F483696

General Info

Members Datasets Scaffolds Average Seq Length
857 326 1714 191

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1472361|Ga0436363_1472361_871_1497
Length 208
Sequence VKLGQIKDSSLVILSAVTSSAILQLFLKTGAYLQGHFRLTSGLHSGEYLQCAKVLAFPEYAEFLGQEIAKKIPASGVQVVVSPAIGGIVIGHEVARALKVRSLFAERDASTREMTLRRGFEVKPGERAVVIEDVITTGGSTKEVVRLLQGLGAEVVAAGSIIDRSGGAADVEVPRVALETLNAVTYNPDACPLCQQGIPVVKPGSRPT

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
217 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
218 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
219 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
270 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
271 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
272 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
273 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
274 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
284 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
285 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
286 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
287 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
288 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
289 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
290 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
291 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
292 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
293 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
294 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
295 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
296 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
297 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
298 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
299 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
300 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
301 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
302 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
303 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
304 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
305 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
308 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
309 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
310 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
326 2739367866 Hymenobacter sp. YR204 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 1.4
Rhizosphere 97.43
Stem 0
Stem Tuber 0
Unclassified 29.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1472361 3300039450 Unclassified 1616
2 CNAas_1000674 3300000532 Bacteria 3273
3 JGI24749J21850_1017327 3300002076 Bacteria 1013
4 JGI24751J29686_10000023 3300002459 Bacteria 97529
5 JGI25406J46586_10014833 3300003203 Unclassified 3303
6 JGI26143J51219_1003133 3300003502 Unclassified 754
7 Ga0065714_10064432 3300005288 Bacteria 133542
8 Ga0065712_10067730 3300005290 Bacteria 133482
9 Ga0065712_10123696 3300005290 Unclassified 1635
10 Ga0065715_10031331 3300005293 Bacteria 1353
11 Ga0065715_10100075 3300005293 Unclassified 3339
12 Ga0065715_10121787 3300005293 Unclassified 2221
13 Ga0065715_10185734 3300005293 Unclassified 1435
14 Ga0065715_10251049 3300005293 Bacteria 1167
15 Ga0065715_10393182 3300005293 Unclassified 891
16 Ga0065715_10447176 3300005293 Unclassified 785
17 Ga0065715_10487911 3300005293 Unclassified 791
18 Ga0065707_10002957 3300005295 Bacteria 4680
19 Ga0065707_10139226 3300005295 Unclassified 1795
20 Ga0065707_10457469 3300005295 Bacteria 794
21 Ga0070658_10387144 3300005327 Bacteria 1200
22 Ga0070658_10565625 3300005327 Unclassified 984
23 Ga0070676_10027009 3300005328 Bacteria 3253
24 Ga0070676_10123541 3300005328 Bacteria 1628
25 Ga0070683_100000049 3300005329 Bacteria 93310
26 Ga0070690_100079526 3300005330 Bacteria 2143
27 Ga0070690_100171911 3300005330 Unclassified 1491
28 Ga0070670_100000324 3300005331 Bacteria 40556
29 Ga0070670_100180022 3300005331 Bacteria 1835
30 Ga0070670_100555808 3300005331 Unclassified 1024
31 Ga0070670_100802968 3300005331 Bacteria 850
32 Ga0070677_10055399 3300005333 Bacteria 1618
33 Ga0070677_10233167 3300005333 Unclassified 905
34 Ga0068869_100003254 3300005334 Bacteria 9925
35 Ga0068869_100052330 3300005334 Bacteria 2965
36 Ga0068869_100094368 3300005334 Bacteria 2255
37 Ga0068869_100285710 3300005334 Unclassified 1328
38 Ga0070680_100032700 3300005336 Bacteria 4188
39 Ga0070682_100008637 3300005337 Bacteria 5752
40 Ga0070682_100101249 3300005337 Bacteria 1902
41 Ga0068868_100027093 3300005338 Bacteria 4370
42 Ga0070660_100087326 3300005339 Bacteria 2455
43 Ga0070660_100442413 3300005339 Unclassified 1078
44 Ga0070689_100011673 3300005340 Bacteria 6301
45 Ga0070689_100027432 3300005340 Unclassified 4293
46 Ga0070689_100027477 3300005340 Bacteria 4290
47 Ga0070689_100243944 3300005340 Unclassified 1480
48 Ga0070689_100282558 3300005340 Bacteria 1377
49 Ga0070689_100726742 3300005340 Bacteria 869
50 Ga0070689_100963003 3300005340 Unclassified 758
51 Ga0070691_10500327 3300005341 Unclassified 702
52 Ga0070687_100137190 3300005343 Unclassified 1419
53 Ga0070661_100054282 3300005344 Bacteria 2935
54 Ga0070692_10018538 3300005345 Bacteria 3349
55 Ga0070692_10022138 3300005345 Bacteria 3102
56 Ga0070692_10120201 3300005345 Bacteria 1464
57 Ga0070692_10203427 3300005345 Bacteria 1161
58 Ga0070692_10617741 3300005345 Unclassified 719
59 Ga0070669_100014481 3300005353 Bacteria 5612
60 Ga0070669_100040070 3300005353 Bacteria 3404
61 Ga0070669_100243313 3300005353 Unclassified 1430
62 Ga0070675_100232182 3300005354 Bacteria 1610
63 Ga0070671_100041883 3300005355 Bacteria 3806
64 Ga0070671_100104459 3300005355 Bacteria 2377
65 Ga0070671_100225242 3300005355 Bacteria 1591
66 Ga0070671_100234716 3300005355 Bacteria 1556
67 Ga0070671_100304023 3300005355 Unclassified 1358
68 Ga0070674_100204638 3300005356 Bacteria 1526
69 Ga0070674_100210328 3300005356 Bacteria 1507
70 Ga0070674_100468620 3300005356 Unclassified 1043
71 Ga0070674_100566825 3300005356 Bacteria 955
72 Ga0070674_101118609 3300005356 Bacteria 696
73 Ga0070673_100017320 3300005364 Bacteria 5119
74 Ga0070673_100021714 3300005364 Bacteria 4661
75 Ga0070673_100176477 3300005364 Unclassified 1826
76 Ga0070673_100418495 3300005364 Bacteria 1201
77 Ga0070673_100778272 3300005364 Unclassified 882
78 Ga0070688_100086129 3300005365 Bacteria 2043
79 Ga0070659_100239808 3300005366 Bacteria 1500
80 Ga0070659_100733680 3300005366 Bacteria 856
81 Ga0070714_100028604 3300005435 Bacteria 4627
82 Ga0070714_101158617 3300005435 Bacteria 754
83 Ga0070701_10040901 3300005438 Bacteria 2359
84 Ga0070701_10084921 3300005438 Bacteria 1722
85 Ga0070701_10150515 3300005438 Unclassified 1339
86 Ga0070701_10205141 3300005438 Unclassified 1167
87 Ga0070701_10468147 3300005438 Bacteria 812
88 Ga0070705_100063400 3300005440 Bacteria 2204
89 Ga0070705_100091119 3300005440 Bacteria 1899
90 Ga0070705_100602788 3300005440 Unclassified 850
91 Ga0070705_100672283 3300005440 Unclassified 810
92 Ga0070705_100735190 3300005440 Unclassified 779
93 Ga0070700_100000042 3300005441 Bacteria 99515
94 Ga0070700_100007847 3300005441 Bacteria 5788
95 Ga0070700_100008567 3300005441 Bacteria 5570
96 Ga0070700_100169994 3300005441 Unclassified 1509
97 Ga0070700_100192856 3300005441 Bacteria 1426
98 Ga0070700_100221369 3300005441 Bacteria 1341
99 Ga0070700_100810066 3300005441 Bacteria 755
100 Ga0070694_100007222 3300005444 Bacteria 6765
101 Ga0070694_100210089 3300005444 Bacteria 1455
102 Ga0070694_100218003 3300005444 Bacteria 1430
103 Ga0070694_100222726 3300005444 Unclassified 1416
104 Ga0070694_100587471 3300005444 Bacteria 896
105 Ga0070694_100904374 3300005444 Unclassified 729
106 Ga0070708_100477641 3300005445 Bacteria 1176
107 Ga0070678_100167982 3300005456 Bacteria 1784
108 Ga0070662_100083098 3300005457 Bacteria 2389
109 Ga0070662_100914117 3300005457 Unclassified 749
110 Ga0070681_10004835 3300005458 Bacteria 12910
111 Ga0070681_10012618 3300005458 Bacteria 8383
112 Ga0070681_10238495 3300005458 Unclassified 1732
113 Ga0070681_11286305 3300005458 Bacteria 654
114 Ga0068867_100003348 3300005459 Bacteria 11289
115 Ga0068867_100107069 3300005459 Unclassified 2142
116 Ga0068867_100304488 3300005459 Bacteria 1315
117 Ga0068867_100307531 3300005459 Unclassified 1309
118 Ga0070685_10105037 3300005466 Bacteria 1731
