949_0037053 | Ga0373949_0037053_163_1164 | 314 |
| 72 | 3300035115 | Ga0373941_0002472 | Ga0373941_0002472_2745_3746 | 314 |
| 73 | 3300048903 | Ga0496100_0174559 | Ga0496100_0174559_175_1176 | 314 |
| 74 | 3300048913 | Ga0496110_0189898 | Ga0496110_0189898_135_1136 | 314 |
| 75 | 3300048918 | Ga0496115_0163649 | Ga0496115_0163649_87_1088 | 314 |
| 76 | iso_pu_bacteria | 2873314349 | 2873316795 | 314 |
| 77 | iso_pu_bacteria | 8055066027 | 8055074352 | 314 |
| 78 | iso_pu_bacteria | 8055172936 | 8055174687 | 314 |
| 79 | 3300031838 | Ga0307518_10144341 | Ga0307518_101443412 | 315 |
| 80 | 3300049570 | Ga0501033_0218449 | Ga0501033_0218449_113_1117 | 315 |
| 81 | 3300049571 | Ga0501034_0031681 | Ga0501034_0031681_1783_2787 | 315 |
| 82 | 3300049574 | Ga0501038_0041961 | Ga0501038_0041961_1212_2216 | 315 |
| 83 | 3300053092 | Ga0500583_0035487 | Ga0500583_0035487_1083_2057 | 315 |
| 84 | 3300037312 | Ga0395899_0029025 | Ga0395899_0029025_49_1086 | 316 |
| 85 | 3300037418 | Ga0395900_0031797 | Ga0395900_0031797_2472_3527 | 316 |
| 86 | 3300037418 | Ga0395900_0154470 | Ga0395900_0154470_517_1554 | 316 |
| 87 | 3300037466 | Ga0395898_0048221 | Ga0395898_0048221_903_1940 | 316 |
| 88 | 3300037471 | Ga0395905_0013363 | Ga0395905_0013363_1362_2417 | 316 |
| 89 | 3300037471 | Ga0395905_0351820 | Ga0395905_0351820_76_1113 | 316 |
| 90 | 3300038443 | Ga0395901_0521874 | Ga0395901_0521874_35_1072 | 316 |
| 91 | 3300046794 | Ga0495589_0026127 | Ga0495589_0026127_1922_2926 | 316 |
| 92 | 3300047447 | Ga0495685_031108 | Ga0495685_031108_484_1488 | 316 |
| 93 | 3300006914 | Ga0075436_100240410 | Ga0075436_1002404102 | 318 |
| 94 | 3300007076 | Ga0075435_100017358 | Ga0075435_1000173584 | 318 |
| 95 | 3300026035 | Ga0207703_10067941 | Ga0207703_100679412 | 318 |
| 96 | 3300028794 | Ga0307515_10000149 | Ga0307515_1000014926 | 318 |
| 97 | 3300035092 | Ga0373952_0025795 | Ga0373952_0025795_162_1163 | 318 |
| 98 | 3300038443 | Ga0395901_0178063 | Ga0395901_0178063_179_1216 | 318 |
| 99 | 3300050514 | nmdc:mga08x19_187122_c1 | nmdc:mga08x19_187122_c1_287_1288 | 318 |
| 100 | iso_pu_bacteria | 2537561592 | 2537900371 | 318 |
| 101 | iso_pu_bacteria | 2887443736 | 2887443961 | 318 |
| 102 | iso_pu_bacteria | 8004021418 | 8004024289 | 318 |
| 103 | iso_pu_bacteria | 8004025490 | 8004025736 | 318 |
| 104 | iso_pu_bacteria | 2643221711 | 2644610006 | 319 |
| 105 | iso_pu_bacteria | 2811994882 | 2812374458 | 319 |
| 106 | iso_pu_bacteria | 2816332119 | 2816423966 | 319 |
| 107 | iso_pu_bacteria | 2818991318 | 2819425457 | 319 |
| 108 | iso_pu_bacteria | 2818991458 | 2819667833 | 319 |
| 109 | iso_pu_bacteria | 2818991469 | 2819730433 | 319 |
| 110 | iso_pu_bacteria | 2904776348 | 2904778229 | 319 |
| 111 | iso_pu_bacteria | 2919034639 | 2919035602 | 319 |
| 112 | iso_pu_bacteria | 2919059106 | 2919060260 | 319 |
| 113 | iso_pu_bacteria | 2939647034 | 2939650226 | 319 |
| 114 | 3300005616 | Ga0068852_100181218 | Ga0068852_1001812182 | 320 |
| 115 | 3300010375 | Ga0105239_10272667 | Ga0105239_102726672 | 320 |
| 116 | 3300026116 | Ga0207674_10117417 | Ga0207674_101174173 | 320 |
| 117 | 3300026142 | Ga0207698_10232836 | Ga0207698_102328362 | 320 |
| 118 | 3300028381 | Ga0268264_10292426 | Ga0268264_102924262 | 320 |
| 119 | 3300030522 | Ga0307512_10009639 | Ga0307512_1000963911 | 320 |
| 120 | 3300031548 | Ga0307408_100328078 | Ga0307408_1003280782 | 320 |
| 121 | 3300031616 | Ga0307508_10007365 | Ga0307508_100073652 | 320 |
| 122 | 3300031852 | Ga0307410_10110484 | Ga0307410_101104842 | 320 |
| 123 | 3300032004 | Ga0307414_10278033 | Ga0307414_102780332 | 320 |
| 124 | 3300041404 | Ga0439436_0001737 | Ga0439436_0001737_1995_3005 | 320 |
| 125 | 3300042014 | Ga0439457_000317 | Ga0439457_000317_1548_2558 | 320 |
| 126 | 3300042015 | Ga0439462_0027327 | Ga0439462_0027327_163_1173 | 320 |
| 127 | 3300042184 | Ga0450908_006312 | Ga0450908_006312_1032_2027 | 320 |
| 128 | 3300046463 | Ga0495653_0014112 | Ga0495653_0014112_2439_3428 | 320 |
| 129 | 3300046476 | Ga0495662_0002045 | Ga0495662_0002045_634_1623 | 320 |
| 130 | 3300046511 | Ga0495608_0004232 | Ga0495608_0004232_438_1427 | 320 |
| 131 | 3300046516 | Ga0495628_0008624 | Ga0495628_0008624_3524_4513 | 320 |
| 132 | 3300046517 | Ga0495630_0027130 | Ga0495630_0027130_2819_3808 | 320 |
| 133 | 3300046526 | Ga0495666_0009586 | Ga0495666_0009586_2556_3545 | 320 |
| 134 | 3300046529 | Ga0495652_0047462 | Ga0495652_0047462_265_1254 | 320 |
| 135 | 3300046531 | Ga0495665_0032757 | Ga0495665_0032757_849_1838 | 320 |
| 136 | 3300046533 | Ga0495640_0016128 | Ga0495640_0016128_2166_3155 | 320 |
| 137 | 3300046535 | Ga0495586_0004174 | Ga0495586_0004174_6737_7726 | 320 |
| 138 | 3300046642 | Ga0495634_0092780 | Ga0495634_0092780_747_1736 | 320 |
| 139 | 3300046663 | Ga0495635_0037566 | Ga0495635_0037566_2312_3301 | 320 |
| 140 | 3300046675 | Ga0495657_0029330 | Ga0495657_0029330_52_1041 | 320 |
| 141 | 3300046678 | Ga0495599_0023853 | Ga0495599_0023853_396_1385 | 320 |
| 142 | 3300046679 | Ga0495623_0014038 | Ga0495623_0014038_4150_5139 | 320 |
| 143 | 3300046680 | Ga0495646_0015364 | Ga0495646_0015364_265_1254 | 320 |
| 144 | 3300046689 | Ga0495613_0012535 | Ga0495613_0012535_180_1169 | 320 |
| 145 | 3300046809 | Ga0495600_0015054 | Ga0495600_0015054_619_1608 | 320 |
| 146 | 3300047317 | Ga0495604_0000491 | Ga0495604_0000491_20286_21275 | 320 |
| 147 | 3300047319 | Ga0495674_0013289 | Ga0495674_0013289_6628_7617 | 320 |
| 148 | 3300047444 | Ga0495675_0081073 | Ga0495675_0081073_875_1864 | 320 |
| 149 | 3300047471 | Ga0495684_0029444 | Ga0495684_0029444_180_1169 | 320 |
| 150 | 3300048912 | Ga0496109_0353657 | Ga0496109_0353657_218_1204 | 320 |
| 151 | 3300053077 | Ga0495601_0016594 | Ga0495601_0016594_2593_3582 | 320 |
| 152 | 3300053085 | Ga0495619_0010276 | Ga0495619_0010276_1276_2265 | 320 |
| 153 | iso_pu_bacteria | 2728369276 | 2729909076 | 320 |
| 154 | iso_pu_bacteria | 2997600082 | 2997601805 | 320 |
| 155 | 3300000546 | LJNas_1007449 | LJNas_10074492 | 321 |
| 156 | 3300009036 | Ga0105244_10027672 | Ga0105244_100276722 | 321 |
| 157 | 3300009148 | Ga0105243_10211219 | Ga0105243_102112192 | 321 |
| 158 | 3300025315 | Ga0207697_10013957 | Ga0207697_100139572 | 321 |
| 159 | 3300025935 | Ga0207709_10055200 | Ga0207709_100552002 | 321 |
| 160 | 3300032002 | Ga0307416_100111683 | Ga0307416_1001116833 | 321 |
| 161 | 3300037466 | Ga0395898_0334844 | Ga0395898_0334844_73_1098 | 321 |
| 162 | 3300046471 | Ga0495650_0030033 | Ga0495650_0030033_1314_2306 | 321 |
| 163 | 3300048915 | Ga0496112_0234308 | Ga0496112_0234308_486_1493 | 321 |
| 164 | 3300049569 | Ga0501032_0009390 | Ga0501032_0009390_584_1606 | 321 |
| 165 | 3300049571 | Ga0501034_0000112 | Ga0501034_0000112_76968_77990 | 321 |
| 166 | iso_pu_bacteria | 2547132111 | 2547412332 | 321 |
| 167 | iso_pu_bacteria | 2582581313 | 2585304192 | 321 |
| 168 | iso_pu_bacteria | 2582581314 | 2585319067 | 321 |
| 169 | iso_pu_bacteria | 2643221647 | 2644270411 | 321 |
| 170 | iso_pu_bacteria | 2643221678 | 2644440917 | 321 |
| 171 | iso_pu_bacteria | 2643221711 | 2644607662 | 321 |
| 172 | iso_pu_bacteria | 2643221714 | 2644631522 | 321 |
| 173 | iso_pu_bacteria | 2690315906 | 2691512817 | 321 |
| 174 | iso_pu_bacteria | 2784132148 | 2784591996 | 321 |
| 175 | iso_pu_bacteria | 2784746763 | 2785339939 | 321 |