119 Ga0070685_10817956 3300005466 Unclassified 688
120 Ga0070706_100000480 3300005467 Bacteria 47075
121 Ga0070706_100004115 3300005467 Bacteria 14151
122 Ga0070707_100246377 3300005468 Bacteria 1739
123 Ga0070698_100040712 3300005471 Bacteria 4774
124 Ga0070698_100045289 3300005471 Bacteria 4503
125 Ga0070698_100124135 3300005471 Unclassified 2539
126 Ga0070698_100798276 3300005471 Unclassified 888
127 Ga0070699_100002826 3300005518 Bacteria 15494
128 Ga0070699_100013038 3300005518 Bacteria 7163
129 Ga0070699_100089628 3300005518 Bacteria 2688
130 Ga0070699_100238296 3300005518 Bacteria 1623
131 Ga0070699_100394154 3300005518 Bacteria 1251
132 Ga0070699_100749426 3300005518 Bacteria 893
133 Ga0070679_100145625 3300005530 Bacteria 2347
134 Ga0070679_100216611 3300005530 Unclassified 1877
135 Ga0070684_100798446 3300005535 Unclassified 882
136 Ga0070684_101221740 3300005535 Unclassified 707
137 Ga0070697_100002092 3300005536 Bacteria 15271
138 Ga0070697_100605110 3300005536 Bacteria 963
139 Ga0068853_100011334 3300005539 Bacteria 7240
140 Ga0068853_100810990 3300005539 Unclassified 896
141 Ga0070672_100025282 3300005543 Unclassified 4401
142 Ga0070672_100085642 3300005543 Bacteria 2533
143 Ga0070672_100766123 3300005543 Bacteria 848
144 Ga0070686_100011993 3300005544 Unclassified 4928
145 Ga0070686_100022711 3300005544 Bacteria 3740
146 Ga0070695_100157973 3300005545 Bacteria 1589
147 Ga0070695_100361549 3300005545 Unclassified 1090
148 Ga0070696_100009805 3300005546 Bacteria 6406
149 Ga0070696_100017946 3300005546 Bacteria 4779
150 Ga0070696_100161336 3300005546 Bacteria 1652
151 Ga0070696_100197066 3300005546 Unclassified 1502
152 Ga0070696_100246898 3300005546 Bacteria 1348
153 Ga0070696_100351331 3300005546 Bacteria 1142
154 Ga0070696_100597282 3300005546 Unclassified 889
155 Ga0070696_100824637 3300005546 Unclassified 765
156 Ga0070693_100000402 3300005547 Bacteria 19643
157 Ga0070693_100014015 3300005547 Bacteria 4095
158 Ga0070693_100715137 3300005547 Bacteria 735
159 Ga0070693_100723639 3300005547 Unclassified 731
160 Ga0070665_100380434 3300005548 Bacteria 1419
161 Ga0070704_100271634 3300005549 Bacteria 1401
162 Ga0070704_100420784 3300005549 Bacteria 1144
163 Ga0070704_100569847 3300005549 Bacteria 991
164 Ga0070704_100785528 3300005549 Bacteria 850
165 Ga0068855_100244418 3300005563 Bacteria 2004
166 Ga0068855_100362306 3300005563 Unclassified 1595
167 Ga0068855_100543156 3300005563 Bacteria 1259
168 Ga0070664_100025594 3300005564 Unclassified 4893
169 Ga0070664_100157169 3300005564 Bacteria 2009
170 Ga0070664_100175967 3300005564 Bacteria 1900
171 Ga0070664_100388068 3300005564 Bacteria 1276
172 Ga0070664_101205559 3300005564 Unclassified 714
173 Ga0068857_100002908 3300005577 Bacteria 14112
174 Ga0068857_100275760 3300005577 Unclassified 1546
175 Ga0068857_100300568 3300005577 Bacteria 1479
176 Ga0068857_100348267 3300005577 Unclassified 1371
177 Ga0068854_100065434 3300005578 Bacteria 2643
178 Ga0068854_100190193 3300005578 Unclassified 1608
179 Ga0068854_100214561 3300005578 Unclassified 1520
180 Ga0068856_100499637 3300005614 Unclassified 1237
181 Ga0068856_100758793 3300005614 Bacteria 990
182 Ga0070702_100121770 3300005615 Bacteria 1634
183 Ga0070702_100195789 3300005615 Unclassified 1334
184 Ga0070702_100371833 3300005615 Bacteria 1013
185 Ga0068852_100776519 3300005616 Unclassified 971
186 Ga0068859_100041310 3300005617 Bacteria 4632
187 Ga0068859_100047427 3300005617 Bacteria 4316
188 Ga0068859_100057602 3300005617 Bacteria 3914
189 Ga0068859_100059419 3300005617 Bacteria 3851
190 Ga0068859_100158857 3300005617 Bacteria 2339
191 Ga0068859_100272047 3300005617 Unclassified 1786
192 Ga0068859_100295990 3300005617 Bacteria 1711
193 Ga0068859_100442786 3300005617 Bacteria 1395
194 Ga0068859_100541769 3300005617 Bacteria 1258
195 Ga0068859_100632463 3300005617 Unclassified 1163
196 Ga0068859_100754633 3300005617 Bacteria 1062
197 Ga0068859_101011296 3300005617 Unclassified 913
198 Ga0068859_101154476 3300005617 Unclassified 853
199 Ga0068859_101219473 3300005617 Bacteria 829
200 Ga0068864_100003467 3300005618 Bacteria 13027
201 Ga0068864_100033289 3300005618 Bacteria 4381
202 Ga0068864_100056051 3300005618 Bacteria 3405
203 Ga0068864_100086157 3300005618 Bacteria 2763
204 Ga0068864_100107851 3300005618 Bacteria 2478
205 Ga0068864_100236543 3300005618 Bacteria 1691
206 Ga0068864_100311369 3300005618 Unclassified 1476
207 Ga0068864_100558243 3300005618 Bacteria 1107
208 Ga0068864_100669693 3300005618 Bacteria 1012
209 Ga0068864_100722005 3300005618 Bacteria 975
210 Ga0068864_101025665 3300005618 Bacteria 819
211 Ga0068866_10030747 3300005718 Bacteria 2580
212 Ga0068861_100011357 3300005719 Bacteria 6187
213 Ga0068861_100031108 3300005719 Bacteria 3917
214 Ga0068861_100178896 3300005719 Bacteria 1764
215 Ga0068861_101458992 3300005719 Unclassified 670
216 Ga0068870_10015961 3300005840 Bacteria 3577
217 Ga0068870_10031416 3300005840 Bacteria 2691
218 Ga0068870_10057483 3300005840 Bacteria 2079
219 Ga0068870_10099471 3300005840 Bacteria 1641
220 Ga0068870_10343172 3300005840 Bacteria 956
221 Ga0068863_100047941 3300005841 Unclassified 4051
222 Ga0068863_100050680 3300005841 Bacteria 3934
223 Ga0068863_100072922 3300005841 Unclassified 3248
224 Ga0068863_100148358 3300005841 Bacteria 2244
225 Ga0068863_100296654 3300005841 Bacteria 1567
226 Ga0068863_100440515 3300005841 Unclassified 1278
227 Ga0068863_100577168 3300005841 Bacteria 1112
228 Ga0068863_100814421 3300005841 Unclassified 932
229 Ga0068858_100033656 3300005842 Unclassified 4753
230 Ga0068858_100038439 3300005842 Unclassified 4439
231 Ga0068858_100074702 3300005842 Bacteria 3148
232 Ga0068858_100247598 3300005842 Unclassified 1692
233 Ga0068858_100259811 3300005842 Bacteria 1650
234 Ga0068858_100522770 3300005842 Bacteria 1148
235 Ga0068860_100050177 3300005843 Unclassified 3973
236 Ga0068860_100074230 3300005843 Unclassified 3234
237 Ga0068860_100105920 3300005843 Bacteria 2685
238 Ga0068860_100113607 3300005843 Bacteria 2589
239 Ga0068860_100220328 3300005843 Bacteria 1842
240 Ga0068860_100255730 3300005843 Bacteria 1706
241 Ga0068860_100266308 3300005843 Bacteria 1671
242 Ga0068860_100482496 3300005843 Unclassified 1236
243 Ga0068862_100029204 3300005844 Unclassified 4645
244 Ga0068862_100122364 3300005844 Bacteria 2295
245 Ga0068862_100552675 3300005844 Bacteria 1099
246 Ga0068862_101391780 3300005844 Bacteria 705
247 Ga0081539_10000395 3300005985 Bacteria 93818
248 Ga0081539_10003972 3300005985 Bacteria 17099
249 Ga0070717_10005114 3300006028 Bacteria 9569
250 Ga0097621_100005127 3300006237 Bacteria 9204
251 Ga0097621_100007032 3300006237 Bacteria 8016
252 Ga0097621_100011502 3300006237 Bacteria 6520
253 Ga0097621_100062212 3300006237 Bacteria 3064
254 Ga0097621_100103789 3300006237 Bacteria 2395
255 Ga0097621_100712539 3300006237 Unclassified 925
256 Ga0097621_100810621 3300006237 Bacteria 868
257 Ga0068871_100001848 3300006358 Bacteria 14311
258 Ga0068871_100019407 3300006358 Bacteria 5190
259 Ga0068871_100307594 3300006358 Bacteria 1393
260 Ga0068871_100355326 3300006358 Bacteria 1297
261 Ga0075428_100000005 3300006844 Bacteria 326130
262 Ga0075428_100023016 3300006844 Bacteria 6895
263 Ga0075428_100200086 3300006844 Bacteria 2160
264 Ga0075428_100712071 3300006844 Unclassified 1069
265 Ga0075428_101465039 3300006844 Bacteria 716
266 Ga0075430_100018829 3300006846 Bacteria 5873
267 Ga0075430_100102245 3300006846 Bacteria 2392
268 Ga0075431_100113586 3300006847 Bacteria 2796
269 Ga0075431_100121061 3300006847 Bacteria 2700
270 Ga0075433_10011090 3300006852 Bacteria 7248
271 Ga0075433_10017396 3300006852 Bacteria 5953
272 Ga0075433_10055957 3300006852 Bacteria 3445
273 Ga0075433_10149512 3300006852 Unclassified 2077
274 Ga0075433_10304639 3300006852 Bacteria 1411
275 Ga0075433_10446298 3300006852 Bacteria 1140
276 Ga0075434_100130601 3300006871 Bacteria 2531
277 Ga0075434_100361829 3300006871 Bacteria 1472
278 Ga0075434_100544209 3300006871 Unclassified 1181
279 Ga0075434_101110888 3300006871 Unclassified 804
280 Ga0075429_100143689 3300006880 Bacteria 2088
281 Ga0075429_100164633 3300006880 Bacteria 1943
282 Ga0075429_100252538 3300006880 Bacteria 1544
283 Ga0068865_100012490 3300006881 Bacteria 5346
284 Ga0068865_100108352 3300006881 Bacteria 2045
285 Ga0075436_100057046 3300006914 Bacteria 2697
286 Ga0075436_100381594 3300006914 Bacteria 1019
287 Ga0097620_100041307 3300006931 Bacteria 4632
288 Ga0097620_100047428 3300006931 Bacteria 4316
289 Ga0097620_100057603 3300006931 Bacteria 3914
290 Ga0097620_100059419 3300006931 Bacteria 3851
291 Ga0097620_100158846 3300006931 Bacteria 2339
292 Ga0097620_100272035 3300006931 Unclassified 1786
293 Ga0097620_100295988 3300006931 Bacteria 1711
294 Ga0097620_100442759 3300006931 Bacteria 1395
295 Ga0097620_100541769 3300006931 Bacteria 1258
296 Ga0097620_100632460 3300006931 Unclassified 1163
297 Ga0097620_100754439 3300006931 Bacteria 1062
298 Ga0097620_101011248 3300006931 Unclassified 913
299 Ga0097620_101154469 3300006931 Unclassified 853
300 Ga0097620_101219408 3300006931 Bacteria 829
301 Ga0075435_100095799 3300007076 Bacteria 2455
302 Ga0075435_100227399 3300007076 Unclassified 1585
303 Ga0105251_10143599 3300009011 Unclassified 1080
304 Ga0105240_10033317 3300009093 Bacteria 6658
305 Ga0105240_10235101 3300009093 Bacteria 2127
306 Ga0105240_10554141 3300009093 Unclassified 1271
307 Ga0105240_11017638 3300009093 Bacteria 885
308 Ga0111539_10000008 3300009094 Bacteria 382609
309 Ga0111539_10000296 3300009094 Bacteria 60206
310 Ga0111539_10011429 3300009094 Bacteria 11144
311 Ga0111539_10081498 3300009094 Unclassified 3806
312 Ga0111539_10241896 3300009094 Bacteria 2101
313 Ga0105245_10388314 3300009098 Unclassified 1392
314 Ga0105245_10982530 3300009098 Unclassified 888
315 Ga0105245_11086035 3300009098 Unclassified 846
316 Ga0105247_10000635 3300009101 Bacteria 28087
317 Ga0105247_10049986 3300009101 Bacteria 2572
318 Ga0105247_10192937 3300009101 Bacteria 1365
319 Ga0114129_10033107 3300009147 Bacteria 7304
320 Ga0114129_10087466 3300009147 Bacteria 4321
321 Ga0114129_10110163 3300009147 Unclassified 3801
322 Ga0114129_10212214 3300009147 Bacteria 2616
323 Ga0114129_10255583 3300009147 Unclassified 2350
324 Ga0114129_10345850 3300009147 Bacteria 1971
325 Ga0114129_10520464 3300009147 Bacteria 1551
326 Ga0114129_10542574 3300009147 Unclassified 1513
327 Ga0114129_10700134 3300009147 Bacteria 1302
328 Ga0114129_10762196 3300009147 Bacteria 1238
329 Ga0114129_10887549 3300009147 Bacteria 1131
330 Ga0114129_10986819 3300009147 Bacteria 1062
331 Ga0114129_11051584 3300009147 Bacteria 1022
332 Ga0105243_10072678 3300009148 Bacteria 2785
333 Ga0105243_10207229 3300009148 Unclassified 1724
334 Ga0105243_10306799 3300009148 Bacteria 1441
335 Ga0105243_10916661 3300009148 Bacteria 873
336 Ga0105243_10965942 3300009148 Bacteria 852
337 Ga0105243_11255018 3300009148 Bacteria 756
338 Ga0105243_11306423 3300009148 Unclassified 743
339 Ga0105243_11472731 3300009148 Unclassified 704
340 Ga0105241_10030898 3300009174 Bacteria 4006
341 Ga0105241_10260096 3300009174 Bacteria 1475
342 Ga0105241_10363570 3300009174 Bacteria 1260
343 Ga0105241_10457433 3300009174 Bacteria 1130
344 Ga0105241_10570045 3300009174 Bacteria 1019
345 Ga0105241_10720048 3300009174 Unclassified 912
346 Ga0105241_10953702 3300009174 Bacteria 800
347 Ga0105242_10010982 3300009176 Bacteria 6956
348 Ga0105242_10090605 3300009176 Bacteria 2573
349 Ga0105242_10753368 3300009176 Unclassified 959
350 Ga0105248_10005991 3300009177 Bacteria 13347
351 Ga0105248_10019085 3300009177 Bacteria 7582
352 Ga0105248_10030093 3300009177 Bacteria 6059
353 Ga0105248_10156156 3300009177 Unclassified 2575
354 Ga0105248_10261700 3300009177 Bacteria 1947
355 Ga0105248_10264910 3300009177 Bacteria 1935
356 Ga0105248_10301738 3300009177 Bacteria 1803
357 Ga0105248_10351207 3300009177 Bacteria 1660
358 Ga0105248_10641958 3300009177 Bacteria 1198
359 Ga0105248_11227051 3300009177 Bacteria 848
360 Ga0105248_11246593 3300009177 Bacteria 841
361 Ga0105248_11462002 3300009177 Bacteria 773
362 Ga0105237_10003124 3300009545 Bacteria 19932
363 Ga0105237_10042090 3300009545 Unclassified 4606
364 Ga0105238_10004387 3300009551 Bacteria 13993
365 Ga0105238_10104245 3300009551 Bacteria 2817
366 Ga0105238_10128368 3300009551 Bacteria 2514
367 Ga0105238_11082237 3300009551 Unclassified 824
368 Ga0105238_11654762 3300009551 Unclassified 671
369 Ga0105249_10262291 3300009553 Bacteria 1717
370 Ga0105249_10309965 3300009553 Bacteria 1586
371 Ga0105249_10508827 3300009553 Unclassified 1250
372 Ga0105249_11226261 3300009553 Unclassified 821
373 Ga0105249_11885498 3300009553 Unclassified 670
374 Ga0105239_10058566 3300010375 Unclassified 4227
375 Ga0105239_10327155 3300010375 Bacteria 1729
376 Ga0105239_10734793 3300010375 Bacteria 1129
377 Ga0105246_10009378 3300011119 Bacteria 6029
378 Ga0105246_10577735 3300011119 Unclassified 968
379 Ga0105246_10820279 3300011119 Bacteria 827
380 Ga0105246_11024316 3300011119 Bacteria 749
381 Ga0157373_10002544 3300013100 Bacteria 13886
382 Ga0157373_10035422 3300013100 Bacteria 3583
383 Ga0157373_10444647 3300013100 Unclassified 932
384 Ga0157371_10093967 3300013102 Unclassified 2125
385 Ga0157371_10840685 3300013102 Unclassified 694
386 Ga0157369_10217396 3300013105 Bacteria 2001
387 Ga0157369_10356752 3300013105 Bacteria 1518
388 Ga0157374_10096087 3300013296 Bacteria 2834
389 Ga0157374_10367840 3300013296 Bacteria 1431
390 Ga0157374_10904502 3300013296 Bacteria 900
391 Ga0157378_10006269 3300013297 Bacteria 10412
392 Ga0157378_10021443 3300013297 Bacteria 5681
393 Ga0157378_10295210 3300013297 Bacteria 1567
394 Ga0157378_10809448 3300013297 Bacteria 963
395 Ga0163162_10012363 3300013306 Bacteria 8335
396 Ga0163162_10021338 3300013306 Bacteria 6377
397 Ga0163162_10028788 3300013306 Bacteria 5499
398 Ga0163162_10086569 3300013306 Unclassified 3211
399 Ga0163162_10148758 3300013306 Bacteria 2459
400 Ga0163162_10164738 3300013306 Bacteria 2340
401 Ga0163162_10196005 3300013306 Bacteria 2149
402 Ga0163162_11122967 3300013306 Bacteria 891
403 Ga0163162_11289070 3300013306 Bacteria 830
404 Ga0157372_10305288 3300013307 Bacteria 1852
405 Ga0157372_10470037 3300013307 Unclassified 1466
406 Ga0157372_10516606 3300013307 Bacteria 1392
407 Ga0157372_10556336 3300013307 Bacteria 1337
408 Ga0157372_10715772 3300013307 Bacteria 1165
409 Ga0157375_10024070 3300013308 Bacteria 5630
410 Ga0157375_10032881 3300013308 Bacteria 4923
411 Ga0157375_10309097 3300013308 Unclassified 1745
412 Ga0157375_10571728 3300013308 Unclassified 1291
413 Ga0157375_10888647 3300013308 Bacteria 1035
414 Ga0157375_11172318 3300013308 Bacteria 901
415 Ga0157375_11390214 3300013308 Unclassified 827
416 Ga0163163_10002165 3300014325 Bacteria 16602
417 Ga0163163_10013625 3300014325 Bacteria 7445
418 Ga0163163_10049856 3300014325 Unclassified 4121
419 Ga0163163_10239451 3300014325 Bacteria 1864
420 Ga0163163_10261649 3300014325 Bacteria 1781
421 Ga0163163_10471618 3300014325 Unclassified 1316
422 Ga0163163_10607984 3300014325 Bacteria 1156
423 Ga0163163_10976793 3300014325 Bacteria 910
424 Ga0157380_10015020 3300014326 Bacteria 5681
425 Ga0157380_10176013 3300014326 Bacteria 1875
426 Ga0157380_10416716 3300014326 Bacteria 1280
427 Ga0157377_10007824 3300014745 Bacteria 5179
428 Ga0157379_10079047 3300014968 Bacteria 2946
429 Ga0157379_10167018 3300014968 Bacteria 1986
430 Ga0157379_10362224 3300014968 Bacteria 1329
431 Ga0157379_10630698 3300014968 Unclassified 1002
432 Ga0157376_10049234 3300014969 Bacteria 3489
433 Ga0157376_10231965 3300014969 Bacteria 1715
434 Ga0157376_10273948 3300014969 Bacteria 1587
435 Ga0157376_10441515 3300014969 Unclassified 1267
436 Ga0157376_10802684 3300014969 Bacteria 954
437 Ga0163161_10014405 3300017792 Bacteria 5506
438 Ga0163161_10131957 3300017792 Unclassified 1885
439 Ga0163161_10354872 3300017792 Unclassified 1166
440 Ga0163161_10437857 3300017792 Bacteria 1055
441 Ga0213874_10047563 3300021377 Bacteria 1306
442 Ga0213876_10008368 3300021384 Bacteria 5598
443 Ga0209455_1004878 3300025272 Bacteria 4270
444 Ga0207653_10064092 3300025885 Bacteria 1245
445 Ga0207653_10172840 3300025885 Bacteria 805
446 Ga0207710_10001176 3300025900 Bacteria 13294
447 Ga0207710_10190953 3300025900 Bacteria 1008
448 Ga0207680_10632292 3300025903 Unclassified 766
449 Ga0207647_10000445 3300025904 Bacteria 33611
450 Ga0207647_10298592 3300025904 Bacteria 917
451 Ga0207645_10028136 3300025907 Bacteria 3630
452 Ga0207645_10119972 3300025907 Bacteria 1707
453 Ga0207643_10001352 3300025908 Bacteria 14172
454 Ga0207643_10013247 3300025908 Bacteria 4463
455 Ga0207643_10036221 3300025908 Bacteria 2766
456 Ga0207643_10064465 3300025908 Bacteria 2097
457 Ga0207643_10202536 3300025908 Bacteria 1209