| 176 | iso_pu_bacteria | 2784746768 | 2785373256 | 321 |
| 177 | iso_pu_bacteria | 2786546132 | 2786674727 | 321 |
| 178 | iso_pu_bacteria | 2791355406 | 2793978636 | 321 |
| 179 | iso_pu_bacteria | 2808606359 | 2808845360 | 321 |
| 180 | iso_pu_bacteria | 2808606375 | 2808915113 | 321 |
| 181 | iso_pu_bacteria | 2808606448 | 2809235632 | 321 |
| 182 | iso_pu_bacteria | 2811994879 | 2812354325 | 321 |
| 183 | iso_pu_bacteria | 2811994917 | 2812482857 | 321 |
| 184 | iso_pu_bacteria | 2816332139 | 2816509983 | 321 |
| 185 | iso_pu_bacteria | 2818991462 | 2819692358 | 321 |
| 186 | iso_pu_bacteria | 2852635781 | 2852635945 | 321 |
| 187 | iso_pu_bacteria | 2857740372 | 2857742528 | 321 |
| 188 | iso_pu_bacteria | 2862281513 | 2862282990 | 321 |
| 189 | iso_pu_bacteria | 2862382967 | 2862387537 | 321 |
| 190 | iso_pu_bacteria | 2862507626 | 2862507680 | 321 |
| 191 | iso_pu_bacteria | 2863404153 | 2863410062 | 321 |
| 192 | iso_pu_bacteria | 2867369537 | 2867370332 | 321 |
| 193 | iso_pu_bacteria | 2867428634 | 2867430004 | 321 |
| 194 | iso_pu_bacteria | 2870782633 | 2870785610 | 321 |
| 195 | iso_pu_bacteria | 2877676314 | 2877677655 | 321 |
| 196 | iso_pu_bacteria | 2904497146 | 2904498386 | 321 |
| 197 | iso_pu_bacteria | 2910809715 | 2910811541 | 321 |
| 198 | iso_pu_bacteria | 2912715099 | 2912715864 | 321 |
| 199 | iso_pu_bacteria | 2912723979 | 2912728913 | 321 |
| 200 | iso_pu_bacteria | 2919051321 | 2919054045 | 321 |
| 201 | iso_pu_bacteria | 2919391150 | 2919391232 | 321 |
| 202 | iso_pu_bacteria | 2919468124 | 2919475139 | 321 |
| 203 | iso_pu_bacteria | 2932426870 | 2932428191 | 321 |
| 204 | iso_pu_bacteria | 2933418574 | 2933421013 | 321 |
| 205 | iso_pu_bacteria | 2939598168 | 2939599416 | 321 |
| 206 | iso_pu_bacteria | 2939674588 | 2939675345 | 321 |
| 207 | iso_pu_bacteria | 2945941187 | 2945944426 | 321 |
| 208 | iso_pu_bacteria | 2946059875 | 2946060548 | 321 |
| 209 | iso_pu_bacteria | 2946064051 | 2946071376 | 321 |
| 210 | iso_pu_bacteria | 2946072368 | 2946079220 | 321 |
| 211 | iso_pu_bacteria | 2947224130 | 2947225360 | 321 |
| 212 | iso_pu_bacteria | 2954002825 | 2954009585 | 321 |
| 213 | iso_pu_bacteria | 2954380949 | 2954382415 | 321 |
| 214 | iso_pu_bacteria | 2954673503 | 2954680674 | 321 |
| 215 | iso_pu_bacteria | 2954682443 | 2954683479 | 321 |
| 216 | iso_pu_bacteria | 2954691527 | 2954693220 | 321 |
| 217 | iso_pu_bacteria | 2954701450 | 2954708317 | 321 |
| 218 | iso_pu_bacteria | 2954711539 | 2954712893 | 321 |
| 219 | iso_pu_bacteria | 2954721474 | 2954722851 | 321 |
| 220 | iso_pu_bacteria | 2954731030 | 2954738978 | 321 |
| 221 | iso_pu_bacteria | 2954740390 | 2954741762 | 321 |
| 222 | iso_pu_bacteria | 2954749733 | 2954757836 | 321 |
| 223 | iso_pu_bacteria | 2954759201 | 2954760741 | 321 |
| 224 | iso_pu_bacteria | 2990059506 | 2990065421 | 321 |
| 225 | iso_pu_bacteria | 3006393351 | 3006395561 | 321 |
| 226 | iso_pu_bacteria | 8008558824 | 8008564079 | 321 |
| 227 | iso_pu_bacteria | 8008574985 | 8008575823 | 321 |
| 228 | iso_pu_bacteria | 8023623736 | 8023624178 | 321 |
| 229 | iso_pu_bacteria | 8047893842 | 8047902947 | 321 |
| 230 | iso_pu_bacteria | 8048127548 | 8048135439 | 321 |
| 231 | iso_pu_bacteria | 8048369669 | 8048370743 | 321 |
| 232 | iso_pu_bacteria | 8048379754 | 8048388679 | 321 |
| 233 | iso_pu_bacteria | 8048406513 | 8048410904 | 321 |
| 234 | iso_pu_bacteria | 8056829672 | 8056836150 | 321 |
| 235 | 3300048908 | Ga0496105_0176717 | Ga0496105_0176717_279_1280 | 322 |
| 236 | 3300005327 | Ga0070658_10002817 | Ga0070658_1000281714 | 323 |
| 237 | 3300005366 | Ga0070659_100225772 | Ga0070659_1002257722 | 323 |
| 238 | 3300006846 | Ga0075430_100202626 | Ga0075430_1002026262 | 323 |
| 239 | 3300006847 | Ga0075431_100201619 | Ga0075431_1002016192 | 323 |
| 240 | 3300009147 | Ga0114129_10002238 | Ga0114129_1000223810 | 323 |
| 241 | 3300009551 | Ga0105238_10155910 | Ga0105238_101559103 | 323 |
| 242 | 3300014326 | Ga0157380_10087454 | Ga0157380_100874542 | 323 |
| 243 | 3300025909 | Ga0207705_10001278 | Ga0207705_100012788 | 323 |
| 244 | 3300025927 | Ga0207687_10118163 | Ga0207687_101181632 | 323 |
| 245 | 3300026078 | Ga0207702_10319612 | Ga0207702_103196122 | 323 |
| 246 | 3300031730 | Ga0307516_10020452 | Ga0307516_100204527 | 323 |
| 247 | 3300031995 | Ga0307409_100207043 | Ga0307409_1002070431 | 323 |
| 248 | 3300035091 | Ga0373951_0000019 | Ga0373951_0000019_51144_52139 | 323 |
| 249 | 3300037418 | Ga0395900_0011877 | Ga0395900_0011877_352_1356 | 323 |
| 250 | 3300037418 | Ga0395900_0202646 | Ga0395900_0202646_676_1680 | 323 |
| 251 | 3300037466 | Ga0395898_0036719 | Ga0395898_0036719_1511_2515 | 323 |
| 252 | 3300046461 | Ga0495641_0011219 | Ga0495641_0011219_3510_4514 | 323 |
| 253 | 3300046543 | Ga0495645_0175166 | Ga0495645_0175166_127_1158 | 323 |
| 254 | 3300046683 | Ga0495658_0137347 | Ga0495658_0137347_358_1362 | 323 |
| 255 | 3300047321 | Ga0495676_0052067 | Ga0495676_0052067_1796_2800 | 323 |
| 256 | 3300047322 | Ga0495680_0029374 | Ga0495680_0029374_2931_3935 | 323 |
| 257 | 3300048903 | Ga0496100_0017676 | Ga0496100_0017676_122_1126 | 323 |
| 258 | 3300048903 | Ga0496100_0019713 | Ga0496100_0019713_1806_2810 | 323 |
| 259 | 3300048904 | Ga0496101_0006250 | Ga0496101_0006250_2719_3723 | 323 |
| 260 | 3300048905 | Ga0496102_0017330 | Ga0496102_0017330_4105_5109 | 323 |
| 261 | 3300048905 | Ga0496102_0138120 | Ga0496102_0138120_686_1690 | 323 |
| 262 | 3300048906 | Ga0496103_0014625 | Ga0496103_0014625_2102_3106 | 323 |
| 263 | 3300048906 | Ga0496103_0138594 | Ga0496103_0138594_418_1449 | 323 |
| 264 | 3300048907 | Ga0496104_0054109 | Ga0496104_0054109_2269_3273 | 323 |
| 265 | 3300048907 | Ga0496104_0162145 | Ga0496104_0162145_642_1646 | 323 |
| 266 | 3300048907 | Ga0496104_0498523 | Ga0496104_0498523_49_1053 | 323 |
| 267 | 3300048908 | Ga0496105_0036895 | Ga0496105_0036895_947_1951 | 323 |
| 268 | 3300048908 | Ga0496105_0337965 | Ga0496105_0337965_147_1151 | 323 |
| 269 | 3300048911 | Ga0496108_0415896 | Ga0496108_0415896_38_1042 | 323 |
| 270 | 3300048912 | Ga0496109_0180149 | Ga0496109_0180149_703_1707 | 323 |
| 271 | 3300048913 | Ga0496110_0050548 | Ga0496110_0050548_2066_3070 | 323 |
| 272 | 3300048914 | Ga0496111_0041567 | Ga0496111_0041567_1283_2287 | 323 |
| 273 | 3300048914 | Ga0496111_0180410 | Ga0496111_0180410_176_1180 | 323 |
| 274 | 3300048916 | Ga0496113_0014186 | Ga0496113_0014186_1173_2177 | 323 |
| 275 | 3300048916 | Ga0496113_0102913 | Ga0496113_0102913_967_1971 | 323 |
| 276 | 3300048917 | Ga0496114_0024038 | Ga0496114_0024038_585_1589 | 323 |
| 277 | 3300048917 | Ga0496114_0065976 | Ga0496114_0065976_1907_2911 | 323 |
| 278 | 3300048917 | Ga0496114_0294108 | Ga0496114_0294108_79_1083 | 323 |
| 279 | 3300050507 | nmdc:mga05p37_4636_c1 | nmdc:mga05p37_4636_c1_587_1588 | 323 |
| 280 | 3300050509 | nmdc:mga0qj67_46691_c1 | nmdc:mga0qj67_46691_c1_1989_2990 | 323 |
| 281 | 3300050510 | nmdc:mga06r32_87637_c1 | nmdc:mga06r32_87637_c1_194_1195 | 323 |
| 282 | 3300053085 | Ga0495619_0059496 | Ga0495619_0059496_1238_2242 | 323 |
| 283 | iso_pu_bacteria | 2738543034 | 2739366871 | 323 |
| 284 | iso_pu_bacteria | 2904535858 | 2904538578 | 323 |
| 285 | iso_pu_bacteria | 2920879853 | 2920883368 | 323 |
| 286 | 3300005328 | Ga0070676_10172681 | Ga0070676_101726812 | 324 |