458 Ga0207684_10000533 3300025910 Bacteria 47088
459 Ga0207684_10003673 3300025910 Bacteria 14881
460 Ga0207654_10059672 3300025911 Bacteria 2226
461 Ga0207654_10378505 3300025911 Unclassified 980
462 Ga0207654_10820222 3300025911 Unclassified 672
463 Ga0207707_10023298 3300025912 Bacteria 5418
464 Ga0207707_10549302 3300025912 Unclassified 981
465 Ga0207707_10889786 3300025912 Bacteria 737
466 Ga0207707_10917944 3300025912 Bacteria 723
467 Ga0207695_10058106 3300025913 Bacteria 4016
468 Ga0207695_10343027 3300025913 Bacteria 1381
469 Ga0207695_10573449 3300025913 Bacteria 1010
470 Ga0207695_10592542 3300025913 Unclassified 990
471 Ga0207671_10087816 3300025914 Bacteria 2339
472 Ga0207671_10235305 3300025914 Bacteria 1438
473 Ga0207663_10038770 3300025916 Bacteria 2883
474 Ga0207660_10089014 3300025917 Bacteria 2284
475 Ga0207660_10110132 3300025917 Unclassified 2071
476 Ga0207662_10007106 3300025918 Bacteria 6082
477 Ga0207662_10017703 3300025918 Bacteria 4033
478 Ga0207662_10117514 3300025918 Bacteria 1664
479 Ga0207662_10185891 3300025918 Bacteria 1339
480 Ga0207649_10036982 3300025920 Bacteria 2945
481 Ga0207649_10236841 3300025920 Bacteria 1308
482 Ga0207652_10291676 3300025921 Bacteria 1472
483 Ga0207646_10153530 3300025922 Bacteria 2076
484 Ga0207681_10039590 3300025923 Bacteria 3131
485 Ga0207681_10057414 3300025923 Bacteria 2660
486 Ga0207681_10278028 3300025923 Unclassified 1317
487 Ga0207681_10359781 3300025923 Unclassified 1167
488 Ga0207681_10793828 3300025923 Unclassified 791
489 Ga0207694_10004561 3300025924 Bacteria 10801
490 Ga0207694_10232774 3300025924 Bacteria 1505
491 Ga0207694_10544966 3300025924 Bacteria 973
492 Ga0207650_10000112 3300025925 Bacteria 106714
493 Ga0207650_10160890 3300025925 Bacteria 1779
494 Ga0207650_10463467 3300025925 Bacteria 1056
495 Ga0207659_10106640 3300025926 Bacteria 2122
496 Ga0207659_10582740 3300025926 Unclassified 953
497 Ga0207659_11068451 3300025926 Unclassified 695
498 Ga0207687_11267516 3300025927 Unclassified 634
499 Ga0207644_10007284 3300025931 Bacteria 7201
500 Ga0207644_10070744 3300025931 Bacteria 2551
501 Ga0207644_10394374 3300025931 Bacteria 1130
502 Ga0207644_10794844 3300025931 Unclassified 791
503 Ga0207690_10032470 3300025932 Bacteria 3350
504 Ga0207690_11234698 3300025932 Unclassified 624
505 Ga0207706_10010103 3300025933 Bacteria 8644
506 Ga0207706_10655378 3300025933 Bacteria 899
507 Ga0207686_10058638 3300025934 Bacteria 2428
508 Ga0207686_10133025 3300025934 Bacteria 1708
509 Ga0207709_10005963 3300025935 Bacteria 6871
510 Ga0207709_10009898 3300025935 Bacteria 5250
511 Ga0207709_10062497 3300025935 Bacteria 2331
512 Ga0207709_10671547 3300025935 Bacteria 827
513 Ga0207709_11055027 3300025935 Bacteria 666
514 Ga0207709_11087872 3300025935 Unclassified 656
515 Ga0207670_10000957 3300025936 Bacteria 15223
516 Ga0207670_10032374 3300025936 Bacteria 3362
517 Ga0207670_10089005 3300025936 Bacteria 2178
518 Ga0207670_10716294 3300025936 Unclassified 829
519 Ga0207670_10800478 3300025936 Unclassified 785
520 Ga0207669_10803261 3300025937 Unclassified 780
521 Ga0207704_10023212 3300025938 Bacteria 3339
522 Ga0207704_10055590 3300025938 Bacteria 2420
523 Ga0207704_10160884 3300025938 Unclassified 1597
524 Ga0207691_10001111 3300025940 Bacteria 26785
525 Ga0207691_10146502 3300025940 Bacteria 2079
526 Ga0207691_10215174 3300025940 Unclassified 1668
527 Ga0207711_10007996 3300025941 Bacteria 8848
528 Ga0207711_10023901 3300025941 Bacteria 5115
529 Ga0207711_10119806 3300025941 Unclassified 2348
530 Ga0207711_10571546 3300025941 Bacteria 1054
531 Ga0207711_11125154 3300025941 Bacteria 726
532 Ga0207689_10007769 3300025942 Bacteria 9384
533 Ga0207689_10025774 3300025942 Bacteria 4926
534 Ga0207689_10064726 3300025942 Bacteria 3007
535 Ga0207689_10167071 3300025942 Bacteria 1813
536 Ga0207679_10030908 3300025945 Bacteria 3744
537 Ga0207679_10245404 3300025945 Bacteria 1520
538 Ga0207679_10646701 3300025945 Unclassified 956
539 Ga0207679_10761561 3300025945 Bacteria 881
540 Ga0207667_10309137 3300025949 Unclassified 1615
541 Ga0207667_10492617 3300025949 Bacteria 1244
542 Ga0207651_10111153 3300025960 Bacteria 2057
543 Ga0207651_10160424 3300025960 Bacteria 1762
544 Ga0207651_10229712 3300025960 Unclassified 1505
545 Ga0207651_10573349 3300025960 Unclassified 984
546 Ga0207712_10007304 3300025961 Bacteria 6971
547 Ga0207712_10011262 3300025961 Bacteria 5695
548 Ga0207640_10091003 3300025981 Unclassified 2113
549 Ga0207640_10181230 3300025981 Bacteria 1579
550 Ga0207640_10462111 3300025981 Bacteria 1048
551 Ga0207658_10277371 3300025986 Unclassified 1436
552 Ga0207677_10130313 3300026023 Unclassified 1908
553 Ga0207677_11203267 3300026023 Bacteria 694
554 Ga0207703_10023842 3300026035 Unclassified 4812
555 Ga0207703_10064235 3300026035 Bacteria 3012
556 Ga0207703_10123140 3300026035 Bacteria 2229
557 Ga0207703_10169600 3300026035 Bacteria 1918
558 Ga0207703_10209192 3300026035 Unclassified 1738
559 Ga0207703_10903207 3300026035 Bacteria 846
560 Ga0207639_10014327 3300026041 Bacteria 5574
561 Ga0207639_11254603 3300026041 Unclassified 695
562 Ga0207708_10000074 3300026075 Bacteria 79215
563 Ga0207708_10005201 3300026075 Bacteria 9594
564 Ga0207708_10030970 3300026075 Bacteria 4060
565 Ga0207708_10112728 3300026075 Bacteria 2112
566 Ga0207708_10258485 3300026075 Bacteria 1405
567 Ga0207708_10545479 3300026075 Unclassified 977
568 Ga0207708_10849002 3300026075 Unclassified 788
569 Ga0207702_10393618 3300026078 Unclassified 1335
570 Ga0207641_10017575 3300026088 Bacteria 5855
571 Ga0207641_10027580 3300026088 Bacteria 4691
572 Ga0207641_10029218 3300026088 Bacteria 4558
573 Ga0207641_10104130 3300026088 Bacteria 2505
574 Ga0207641_10120209 3300026088 Bacteria 2343
575 Ga0207641_10217080 3300026088 Bacteria 1772
576 Ga0207641_10239560 3300026088 Bacteria 1690
577 Ga0207641_10289323 3300026088 Unclassified 1544
578 Ga0207641_10429838 3300026088 Bacteria 1273
579 Ga0207648_10005481 3300026089 Bacteria 12788
580 Ga0207648_10055692 3300026089 Unclassified 3451
581 Ga0207648_10069594 3300026089 Bacteria 3066
582 Ga0207648_10086829 3300026089 Unclassified 2729
583 Ga0207648_10153051 3300026089 Bacteria 2035
584 Ga0207648_10233480 3300026089 Bacteria 1636
585 Ga0207648_10400948 3300026089 Bacteria 1243
586 Ga0207676_10002972 3300026095 Bacteria 12095
587 Ga0207676_10141770 3300026095 Bacteria 2058
588 Ga0207676_10387513 3300026095 Bacteria 1303
589 Ga0207676_10439810 3300026095 Bacteria 1227
590 Ga0207676_10588524 3300026095 Bacteria 1067
591 Ga0207676_10682231 3300026095 Unclassified 994
592 Ga0207674_10004656 3300026116 Bacteria 16464
593 Ga0207674_10075626 3300026116 Bacteria 3377
594 Ga0207674_10146093 3300026116 Bacteria 2323
595 Ga0207674_10232027 3300026116 Bacteria 1793
596 Ga0207674_10473086 3300026116 Unclassified 1211
597 Ga0207674_10671372 3300026116 Bacteria 1001
598 Ga0207675_100013059 3300026118 Bacteria 7751
599 Ga0207675_100088148 3300026118 Unclassified 2915
600 Ga0207675_100098816 3300026118 Bacteria 2749
601 Ga0207675_100158606 3300026118 Bacteria 2157
602 Ga0207675_100348180 3300026118 Unclassified 1452
603 Ga0207675_100372176 3300026118 Bacteria 1403
604 Ga0207675_100949669 3300026118 Unclassified 877
605 Ga0207683_10207617 3300026121 Bacteria 1782
606 Ga0207683_10297668 3300026121 Bacteria 1476
607 Ga0207698_10402321 3300026142 Bacteria 1309
608 Ga0207698_10791867 3300026142 Unclassified 950
609 Ga0209970_1035874 3300027614 Unclassified 872
610 Ga0209983_1004828 3300027665 Bacteria 2814
611 Ga0207428_10000019 3300027907 Bacteria 276945
612 Ga0207428_10037183 3300027907 Bacteria 3963
613 Ga0207428_10046498 3300027907 Bacteria 3490
614 Ga0268265_10219121 3300028380 Bacteria 1664
615 Ga0268265_10649961 3300028380 Unclassified 1013
616 Ga0268265_10816311 3300028380 Bacteria 910
617 Ga0268265_10956974 3300028380 Bacteria 844
618 Ga0268264_10057234 3300028381 Unclassified 3261
619 Ga0268264_10177548 3300028381 Bacteria 1931
620 Ga0268264_10820378 3300028381 Bacteria 930
621 Ga0268264_10920967 3300028381 Unclassified 878
622 Ga0265323_10000323 3300028653 Bacteria 27404
623 Ga0265336_10023629 3300028666 Bacteria 1948
624 Ga0265330_10128302 3300031235 Bacteria 1080
625 Ga0265332_10140877 3300031238 Unclassified 1010
626 Ga0265332_10156065 3300031238 Bacteria 954
627 Ga0265339_10151733 3300031249 Bacteria 1171
628 Ga0265316_10032843 3300031344 Bacteria 4234
629 Ga0265316_10052368 3300031344 Unclassified 3202
630 Ga0265316_10203291 3300031344 Bacteria 1468
631 Ga0265316_10542761 3300031344 Unclassified 828
632 Ga0307513_10546948 3300031456 Bacteria 871
633 Ga0307408_100033141 3300031548 Unclassified 3606
634 Ga0307408_100070311 3300031548 Bacteria 2584
635 Ga0307408_100971571 3300031548 Unclassified 781
636 Ga0265314_10040041 3300031711 Bacteria 3368
637 Ga0265342_10035846 3300031712 Bacteria 3033
638 Ga0307405_10015144 3300031731 Unclassified 4167
639 Ga0307405_10197420 3300031731 Bacteria 1458
640 Ga0307410_10028486 3300031852 Bacteria 3544
641 Ga0307406_10003612 3300031901 Bacteria 8426
642 Ga0307406_10312163 3300031901 Unclassified 1213
643 Ga0307412_10003279 3300031911 Bacteria 8982
644 Ga0307412_10741772 3300031911 Unclassified 847
645 Ga0307409_100238659 3300031995 Unclassified 1653
646 Ga0307416_100195944 3300032002 Bacteria 1911
647 Ga0307416_100236629 3300032002 Bacteria 1765
648 Ga0307416_100243313 3300032002 Unclassified 1745
649 Ga0307414_10002715 3300032004 Bacteria 9314
650 Ga0307414_10089250 3300032004 Bacteria 2284
651 Ga0307414_10137587 3300032004 Bacteria 1907
652 Ga0307414_10617643 3300032004 Bacteria 974
653 Ga0307411_10008953 3300032005 Bacteria 5226
654 Ga0307415_100003868 3300032126 Bacteria 7682
655 Ga0307415_100424826 3300032126 Unclassified 1142
656 Ga0373926_0263485 3300035083 Unclassified 669
657 Ga0373940_0200159 3300035088 Bacteria 656
658 Ga0373951_0004792 3300035091 Bacteria 3186
659 Ga0373943_0047284 3300035170 Bacteria 2103
660 Ga0373946_0137236 3300035171 Bacteria 1130
661 Ga0373961_0042099 3300035241 Bacteria 1323
662 Ga0373931_0775267 3300035691 Unclassified 638
663 Ga0373935_0086083 3300035692 Unclassified 2050
664 Ga0373927_0000536 3300035695 Bacteria 28860
665 Ga0373927_0147261 3300035695 Unclassified 1542
666 Ga0373933_0235531 3300035724 Bacteria 1177
667 Ga0373947_0007592 3300035725 Bacteria 6276
668 Ga0373937_0655564 3300036401 Bacteria 995
669 Ga0373937_1344854 3300036401 Unclassified 662
670 Ga0373925_0000027 3300037068 Bacteria 154706
671 Ga0373925_0490428 3300037068 Bacteria 1008
672 Ga0373925_0708812 3300037068 Unclassified 830
673 Ga0395900_0105505 3300037418 Bacteria 2895
674 Ga0395898_0053030 3300037466 Bacteria 3961
675 Ga0436364_0469743 3300037853 Unclassified 1400
676 Ga0242422_01309 3300038699 Unclassified 1716
677 Ga0436365_0466471 3300039437 Bacteria 8515
678 Ga0436365_0746282 3300039437 Bacteria 2192
679 Ga0436363_1523099 3300039450 Bacteria 1095
680 Ga0439455_0017892 3300042012 Bacteria 1657
681 Ga0450889_022670 3300042144 Bacteria 705
682 Ga0439446_0078787 3300042156 Bacteria 1018
683 Ga0439458_0002859 3300042157 Bacteria 4150
684 Ga0450908_048562 3300042184 Bacteria 738
685 Ga0439434_0017398 3300042435 Bacteria 2151
686 Ga0466963_0379566 3300044694 Unclassified 996
687 Ga0453684_1118939 3300044712 Unclassified 831
688 Ga0466957_0303661 3300044842 Bacteria 1073
689 Ga0466959_0423032 3300045049 Bacteria 904
690 Ga0451576_0881052 3300045051 Unclassified 939
691 Ga0451576_1026125 3300045051 Unclassified 864
692 Ga0495592_0134920 3300046454 Unclassified 1723
693 Ga0495651_0079753 3300046462 Bacteria 2473
694 Ga0495651_0151974 3300046462 Bacteria 1668
695 Ga0495653_0421660 3300046463 Unclassified 844
696 Ga0495580_0001260 3300046472 Bacteria 22339
697 Ga0495580_0043594 3300046472 Bacteria 3193
698 Ga0495580_0111800 3300046472 Bacteria 1897
699 Ga0495580_0406677 3300046472 Unclassified 917
700 Ga0495662_0075355 3300046476 Unclassified 1637
701 Ga0495662_0221612 3300046476 Bacteria 932
702 Ga0495664_0006997 3300046477 Bacteria 6248
703 Ga0495594_0088687 3300046499 Bacteria 1732
704 Ga0495618_0132595 3300046514 Bacteria 1594
705 Ga0495618_0172315 3300046514 Unclassified 1377
706 Ga0495628_0312713 3300046516 Unclassified 1161
707 Ga0495630_0026033 3300046517 Unclassified 4329
708 Ga0495630_0591387 3300046517 Unclassified 851
709 Ga0495666_0054372 3300046526 Bacteria 1920
710 Ga0495652_0055394 3300046529 Bacteria 3372
711 Ga0495665_0110074 3300046531 Unclassified 1445
712 Ga0495665_0120023 3300046531 Bacteria 1377
713 Ga0495665_0183308 3300046531 Bacteria 1087
714 Ga0495640_0051269 3300046533 Bacteria 2837
715 Ga0495586_0352486 3300046535 Bacteria 845
716 Ga0495598_0000025 3300046537 Bacteria 24142
717 Ga0495621_0001402 3300046539 Bacteria 6240
718 Ga0495645_0097900 3300046543 Bacteria 2088
719 Ga0495645_0350077 3300046543 Unclassified 952
720 Ga0495645_0440222 3300046543 Bacteria 824
721 Ga0495645_0590056 3300046543 Unclassified 684
722 Ga0495667_0065648 3300046559 Bacteria 2374
723 Ga0495656_0421787 3300046615 Bacteria 700
724 Ga0495634_0298588 3300046642 Unclassified 974
725 Ga0495635_0559005 3300046663 Unclassified 750
726 Ga0495588_0058381 3300046674 Bacteria 1995
727 Ga0495657_0137157 3300046675 Bacteria 1528
728 Ga0495599_0067466 3300046678 Bacteria 2234
729 Ga0495623_0136498 3300046679 Bacteria 1463
730 Ga0495623_0164564 3300046679 Unclassified 1301
731 Ga0495623_0178521 3300046679 Unclassified 1235
732 Ga0495646_0038426 3300046680 Unclassified 2956
733 Ga0495613_0043198 3300046689 Unclassified 3334
734 Ga0495613_0322369 3300046689 Bacteria 1066
735 Ga0495600_0055414 3300046809 Bacteria 2589
736 Ga0495600_0116416 3300046809 Bacteria 1740
737 Ga0495604_0013300 3300047317 Bacteria 6553
738 Ga0495604_0032092 3300047317 Bacteria 4164
739 Ga0495604_0151681 3300047317 Unclassified 1646
740 Ga0495674_0016514 3300047319 Bacteria 6887
741 Ga0495674_0016516 3300047319 Bacteria 6887
742 Ga0495674_0593563 3300047319 Unclassified 878
743 Ga0495672_0022123 3300047320 Bacteria 4138
744 Ga0495675_0177684 3300047444 Unclassified 1305
745 Ga0495684_0003936 3300047471 Bacteria 11578
746 Ga0495684_0012823 3300047471 Bacteria 6469
747 Ga0495684_0059490 3300047471 Bacteria 2909
748 Ga0495684_0365936 3300047471 Unclassified 1020
749 Ga0495602_0028403 3300048088 Bacteria 5353
750 Ga0495614_0078217 3300048089 Bacteria 1431
751 Ga0496104_1086693 3300048907 Unclassified 704
752 Ga0496105_0647422 3300048908 Unclassified 816
753 Ga0496108_0226242 3300048911 Bacteria 1626
754 Ga0496108_0484139 3300048911 Unclassified 1081
755 Ga0496110_0202483 3300048913 Unclassified 1804
756 Ga0496110_0761472 3300048913 Bacteria 872
757 Ga0496112_0140577 3300048915 Bacteria 2384
758 Ga0496112_0182188 3300048915 Bacteria 2064
759 Ga0496112_0481335 3300048915 Bacteria 1178
760 Ga0496113_0013168 3300048916 Bacteria 5590
761 Ga0496113_0747475 3300048916 Bacteria 779
762 Ga0496114_0253513 3300048917 Bacteria 1549
763 Ga0501291_011948 3300049514 Bacteria 1261
764 Ga0501291_052662 3300049514 Bacteria 745
765 Ga0501295_000894 3300049518 Bacteria 2875
766 Ga0501295_063686 3300049518 Unclassified 812
767 Ga0501296_022213 3300049519 Bacteria 816
768 Ga0501297_010339 3300049520 Bacteria 1055
769 Ga0501298_003744 3300049521 Bacteria 2370
770 Ga0501299_062988 3300049522 Bacteria 789
771 Ga0501299_084014 3300049522 Unclassified 712
772 Ga0501031_0471994 3300049568 Unclassified 810
773 Ga0501038_0001223 3300049574 Bacteria 23290
774 Ga0501040_0398843 3300049576 Bacteria 988
775 Ga0501041_0051377 3300049577 Bacteria 2513
776 Ga0501042_0569594 3300049578 Unclassified 823
777 Ga0501048_0522403 3300049582 Bacteria 851
778 Ga0501076_0025214 3300049592 Bacteria 4601
779 Ga0501077_0300852 3300049593 Bacteria 1022
780 Ga0501198_020879 3300049649 Unclassified 1040
781 Ga0501199_009152 3300049650 Bacteria 1045
782 Ga0501202_001485 3300049652 Unclassified 3770
783 Ga0501207_009305 3300049654 Bacteria 1434
784 Ga0501210_006585 3300049657 Unclassified 855
785 Ga0501214_009487 3300049659 Bacteria 1047
786 Ga0501216_019529 3300049660 Bacteria 1177
787 Ga0501217_000392 3300049661 Bacteria 7053
788 Ga0501217_002225 3300049661 Unclassified 3785
789 Ga0501217_005293 3300049661 Unclassified 2692
790 Ga0501223_002306 3300049663 Bacteria 4257
791 Ga0501224_004111 3300049664 Unclassified 2053
792 Ga0501224_017389 3300049664 Unclassified 1069
793 Ga0501227_000419 3300049665 Bacteria 9050
794 Ga0501227_059249 3300049665 Bacteria 978
795 Ga0501233_003913 3300049668 Bacteria 2700
796 Ga0501235_006699 3300049669 Bacteria 2507
797 Ga0501236_012587 3300049670 Unclassified 1143
798 Ga0501240_003036 3300049673 Bacteria 1838
799 Ga0501240_039507 3300049673 Unclassified 781
800 Ga0501243_026896 3300049675 Unclassified 970
801 Ga0501257_036952 3300049686 Unclassified 1190
802 Ga0501259_009799 3300049688 Bacteria 1558