| 287 | 3300005329 | Ga0070683_100116116 | Ga0070683_1001161162 | 324 |
| 288 | 3300005333 | Ga0070677_10037016 | Ga0070677_100370161 | 324 |
| 289 | 3300005364 | Ga0070673_100156160 | Ga0070673_1001561601 | 324 |
| 290 | 3300009177 | Ga0105248_10120250 | Ga0105248_101202504 | 324 |
| 291 | 3300011119 | Ga0105246_10010978 | Ga0105246_100109786 | 324 |
| 292 | 3300025315 | Ga0207697_10001554 | Ga0207697_100015542 | 324 |
| 293 | 3300025728 | Ga0207655_1027201 | Ga0207655_10272013 | 324 |
| 294 | 3300025893 | Ga0207682_10036006 | Ga0207682_100360061 | 324 |
| 295 | 3300025923 | Ga0207681_10037972 | Ga0207681_100379723 | 324 |
| 296 | 3300025944 | Ga0207661_10065810 | Ga0207661_100658102 | 324 |
| 297 | 3300026067 | Ga0207678_10269127 | Ga0207678_102691272 | 324 |
| 298 | 3300026121 | Ga0207683_10104334 | Ga0207683_101043343 | 324 |
| 299 | 3300027907 | Ga0207428_10005972 | Ga0207428_100059729 | 324 |
| 300 | 3300031548 | Ga0307408_100001087 | Ga0307408_10000108711 | 324 |
| 301 | 3300031548 | Ga0307408_100037920 | Ga0307408_1000379202 | 324 |
| 302 | 3300031548 | Ga0307408_100074614 | Ga0307408_1000746142 | 324 |
| 303 | 3300031731 | Ga0307405_10002066 | Ga0307405_100020667 | 324 |
| 304 | 3300031731 | Ga0307405_10007947 | Ga0307405_100079473 | 324 |
| 305 | 3300031731 | Ga0307405_10019009 | Ga0307405_100190094 | 324 |
| 306 | 3300031731 | Ga0307405_10051669 | Ga0307405_100516692 | 324 |
| 307 | 3300031731 | Ga0307405_10075179 | Ga0307405_100751792 | 324 |
| 308 | 3300031824 | Ga0307413_10036545 | Ga0307413_100365453 | 324 |
| 309 | 3300031824 | Ga0307413_10078030 | Ga0307413_100780302 | 324 |
| 310 | 3300031824 | Ga0307413_10306170 | Ga0307413_103061701 | 324 |
| 311 | 3300031852 | Ga0307410_10002873 | Ga0307410_100028732 | 324 |
| 312 | 3300031852 | Ga0307410_10008843 | Ga0307410_100088434 | 324 |
| 313 | 3300031852 | Ga0307410_10017872 | Ga0307410_100178723 | 324 |
| 314 | 3300031852 | Ga0307410_10032306 | Ga0307410_100323063 | 324 |
| 315 | 3300031901 | Ga0307406_10042293 | Ga0307406_100422932 | 324 |
| 316 | 3300031901 | Ga0307406_10068658 | Ga0307406_100686582 | 324 |
| 317 | 3300031903 | Ga0307407_10015923 | Ga0307407_100159234 | 324 |
| 318 | 3300031911 | Ga0307412_10000650 | Ga0307412_1000065010 | 324 |
| 319 | 3300031911 | Ga0307412_10007944 | Ga0307412_100079443 | 324 |
| 320 | 3300031911 | Ga0307412_10029499 | Ga0307412_100294992 | 324 |
| 321 | 3300031911 | Ga0307412_10063896 | Ga0307412_100638962 | 324 |
| 322 | 3300031911 | Ga0307412_10146149 | Ga0307412_101461492 | 324 |
| 323 | 3300031995 | Ga0307409_100006051 | Ga0307409_1000060512 | 324 |
| 324 | 3300031995 | Ga0307409_100080596 | Ga0307409_1000805963 | 324 |
| 325 | 3300031995 | Ga0307409_100230855 | Ga0307409_1002308552 | 324 |
| 326 | 3300032002 | Ga0307416_100028781 | Ga0307416_1000287813 | 324 |
| 327 | 3300032002 | Ga0307416_100030951 | Ga0307416_1000309513 | 324 |
| 328 | 3300032002 | Ga0307416_100051065 | Ga0307416_1000510653 | 324 |
| 329 | 3300032002 | Ga0307416_100065519 | Ga0307416_1000655193 | 324 |
| 330 | 3300032002 | Ga0307416_100172751 | Ga0307416_1001727512 | 324 |
| 331 | 3300032002 | Ga0307416_100224953 | Ga0307416_1002249532 | 324 |
| 332 | 3300032002 | Ga0307416_100258020 | Ga0307416_1002580202 | 324 |
| 333 | 3300032002 | Ga0307416_100445977 | Ga0307416_1004459772 | 324 |
| 334 | 3300032004 | Ga0307414_10006263 | Ga0307414_100062636 | 324 |
| 335 | 3300032005 | Ga0307411_10165807 | Ga0307411_101658071 | 324 |
| 336 | 3300032126 | Ga0307415_100011275 | Ga0307415_1000112753 | 324 |
| 337 | 3300032126 | Ga0307415_100092963 | Ga0307415_1000929632 | 324 |
| 338 | 3300037312 | Ga0395899_0048530 | Ga0395899_0048530_1851_2885 | 324 |
| 339 | 3300037466 | Ga0395898_0218205 | Ga0395898_0218205_288_1322 | 324 |
| 340 | 3300038443 | Ga0395901_0027568 | Ga0395901_0027568_2823_3857 | 324 |
| 341 | 3300041404 | Ga0439436_0000890 | Ga0439436_0000890_5088_6122 | 324 |
| 342 | 3300041999 | Ga0439433_0001547 | Ga0439433_0001547_729_1763 | 324 |
| 343 | 3300042007 | Ga0439449_0001011 | Ga0439449_0001011_3873_4907 | 324 |
| 344 | 3300042007 | Ga0439449_0001639 | Ga0439449_0001639_2367_3401 | 324 |
| 345 | 3300042014 | Ga0439457_001433 | Ga0439457_001433_2637_3671 | 324 |
| 346 | 3300042015 | Ga0439462_0002416 | Ga0439462_0002416_661_1695 | 324 |
| 347 | 3300042435 | Ga0439434_0035638 | Ga0439434_0035638_194_1228 | 324 |
| 348 | 3300046472 | Ga0495580_0010354 | Ga0495580_0010354_341_1375 | 324 |
| 349 | 3300046531 | Ga0495665_0027028 | Ga0495665_0027028_1520_2554 | 324 |
| 350 | 3300046535 | Ga0495586_0001649 | Ga0495586_0001649_10272_11306 | 324 |
| 351 | 3300046615 | Ga0495656_0002914 | Ga0495656_0002914_2845_3879 | 324 |
| 352 | 3300046615 | Ga0495656_0010283 | Ga0495656_0010283_1509_2543 | 324 |
| 353 | 3300046616 | Ga0495668_0017386 | Ga0495668_0017386_287_1321 | 324 |
| 354 | 3300046674 | Ga0495588_0014737 | Ga0495588_0014737_1575_2609 | 324 |
| 355 | 3300046691 | Ga0495670_0003869 | Ga0495670_0003869_5439_6473 | 324 |
| 356 | 3300046691 | Ga0495670_0115866 | Ga0495670_0115866_160_1194 | 324 |
| 357 | 3300047315 | Ga0495581_0073781 | Ga0495581_0073781_410_1444 | 324 |
| 358 | 3300048905 | Ga0496102_0081798 | Ga0496102_0081798_1782_2822 | 324 |
| 359 | 3300048909 | Ga0496106_0010795 | Ga0496106_0010795_5695_6729 | 324 |
| 360 | 3300048909 | Ga0496106_0254309 | Ga0496106_0254309_310_1344 | 324 |
| 361 | 3300048911 | Ga0496108_0440146 | Ga0496108_0440146_50_1048 | 324 |
| 362 | 3300048912 | Ga0496109_0096411 | Ga0496109_0096411_1057_2091 | 324 |
| 363 | 3300048915 | Ga0496112_0066132 | Ga0496112_0066132_1961_3001 | 324 |
| 364 | 3300048918 | Ga0496115_0196843 | Ga0496115_0196843_436_1470 | 324 |
| 365 | 3300049573 | Ga0501037_0056311 | Ga0501037_0056311_1046_2089 | 324 |
| 366 | 3300059424 | Ga0590075_010080 | Ga0590075_010080_972_2006 | 324 |
| 367 | iso_pu_bacteria | 8054107350 | 8054109104 | 324 |
| 368 | 3300001978 | JGI24747J21853_1000411 | JGI24747J21853_10004112 | 325 |
| 369 | 3300001990 | JGI24737J22298_10056929 | JGI24737J22298_100569292 | 325 |
| 370 | 3300002067 | JGI24735J21928_10020495 | JGI24735J21928_100204952 | 325 |
| 371 | 3300002070 | JGI24750J21931_1002461 | JGI24750J21931_10024612 | 325 |
| 372 | 3300002074 | JGI24748J21848_1002241 | JGI24748J21848_10022412 | 325 |
| 373 | 3300002077 | JGI24744J21845_10001784 | JGI24744J21845_100017844 | 325 |
| 374 | 3300002244 | JGI24742J22300_10001076 | JGI24742J22300_100010766 | 325 |
| 375 | 3300003203 | JGI25406J46586_10017256 | JGI25406J46586_100172562 | 325 |
| 376 | 3300003316 | rootH1_10000180 | rootH1_1000018017 | 325 |
| 377 | 3300003578 | Ga0006562J51391_1090646 | Ga0006562J51391_10906463 | 325 |
| 378 | 3300003578 | Ga0006562J51391_1090648 | Ga0006562J51391_10906482 | 325 |
| 379 | 3300005330 | Ga0070690_100021466 | Ga0070690_1000214666 | 325 |
| 380 | 3300005334 | Ga0068869_100062168 | Ga0068869_1000621681 | 325 |
| 381 | 3300005343 | Ga0070687_100042717 | Ga0070687_1000427172 | 325 |
| 382 | 3300005353 | Ga0070669_100348477 | Ga0070669_1003484771 | 325 |
| 383 | 3300005355 | Ga0070671_100106988 | Ga0070671_1001069882 | 325 |
| 384 | 3300005365 | Ga0070688_100011804 | Ga0070688_1000118043 | 325 |
| 385 | 3300005367 | Ga0070667_100516903 | Ga0070667_1005169031 | 325 |