803 Ga0501259_075802 3300049688 Bacteria 730
804 Ga0501260_005810 3300049689 Bacteria 1171
805 Ga0501225_0002302 3300049705 Bacteria 5901
806 Ga0501225_0004997 3300049705 Bacteria 3919
807 Ga0501225_0040090 3300049705 Bacteria 1290
808 Ga0501225_0047624 3300049705 Bacteria 1190
809 Ga0501229_012072 3300049706 Unclassified 1100
810 Ga0501234_001008 3300049707 Bacteria 4471
811 Ga0501245_007227 3300049708 Bacteria 1568
812 Ga0501081_0180917 3300049743 Unclassified 1525
813 Ga0501272_005995 3300049769 Bacteria 1293
814 Ga0501273_004524 3300049770 Bacteria 1530
815 Ga0501273_009252 3300049770 Bacteria 1193
816 Ga0501279_009708 3300049775 Bacteria 1291
817 Ga0501283_002976 3300049779 Bacteria 2223
818 Ga0501283_025911 3300049779 Unclassified 962
819 Ga0501035_0271942 3300049822 Unclassified 1434
820 Ga0501045_0018591 3300049824 Bacteria 4945
821 nmdc:mga05p37_331661_c1 3300050507 Bacteria 1797
822 nmdc:mga05p37_409080_c1 3300050507 Bacteria 1582
823 nmdc:mga05p37_59302_c1 3300050507 Bacteria 4713
824 nmdc:mga05p37_680192_c1 3300050507 Unclassified 1147
825 nmdc:mga05p37_82913_c1 3300050507 Unclassified 3951
826 nmdc:mga05p37_871049_c1 3300050507 Unclassified 674
827 nmdc:mga05p37_930104_c1 3300050507 Unclassified 933
828 nmdc:mga09592_119509_c1 3300050508 Bacteria 2263
829 nmdc:mga09592_150716_c1 3300050508 Unclassified 2006
830 nmdc:mga09592_267694_c1 3300050508 Bacteria 1482
831 nmdc:mga0qj67_189301_c1 3300050509 Bacteria 1672
832 nmdc:mga0qj67_195935_c1 3300050509 Bacteria 1642
833 nmdc:mga06r32_308879_c1 3300050510 Bacteria 1567
834 nmdc:mga06r32_570618_c1 3300050510 Unclassified 1104
835 nmdc:mga08y16_17931_c1 3300050511 Bacteria 7459
836 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
837 nmdc:mga08y16_22423_c1 3300050511 Bacteria 6665
838 nmdc:mga08y16_244383_c1 3300050511 Unclassified 1855
839 nmdc:mga0n895_463075_c1 3300050512 Bacteria 1279
840 nmdc:mga0rr50_172513_c1 3300050513 Bacteria 1763
841 nmdc:mga0rr50_419821_c1 3300050513 Unclassified 1131
842 nmdc:mga0rr50_72054_c1 3300050513 Bacteria 2638
843 nmdc:mga08x19_48465_c1 3300050514 Bacteria 2722
844 nmdc:mga0a205_165146_c1 3300050515 Bacteria 2109
845 nmdc:mga0a205_207441_c1 3300050515 Unclassified 1849
846 nmdc:mga0a205_228715_c1 3300050515 Unclassified 1744
847 nmdc:mga0a205_337285_c1 3300050515 Bacteria 1376
848 nmdc:mga0a205_44105_c1 3300050515 Bacteria 4298
849 nmdc:mga0a205_453235_c1 3300050515 Unclassified 1143
850 nmdc:mga0a205_6715_c1 3300050515 Bacteria 10407
851 Ga0495601_0228385 3300053077 Unclassified 1216
852 Ga0501084_0750852 3300054114 Unclassified 822
853 Ga0501082_0034590 3300060353 Bacteria 4355
854 Ga0501082_0437827 3300060353 Bacteria 1142
855 Ga0530510_0217000 3300061734 Unclassified 1421
856 Ga0530510_0316199 3300061734 Bacteria 1170
857 2740031717 2739367866 Bacteria 4215900
858 Ga0436363_1472361
859 CNAas_1000674
860 JGI24749J21850_1017327
861 JGI24751J29686_10000023
862 JGI25406J46586_10014833
863 JGI26143J51219_1003133
864 Ga0065714_10064432
865 Ga0065712_10067730
866 Ga0065712_10123696
867 Ga0065715_10031331
868 Ga0065715_10100075
869 Ga0065715_10121787
870 Ga0065715_10185734
871 Ga0065715_10251049
872 Ga0065715_10393182
873 Ga0065715_10447176
874 Ga0065715_10487911
875 Ga0065707_10002957
876 Ga0065707_10139226
877 Ga0065707_10457469
878 Ga0070658_10387144
879 Ga0070658_10565625
880 Ga0070676_10027009
881 Ga0070676_10123541
882 Ga0070683_100000049
883 Ga0070690_100079526
884 Ga0070690_100171911
885 Ga0070670_100000324
886 Ga0070670_100180022
887 Ga0070670_100555808
888 Ga0070670_100802968
889 Ga0070677_10055399
890 Ga0070677_10233167
891 Ga0068869_100003254
892 Ga0068869_100052330
893 Ga0068869_100094368
894 Ga0068869_100285710
895 Ga0070680_100032700
896 Ga0070682_100008637
897 Ga0070682_100101249
898 Ga0068868_100027093
899 Ga0070660_100087326
900 Ga0070660_100442413
901 Ga0070689_100011673
902 Ga0070689_100027432
903 Ga0070689_100027477
904 Ga0070689_100243944
905 Ga0070689_100282558
906 Ga0070689_100726742
907 Ga0070689_100963003
908 Ga0070691_10500327
909 Ga0070687_100137190
910 Ga0070661_100054282
911 Ga0070692_10018538
912 Ga0070692_10022138
913 Ga0070692_10120201
914 Ga0070692_10203427
915 Ga0070692_10617741
916 Ga0070669_100014481
917 Ga0070669_100040070
918 Ga0070669_100243313
919 Ga0070675_100232182
920 Ga0070671_100041883
921 Ga0070671_100104459
922 Ga0070671_100225242
923 Ga0070671_100234716
924 Ga0070671_100304023
925 Ga0070674_100204638
926 Ga0070674_100210328
927 Ga0070674_100468620
928 Ga0070674_100566825
929 Ga0070674_101118609
930 Ga0070673_100017320
931 Ga0070673_100021714
932 Ga0070673_100176477
933 Ga0070673_100418495
934 Ga0070673_100778272
935 Ga0070688_100086129
936 Ga0070659_100239808
937 Ga0070659_100733680
938 Ga0070714_100028604
939 Ga0070714_101158617
940 Ga0070701_10040901
941 Ga0070701_10084921
942 Ga0070701_10150515
943 Ga0070701_10205141
944 Ga0070701_10468147
945 Ga0070705_100063400
946 Ga0070705_100091119
947 Ga0070705_100602788
948 Ga0070705_100672283
949 Ga0070705_100735190
950 Ga0070700_100000042
951 Ga0070700_100007847
952 Ga0070700_100008567
953 Ga0070700_100169994
954 Ga0070700_100192856
955 Ga0070700_100221369
956 Ga0070700_100810066
957 Ga0070694_100007222
958 Ga0070694_100210089
959 Ga0070694_100218003
960 Ga0070694_100222726
961 Ga0070694_100587471
962 Ga0070694_100904374
963 Ga0070708_100477641
964 Ga0070678_100167982
965 Ga0070662_100083098
966 Ga0070662_100914117
967 Ga0070681_10004835
968 Ga0070681_10012618
969 Ga0070681_10238495
970 Ga0070681_11286305
971 Ga0068867_100003348
972 Ga0068867_100107069
973 Ga0068867_100304488
974 Ga0068867_100307531
975 Ga0070685_10105037
976 Ga0070685_10817956
977 Ga0070706_100000480
978 Ga0070706_100004115
979 Ga0070707_100246377
980 Ga0070698_100040712
981 Ga0070698_100045289
982 Ga0070698_100124135
983 Ga0070698_100798276
984 Ga0070699_100002826
985 Ga0070699_100013038
986 Ga0070699_100089628
987 Ga0070699_100238296
988 Ga0070699_100394154
989 Ga0070699_100749426
990 Ga0070679_100145625
991 Ga0070679_100216611
992 Ga0070684_100798446
993 Ga0070684_101221740
994 Ga0070697_100002092
995 Ga0070697_100605110
996 Ga0068853_100011334
997 Ga0068853_100810990
998 Ga0070672_100025282
999 Ga0070672_100085642
1000 Ga0070672_100766123
1001 Ga0070686_100011993
1002 Ga0070686_100022711
1003 Ga0070695_100157973
1004 Ga0070695_100361549
1005 Ga0070696_100009805
1006 Ga0070696_100017946
1007 Ga0070696_100161336
1008 Ga0070696_100197066
1009 Ga0070696_100246898
1010 Ga0070696_100351331
1011 Ga0070696_100597282
1012 Ga0070696_100824637
1013 Ga0070693_100000402
1014 Ga0070693_100014015
1015 Ga0070693_100715137
1016 Ga0070693_100723639
1017 Ga0070665_100380434
1018 Ga0070704_100271634
1019 Ga0070704_100420784
1020 Ga0070704_100569847
1021 Ga0070704_100785528
1022 Ga0068855_100244418
1023 Ga0068855_100362306
1024 Ga0068855_100543156
1025 Ga0070664_100025594
1026 Ga0070664_100157169
1027 Ga0070664_100175967
1028 Ga0070664_100388068
1029 Ga0070664_101205559
1030 Ga0068857_100002908
1031 Ga0068857_100275760
1032 Ga0068857_100300568
1033 Ga0068857_100348267
1034 Ga0068854_100065434
1035 Ga0068854_100190193
1036 Ga0068854_100214561
1037 Ga0068856_100499637
1038 Ga0068856_100758793
1039 Ga0070702_100121770
1040 Ga0070702_100195789
1041 Ga0070702_100371833
1042 Ga0068852_100776519
1043 Ga0068859_100041310
1044 Ga0068859_100047427
1045 Ga0068859_100057602
1046 Ga0068859_100059419
1047 Ga0068859_100158857
1048 Ga0068859_100272047
1049 Ga0068859_100295990
1050 Ga0068859_100442786
1051 Ga0068859_100541769
1052 Ga0068859_100632463
1053 Ga0068859_100754633
1054 Ga0068859_101011296
1055 Ga0068859_101154476
1056 Ga0068859_101219473
1057 Ga0068864_100003467
1058 Ga0068864_100033289
1059 Ga0068864_100056051
1060 Ga0068864_100086157
1061 Ga0068864_100107851
1062 Ga0068864_100236543
1063 Ga0068864_100311369
1064 Ga0068864_100558243
1065 Ga0068864_100669693
1066 Ga0068864_100722005
1067 Ga0068864_101025665
1068 Ga0068866_10030747
1069 Ga0068861_100011357
1070 Ga0068861_100031108
1071 Ga0068861_100178896
1072 Ga0068861_101458992
1073 Ga0068870_10015961
1074 Ga0068870_10031416
1075 Ga0068870_10057483
1076 Ga0068870_10099471
1077 Ga0068870_10343172
1078 Ga0068863_100047941
1079 Ga0068863_100050680
1080 Ga0068863_100072922
1081 Ga0068863_100148358
1082 Ga0068863_100296654
1083 Ga0068863_100440515
1084 Ga0068863_100577168
1085 Ga0068863_100814421
1086 Ga0068858_100033656
1087 Ga0068858_100038439
1088 Ga0068858_100074702
1089 Ga0068858_100247598
1090 Ga0068858_100259811
1091 Ga0068858_100522770
1092 Ga0068860_100050177
1093 Ga0068860_100074230
1094 Ga0068860_100105920
1095 Ga0068860_100113607
1096 Ga0068860_100220328
1097 Ga0068860_100255730
1098 Ga0068860_100266308
1099 Ga0068860_100482496
1100 Ga0068862_100029204
1101 Ga0068862_100122364
1102 Ga0068862_100552675
1103 Ga0068862_101391780
1104 Ga0081539_10000395
1105 Ga0081539_10003972
1106 Ga0070717_10005114
1107 Ga0097621_100005127
1108 Ga0097621_100007032
1109 Ga0097621_100011502
1110 Ga0097621_100062212
1111 Ga0097621_100103789
1112 Ga0097621_100712539
1113 Ga0097621_100810621
1114 Ga0068871_100001848
1115 Ga0068871_100019407
1116 Ga0068871_100307594
1117 Ga0068871_100355326
1118 Ga0075428_100000005
1119 Ga0075428_100023016
1120 Ga0075428_100200086
1121 Ga0075428_100712071
1122 Ga0075428_101465039
1123 Ga0075430_100018829
1124 Ga0075430_100102245
1125 Ga0075431_100113586
1126 Ga0075431_100121061
1127 Ga0075433_10011090
1128 Ga0075433_10017396
1129 Ga0075433_10055957
1130 Ga0075433_10149512
1131 Ga0075433_10304639
1132 Ga0075433_10446298
1133 Ga0075434_100130601
1134 Ga0075434_100361829
1135 Ga0075434_100544209
1136 Ga0075434_101110888
1137 Ga0075429_100143689
1138 Ga0075429_100164633
1139 Ga0075429_100252538
1140 Ga0068865_100012490
1141 Ga0068865_100108352
1142 Ga0075436_100057046
1143 Ga0075436_100381594
1144 Ga0097620_100041307
1145 Ga0097620_100047428
1146 Ga0097620_100057603
1147 Ga0097620_100059419
1148 Ga0097620_100158846
1149 Ga0097620_100272035
1150 Ga0097620_100295988
1151 Ga0097620_100442759
1152 Ga0097620_100541769
1153 Ga0097620_100632460
1154 Ga0097620_100754439
1155 Ga0097620_101011248
1156 Ga0097620_101154469
1157 Ga0097620_101219408
1158 Ga0075435_100095799
1159 Ga0075435_100227399
1160 Ga0105251_10143599
1161 Ga0105240_10033317
1162 Ga0105240_10235101
1163 Ga0105240_10554141
1164 Ga0105240_11017638
1165 Ga0111539_10000008
1166 Ga0111539_10000296
1167 Ga0111539_10011429
1168 Ga0111539_10081498
1169 Ga0111539_10241896
1170 Ga0105245_10388314
1171 Ga0105245_10982530
1172 Ga0105245_11086035
1173 Ga0105247_10000635
1174 Ga0105247_10049986
1175 Ga0105247_10192937
1176 Ga0114129_10033107
1177 Ga0114129_10087466
1178 Ga0114129_10110163
1179 Ga0114129_10212214
1180 Ga0114129_10255583
1181 Ga0114129_10345850
1182 Ga0114129_10520464
1183 Ga0114129_10542574
1184 Ga0114129_10700134
1185 Ga0114129_10762196
1186 Ga0114129_10887549
1187 Ga0114129_10986819
1188 Ga0114129_11051584
1189 Ga0105243_10072678
1190 Ga0105243_10207229
1191 Ga0105243_10306799
1192 Ga0105243_10916661
1193 Ga0105243_10965942
1194 Ga0105243_11255018
1195 Ga0105243_11306423
1196 Ga0105243_11472731
1197 Ga0105241_10030898
1198 Ga0105241_10260096
1199 Ga0105241_10363570
1200 Ga0105241_10457433
1201 Ga0105241_10570045
1202 Ga0105241_10720048
1203 Ga0105241_10953702
1204 Ga0105242_10010982
1205 Ga0105242_10090605
1206 Ga0105242_10753368
1207 Ga0105248_10005991
1208 Ga0105248_10019085
1209 Ga0105248_10030093
1210 Ga0105248_10156156
1211 Ga0105248_10261700
1212 Ga0105248_10264910
1213 Ga0105248_10301738
1214 Ga0105248_10351207
1215 Ga0105248_10641958
1216 Ga0105248_11227051
1217 Ga0105248_11246593
1218 Ga0105248_11462002
1219 Ga0105237_10003124
1220 Ga0105237_10042090
1221 Ga0105238_10004387
1222 Ga0105238_10104245
1223 Ga0105238_10128368
1224 Ga0105238_11082237
1225 Ga0105238_11654762
1226 Ga0105249_10262291
1227 Ga0105249_10309965
1228 Ga0105249_10508827
1229 Ga0105249_11226261
1230 Ga0105249_11885498
1231 Ga0105239_10058566
1232 Ga0105239_10327155
1233 Ga0105239_10734793
1234 Ga0105246_10009378
1235 Ga0105246_10577735
1236 Ga0105246_10820279
1237 Ga0105246_11024316
1238 Ga0157373_10002544
1239 Ga0157373_10035422
1240 Ga0157373_10444647
1241 Ga0157371_10093967
1242 Ga0157371_10840685
1243 Ga0157369_10217396
1244 Ga0157369_10356752
1245 Ga0157374_10096087
1246 Ga0157374_10367840
1247 Ga0157374_10904502
1248 Ga0157378_10006269
1249 Ga0157378_10021443
1250 Ga0157378_10295210
1251 Ga0157378_10809448
1252 Ga0163162_10012363
1253 Ga0163162_10021338
1254 Ga0163162_10028788
1255 Ga0163162_10086569
1256 Ga0163162_10148758
1257 Ga0163162_10164738
1258 Ga0163162_10196005
1259 Ga0163162_11122967
1260 Ga0163162_11289070
1261 Ga0157372_10305288
1262 Ga0157372_10470037
1263 Ga0157372_10516606
1264 Ga0157372_10556336
1265 Ga0157372_10715772
1266 Ga0157375_10024070
1267 Ga0157375_10032881
1268 Ga0157375_10309097
1269 Ga0157375_10571728
1270 Ga0157375_10888647
1271 Ga0157375_11172318
1272 Ga0157375_11390214
1273 Ga0163163_10002165
1274 Ga0163163_10013625
1275 Ga0163163_10049856
1276 Ga0163163_10239451
1277 Ga0163163_10261649
1278 Ga0163163_10471618
1279 Ga0163163_10607984
1280 Ga0163163_10976793
1281 Ga0157380_10015020
1282 Ga0157380_10176013
1283 Ga0157380_10416716
1284 Ga0157377_10007824
1285 Ga0157379_10079047
1286 Ga0157379_10167018
1287 Ga0157379_10362224
1288 Ga0157379_10630698
1289 Ga0157376_10049234
1290 Ga0157376_10231965
1291 Ga0157376_10273948
1292 Ga0157376_10441515
1293 Ga0157376_10802684
1294 Ga0163161_10014405
1295 Ga0163161_10131957
1296 Ga0163161_10354872
1297 Ga0163161_10437857
1298 Ga0213874_10047563
1299 Ga0213876_10008368
1300 Ga0209455_1004878
1301 Ga0207653_10064092
1302 Ga0207653_10172840
1303 Ga0207710_10001176
1304 Ga0207710_10190953
1305 Ga0207680_10632292
1306 Ga0207647_10000445
1307 Ga0207647_10298592
1308 Ga0207645_10028136
1309 Ga0207645_10119972
1310 Ga0207643_10001352
1311 Ga0207643_10013247
1312 Ga0207643_10036221
1313 Ga0207643_10064465
1314 Ga0207643_10202536
1315 Ga0207684_10000533
1316 Ga0207684_10003673
1317 Ga0207654_10059672
1318 Ga0207654_10378505
1319 Ga0207654_10820222
1320 Ga0207707_10023298
1321 Ga0207707_10549302
1322 Ga0207707_10889786
1323 Ga0207707_10917944
1324 Ga0207695_10058106
1325 Ga0207695_10343027
1326 Ga0207695_10573449
1327 Ga0207695_10592542
1328 Ga0207671_10087816
1329 Ga0207671_10235305
1330 Ga0207663_10038770
1331 Ga0207660_10089014
1332 Ga0207660_10110132
1333 Ga0207662_10007106
1334 Ga0207662_10017703
1335 Ga0207662_10117514
1336 Ga0207662_10185891
1337 Ga0207649_10036982
1338 Ga0207649_10236841
1339 Ga0207652_10291676
1340 Ga0207646_10153530
1341 Ga0207681_10039590
1342 Ga0207681_10057414
1343 Ga0207681_10278028
1344 Ga0207681_10359781
1345 Ga0207681_10793828
1346 Ga0207694_10004561
1347 Ga0207694_10232774
1348 Ga0207694_10544966
1349 Ga0207650_10000112
1350 Ga0207650_10160890
1351 Ga0207650_10463467
1352 Ga0207659_10106640
1353 Ga0207659_10582740
1354 Ga0207659_11068451
1355 Ga0207687_11267516
1356 Ga0207644_10007284
1357 Ga0207644_10070744
1358 Ga0207644_10394374
1359 Ga0207644_10794844
1360 Ga0207690_10032470
1361 Ga0207690_11234698
1362 Ga0207706_10010103
1363 Ga0207706_10655378
1364 Ga0207686_10058638
1365 Ga0207686_10133025
1366 Ga0207709_10005963
1367 Ga0207709_10009898
1368 Ga0207709_10062497
1369 Ga0207709_10671547
1370 Ga0207709_11055027
1371 Ga0207709_11087872
1372 Ga0207670_10000957
1373 Ga0207670_10032374
1374 Ga0207670_10089005
1375 Ga0207670_10716294
1376 Ga0207670_10800478
1377 Ga0207669_10803261
1378 Ga0207704_10023212
1379 Ga0207704_10055590
1380 Ga0207704_10160884
1381 Ga0207691_10001111
1382 Ga0207691_10146502
1383 Ga0207691_10215174
1384 Ga0207711_10007996
1385 Ga0207711_10023901
1386 Ga0207711_10119806
1387 Ga0207711_10571546
1388 Ga0207711_11125154
1389 Ga0207689_10007769
1390 Ga0207689_10025774
1391 Ga0207689_10064726
1392 Ga0207689_10167071
1393 Ga0207679_10030908
1394 Ga0207679_10245404
1395 Ga0207679_10646701
1396 Ga0207679_10761561
1397 Ga0207667_10309137
1398 Ga0207667_10492617
1399 Ga0207651_10111153
1400 Ga0207651_10160424
1401 Ga0207651_10229712
1402 Ga0207651_10573349
1403 Ga0207712_10007304
1404 Ga0207712_10011262
1405 Ga0207640_10091003
1406 Ga0207640_10181230
1407 Ga0207640_10462111
1408 Ga0207658_10277371
1409 Ga0207677_10130313
1410 Ga0207677_11203267
1411 Ga0207703_10023842
1412 Ga0207703_10064235
1413 Ga0207703_10123140
1414 Ga0207703_10169600
1415 Ga0207703_10209192
1416 Ga0207703_10903207
1417 Ga0207639_10014327
1418 Ga0207639_11254603
1419 Ga0207708_10000074
1420 Ga0207708_10005201
1421 Ga0207708_10030970
1422 Ga0207708_10112728
1423 Ga0207708_10258485
1424 Ga0207708_10545479
1425 Ga0207708_10849002
1426 Ga0207702_10393618
1427 Ga0207641_10017575
1428 Ga0207641_10027580
1429 Ga0207641_10029218
1430 Ga0207641_10104130
1431 Ga0207641_10120209
1432 Ga0207641_10217080
1433 Ga0207641_10239560