| 386 | 3300005406 | Ga0070703_10007190 | Ga0070703_100071902 | 325 |
| 387 | 3300005435 | Ga0070714_100020361 | Ga0070714_1000203612 | 325 |
| 388 | 3300005437 | Ga0070710_10073448 | Ga0070710_100734482 | 325 |
| 389 | 3300005437 | Ga0070710_10147698 | Ga0070710_101476982 | 325 |
| 390 | 3300005440 | Ga0070705_100064350 | Ga0070705_1000643502 | 325 |
| 391 | 3300005445 | Ga0070708_100010999 | Ga0070708_1000109991 | 325 |
| 392 | 3300005457 | Ga0070662_100388748 | Ga0070662_1003887482 | 325 |
| 393 | 3300005459 | Ga0068867_100043517 | Ga0068867_1000435174 | 325 |
| 394 | 3300005459 | Ga0068867_100439913 | Ga0068867_1004399131 | 325 |
| 395 | 3300005466 | Ga0070685_10067743 | Ga0070685_100677431 | 325 |
| 396 | 3300005468 | Ga0070707_100158662 | Ga0070707_1001586622 | 325 |
| 397 | 3300005539 | Ga0068853_100058607 | Ga0068853_1000586073 | 325 |
| 398 | 3300005543 | Ga0070672_100189323 | Ga0070672_1001893232 | 325 |
| 399 | 3300005546 | Ga0070696_100101390 | Ga0070696_1001013902 | 325 |
| 400 | 3300005549 | Ga0070704_100298433 | Ga0070704_1002984332 | 325 |
| 401 | 3300005614 | Ga0068856_100100307 | Ga0068856_1001003072 | 325 |
| 402 | 3300005718 | Ga0068866_10059848 | Ga0068866_100598482 | 325 |
| 403 | 3300005718 | Ga0068866_10152799 | Ga0068866_101527992 | 325 |
| 404 | 3300005718 | Ga0068866_10191066 | Ga0068866_101910661 | 325 |
| 405 | 3300005843 | Ga0068860_100410211 | Ga0068860_1004102112 | 325 |
| 406 | 3300005981 | Ga0081538_10007282 | Ga0081538_100072823 | 325 |
| 407 | 3300005981 | Ga0081538_10013417 | Ga0081538_100134173 | 325 |
| 408 | 3300005981 | Ga0081538_10020096 | Ga0081538_100200967 | 325 |
| 409 | 3300005985 | Ga0081539_10001911 | Ga0081539_100019118 | 325 |
| 410 | 3300005985 | Ga0081539_10002039 | Ga0081539_1000203918 | 325 |
| 411 | 3300005985 | Ga0081539_10028201 | Ga0081539_100282013 | 325 |
| 412 | 3300006028 | Ga0070717_10083515 | Ga0070717_100835153 | 325 |
| 413 | 3300006028 | Ga0070717_10323305 | Ga0070717_103233051 | 325 |
| 414 | 3300006028 | Ga0070717_10421529 | Ga0070717_104215291 | 325 |
| 415 | 3300006173 | Ga0070716_100019475 | Ga0070716_1000194754 | 325 |
| 416 | 3300006173 | Ga0070716_100054233 | Ga0070716_1000542332 | 325 |
| 417 | 3300006358 | Ga0068871_100098224 | Ga0068871_1000982242 | 325 |
| 418 | 3300006844 | Ga0075428_100051364 | Ga0075428_1000513643 | 325 |
| 419 | 3300006846 | Ga0075430_100072408 | Ga0075430_1000724083 | 325 |
| 420 | 3300006852 | Ga0075433_10016326 | Ga0075433_100163267 | 325 |
| 421 | 3300006871 | Ga0075434_100019077 | Ga0075434_1000190777 | 325 |
| 422 | 3300006880 | Ga0075429_100090918 | Ga0075429_1000909183 | 325 |
| 423 | 3300006948 | Ga0099826_10112892 | Ga0099826_101128922 | 325 |
| 424 | 3300009092 | Ga0105250_10014173 | Ga0105250_100141734 | 325 |
| 425 | 3300009093 | Ga0105240_10232985 | Ga0105240_102329852 | 325 |
| 426 | 3300009094 | Ga0111539_10201896 | Ga0111539_102018963 | 325 |
| 427 | 3300009147 | Ga0114129_10121840 | Ga0114129_101218403 | 325 |
| 428 | 3300009147 | Ga0114129_10248132 | Ga0114129_102481323 | 325 |
| 429 | 3300009174 | Ga0105241_10190504 | Ga0105241_101905042 | 325 |
| 430 | 3300009551 | Ga0105238_10229048 | Ga0105238_102290482 | 325 |
| 431 | 3300009551 | Ga0105238_10267275 | Ga0105238_102672752 | 325 |
| 432 | 3300010375 | Ga0105239_10244205 | Ga0105239_102442052 | 325 |
| 433 | 3300013105 | Ga0157369_10007585 | Ga0157369_100075858 | 325 |
| 434 | 3300013306 | Ga0163162_10187843 | Ga0163162_101878433 | 325 |
| 435 | 3300013307 | Ga0157372_10429327 | Ga0157372_104293273 | 325 |
| 436 | 3300013308 | Ga0157375_10008683 | Ga0157375_100086834 | 325 |
| 437 | 3300013308 | Ga0157375_10357746 | Ga0157375_103577462 | 325 |
| 438 | 3300014497 | Ga0182008_10001253 | Ga0182008_1000125310 | 325 |
| 439 | 3300014497 | Ga0182008_10092955 | Ga0182008_100929551 | 325 |
| 440 | 3300015262 | Ga0182007_10009486 | Ga0182007_100094861 | 325 |
| 441 | 3300015688 | Ga0183367_1001 | Ga0183367_1001982 | 325 |
| 442 | 3300017792 | Ga0163161_10059058 | Ga0163161_100590583 | 325 |
| 443 | 3300025885 | Ga0207653_10005382 | Ga0207653_100053823 | 325 |
| 444 | 3300025898 | Ga0207692_10025252 | Ga0207692_100252523 | 325 |
| 445 | 3300025901 | Ga0207688_10058232 | Ga0207688_100582322 | 325 |
| 446 | 3300025904 | Ga0207647_10148132 | Ga0207647_101481322 | 325 |
| 447 | 3300025906 | Ga0207699_10299085 | Ga0207699_102990851 | 325 |
| 448 | 3300025915 | Ga0207693_10307924 | Ga0207693_103079242 | 325 |
| 449 | 3300025918 | Ga0207662_10066950 | Ga0207662_100669502 | 325 |
| 450 | 3300025921 | Ga0207652_10072244 | Ga0207652_100722443 | 325 |
| 451 | 3300025922 | Ga0207646_10043317 | Ga0207646_100433171 | 325 |
| 452 | 3300025923 | Ga0207681_10071132 | Ga0207681_100711322 | 325 |
| 453 | 3300025927 | Ga0207687_10018087 | Ga0207687_100180873 | 325 |
| 454 | 3300025929 | Ga0207664_10040745 | Ga0207664_100407451 | 325 |
| 455 | 3300025929 | Ga0207664_10043723 | Ga0207664_100437233 | 325 |
| 456 | 3300025934 | Ga0207686_10075145 | Ga0207686_100751452 | 325 |
| 457 | 3300025938 | Ga0207704_10012717 | Ga0207704_100127174 | 325 |
| 458 | 3300025939 | Ga0207665_10290453 | Ga0207665_102904532 | 325 |
| 459 | 3300025940 | Ga0207691_10109193 | Ga0207691_101091932 | 325 |
| 460 | 3300025942 | Ga0207689_10079381 | Ga0207689_100793811 | 325 |
| 461 | 3300025942 | Ga0207689_10247867 | Ga0207689_102478671 | 325 |
| 462 | 3300025972 | Ga0207668_10023437 | Ga0207668_100234376 | 325 |
| 463 | 3300026023 | Ga0207677_10103413 | Ga0207677_101034133 | 325 |
| 464 | 3300026035 | Ga0207703_10195047 | Ga0207703_101950472 | 325 |
| 465 | 3300026067 | Ga0207678_10315368 | Ga0207678_103153682 | 325 |
| 466 | 3300026075 | Ga0207708_10018814 | Ga0207708_100188143 | 325 |
| 467 | 3300026118 | Ga0207675_100158503 | Ga0207675_1001585032 | 325 |
| 468 | 3300026118 | Ga0207675_100283651 | Ga0207675_1002836512 | 325 |
| 469 | 3300026121 | Ga0207683_10151673 | Ga0207683_101516732 | 325 |
| 470 | 3300026121 | Ga0207683_10313682 | Ga0207683_103136822 | 325 |
| 471 | 3300027866 | Ga0209813_10066393 | Ga0209813_100663931 | 325 |
| 472 | 3300028381 | Ga0268264_10437633 | Ga0268264_104376332 | 325 |
| 473 | 3300028786 | Ga0307517_10004208 | Ga0307517_1000420812 | 325 |
| 474 | 3300028794 | Ga0307515_10000046 | Ga0307515_10000046311 | 325 |
| 475 | 3300028794 | Ga0307515_10034314 | Ga0307515_100343144 | 325 |
| 476 | 3300030521 | Ga0307511_10004532 | Ga0307511_100045323 | 325 |
| 477 | 3300030521 | Ga0307511_10026828 | Ga0307511_100268282 | 325 |
| 478 | 3300030522 | Ga0307512_10065667 | Ga0307512_100656672 | 325 |
| 479 | 3300030522 | Ga0307512_10116292 | Ga0307512_101162921 | 325 |
| 480 | 3300031456 | Ga0307513_10008529 | Ga0307513_100085291 | 325 |
| 481 | 3300031507 | Ga0307509_10018697 | Ga0307509_100186976 | 325 |
| 482 | 3300031507 | Ga0307509_10099927 | Ga0307509_100999271 | 325 |
| 483 | 3300031548 | Ga0307408_100013603 | Ga0307408_1000136035 | 325 |
| 484 | 3300031548 | Ga0307408_100015963 | Ga0307408_1000159633 | 325 |
| 485 | 3300031616 | Ga0307508_10005047 | Ga0307508_100050476 | 325 |
| 486 | 3300031616 | Ga0307508_10011478 | Ga0307508_100114781 | 325 |
| 487 | 3300031616 | Ga0307508_10124426 | Ga0307508_101244262 | 325 |
| 488 | 3300031649 | Ga0307514_10006879 | Ga0307514_100068796 | 325 |
| 489 | 3300031649 | Ga0307514_10173395 | Ga0307514_101733952 | 325 |
| 490 | 3300031730 | Ga0307516_10010982 | Ga0307516_100109826 | 325 |
| 491 | 3300031730 | Ga0307516_10013623 | Ga0307516_100136232 | 325 |
| 492 | 3300031731 | Ga0307405_10006030 | Ga0307405_100060303 | 325 |
| 493 | 3300031731 | Ga0307405_10043060 | Ga0307405_100430603 | 325 |
| 494 | 3300031731 | Ga0307405_10062249 | Ga0307405_100622492 | 325 |
| 495 | 3300031824 | Ga0307413_10038517 | Ga0307413_100385172 | 325 |
| 496 | 3300031824 | Ga0307413_10074884 | Ga0307413_100748842 | 325 |
| 497 | 3300031838 | Ga0307518_10098538 | Ga0307518_100985382 | 325 |
| 498 | 3300031838 | Ga0307518_10143289 | Ga0307518_101432892 | 325 |
| 499 | 3300031852 | Ga0307410_10001911 | Ga0307410_1000191110 | 325 |
| 500 | 3300031852 | Ga0307410_10002556 | Ga0307410_100025568 | 325 |
| 501 | 3300031852 | Ga0307410_10004357 | Ga0307410_100043574 | 325 |
| 502 | 3300031852 | Ga0307410_10071187 | Ga0307410_100711873 | 325 |
| 503 | 3300031901 | Ga0307406_10000246 | Ga0307406_1000024621 | 325 |
| 504 | 3300031901 | Ga0307406_10022105 | Ga0307406_100221052 | 325 |
| 505 | 3300031901 | Ga0307406_10103248 | Ga0307406_101032482 | 325 |
| 506 | 3300031903 | Ga0307407_10010005 | Ga0307407_100100052 | 325 |
| 507 | 3300031903 | Ga0307407_10028538 | Ga0307407_100285383 | 325 |
| 508 | 3300031903 | Ga0307407_10071207 | Ga0307407_100712072 | 325 |
| 509 | 3300031903 | Ga0307407_10121535 | Ga0307407_101215352 | 325 |
| 510 | 3300031995 | Ga0307409_100000284 | Ga0307409_1000002845 | 325 |
| 511 | 3300031995 | Ga0307409_100000345 | Ga0307409_1000003452 | 325 |
| 512 | 3300031995 | Ga0307409_100001116 | Ga0307409_1000011162 | 325 |
| 513 | 3300031995 | Ga0307409_100045288 | Ga0307409_1000452883 | 325 |
| 514 | 3300031995 | Ga0307409_100052036 | Ga0307409_1000520362 | 325 |
| 515 | 3300032002 | Ga0307416_100000283 | Ga0307416_10000028318 | 325 |
| 516 | 3300032002 | Ga0307416_100013462 | Ga0307416_1000134622 | 325 |
| 517 | 3300032002 | Ga0307416_100022366 | Ga0307416_1000223664 | 325 |
| 518 | 3300032002 | Ga0307416_100086492 | Ga0307416_1000864922 | 325 |
| 519 | 3300032002 | Ga0307416_100148632 | Ga0307416_1001486323 | 325 |
| 520 | 3300032002 | Ga0307416_100366314 | Ga0307416_1003663142 | 325 |
| 521 | 3300032004 | Ga0307414_10071803 | Ga0307414_100718033 | 325 |
| 522 | 3300032005 | Ga0307411_10028810 | Ga0307411_100288103 | 325 |
| 523 | 3300032005 | Ga0307411_10030404 | Ga0307411_100304044 | 325 |
| 524 | 3300032126 | Ga0307415_100000587 | Ga0307415_1000005877 | 325 |
| 525 | 3300032126 | Ga0307415_100000874 | Ga0307415_10000087410 | 325 |
| 526 | 3300032126 | Ga0307415_100313106 | Ga0307415_1003131061 | 325 |
| 527 | 3300033179 | Ga0307507_10015481 | Ga0307507_100154814 | 325 |
| 528 | 3300033179 | Ga0307507_10047057 | Ga0307507_100470573 | 325 |
| 529 | 3300033180 | Ga0307510_10005834 | Ga0307510_100058345 | 325 |
| 530 | 3300033180 | Ga0307510_10040367 | Ga0307510_100403672 | 325 |
| 531 | 3300033180 | Ga0307510_10188532 | Ga0307510_101885322 | 325 |
| 532 | 3300035207 | Ga0373942_0010964 | Ga0373942_0010964_1060_2067 | 325 |
| 533 | 3300035242 | Ga0373962_0030264 | Ga0373962_0030264_127_1128 | 325 |
| 534 | 3300035724 | Ga0373933_0141066 | Ga0373933_0141066_193_1197 | 325 |
| 535 | 3300036401 | Ga0373937_0068047 | Ga0373937_0068047_2136_3140 | 325 |
| 536 | 3300037312 | Ga0395899_0112409 | Ga0395899_0112409_839_1840 | 325 |
| 537 | 3300037418 | Ga0395900_0038477 | Ga0395900_0038477_550_1551 | 325 |
| 538 | 3300037418 | Ga0395900_0059154 | Ga0395900_0059154_1143_2144 | 325 |
| 539 | 3300037466 | Ga0395898_0011687 | Ga0395898_0011687_5762_6766 | 325 |
| 540 | 3300037466 | Ga0395898_0203521 | Ga0395898_0203521_644_1645 | 325 |
| 541 | 3300037471 | Ga0395905_0090804 | Ga0395905_0090804_299_1300 | 325 |
| 542 | 3300037471 | Ga0395905_0161863 | Ga0395905_0161863_1010_2011 | 325 |
| 543 | 3300037853 | Ga0436364_0980706 | Ga0436364_0980706_548_1552 | 325 |
| 544 | 3300038443 | Ga0395901_0075983 | Ga0395901_0075983_2146_3147 | 325 |
| 545 | 3300038443 | Ga0395901_0395959 | Ga0395901_0395959_254_1255 | 325 |
| 546 | 3300039450 | Ga0436363_1613141 | Ga0436363_1613141_726_1730 | 325 |
| 547 | 3300041404 | Ga0439436_0032572 | Ga0439436_0032572_237_1262 | 325 |
| 548 | 3300041411 | Ga0439466_0048903 | Ga0439466_0048903_265_1290 | 325 |
| 549 | 3300041494 | Ga0451837_1508489 | Ga0451837_1508489_129_1133 | 325 |
| 550 | 3300041512 | Ga0451853_0498644 | Ga0451853_0498644_214_1242 | 325 |
| 551 | 3300041512 | Ga0451853_3326361 | Ga0451853_3326361_1484_2488 | 325 |
| 552 | 3300042005 | Ga0439448_0027207 | Ga0439448_0027207_185_1186 | 325 |
| 553 | 3300042005 | Ga0439448_0027541 | Ga0439448_0027541_619_1623 | 325 |
| 554 | 3300042007 | Ga0439449_0003409 | Ga0439449_0003409_1960_2964 | 325 |
| 555 | 3300042012 | Ga0439455_0021323 | Ga0439455_0021323_521_1522 | 325 |
| 556 | 3300042131 | Ga0450894_000335 | Ga0450894_000335_1730_2740 | 325 |
| 557 | 3300042133 | Ga0450896_001171 | Ga0450896_001171_507_1517 | 325 |
| 558 | 3300042134 | Ga0450898_002836 | Ga0450898_002836_1044_2054 | 325 |
| 559 | 3300042135 | Ga0450899_000754 | Ga0450899_000754_2206_3216 | 325 |
| 560 | 3300042138 | Ga0450903_000618 | Ga0450903_000618_1352_2356 | 325 |
| 561 | 3300042157 | Ga0439458_0001937 | Ga0439458_0001937_1422_2426 | 325 |
| 562 | 3300042157 | Ga0439458_0002826 | Ga0439458_0002826_2046_3050 | 325 |
| 563 | 3300042157 | Ga0439458_0033476 | Ga0439458_0033476_142_1143 | 325 |
| 564 | 3300042437 | Ga0439444_0005125 | Ga0439444_0005125_372_1373 | 325 |
| 565 | 3300042461 | Ga0439460_0026898 | Ga0439460_0026898_381_1382 | 325 |
| 566 | 3300042993 | Ga0439440_0010269 | Ga0439440_0010269_266_1267 | 325 |
| 567 | 3300044656 | Ga0466969_0033377 | Ga0466969_0033377_795_1799 | 325 |
| 568 | 3300044683 | Ga0466965_0000288 | Ga0466965_0000288_9846_10850 | 325 |
| 569 | 3300044684 | Ga0466966_0002830 | Ga0466966_0002830_1215_2219 | 325 |
| 570 | 3300044693 | Ga0466961_0012755 | Ga0466961_0012755_3698_4702 | 325 |
| 571 | 3300044693 | Ga0466961_0023127 | Ga0466961_0023127_1343_2347 | 325 |
| 572 | 3300044693 | Ga0466961_0108287 | Ga0466961_0108287_78_1082 | 325 |
| 573 | 3300044694 | Ga0466963_0001177 | Ga0466963_0001177_1215_2219 | 325 |
| 574 | 3300044694 | Ga0466963_0025611 | Ga0466963_0025611_329_1336 | 325 |
| 575 | 3300044706 | Ga0466964_0001884 | Ga0466964_0001884_6081_7085 | 325 |
| 576 | 3300044719 | Ga0466971_0001045 | Ga0466971_0001045_9044_10048 | 325 |
| 577 | 3300044719 | Ga0466971_0004284 | Ga0466971_0004284_2379_3383 | 325 |
| 578 | 3300044735 | Ga0466968_0015344 | Ga0466968_0015344_1181_2185 | 325 |
| 579 | 3300044765 | Ga0466970_0021714 | Ga0466970_0021714_160_1164 | 325 |
| 580 | 3300044765 | Ga0466970_0032738 | Ga0466970_0032738_964_1968 | 325 |
| 581 | 3300044842 | Ga0466957_0009571 | Ga0466957_0009571_165_1169 | 325 |
| 582 | 3300044901 | Ga0466960_0102429 | Ga0466960_0102429_454_1458 | 325 |
| 583 | 3300045049 | Ga0466959_0008657 | Ga0466959_0008657_1215_2219 | 325 |
| 584 | 3300045049 | Ga0466959_0008896 | Ga0466959_0008896_2364_3368 | 325 |
| 585 | 3300045836 | Ga0466958_0001015 | Ga0466958_0001015_2785_3789 | 325 |
| 586 | 3300045976 | Ga0466967_0017691 | Ga0466967_0017691_270_1274 | 325 |
| 587 | 3300045976 | Ga0466967_0029886 | Ga0466967_0029886_3510_4514 | 325 |
| 588 | 3300046454 | Ga0495592_0107800 | Ga0495592_0107800_235_1239 | 325 |