1434 Ga0207641_10289323
1435 Ga0207641_10429838
1436 Ga0207648_10005481
1437 Ga0207648_10055692
1438 Ga0207648_10069594
1439 Ga0207648_10086829
1440 Ga0207648_10153051
1441 Ga0207648_10233480
1442 Ga0207648_10400948
1443 Ga0207676_10002972
1444 Ga0207676_10141770
1445 Ga0207676_10387513
1446 Ga0207676_10439810
1447 Ga0207676_10588524
1448 Ga0207676_10682231
1449 Ga0207674_10004656
1450 Ga0207674_10075626
1451 Ga0207674_10146093
1452 Ga0207674_10232027
1453 Ga0207674_10473086
1454 Ga0207674_10671372
1455 Ga0207675_100013059
1456 Ga0207675_100088148
1457 Ga0207675_100098816
1458 Ga0207675_100158606
1459 Ga0207675_100348180
1460 Ga0207675_100372176
1461 Ga0207675_100949669
1462 Ga0207683_10207617
1463 Ga0207683_10297668
1464 Ga0207698_10402321
1465 Ga0207698_10791867
1466 Ga0209970_1035874
1467 Ga0209983_1004828
1468 Ga0207428_10000019
1469 Ga0207428_10037183
1470 Ga0207428_10046498
1471 Ga0268265_10219121
1472 Ga0268265_10649961
1473 Ga0268265_10816311
1474 Ga0268265_10956974
1475 Ga0268264_10057234
1476 Ga0268264_10177548
1477 Ga0268264_10820378
1478 Ga0268264_10920967
1479 Ga0265323_10000323
1480 Ga0265336_10023629
1481 Ga0265330_10128302
1482 Ga0265332_10140877
1483 Ga0265332_10156065
1484 Ga0265339_10151733
1485 Ga0265316_10032843
1486 Ga0265316_10052368
1487 Ga0265316_10203291
1488 Ga0265316_10542761
1489 Ga0307513_10546948
1490 Ga0307408_100033141
1491 Ga0307408_100070311
1492 Ga0307408_100971571
1493 Ga0265314_10040041
1494 Ga0265342_10035846
1495 Ga0307405_10015144
1496 Ga0307405_10197420
1497 Ga0307410_10028486
1498 Ga0307406_10003612
1499 Ga0307406_10312163
1500 Ga0307412_10003279
1501 Ga0307412_10741772
1502 Ga0307409_100238659
1503 Ga0307416_100195944
1504 Ga0307416_100236629
1505 Ga0307416_100243313
1506 Ga0307414_10002715
1507 Ga0307414_10089250
1508 Ga0307414_10137587
1509 Ga0307414_10617643
1510 Ga0307411_10008953
1511 Ga0307415_100003868
1512 Ga0307415_100424826
1513 Ga0373926_0263485
1514 Ga0373940_0200159
1515 Ga0373951_0004792
1516 Ga0373943_0047284
1517 Ga0373946_0137236
1518 Ga0373961_0042099
1519 Ga0373931_0775267
1520 Ga0373935_0086083
1521 Ga0373927_0000536
1522 Ga0373927_0147261
1523 Ga0373933_0235531
1524 Ga0373947_0007592
1525 Ga0373937_0655564
1526 Ga0373937_1344854
1527 Ga0373925_0000027
1528 Ga0373925_0490428
1529 Ga0373925_0708812
1530 Ga0395900_0105505
1531 Ga0395898_0053030
1532 Ga0436364_0469743
1533 Ga0242422_01309
1534 Ga0436365_0466471
1535 Ga0436365_0746282
1536 Ga0436363_1523099
1537 Ga0439455_0017892
1538 Ga0450889_022670
1539 Ga0439446_0078787
1540 Ga0439458_0002859
1541 Ga0450908_048562
1542 Ga0439434_0017398
1543 Ga0466963_0379566
1544 Ga0453684_1118939
1545 Ga0466957_0303661
1546 Ga0466959_0423032
1547 Ga0451576_0881052
1548 Ga0451576_1026125
1549 Ga0495592_0134920
1550 Ga0495651_0079753
1551 Ga0495651_0151974
1552 Ga0495653_0421660
1553 Ga0495580_0001260
1554 Ga0495580_0043594
1555 Ga0495580_0111800
1556 Ga0495580_0406677
1557 Ga0495662_0075355
1558 Ga0495662_0221612
1559 Ga0495664_0006997
1560 Ga0495594_0088687
1561 Ga0495618_0132595
1562 Ga0495618_0172315
1563 Ga0495628_0312713
1564 Ga0495630_0026033
1565 Ga0495630_0591387
1566 Ga0495666_0054372
1567 Ga0495652_0055394
1568 Ga0495665_0110074
1569 Ga0495665_0120023
1570 Ga0495665_0183308
1571 Ga0495640_0051269
1572 Ga0495586_0352486
1573 Ga0495598_0000025
1574 Ga0495621_0001402
1575 Ga0495645_0097900
1576 Ga0495645_0350077
1577 Ga0495645_0440222
1578 Ga0495645_0590056
1579 Ga0495667_0065648
1580 Ga0495656_0421787
1581 Ga0495634_0298588
1582 Ga0495635_0559005
1583 Ga0495588_0058381
1584 Ga0495657_0137157
1585 Ga0495599_0067466
1586 Ga0495623_0136498
1587 Ga0495623_0164564
1588 Ga0495623_0178521
1589 Ga0495646_0038426
1590 Ga0495613_0043198
1591 Ga0495613_0322369
1592 Ga0495600_0055414
1593 Ga0495600_0116416
1594 Ga0495604_0013300
1595 Ga0495604_0032092
1596 Ga0495604_0151681
1597 Ga0495674_0016514
1598 Ga0495674_0016516
1599 Ga0495674_0593563
1600 Ga0495672_0022123
1601 Ga0495675_0177684
1602 Ga0495684_0003936
1603 Ga0495684_0012823
1604 Ga0495684_0059490
1605 Ga0495684_0365936
1606 Ga0495602_0028403
1607 Ga0495614_0078217
1608 Ga0496104_1086693
1609 Ga0496105_0647422
1610 Ga0496108_0226242
1611 Ga0496108_0484139
1612 Ga0496110_0202483
1613 Ga0496110_0761472
1614 Ga0496112_0140577
1615 Ga0496112_0182188
1616 Ga0496112_0481335
1617 Ga0496113_0013168
1618 Ga0496113_0747475
1619 Ga0496114_0253513
1620 Ga0501291_011948
1621 Ga0501291_052662
1622 Ga0501295_000894
1623 Ga0501295_063686
1624 Ga0501296_022213
1625 Ga0501297_010339
1626 Ga0501298_003744
1627 Ga0501299_062988
1628 Ga0501299_084014
1629 Ga0501031_0471994
1630 Ga0501038_0001223
1631 Ga0501040_0398843
1632 Ga0501041_0051377
1633 Ga0501042_0569594
1634 Ga0501048_0522403
1635 Ga0501076_0025214
1636 Ga0501077_0300852
1637 Ga0501198_020879
1638 Ga0501199_009152
1639 Ga0501202_001485
1640 Ga0501207_009305
1641 Ga0501210_006585
1642 Ga0501214_009487
1643 Ga0501216_019529
1644 Ga0501217_000392
1645 Ga0501217_002225
1646 Ga0501217_005293
1647 Ga0501223_002306
1648 Ga0501224_004111
1649 Ga0501224_017389
1650 Ga0501227_000419
1651 Ga0501227_059249
1652 Ga0501233_003913
1653 Ga0501235_006699
1654 Ga0501236_012587
1655 Ga0501240_003036
1656 Ga0501240_039507
1657 Ga0501243_026896
1658 Ga0501257_036952
1659 Ga0501259_009799
1660 Ga0501259_075802
1661 Ga0501260_005810
1662 Ga0501225_0002302
1663 Ga0501225_0004997
1664 Ga0501225_0040090
1665 Ga0501225_0047624
1666 Ga0501229_012072
1667 Ga0501234_001008
1668 Ga0501245_007227
1669 Ga0501081_0180917
1670 Ga0501272_005995
1671 Ga0501273_004524
1672 Ga0501273_009252
1673 Ga0501279_009708
1674 Ga0501283_002976
1675 Ga0501283_025911
1676 Ga0501035_0271942
1677 Ga0501045_0018591
1678 nmdc:mga05p37_331661_c1
1679 nmdc:mga05p37_409080_c1
1680 nmdc:mga05p37_59302_c1
1681 nmdc:mga05p37_680192_c1
1682 nmdc:mga05p37_82913_c1
1683 nmdc:mga05p37_871049_c1
1684 nmdc:mga05p37_930104_c1
1685 nmdc:mga09592_119509_c1
1686 nmdc:mga09592_150716_c1
1687 nmdc:mga09592_267694_c1
1688 nmdc:mga0qj67_189301_c1
1689 nmdc:mga0qj67_195935_c1
1690 nmdc:mga06r32_308879_c1
1691 nmdc:mga06r32_570618_c1
1692 nmdc:mga08y16_17931_c1
1693 nmdc:mga08y16_17_c1
1694 nmdc:mga08y16_22423_c1
1695 nmdc:mga08y16_244383_c1
1696 nmdc:mga0n895_463075_c1
1697 nmdc:mga0rr50_172513_c1
1698 nmdc:mga0rr50_419821_c1
1699 nmdc:mga0rr50_72054_c1
1700 nmdc:mga08x19_48465_c1
1701 nmdc:mga0a205_165146_c1
1702 nmdc:mga0a205_207441_c1
1703 nmdc:mga0a205_228715_c1
1704 nmdc:mga0a205_337285_c1
1705 nmdc:mga0a205_44105_c1
1706 nmdc:mga0a205_453235_c1
1707 nmdc:mga0a205_6715_c1
1708 Ga0495601_0228385
1709 Ga0501084_0750852
1710 Ga0501082_0034590
1711 Ga0501082_0437827
1712 Ga0530510_0217000
1713 Ga0530510_0316199
1714 2740031717

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

55

190

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4paw-assembly1.cif.gz_A structure of hypothetical protein hp1257. 0.9036 6 185
4rv4-assembly1.cif.gz_B 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.8714 3 163
2aee-assembly1.cif.gz_B crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.8678 1 162
2aee-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.8582 1 162
4ohc-assembly1.cif.gz_D crystal structure of orotate phosphoribosyltransferase (oprtase) from burkholderia cenocepacia 0.8548 3 162
ID Description Score Start End Superfamily
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8714 3 163 3.40.50.2020
af_G5EDZ2_3_216_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8577 3 163 3.40.50.2020
af_P09556_2_207_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8568 2 163 3.40.50.2020
af_Q59040_42_210_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8559 32 168 3.40.50.2020
af_O61790_6_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8553 5 162 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1G1GAB1-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9855 8 133 GO:0004588
GO:0019856
GO:0044205
AF-A0A7C7L353-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9826 1 188 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A836SE06-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9814 1 142 GO:0004588
GO:0019856
GO:0044205
AF-A0A7C7L353-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9775 1 188 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A838U9J1-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.977 6 129 GO:0004588
GO:0016020
GO:0019856
GO:0044205

Map