| 589 | 3300046455 | Ga0495603_0101371 | Ga0495603_0101371_595_1596 | 325 |
| 590 | 3300046459 | Ga0495629_0001242 | Ga0495629_0001242_19014_20018 | 325 |
| 591 | 3300046460 | Ga0495638_0023679 | Ga0495638_0023679_402_1403 | 325 |
| 592 | 3300046460 | Ga0495638_0049225 | Ga0495638_0049225_1266_2282 | 325 |
| 593 | 3300046462 | Ga0495651_0020708 | Ga0495651_0020708_3035_4039 | 325 |
| 594 | 3300046463 | Ga0495653_0006973 | Ga0495653_0006973_5277_6281 | 325 |
| 595 | 3300046473 | Ga0495582_0058050 | Ga0495582_0058050_555_1559 | 325 |
| 596 | 3300046476 | Ga0495662_0000305 | Ga0495662_0000305_17494_18498 | 325 |
| 597 | 3300046477 | Ga0495664_0000787 | Ga0495664_0000787_12473_13477 | 325 |
| 598 | 3300046506 | Ga0495583_0073461 | Ga0495583_0073461_96_1100 | 325 |
| 599 | 3300046511 | Ga0495608_0231526 | Ga0495608_0231526_142_1146 | 325 |
| 600 | 3300046514 | Ga0495618_0053782 | Ga0495618_0053782_935_1939 | 325 |
| 601 | 3300046516 | Ga0495628_0044866 | Ga0495628_0044866_1592_2596 | 325 |
| 602 | 3300046529 | Ga0495652_0064012 | Ga0495652_0064012_1047_2051 | 325 |
| 603 | 3300046536 | Ga0495587_0003178 | Ga0495587_0003178_990_1994 | 325 |
| 604 | 3300046543 | Ga0495645_0038329 | Ga0495645_0038329_1440_2444 | 325 |
| 605 | 3300046642 | Ga0495634_0014249 | Ga0495634_0014249_1070_2074 | 325 |
| 606 | 3300046660 | Ga0495625_0072160 | Ga0495625_0072160_1221_2225 | 325 |
| 607 | 3300046663 | Ga0495635_0005045 | Ga0495635_0005045_1456_2460 | 325 |
| 608 | 3300046674 | Ga0495588_0002246 | Ga0495588_0002246_1461_2465 | 325 |
| 609 | 3300046680 | Ga0495646_0029621 | Ga0495646_0029621_467_1471 | 325 |
| 610 | 3300046683 | Ga0495658_0052702 | Ga0495658_0052702_350_1354 | 325 |
| 611 | 3300046689 | Ga0495613_0016742 | Ga0495613_0016742_3423_4427 | 325 |
| 612 | 3300046690 | Ga0495624_0157423 | Ga0495624_0157423_172_1188 | 325 |
| 613 | 3300046692 | Ga0495671_0073198 | Ga0495671_0073198_610_1626 | 325 |
| 614 | 3300047315 | Ga0495581_0001698 | Ga0495581_0001698_1042_2046 | 325 |
| 615 | 3300047317 | Ga0495604_0000811 | Ga0495604_0000811_11568_12572 | 325 |
| 616 | 3300047317 | Ga0495604_0187915 | Ga0495604_0187915_401_1405 | 325 |
| 617 | 3300047319 | Ga0495674_0104386 | Ga0495674_0104386_412_1416 | 325 |
| 618 | 3300047321 | Ga0495676_0106092 | Ga0495676_0106092_387_1391 | 325 |
| 619 | 3300047443 | Ga0495687_001428 | Ga0495687_001428_9785_10789 | 325 |
| 620 | 3300047443 | Ga0495687_011432 | Ga0495687_011432_938_1954 | 325 |
| 621 | 3300047443 | Ga0495687_013341 | Ga0495687_013341_64_1068 | 325 |
| 622 | 3300047443 | Ga0495687_013809 | Ga0495687_013809_115_1131 | 325 |
| 623 | 3300047447 | Ga0495685_002934 | Ga0495685_002934_3676_4692 | 325 |
| 624 | 3300047447 | Ga0495685_013905 | Ga0495685_013905_155_1159 | 325 |
| 625 | 3300047470 | Ga0495681_0014664 | Ga0495681_0014664_940_1956 | 325 |
| 626 | 3300047471 | Ga0495684_0202687 | Ga0495684_0202687_83_1087 | 325 |
| 627 | 3300047673 | Ga0495593_0003017 | Ga0495593_0003017_8078_9082 | 325 |
| 628 | 3300048089 | Ga0495614_0005221 | Ga0495614_0005221_3221_4225 | 325 |
| 629 | 3300048089 | Ga0495614_0032534 | Ga0495614_0032534_153_1157 | 325 |
| 630 | 3300048904 | Ga0496101_0037432 | Ga0496101_0037432_1655_2662 | 325 |
| 631 | 3300048905 | Ga0496102_0131030 | Ga0496102_0131030_1147_2163 | 325 |
| 632 | 3300048906 | Ga0496103_0004152 | Ga0496103_0004152_5636_6643 | 325 |
| 633 | 3300048906 | Ga0496103_0202118 | Ga0496103_0202118_104_1105 | 325 |
| 634 | 3300048907 | Ga0496104_0114339 | Ga0496104_0114339_604_1632 | 325 |
| 635 | 3300048907 | Ga0496104_0152172 | Ga0496104_0152172_142_1149 | 325 |
| 636 | 3300048908 | Ga0496105_0030685 | Ga0496105_0030685_1879_2883 | 325 |
| 637 | 3300048909 | Ga0496106_0018727 | Ga0496106_0018727_2410_3417 | 325 |
| 638 | 3300048910 | Ga0496107_0030794 | Ga0496107_0030794_2581_3588 | 325 |
| 639 | 3300048911 | Ga0496108_0184540 | Ga0496108_0184540_751_1755 | 325 |
| 640 | 3300048911 | Ga0496108_0232607 | Ga0496108_0232607_278_1288 | 325 |
| 641 | 3300048911 | Ga0496108_0354496 | Ga0496108_0354496_61_1062 | 325 |
| 642 | 3300048912 | Ga0496109_0146228 | Ga0496109_0146228_759_1763 | 325 |
| 643 | 3300048912 | Ga0496109_0313909 | Ga0496109_0313909_11_1039 | 325 |
| 644 | 3300048914 | Ga0496111_0121854 | Ga0496111_0121854_452_1456 | 325 |
| 645 | 3300048917 | Ga0496114_0006529 | Ga0496114_0006529_5628_6635 | 325 |
| 646 | 3300048917 | Ga0496114_0035253 | Ga0496114_0035253_1641_2645 | 325 |
| 647 | 3300048918 | Ga0496115_0013550 | Ga0496115_0013550_3168_4175 | 325 |
| 648 | 3300049568 | Ga0501031_0006068 | Ga0501031_0006068_2954_3961 | 325 |
| 649 | 3300049568 | Ga0501031_0177555 | Ga0501031_0177555_353_1357 | 325 |
| 650 | 3300049569 | Ga0501032_0016570 | Ga0501032_0016570_2123_3130 | 325 |
| 651 | 3300049570 | Ga0501033_0045356 | Ga0501033_0045356_1115_2119 | 325 |
| 652 | 3300049571 | Ga0501034_0006804 | Ga0501034_0006804_3989_4993 | 325 |
| 653 | 3300049571 | Ga0501034_0035780 | Ga0501034_0035780_467_1474 | 325 |
| 654 | 3300049572 | Ga0501036_0009835 | Ga0501036_0009835_1153_2157 | 325 |
| 655 | 3300049572 | Ga0501036_0016707 | Ga0501036_0016707_1961_2968 | 325 |
| 656 | 3300049572 | Ga0501036_0017920 | Ga0501036_0017920_3219_4223 | 325 |
| 657 | 3300049572 | Ga0501036_0222747 | Ga0501036_0222747_543_1547 | 325 |
| 658 | 3300049573 | Ga0501037_0004673 | Ga0501037_0004673_8195_9202 | 325 |
| 659 | 3300049573 | Ga0501037_0132606 | Ga0501037_0132606_667_1671 | 325 |
| 660 | 3300049573 | Ga0501037_0140121 | Ga0501037_0140121_155_1162 | 325 |
| 661 | 3300049574 | Ga0501038_0000531 | Ga0501038_0000531_29929_30933 | 325 |
| 662 | 3300049574 | Ga0501038_0054915 | Ga0501038_0054915_49_1056 | 325 |
| 663 | 3300049578 | Ga0501042_0004136 | Ga0501042_0004136_3371_4378 | 325 |
| 664 | 3300049579 | Ga0501043_0002652 | Ga0501043_0002652_13117_14121 | 325 |
| 665 | 3300049579 | Ga0501043_0016086 | Ga0501043_0016086_449_1456 | 325 |
| 666 | 3300049579 | Ga0501043_0082019 | Ga0501043_0082019_585_1589 | 325 |
| 667 | 3300049580 | Ga0501046_0025985 | Ga0501046_0025985_839_1846 | 325 |
| 668 | 3300049580 | Ga0501046_0043617 | Ga0501046_0043617_270_1277 | 325 |
| 669 | 3300049581 | Ga0501047_0083898 | Ga0501047_0083898_1969_2976 | 325 |
| 670 | 3300049581 | Ga0501047_0102281 | Ga0501047_0102281_1546_2553 | 325 |
| 671 | 3300049582 | Ga0501048_0021390 | Ga0501048_0021390_2350_3357 | 325 |
| 672 | 3300049586 | Ga0501070_0001683 | Ga0501070_0001683_9050_10054 | 325 |
| 673 | 3300049589 | Ga0501073_0237498 | Ga0501073_0237498_95_1102 | 325 |
| 674 | 3300049590 | Ga0501074_0011845 | Ga0501074_0011845_1703_2707 | 325 |
| 675 | 3300049652 | Ga0501202_018009 | Ga0501202_018009_241_1257 | 325 |
| 676 | 3300049742 | Ga0501080_0122212 | Ga0501080_0122212_1204_2208 | 325 |
| 677 | 3300049822 | Ga0501035_0027151 | Ga0501035_0027151_4036_5043 | 325 |
| 678 | 3300049822 | Ga0501035_0029689 | Ga0501035_0029689_3241_4245 | 325 |
| 679 | 3300049823 | Ga0501044_0026941 | Ga0501044_0026941_2124_3131 | 325 |
| 680 | 3300049824 | Ga0501045_0110852 | Ga0501045_0110852_742_1749 | 325 |
| 681 | 3300050490 | nmdc:mga03n38_23039_c1 | nmdc:mga03n38_23039_c1_652_1656 | 325 |
| 682 | 3300050492 | nmdc:mga0yw44_189835_c1 | nmdc:mga0yw44_189835_c1_215_1219 | 325 |
| 683 | 3300050494 | nmdc:mga06z11_3783_c1 | nmdc:mga06z11_3783_c1_2811_3815 | 325 |
| 684 | 3300050507 | nmdc:mga05p37_42469_c1 | nmdc:mga05p37_42469_c1_1011_2012 | 325 |
| 685 | 3300050507 | nmdc:mga05p37_73219_c1 | nmdc:mga05p37_73219_c1_2227_3228 | 325 |
| 686 | 3300050508 | nmdc:mga09592_80800_c1 | nmdc:mga09592_80800_c1_993_1994 | 325 |
| 687 | 3300050509 | nmdc:mga0qj67_62106_c1 | nmdc:mga0qj67_62106_c1_976_1977 | 325 |
| 688 | 3300050510 | nmdc:mga06r32_177344_c1 | nmdc:mga06r32_177344_c1_993_1994 | 325 |
| 689 | 3300050511 | nmdc:mga08y16_40577_c1 | nmdc:mga08y16_40577_c1_1900_2901 | 325 |
| 690 | 3300050511 | nmdc:mga08y16_533362_c1 | nmdc:mga08y16_533362_c1_151_1161 | 325 |
| 691 | 3300050512 | nmdc:mga0n895_65935_c1 | nmdc:mga0n895_65935_c1_1604_2605 | 325 |
| 692 | 3300050515 | nmdc:mga0a205_17567_c1 | nmdc:mga0a205_17567_c1_3987_4988 | 325 |
| 693 | 3300053078 | Ga0495612_0015629 | Ga0495612_0015629_1166_2170 | 325 |
| 694 | 3300053085 | Ga0495619_0031981 | Ga0495619_0031981_440_1444 | 325 |
| 695 | 3300053086 | Ga0500578_0073202 | Ga0500578_0073202_75_1091 | 325 |
| 696 | 3300053088 | Ga0500644_0041293 | Ga0500644_0041293_82_1086 | 325 |
| 697 | 3300053092 | Ga0500583_0106408 | Ga0500583_0106408_242_1246 | 325 |
| 698 | 3300053095 | Ga0500640_034651 | Ga0500640_034651_520_1524 | 325 |
| 699 | 3300053107 | Ga0500560_004346 | Ga0500560_004346_1930_2934 | 325 |
| 700 | 3300053107 | Ga0500560_015854 | Ga0500560_015854_443_1444 | 325 |
| 701 | 3300053131 | Ga0500652_013987 | Ga0500652_013987_1008_2024 | 325 |
| 702 | 3300053134 | Ga0500658_0017085 | Ga0500658_0017085_1009_2025 | 325 |
| 703 | 3300053137 | Ga0500561_0000666 | Ga0500561_0000666_1644_2660 | 325 |
| 704 | 3300053140 | Ga0500573_0011060 | Ga0500573_0011060_2928_3932 | 325 |
| 705 | 3300053153 | Ga0500616_0000495 | Ga0500616_0000495_21541_22542 | 325 |
| 706 | 3300053153 | Ga0500616_0032244 | Ga0500616_0032244_1421_2437 | 325 |
| 707 | 3300053157 | Ga0500624_008844 | Ga0500624_008844_341_1345 | 325 |
| 708 | 3300053739 | Ga0500587_005064 | Ga0500587_005064_322_1338 | 325 |
| 709 | 3300061719 | Ga0466962_0006897 | Ga0466962_0006897_795_1799 | 325 |
| 710 | 3300061719 | Ga0466962_0010113 | Ga0466962_0010113_1343_2347 | 325 |
| 711 | 3300005564 | Ga0070664_100531464 | Ga0070664_1005314641 | 326 |
| 712 | 3300005840 | Ga0068870_10067519 | Ga0068870_100675192 | 326 |
| 713 | 3300006048 | Ga0075363_100001332 | Ga0075363_1000013329 | 326 |
| 714 | 3300006048 | Ga0075363_100175879 | Ga0075363_1001758791 | 326 |
| 715 | 3300009098 | Ga0105245_10293825 | Ga0105245_102938252 | 326 |
| 716 | 3300013306 | Ga0163162_10041447 | Ga0163162_100414474 | 326 |
| 717 | 3300025944 | Ga0207661_10133411 | Ga0207661_101334112 | 326 |
| 718 | 3300026067 | Ga0207678_10006777 | Ga0207678_100067777 | 326 |
| 719 | 3300026142 | Ga0207698_10109210 | Ga0207698_101092102 | 326 |
| 720 | 3300031507 | Ga0307509_10051169 | Ga0307509_100511693 | 326 |
| 721 | 3300031616 | Ga0307508_10142436 | Ga0307508_101424362 | 326 |
| 722 | 3300044683 | Ga0466965_0001958 | Ga0466965_0001958_6095_7102 | 326 |
| 723 | 3300044901 | Ga0466960_0002703 | Ga0466960_0002703_4798_5805 | 326 |
| 724 | 3300046454 | Ga0495592_0064011 | Ga0495592_0064011_1294_2298 | 326 |
| 725 | 3300046462 | Ga0495651_0013761 | Ga0495651_0013761_1065_2069 | 326 |
| 726 | 3300046473 | Ga0495582_0049898 | Ga0495582_0049898_921_1928 | 326 |
| 727 | 3300046477 | Ga0495664_0062036 | Ga0495664_0062036_187_1191 | 326 |
| 728 | 3300046529 | Ga0495652_0000478 | Ga0495652_0000478_6779_7783 | 326 |
| 729 | 3300046533 | Ga0495640_0007509 | Ga0495640_0007509_1168_2175 | 326 |
| 730 | 3300046533 | Ga0495640_0083092 | Ga0495640_0083092_793_1797 | 326 |
| 731 | 3300046642 | Ga0495634_0054241 | Ga0495634_0054241_841_1845 | 326 |
| 732 | 3300046663 | Ga0495635_0039076 | Ga0495635_0039076_1417_2421 | 326 |
| 733 | 3300046679 | Ga0495623_0076761 | Ga0495623_0076761_960_1964 | 326 |
| 734 | 3300046680 | Ga0495646_0006479 | Ga0495646_0006479_5424_6428 | 326 |
| 735 | 3300046809 | Ga0495600_0034379 | Ga0495600_0034379_1666_2670 | 326 |
| 736 | 3300047319 | Ga0495674_0069188 | Ga0495674_0069188_1304_2311 | 326 |
| 737 | 3300048911 | Ga0496108_0010745 | Ga0496108_0010745_4082_5089 | 326 |
| 738 | 3300048912 | Ga0496109_0008180 | Ga0496109_0008180_6751_7758 | 326 |
| 739 | 3300048915 | Ga0496112_0066474 | Ga0496112_0066474_1557_2564 | 326 |
| 740 | 3300048916 | Ga0496113_0028343 | Ga0496113_0028343_197_1204 | 326 |
| 741 | 3300050490 | nmdc:mga03n38_7358_c1 | nmdc:mga03n38_7358_c1_2150_3157 | 326 |
| 742 | 3300050491 | nmdc:mga00v17_29651_c1 | nmdc:mga00v17_29651_c1_95_1102 | 326 |
| 743 | 3300050516 | nmdc:mga0sz30_31789_c1 | nmdc:mga0sz30_31789_c1_21_1028 | 326 |
| 744 | 3300053078 | Ga0495612_0008777 | Ga0495612_0008777_351_1355 | 326 |
| 745 | 3300053085 | Ga0495619_0135766 | Ga0495619_0135766_550_1554 | 326 |
| 746 | 3300053085 | Ga0495619_0152323 | Ga0495619_0152323_92_1096 | 326 |
| 747 | 3300000546 | LJNas_1001384 | LJNas_10013843 | 327 |
| 748 | 3300001977 | JGI24746J21847_1002055 | JGI24746J21847_10020552 | 327 |
| 749 | 3300001989 | JGI24739J22299_10042354 | JGI24739J22299_100423543 | 327 |
| 750 | 3300001990 | JGI24737J22298_10031649 | JGI24737J22298_100316492 | 327 |
| 751 | 3300001991 | JGI24743J22301_10001318 | JGI24743J22301_100013183 | 327 |
| 752 | 3300002073 | JGI24745J21846_1000765 | JGI24745J21846_10007653 | 327 |
| 753 | 3300002073 | JGI24745J21846_1000984 | JGI24745J21846_10009842 | 327 |
| 754 | 3300002074 | JGI24748J21848_1006431 | JGI24748J21848_10064311 | 327 |
| 755 | 3300002077 | JGI24744J21845_10001076 | JGI24744J21845_100010765 | 327 |
| 756 | 3300002239 | JGI24034J26672_10010189 | JGI24034J26672_100101892 | 327 |
| 757 | 3300005327 | Ga0070658_10208076 | Ga0070658_102080762 | 327 |
| 758 | 3300005330 | Ga0070690_100116958 | Ga0070690_1001169582 | 327 |
| 759 | 3300005334 | Ga0068869_100074067 | Ga0068869_1000740673 | 327 |
| 760 | 3300005337 | Ga0070682_100095268 | Ga0070682_1000952681 | 327 |
| 761 | 3300005340 | Ga0070689_100170067 | Ga0070689_1001700671 | 327 |
| 762 | 3300005354 | Ga0070675_100202827 | Ga0070675_1002028272 | 327 |
| 763 | 3300005356 | Ga0070674_100061062 | Ga0070674_1000610623 | 327 |
| 764 | 3300005364 | Ga0070673_100245491 | Ga0070673_1002454911 | 327 |
| 765 | 3300005366 | Ga0070659_100195575 | Ga0070659_1001955752 | 327 |
| 766 | 3300005367 | Ga0070667_100101417 | Ga0070667_1001014171 | 327 |
| 767 | 3300005441 | Ga0070700_100110958 | Ga0070700_1001109582 | 327 |
| 768 | 3300005444 | Ga0070694_100245795 | Ga0070694_1002457951 | 327 |
| 769 | 3300005455 | Ga0070663_100227384 | Ga0070663_1002273842 | 327 |
| 770 | 3300005456 | Ga0070678_100049687 | Ga0070678_1000496871 | 327 |
| 771 | 3300005459 | Ga0068867_100163794 | Ga0068867_1001637942 | 327 |
| 772 | 3300005466 | Ga0070685_10079032 | Ga0070685_100790322 | 327 |
| 773 | 3300005545 | Ga0070695_100297049 | Ga0070695_1002970491 | 327 |
| 774 | 3300005547 | Ga0070693_100235145 | Ga0070693_1002351452 | 327 |
| 775 | 3300005549 | Ga0070704_100133556 | Ga0070704_1001335562 | 327 |
| 776 | 3300005578 | Ga0068854_100069553 | Ga0068854_1000695532 | 327 |
| 777 | 3300005615 | Ga0070702_100030685 | Ga0070702_1000306853 | 327 |
| 778 | 3300005617 | Ga0068859_100130301 | Ga0068859_1001303012 | 327 |
| 779 | 3300005618 | Ga0068864_100036323 | Ga0068864_1000363233 | 327 |
| 780 | 3300005719 | Ga0068861_100076648 | Ga0068861_1000766482 | 327 |
| 781 | 3300005840 | Ga0068870_10037494 | Ga0068870_100374943 | 327 |
| 782 | 3300005841 | Ga0068863_100071447 | Ga0068863_1000714472 | 327 |
| 783 | 3300005842 | Ga0068858_100106930 | Ga0068858_1001069303 | 327 |
| 784 | 3300005842 | Ga0068858_100363881 | Ga0068858_1003638812 | 327 |
| 785 | 3300005843 | Ga0068860_100137333 | Ga0068860_1001373333 | 327 |
| 786 | 3300005844 | Ga0068862_100078615 | Ga0068862_1000786152 | 327 |
| 787 | 3300005844 | Ga0068862_100607825 | Ga0068862_1006078251 | 327 |
| 788 | 3300005937 | Ga0081455_10031783 | Ga0081455_100317834 | 327 |
| 789 | 3300006163 | Ga0070715_10004891 | Ga0070715_100048913 | 327 |
| 790 | 3300006844 | Ga0075428_100002335 | Ga0075428_1000023355 | 327 |
| 791 | 3300006846 | Ga0075430_100026112 | Ga0075430_1000261122 | 327 |
| 792 | 3300006881 | Ga0068865_100083333 | Ga0068865_1000833332 | 327 |
| 793 | 3300006931 | Ga0097620_100130309 | Ga0097620_1001303093 | 327 |
| 794 | 3300007788 | Ga0099795_10032564 | Ga0099795_100325642 | 327 |
| 795 | 3300009098 | Ga0105245_10095034 | Ga0105245_100950342 | 327 |
| 796 | 3300009147 | Ga0114129_10006340 | Ga0114129_100063405 | 327 |
| 797 | 3300009148 | Ga0105243_10313558 | Ga0105243_103135582 | 327 |
| 798 | 3300009176 | Ga0105242_10193803 | Ga0105242_101938031 | 327 |
| 799 | 3300009553 | Ga0105249_10377205 | Ga0105249_103772051 | 327 |
| 800 | 3300010375 | Ga0105239_10210791 | Ga0105239_102107913 | 327 |
| 801 | 3300011119 | Ga0105246_10136270 | Ga0105246_101362702 | 327 |
| 802 | 3300013105 | Ga0157369_10193114 | Ga0157369_101931142 | 327 |
| 803 | 3300013296 | Ga0157374_10252055 | Ga0157374_102520552 | 327 |
| 804 | 3300013306 | Ga0163162_10185644 | Ga0163162_101856442 | 327 |
| 805 | 3300013307 | Ga0157372_10304107 | Ga0157372_103041072 | 327 |
| 806 | 3300013308 | Ga0157375_10304096 | Ga0157375_103040962 | 327 |
| 807 | 3300014325 | Ga0163163_10361280 | Ga0163163_103612802 | 327 |
| 808 | 3300014326 | Ga0157380_10044779 | Ga0157380_100447794 | 327 |
| 809 | 3300014745 | Ga0157377_10038572 | Ga0157377_100385722 | 327 |
| 810 | 3300014968 | Ga0157379_10129161 | Ga0157379_101291612 | 327 |
| 811 | 3300025321 | Ga0207656_10100562 | Ga0207656_101005622 | 327 |
| 812 | 3300025901 | Ga0207688_10041511 | Ga0207688_100415113 | 327 |
| 813 | 3300025901 | Ga0207688_10145964 | Ga0207688_101459642 | 327 |
| 814 | 3300025907 | Ga0207645_10031073 | Ga0207645_100310734 | 327 |
| 815 | 3300025908 | Ga0207643_10008448 | Ga0207643_100084483 | 327 |
| 816 | 3300025909 | Ga0207705_10163159 | Ga0207705_101631592 | 327 |
| 817 | 3300025915 | Ga0207693_10266846 | Ga0207693_102668462 | 327 |
| 818 | 3300025919 | Ga0207657_10062162 | Ga0207657_100621623 | 327 |
| 819 | 3300025926 | Ga0207659_10028255 | Ga0207659_100282552 | 327 |
| 820 | 3300025927 | Ga0207687_10063449 | Ga0207687_100634493 | 327 |
| 821 | 3300025933 | Ga0207706_10284058 | Ga0207706_102840583 | 327 |
| 822 | 3300025936 | Ga0207670_10276531 | Ga0207670_102765311 | 327 |
| 823 | 3300025960 | Ga0207651_10109454 | Ga0207651_101094542 | 327 |
| 824 | 3300025961 | Ga0207712_10210608 | Ga0207712_102106082 | 327 |
| 825 | 3300025961 | Ga0207712_10225569 | Ga0207712_102255692 | 327 |
| 826 | 3300025981 | Ga0207640_10091970 | Ga0207640_100919702 | 327 |
| 827 | 3300025986 | Ga0207658_10030161 | Ga0207658_100301612 | 327 |
| 828 | 3300026023 | Ga0207677_10072049 | Ga0207677_100720492 | 327 |
| 829 | 3300026067 | Ga0207678_10164005 | Ga0207678_101640052 | 327 |
| 830 | 3300026075 | Ga0207708_10088421 | Ga0207708_100884213 | 327 |
| 831 | 3300026089 | Ga0207648_10156802 | Ga0207648_101568022 | 327 |
| 832 | 3300026095 | Ga0207676_10010413 | Ga0207676_100104136 | 327 |
| 833 | 3300026121 | Ga0207683_10214345 | Ga0207683_102143452 | 327 |
| 834 | 3300026121 | Ga0207683_10345990 | Ga0207683_103459902 | 327 |
| 835 | 3300026142 | Ga0207698_10148117 | Ga0207698_101481172 | 327 |
| 836 | 3300026142 | Ga0207698_10619034 | Ga0207698_106190341 | 327 |
| 837 | 3300028379 | Ga0268266_10107051 | Ga0268266_101070513 | 327 |
| 838 | 3300028380 | Ga0268265_10036321 | Ga0268265_100363213 | 327 |
| 839 | 3300035691 | Ga0373931_0106548 | Ga0373931_0106548_433_1440 | 327 |
| 840 | 3300036459 | Ga0372808_010586 | Ga0372808_010586_46_1077 | 327 |
| 841 | 3300046473 | Ga0495582_0088840 | Ga0495582_0088840_145_1152 | 327 |
| 842 | 3300047315 | Ga0495581_0055951 | Ga0495581_0055951_577_1584 | 327 |
| 843 | 3300047321 | Ga0495676_0165950 | Ga0495676_0165950_485_1492 | 327 |
| 844 | 3300048905 | Ga0496102_0042309 | Ga0496102_0042309_1714_2721 | 327 |
| 845 | 3300048906 | Ga0496103_0244184 | Ga0496103_0244184_31_1038 | 327 |
| 846 | 3300048907 | Ga0496104_0034413 | Ga0496104_0034413_1339_2346 | 327 |
| 847 | 3300048908 | Ga0496105_0087609 | Ga0496105_0087609_291_1298 | 327 |
| 848 | 3300048909 | Ga0496106_0192120 | Ga0496106_0192120_238_1245 | 327 |
| 849 | 3300048911 | Ga0496108_0000589 | Ga0496108_0000589_472_1479 | 327 |
| 850 | 3300048912 | Ga0496109_0019238 | Ga0496109_0019238_2706_3713 | 327 |
| 851 | 3300048913 | Ga0496110_0008537 | Ga0496110_0008537_2355_3362 | 327 |
| 852 | 3300048913 | Ga0496110_0211866 | Ga0496110_0211866_68_1075 | 327 |
| 853 | 3300048915 | Ga0496112_0060387 | Ga0496112_0060387_2148_3155 | 327 |
| 854 | 3300050507 | nmdc:mga05p37_13318_c1 | nmdc:mga05p37_13318_c1_4526_5533 | 327 |
| 855 | 3300050509 | nmdc:mga0qj67_18337_c1 | nmdc:mga0qj67_18337_c1_3198_4205 | 327 |
| 856 | iso_pu_bacteria | 2974315732 | 2974318057 | 327 |
| 857 | iso_pu_bacteria | 2984523437 | 2984526275 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hkt-assembly1.cif.gz_D | crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) | 0.9175 | 3 | 322 |
| 3euw-assembly1.cif.gz_B | crystal structure of a myo-inositol dehydrogenase from corynebacterium glutamicum atcc 13032 | 0.9163 | 1 | 322 |
| 4mkx-assembly1.cif.gz_A | crystal structure of apo scyllo-inositol dehydrogenase from lactobacillus casei | 0.9075 | 2 | 323 |
| 3ezy-assembly1.cif.gz_B | crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima | 0.9071 | 4 | 325 |
| 3ezy-assembly1.cif.gz_C | crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima | 0.907 | 4 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hktB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9385 | 3 | 119 | 3.40.50.720 |
| af_X1WHF8_40_206_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9293 | 2 | 36 | 3.50.50.60 |
| af_A0A1D8PPX6_1_125_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9276 | 1 | 116 | 3.40.50.720 |
| 4hktB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9232 | 3 | 119 | 3.40.50.720 |
| 1xeaB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.914 | 2 | 119 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A558HCL1-F1-model_v4 | Dehydrogenase | 0.9727 | 1 | 322 |
GO:0000166
GO:0016491 |
| AF-A0A1Q2CQZ5-F1-model_v4 | Dehydrogenase | 0.9706 | 4 | 327 |
GO:0000166
GO:0016491 |
| AF-K6VRP8-F1-model_v4 | Putative oxidoreductase | 0.9679 | 2 | 326 |
GO:0000166
GO:0016491 |
| AF-K6VRP8-F1-model_v4 | Putative oxidoreductase | 0.9592 | 2 | 326 |
GO:0000166
GO:0016491 |
| AF-A0A1Q2CQZ5-F1-model_v4 | Dehydrogenase | 0.959 | 4 | 327 |
GO:0000166
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar