F483696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 857 | 326 | 1714 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_1472361|Ga0436363_1472361_871_1497 |
| Length | 208 |
| Sequence | VKLGQIKDSSLVILSAVTSSAILQLFLKTGAYLQGHFRLTSGLHSGEYLQCAKVLAFPEYAEFLGQEIAKKIPASGVQVVVSPAIGGIVIGHEVARALKVRSLFAERDASTREMTLRRGFEVKPGERAVVIEDVITTGGSTKEVVRLLQGLGAEVVAAGSIIDRSGGAADVEVPRVALETLNAVTYNPDACPLCQQGIPVVKPGSRPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 216 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 217 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 218 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 219 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 220 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 271 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 272 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 273 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 274 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 284 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 285 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 286 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 287 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 289 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 290 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 291 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 299 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 300 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 301 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 304 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 306 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 309 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 310 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 326 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 1.4 |
| Rhizosphere | 97.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 29.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436363_1472361 | 3300039450 | Unclassified | 1616 |
| 2 | CNAas_1000674 | 3300000532 | Bacteria | 3273 |
| 3 | JGI24749J21850_1017327 | 3300002076 | Bacteria | 1013 |
| 4 | JGI24751J29686_10000023 | 3300002459 | Bacteria | 97529 |
| 5 | JGI25406J46586_10014833 | 3300003203 | Unclassified | 3303 |
| 6 | JGI26143J51219_1003133 | 3300003502 | Unclassified | 754 |
| 7 | Ga0065714_10064432 | 3300005288 | Bacteria | 133542 |
| 8 | Ga0065712_10067730 | 3300005290 | Bacteria | 133482 |
| 9 | Ga0065712_10123696 | 3300005290 | Unclassified | 1635 |
| 10 | Ga0065715_10031331 | 3300005293 | Bacteria | 1353 |
| 11 | Ga0065715_10100075 | 3300005293 | Unclassified | 3339 |
| 12 | Ga0065715_10121787 | 3300005293 | Unclassified | 2221 |
| 13 | Ga0065715_10185734 | 3300005293 | Unclassified | 1435 |
| 14 | Ga0065715_10251049 | 3300005293 | Bacteria | 1167 |
| 15 | Ga0065715_10393182 | 3300005293 | Unclassified | 891 |
| 16 | Ga0065715_10447176 | 3300005293 | Unclassified | 785 |
| 17 | Ga0065715_10487911 | 3300005293 | Unclassified | 791 |
| 18 | Ga0065707_10002957 | 3300005295 | Bacteria | 4680 |
| 19 | Ga0065707_10139226 | 3300005295 | Unclassified | 1795 |
| 20 | Ga0065707_10457469 | 3300005295 | Bacteria | 794 |
| 21 | Ga0070658_10387144 | 3300005327 | Bacteria | 1200 |
| 22 | Ga0070658_10565625 | 3300005327 | Unclassified | 984 |
| 23 | Ga0070676_10027009 | 3300005328 | Bacteria | 3253 |
| 24 | Ga0070676_10123541 | 3300005328 | Bacteria | 1628 |
| 25 | Ga0070683_100000049 | 3300005329 | Bacteria | 93310 |
| 26 | Ga0070690_100079526 | 3300005330 | Bacteria | 2143 |
| 27 | Ga0070690_100171911 | 3300005330 | Unclassified | 1491 |
| 28 | Ga0070670_100000324 | 3300005331 | Bacteria | 40556 |
| 29 | Ga0070670_100180022 | 3300005331 | Bacteria | 1835 |
| 30 | Ga0070670_100555808 | 3300005331 | Unclassified | 1024 |
| 31 | Ga0070670_100802968 | 3300005331 | Bacteria | 850 |
| 32 | Ga0070677_10055399 | 3300005333 | Bacteria | 1618 |
| 33 | Ga0070677_10233167 | 3300005333 | Unclassified | 905 |
| 34 | Ga0068869_100003254 | 3300005334 | Bacteria | 9925 |
| 35 | Ga0068869_100052330 | 3300005334 | Bacteria | 2965 |
| 36 | Ga0068869_100094368 | 3300005334 | Bacteria | 2255 |
| 37 | Ga0068869_100285710 | 3300005334 | Unclassified | 1328 |
| 38 | Ga0070680_100032700 | 3300005336 | Bacteria | 4188 |
| 39 | Ga0070682_100008637 | 3300005337 | Bacteria | 5752 |
| 40 | Ga0070682_100101249 | 3300005337 | Bacteria | 1902 |
| 41 | Ga0068868_100027093 | 3300005338 | Bacteria | 4370 |
| 42 | Ga0070660_100087326 | 3300005339 | Bacteria | 2455 |
| 43 | Ga0070660_100442413 | 3300005339 | Unclassified | 1078 |
| 44 | Ga0070689_100011673 | 3300005340 | Bacteria | 6301 |
| 45 | Ga0070689_100027432 | 3300005340 | Unclassified | 4293 |
| 46 | Ga0070689_100027477 | 3300005340 | Bacteria | 4290 |
| 47 | Ga0070689_100243944 | 3300005340 | Unclassified | 1480 |
| 48 | Ga0070689_100282558 | 3300005340 | Bacteria | 1377 |
| 49 | Ga0070689_100726742 | 3300005340 | Bacteria | 869 |
| 50 | Ga0070689_100963003 | 3300005340 | Unclassified | 758 |
| 51 | Ga0070691_10500327 | 3300005341 | Unclassified | 702 |
| 52 | Ga0070687_100137190 | 3300005343 | Unclassified | 1419 |
| 53 | Ga0070661_100054282 | 3300005344 | Bacteria | 2935 |
| 54 | Ga0070692_10018538 | 3300005345 | Bacteria | 3349 |
| 55 | Ga0070692_10022138 | 3300005345 | Bacteria | 3102 |
| 56 | Ga0070692_10120201 | 3300005345 | Bacteria | 1464 |
| 57 | Ga0070692_10203427 | 3300005345 | Bacteria | 1161 |
| 58 | Ga0070692_10617741 | 3300005345 | Unclassified | 719 |
| 59 | Ga0070669_100014481 | 3300005353 | Bacteria | 5612 |
| 60 | Ga0070669_100040070 | 3300005353 | Bacteria | 3404 |
| 61 | Ga0070669_100243313 | 3300005353 | Unclassified | 1430 |
| 62 | Ga0070675_100232182 | 3300005354 | Bacteria | 1610 |
| 63 | Ga0070671_100041883 | 3300005355 | Bacteria | 3806 |
| 64 | Ga0070671_100104459 | 3300005355 | Bacteria | 2377 |
| 65 | Ga0070671_100225242 | 3300005355 | Bacteria | 1591 |
| 66 | Ga0070671_100234716 | 3300005355 | Bacteria | 1556 |
| 67 | Ga0070671_100304023 | 3300005355 | Unclassified | 1358 |
| 68 | Ga0070674_100204638 | 3300005356 | Bacteria | 1526 |
| 69 | Ga0070674_100210328 | 3300005356 | Bacteria | 1507 |
| 70 | Ga0070674_100468620 | 3300005356 | Unclassified | 1043 |
| 71 | Ga0070674_100566825 | 3300005356 | Bacteria | 955 |
| 72 | Ga0070674_101118609 | 3300005356 | Bacteria | 696 |
| 73 | Ga0070673_100017320 | 3300005364 | Bacteria | 5119 |
| 74 | Ga0070673_100021714 | 3300005364 | Bacteria | 4661 |
| 75 | Ga0070673_100176477 | 3300005364 | Unclassified | 1826 |
| 76 | Ga0070673_100418495 | 3300005364 | Bacteria | 1201 |
| 77 | Ga0070673_100778272 | 3300005364 | Unclassified | 882 |
| 78 | Ga0070688_100086129 | 3300005365 | Bacteria | 2043 |
| 79 | Ga0070659_100239808 | 3300005366 | Bacteria | 1500 |
| 80 | Ga0070659_100733680 | 3300005366 | Bacteria | 856 |
| 81 | Ga0070714_100028604 | 3300005435 | Bacteria | 4627 |
| 82 | Ga0070714_101158617 | 3300005435 | Bacteria | 754 |
| 83 | Ga0070701_10040901 | 3300005438 | Bacteria | 2359 |
| 84 | Ga0070701_10084921 | 3300005438 | Bacteria | 1722 |
| 85 | Ga0070701_10150515 | 3300005438 | Unclassified | 1339 |
| 86 | Ga0070701_10205141 | 3300005438 | Unclassified | 1167 |
| 87 | Ga0070701_10468147 | 3300005438 | Bacteria | 812 |
| 88 | Ga0070705_100063400 | 3300005440 | Bacteria | 2204 |
| 89 | Ga0070705_100091119 | 3300005440 | Bacteria | 1899 |
| 90 | Ga0070705_100602788 | 3300005440 | Unclassified | 850 |
| 91 | Ga0070705_100672283 | 3300005440 | Unclassified | 810 |
| 92 | Ga0070705_100735190 | 3300005440 | Unclassified | 779 |
| 93 | Ga0070700_100000042 | 3300005441 | Bacteria | 99515 |
| 94 | Ga0070700_100007847 | 3300005441 | Bacteria | 5788 |
| 95 | Ga0070700_100008567 | 3300005441 | Bacteria | 5570 |
| 96 | Ga0070700_100169994 | 3300005441 | Unclassified | 1509 |
| 97 | Ga0070700_100192856 | 3300005441 | Bacteria | 1426 |
| 98 | Ga0070700_100221369 | 3300005441 | Bacteria | 1341 |
| 99 | Ga0070700_100810066 | 3300005441 | Bacteria | 755 |
| 100 | Ga0070694_100007222 | 3300005444 | Bacteria | 6765 |
| 101 | Ga0070694_100210089 | 3300005444 | Bacteria | 1455 |
| 102 | Ga0070694_100218003 | 3300005444 | Bacteria | 1430 |
| 103 | Ga0070694_100222726 | 3300005444 | Unclassified | 1416 |
| 104 | Ga0070694_100587471 | 3300005444 | Bacteria | 896 |
| 105 | Ga0070694_100904374 | 3300005444 | Unclassified | 729 |
| 106 | Ga0070708_100477641 | 3300005445 | Bacteria | 1176 |
| 107 | Ga0070678_100167982 | 3300005456 | Bacteria | 1784 |
| 108 | Ga0070662_100083098 | 3300005457 | Bacteria | 2389 |
| 109 | Ga0070662_100914117 | 3300005457 | Unclassified | 749 |
| 110 | Ga0070681_10004835 | 3300005458 | Bacteria | 12910 |
| 111 | Ga0070681_10012618 | 3300005458 | Bacteria | 8383 |
| 112 | Ga0070681_10238495 | 3300005458 | Unclassified | 1732 |
| 113 | Ga0070681_11286305 | 3300005458 | Bacteria | 654 |
| 114 | Ga0068867_100003348 | 3300005459 | Bacteria | 11289 |
| 115 | Ga0068867_100107069 | 3300005459 | Unclassified | 2142 |
| 116 | Ga0068867_100304488 | 3300005459 | Bacteria | 1315 |
| 117 | Ga0068867_100307531 | 3300005459 | Unclassified | 1309 |
| 118 | Ga0070685_10105037 | 3300005466 | Bacteria | 1731 |
| 119 | Ga0070685_10817956 | 3300005466 | Unclassified | 688 |
| 120 | Ga0070706_100000480 | 3300005467 | Bacteria | 47075 |
| 121 | Ga0070706_100004115 | 3300005467 | Bacteria | 14151 |
| 122 | Ga0070707_100246377 | 3300005468 | Bacteria | 1739 |
| 123 | Ga0070698_100040712 | 3300005471 | Bacteria | 4774 |
| 124 | Ga0070698_100045289 | 3300005471 | Bacteria | 4503 |
| 125 | Ga0070698_100124135 | 3300005471 | Unclassified | 2539 |
| 126 | Ga0070698_100798276 | 3300005471 | Unclassified | 888 |
| 127 | Ga0070699_100002826 | 3300005518 | Bacteria | 15494 |
| 128 | Ga0070699_100013038 | 3300005518 | Bacteria | 7163 |
| 129 | Ga0070699_100089628 | 3300005518 | Bacteria | 2688 |
| 130 | Ga0070699_100238296 | 3300005518 | Bacteria | 1623 |
| 131 | Ga0070699_100394154 | 3300005518 | Bacteria | 1251 |
| 132 | Ga0070699_100749426 | 3300005518 | Bacteria | 893 |
| 133 | Ga0070679_100145625 | 3300005530 | Bacteria | 2347 |
| 134 | Ga0070679_100216611 | 3300005530 | Unclassified | 1877 |
| 135 | Ga0070684_100798446 | 3300005535 | Unclassified | 882 |
| 136 | Ga0070684_101221740 | 3300005535 | Unclassified | 707 |
| 137 | Ga0070697_100002092 | 3300005536 | Bacteria | 15271 |
| 138 | Ga0070697_100605110 | 3300005536 | Bacteria | 963 |
| 139 | Ga0068853_100011334 | 3300005539 | Bacteria | 7240 |
| 140 | Ga0068853_100810990 | 3300005539 | Unclassified | 896 |
| 141 | Ga0070672_100025282 | 3300005543 | Unclassified | 4401 |
| 142 | Ga0070672_100085642 | 3300005543 | Bacteria | 2533 |
| 143 | Ga0070672_100766123 | 3300005543 | Bacteria | 848 |
| 144 | Ga0070686_100011993 | 3300005544 | Unclassified | 4928 |
| 145 | Ga0070686_100022711 | 3300005544 | Bacteria | 3740 |
| 146 | Ga0070695_100157973 | 3300005545 | Bacteria | 1589 |
| 147 | Ga0070695_100361549 | 3300005545 | Unclassified | 1090 |
| 148 | Ga0070696_100009805 | 3300005546 | Bacteria | 6406 |
| 149 | Ga0070696_100017946 | 3300005546 | Bacteria | 4779 |
| 150 | Ga0070696_100161336 | 3300005546 | Bacteria | 1652 |
| 151 | Ga0070696_100197066 | 3300005546 | Unclassified | 1502 |
| 152 | Ga0070696_100246898 | 3300005546 | Bacteria | 1348 |
| 153 | Ga0070696_100351331 | 3300005546 | Bacteria | 1142 |
| 154 | Ga0070696_100597282 | 3300005546 | Unclassified | 889 |
| 155 | Ga0070696_100824637 | 3300005546 | Unclassified | 765 |
| 156 | Ga0070693_100000402 | 3300005547 | Bacteria | 19643 |
| 157 | Ga0070693_100014015 | 3300005547 | Bacteria | 4095 |
| 158 | Ga0070693_100715137 | 3300005547 | Bacteria | 735 |
| 159 | Ga0070693_100723639 | 3300005547 | Unclassified | 731 |
| 160 | Ga0070665_100380434 | 3300005548 | Bacteria | 1419 |
| 161 | Ga0070704_100271634 | 3300005549 | Bacteria | 1401 |
| 162 | Ga0070704_100420784 | 3300005549 | Bacteria | 1144 |
| 163 | Ga0070704_100569847 | 3300005549 | Bacteria | 991 |
| 164 | Ga0070704_100785528 | 3300005549 | Bacteria | 850 |
| 165 | Ga0068855_100244418 | 3300005563 | Bacteria | 2004 |
| 166 | Ga0068855_100362306 | 3300005563 | Unclassified | 1595 |
| 167 | Ga0068855_100543156 | 3300005563 | Bacteria | 1259 |
| 168 | Ga0070664_100025594 | 3300005564 | Unclassified | 4893 |
| 169 | Ga0070664_100157169 | 3300005564 | Bacteria | 2009 |
| 170 | Ga0070664_100175967 | 3300005564 | Bacteria | 1900 |
| 171 | Ga0070664_100388068 | 3300005564 | Bacteria | 1276 |
| 172 | Ga0070664_101205559 | 3300005564 | Unclassified | 714 |
| 173 | Ga0068857_100002908 | 3300005577 | Bacteria | 14112 |
| 174 | Ga0068857_100275760 | 3300005577 | Unclassified | 1546 |
| 175 | Ga0068857_100300568 | 3300005577 | Bacteria | 1479 |
| 176 | Ga0068857_100348267 | 3300005577 | Unclassified | 1371 |
| 177 | Ga0068854_100065434 | 3300005578 | Bacteria | 2643 |
| 178 | Ga0068854_100190193 | 3300005578 | Unclassified | 1608 |
| 179 | Ga0068854_100214561 | 3300005578 | Unclassified | 1520 |
| 180 | Ga0068856_100499637 | 3300005614 | Unclassified | 1237 |
| 181 | Ga0068856_100758793 | 3300005614 | Bacteria | 990 |
| 182 | Ga0070702_100121770 | 3300005615 | Bacteria | 1634 |
| 183 | Ga0070702_100195789 | 3300005615 | Unclassified | 1334 |
| 184 | Ga0070702_100371833 | 3300005615 | Bacteria | 1013 |
| 185 | Ga0068852_100776519 | 3300005616 | Unclassified | 971 |
| 186 | Ga0068859_100041310 | 3300005617 | Bacteria | 4632 |
| 187 | Ga0068859_100047427 | 3300005617 | Bacteria | 4316 |
| 188 | Ga0068859_100057602 | 3300005617 | Bacteria | 3914 |
| 189 | Ga0068859_100059419 | 3300005617 | Bacteria | 3851 |
| 190 | Ga0068859_100158857 | 3300005617 | Bacteria | 2339 |
| 191 | Ga0068859_100272047 | 3300005617 | Unclassified | 1786 |
| 192 | Ga0068859_100295990 | 3300005617 | Bacteria | 1711 |
| 193 | Ga0068859_100442786 | 3300005617 | Bacteria | 1395 |
| 194 | Ga0068859_100541769 | 3300005617 | Bacteria | 1258 |
| 195 | Ga0068859_100632463 | 3300005617 | Unclassified | 1163 |
| 196 | Ga0068859_100754633 | 3300005617 | Bacteria | 1062 |
| 197 | Ga0068859_101011296 | 3300005617 | Unclassified | 913 |
| 198 | Ga0068859_101154476 | 3300005617 | Unclassified | 853 |
| 199 | Ga0068859_101219473 | 3300005617 | Bacteria | 829 |
| 200 | Ga0068864_100003467 | 3300005618 | Bacteria | 13027 |
| 201 | Ga0068864_100033289 | 3300005618 | Bacteria | 4381 |
| 202 | Ga0068864_100056051 | 3300005618 | Bacteria | 3405 |
| 203 | Ga0068864_100086157 | 3300005618 | Bacteria | 2763 |
| 204 | Ga0068864_100107851 | 3300005618 | Bacteria | 2478 |
| 205 | Ga0068864_100236543 | 3300005618 | Bacteria | 1691 |
| 206 | Ga0068864_100311369 | 3300005618 | Unclassified | 1476 |
| 207 | Ga0068864_100558243 | 3300005618 | Bacteria | 1107 |
| 208 | Ga0068864_100669693 | 3300005618 | Bacteria | 1012 |
| 209 | Ga0068864_100722005 | 3300005618 | Bacteria | 975 |
| 210 | Ga0068864_101025665 | 3300005618 | Bacteria | 819 |
| 211 | Ga0068866_10030747 | 3300005718 | Bacteria | 2580 |
| 212 | Ga0068861_100011357 | 3300005719 | Bacteria | 6187 |
| 213 | Ga0068861_100031108 | 3300005719 | Bacteria | 3917 |
| 214 | Ga0068861_100178896 | 3300005719 | Bacteria | 1764 |
| 215 | Ga0068861_101458992 | 3300005719 | Unclassified | 670 |
| 216 | Ga0068870_10015961 | 3300005840 | Bacteria | 3577 |
| 217 | Ga0068870_10031416 | 3300005840 | Bacteria | 2691 |
| 218 | Ga0068870_10057483 | 3300005840 | Bacteria | 2079 |
| 219 | Ga0068870_10099471 | 3300005840 | Bacteria | 1641 |
| 220 | Ga0068870_10343172 | 3300005840 | Bacteria | 956 |
| 221 | Ga0068863_100047941 | 3300005841 | Unclassified | 4051 |
| 222 | Ga0068863_100050680 | 3300005841 | Bacteria | 3934 |
| 223 | Ga0068863_100072922 | 3300005841 | Unclassified | 3248 |
| 224 | Ga0068863_100148358 | 3300005841 | Bacteria | 2244 |
| 225 | Ga0068863_100296654 | 3300005841 | Bacteria | 1567 |
| 226 | Ga0068863_100440515 | 3300005841 | Unclassified | 1278 |
| 227 | Ga0068863_100577168 | 3300005841 | Bacteria | 1112 |
| 228 | Ga0068863_100814421 | 3300005841 | Unclassified | 932 |
| 229 | Ga0068858_100033656 | 3300005842 | Unclassified | 4753 |
| 230 | Ga0068858_100038439 | 3300005842 | Unclassified | 4439 |
| 231 | Ga0068858_100074702 | 3300005842 | Bacteria | 3148 |
| 232 | Ga0068858_100247598 | 3300005842 | Unclassified | 1692 |
| 233 | Ga0068858_100259811 | 3300005842 | Bacteria | 1650 |
| 234 | Ga0068858_100522770 | 3300005842 | Bacteria | 1148 |
| 235 | Ga0068860_100050177 | 3300005843 | Unclassified | 3973 |
| 236 | Ga0068860_100074230 | 3300005843 | Unclassified | 3234 |
| 237 | Ga0068860_100105920 | 3300005843 | Bacteria | 2685 |
| 238 | Ga0068860_100113607 | 3300005843 | Bacteria | 2589 |
| 239 | Ga0068860_100220328 | 3300005843 | Bacteria | 1842 |
| 240 | Ga0068860_100255730 | 3300005843 | Bacteria | 1706 |
| 241 | Ga0068860_100266308 | 3300005843 | Bacteria | 1671 |
| 242 | Ga0068860_100482496 | 3300005843 | Unclassified | 1236 |
| 243 | Ga0068862_100029204 | 3300005844 | Unclassified | 4645 |
| 244 | Ga0068862_100122364 | 3300005844 | Bacteria | 2295 |
| 245 | Ga0068862_100552675 | 3300005844 | Bacteria | 1099 |
| 246 | Ga0068862_101391780 | 3300005844 | Bacteria | 705 |
| 247 | Ga0081539_10000395 | 3300005985 | Bacteria | 93818 |
| 248 | Ga0081539_10003972 | 3300005985 | Bacteria | 17099 |
| 249 | Ga0070717_10005114 | 3300006028 | Bacteria | 9569 |
| 250 | Ga0097621_100005127 | 3300006237 | Bacteria | 9204 |
| 251 | Ga0097621_100007032 | 3300006237 | Bacteria | 8016 |
| 252 | Ga0097621_100011502 | 3300006237 | Bacteria | 6520 |
| 253 | Ga0097621_100062212 | 3300006237 | Bacteria | 3064 |
| 254 | Ga0097621_100103789 | 3300006237 | Bacteria | 2395 |
| 255 | Ga0097621_100712539 | 3300006237 | Unclassified | 925 |
| 256 | Ga0097621_100810621 | 3300006237 | Bacteria | 868 |
| 257 | Ga0068871_100001848 | 3300006358 | Bacteria | 14311 |
| 258 | Ga0068871_100019407 | 3300006358 | Bacteria | 5190 |
| 259 | Ga0068871_100307594 | 3300006358 | Bacteria | 1393 |
| 260 | Ga0068871_100355326 | 3300006358 | Bacteria | 1297 |
| 261 | Ga0075428_100000005 | 3300006844 | Bacteria | 326130 |
| 262 | Ga0075428_100023016 | 3300006844 | Bacteria | 6895 |
| 263 | Ga0075428_100200086 | 3300006844 | Bacteria | 2160 |
| 264 | Ga0075428_100712071 | 3300006844 | Unclassified | 1069 |
| 265 | Ga0075428_101465039 | 3300006844 | Bacteria | 716 |
| 266 | Ga0075430_100018829 | 3300006846 | Bacteria | 5873 |
| 267 | Ga0075430_100102245 | 3300006846 | Bacteria | 2392 |
| 268 | Ga0075431_100113586 | 3300006847 | Bacteria | 2796 |
| 269 | Ga0075431_100121061 | 3300006847 | Bacteria | 2700 |
| 270 | Ga0075433_10011090 | 3300006852 | Bacteria | 7248 |
| 271 | Ga0075433_10017396 | 3300006852 | Bacteria | 5953 |
| 272 | Ga0075433_10055957 | 3300006852 | Bacteria | 3445 |
| 273 | Ga0075433_10149512 | 3300006852 | Unclassified | 2077 |
| 274 | Ga0075433_10304639 | 3300006852 | Bacteria | 1411 |
| 275 | Ga0075433_10446298 | 3300006852 | Bacteria | 1140 |
| 276 | Ga0075434_100130601 | 3300006871 | Bacteria | 2531 |
| 277 | Ga0075434_100361829 | 3300006871 | Bacteria | 1472 |
| 278 | Ga0075434_100544209 | 3300006871 | Unclassified | 1181 |
| 279 | Ga0075434_101110888 | 3300006871 | Unclassified | 804 |
| 280 | Ga0075429_100143689 | 3300006880 | Bacteria | 2088 |
| 281 | Ga0075429_100164633 | 3300006880 | Bacteria | 1943 |
| 282 | Ga0075429_100252538 | 3300006880 | Bacteria | 1544 |
| 283 | Ga0068865_100012490 | 3300006881 | Bacteria | 5346 |
| 284 | Ga0068865_100108352 | 3300006881 | Bacteria | 2045 |
| 285 | Ga0075436_100057046 | 3300006914 | Bacteria | 2697 |
| 286 | Ga0075436_100381594 | 3300006914 | Bacteria | 1019 |
| 287 | Ga0097620_100041307 | 3300006931 | Bacteria | 4632 |
| 288 | Ga0097620_100047428 | 3300006931 | Bacteria | 4316 |
| 289 | Ga0097620_100057603 | 3300006931 | Bacteria | 3914 |
| 290 | Ga0097620_100059419 | 3300006931 | Bacteria | 3851 |
| 291 | Ga0097620_100158846 | 3300006931 | Bacteria | 2339 |
| 292 | Ga0097620_100272035 | 3300006931 | Unclassified | 1786 |
| 293 | Ga0097620_100295988 | 3300006931 | Bacteria | 1711 |
| 294 | Ga0097620_100442759 | 3300006931 | Bacteria | 1395 |
| 295 | Ga0097620_100541769 | 3300006931 | Bacteria | 1258 |
| 296 | Ga0097620_100632460 | 3300006931 | Unclassified | 1163 |
| 297 | Ga0097620_100754439 | 3300006931 | Bacteria | 1062 |
| 298 | Ga0097620_101011248 | 3300006931 | Unclassified | 913 |
| 299 | Ga0097620_101154469 | 3300006931 | Unclassified | 853 |
| 300 | Ga0097620_101219408 | 3300006931 | Bacteria | 829 |
| 301 | Ga0075435_100095799 | 3300007076 | Bacteria | 2455 |
| 302 | Ga0075435_100227399 | 3300007076 | Unclassified | 1585 |
| 303 | Ga0105251_10143599 | 3300009011 | Unclassified | 1080 |
| 304 | Ga0105240_10033317 | 3300009093 | Bacteria | 6658 |
| 305 | Ga0105240_10235101 | 3300009093 | Bacteria | 2127 |
| 306 | Ga0105240_10554141 | 3300009093 | Unclassified | 1271 |
| 307 | Ga0105240_11017638 | 3300009093 | Bacteria | 885 |
| 308 | Ga0111539_10000008 | 3300009094 | Bacteria | 382609 |
| 309 | Ga0111539_10000296 | 3300009094 | Bacteria | 60206 |
| 310 | Ga0111539_10011429 | 3300009094 | Bacteria | 11144 |
| 311 | Ga0111539_10081498 | 3300009094 | Unclassified | 3806 |
| 312 | Ga0111539_10241896 | 3300009094 | Bacteria | 2101 |
| 313 | Ga0105245_10388314 | 3300009098 | Unclassified | 1392 |
| 314 | Ga0105245_10982530 | 3300009098 | Unclassified | 888 |
| 315 | Ga0105245_11086035 | 3300009098 | Unclassified | 846 |
| 316 | Ga0105247_10000635 | 3300009101 | Bacteria | 28087 |
| 317 | Ga0105247_10049986 | 3300009101 | Bacteria | 2572 |
| 318 | Ga0105247_10192937 | 3300009101 | Bacteria | 1365 |
| 319 | Ga0114129_10033107 | 3300009147 | Bacteria | 7304 |
| 320 | Ga0114129_10087466 | 3300009147 | Bacteria | 4321 |
| 321 | Ga0114129_10110163 | 3300009147 | Unclassified | 3801 |
| 322 | Ga0114129_10212214 | 3300009147 | Bacteria | 2616 |
| 323 | Ga0114129_10255583 | 3300009147 | Unclassified | 2350 |
| 324 | Ga0114129_10345850 | 3300009147 | Bacteria | 1971 |
| 325 | Ga0114129_10520464 | 3300009147 | Bacteria | 1551 |
| 326 | Ga0114129_10542574 | 3300009147 | Unclassified | 1513 |
| 327 | Ga0114129_10700134 | 3300009147 | Bacteria | 1302 |
| 328 | Ga0114129_10762196 | 3300009147 | Bacteria | 1238 |
| 329 | Ga0114129_10887549 | 3300009147 | Bacteria | 1131 |
| 330 | Ga0114129_10986819 | 3300009147 | Bacteria | 1062 |
| 331 | Ga0114129_11051584 | 3300009147 | Bacteria | 1022 |
| 332 | Ga0105243_10072678 | 3300009148 | Bacteria | 2785 |
| 333 | Ga0105243_10207229 | 3300009148 | Unclassified | 1724 |
| 334 | Ga0105243_10306799 | 3300009148 | Bacteria | 1441 |
| 335 | Ga0105243_10916661 | 3300009148 | Bacteria | 873 |
| 336 | Ga0105243_10965942 | 3300009148 | Bacteria | 852 |
| 337 | Ga0105243_11255018 | 3300009148 | Bacteria | 756 |
| 338 | Ga0105243_11306423 | 3300009148 | Unclassified | 743 |
| 339 | Ga0105243_11472731 | 3300009148 | Unclassified | 704 |
| 340 | Ga0105241_10030898 | 3300009174 | Bacteria | 4006 |
| 341 | Ga0105241_10260096 | 3300009174 | Bacteria | 1475 |
| 342 | Ga0105241_10363570 | 3300009174 | Bacteria | 1260 |
| 343 | Ga0105241_10457433 | 3300009174 | Bacteria | 1130 |
| 344 | Ga0105241_10570045 | 3300009174 | Bacteria | 1019 |
| 345 | Ga0105241_10720048 | 3300009174 | Unclassified | 912 |
| 346 | Ga0105241_10953702 | 3300009174 | Bacteria | 800 |
| 347 | Ga0105242_10010982 | 3300009176 | Bacteria | 6956 |
| 348 | Ga0105242_10090605 | 3300009176 | Bacteria | 2573 |
| 349 | Ga0105242_10753368 | 3300009176 | Unclassified | 959 |
| 350 | Ga0105248_10005991 | 3300009177 | Bacteria | 13347 |
| 351 | Ga0105248_10019085 | 3300009177 | Bacteria | 7582 |
| 352 | Ga0105248_10030093 | 3300009177 | Bacteria | 6059 |
| 353 | Ga0105248_10156156 | 3300009177 | Unclassified | 2575 |
| 354 | Ga0105248_10261700 | 3300009177 | Bacteria | 1947 |
| 355 | Ga0105248_10264910 | 3300009177 | Bacteria | 1935 |
| 356 | Ga0105248_10301738 | 3300009177 | Bacteria | 1803 |
| 357 | Ga0105248_10351207 | 3300009177 | Bacteria | 1660 |
| 358 | Ga0105248_10641958 | 3300009177 | Bacteria | 1198 |
| 359 | Ga0105248_11227051 | 3300009177 | Bacteria | 848 |
| 360 | Ga0105248_11246593 | 3300009177 | Bacteria | 841 |
| 361 | Ga0105248_11462002 | 3300009177 | Bacteria | 773 |
| 362 | Ga0105237_10003124 | 3300009545 | Bacteria | 19932 |
| 363 | Ga0105237_10042090 | 3300009545 | Unclassified | 4606 |
| 364 | Ga0105238_10004387 | 3300009551 | Bacteria | 13993 |
| 365 | Ga0105238_10104245 | 3300009551 | Bacteria | 2817 |
| 366 | Ga0105238_10128368 | 3300009551 | Bacteria | 2514 |
| 367 | Ga0105238_11082237 | 3300009551 | Unclassified | 824 |
| 368 | Ga0105238_11654762 | 3300009551 | Unclassified | 671 |
| 369 | Ga0105249_10262291 | 3300009553 | Bacteria | 1717 |
| 370 | Ga0105249_10309965 | 3300009553 | Bacteria | 1586 |
| 371 | Ga0105249_10508827 | 3300009553 | Unclassified | 1250 |
| 372 | Ga0105249_11226261 | 3300009553 | Unclassified | 821 |
| 373 | Ga0105249_11885498 | 3300009553 | Unclassified | 670 |
| 374 | Ga0105239_10058566 | 3300010375 | Unclassified | 4227 |
| 375 | Ga0105239_10327155 | 3300010375 | Bacteria | 1729 |
| 376 | Ga0105239_10734793 | 3300010375 | Bacteria | 1129 |
| 377 | Ga0105246_10009378 | 3300011119 | Bacteria | 6029 |
| 378 | Ga0105246_10577735 | 3300011119 | Unclassified | 968 |
| 379 | Ga0105246_10820279 | 3300011119 | Bacteria | 827 |
| 380 | Ga0105246_11024316 | 3300011119 | Bacteria | 749 |
| 381 | Ga0157373_10002544 | 3300013100 | Bacteria | 13886 |
| 382 | Ga0157373_10035422 | 3300013100 | Bacteria | 3583 |
| 383 | Ga0157373_10444647 | 3300013100 | Unclassified | 932 |
| 384 | Ga0157371_10093967 | 3300013102 | Unclassified | 2125 |
| 385 | Ga0157371_10840685 | 3300013102 | Unclassified | 694 |
| 386 | Ga0157369_10217396 | 3300013105 | Bacteria | 2001 |
| 387 | Ga0157369_10356752 | 3300013105 | Bacteria | 1518 |
| 388 | Ga0157374_10096087 | 3300013296 | Bacteria | 2834 |
| 389 | Ga0157374_10367840 | 3300013296 | Bacteria | 1431 |
| 390 | Ga0157374_10904502 | 3300013296 | Bacteria | 900 |
| 391 | Ga0157378_10006269 | 3300013297 | Bacteria | 10412 |
| 392 | Ga0157378_10021443 | 3300013297 | Bacteria | 5681 |
| 393 | Ga0157378_10295210 | 3300013297 | Bacteria | 1567 |
| 394 | Ga0157378_10809448 | 3300013297 | Bacteria | 963 |
| 395 | Ga0163162_10012363 | 3300013306 | Bacteria | 8335 |
| 396 | Ga0163162_10021338 | 3300013306 | Bacteria | 6377 |
| 397 | Ga0163162_10028788 | 3300013306 | Bacteria | 5499 |
| 398 | Ga0163162_10086569 | 3300013306 | Unclassified | 3211 |
| 399 | Ga0163162_10148758 | 3300013306 | Bacteria | 2459 |
| 400 | Ga0163162_10164738 | 3300013306 | Bacteria | 2340 |
| 401 | Ga0163162_10196005 | 3300013306 | Bacteria | 2149 |
| 402 | Ga0163162_11122967 | 3300013306 | Bacteria | 891 |
| 403 | Ga0163162_11289070 | 3300013306 | Bacteria | 830 |
| 404 | Ga0157372_10305288 | 3300013307 | Bacteria | 1852 |
| 405 | Ga0157372_10470037 | 3300013307 | Unclassified | 1466 |
| 406 | Ga0157372_10516606 | 3300013307 | Bacteria | 1392 |
| 407 | Ga0157372_10556336 | 3300013307 | Bacteria | 1337 |
| 408 | Ga0157372_10715772 | 3300013307 | Bacteria | 1165 |
| 409 | Ga0157375_10024070 | 3300013308 | Bacteria | 5630 |
| 410 | Ga0157375_10032881 | 3300013308 | Bacteria | 4923 |
| 411 | Ga0157375_10309097 | 3300013308 | Unclassified | 1745 |
| 412 | Ga0157375_10571728 | 3300013308 | Unclassified | 1291 |
| 413 | Ga0157375_10888647 | 3300013308 | Bacteria | 1035 |
| 414 | Ga0157375_11172318 | 3300013308 | Bacteria | 901 |
| 415 | Ga0157375_11390214 | 3300013308 | Unclassified | 827 |
| 416 | Ga0163163_10002165 | 3300014325 | Bacteria | 16602 |
| 417 | Ga0163163_10013625 | 3300014325 | Bacteria | 7445 |
| 418 | Ga0163163_10049856 | 3300014325 | Unclassified | 4121 |
| 419 | Ga0163163_10239451 | 3300014325 | Bacteria | 1864 |
| 420 | Ga0163163_10261649 | 3300014325 | Bacteria | 1781 |
| 421 | Ga0163163_10471618 | 3300014325 | Unclassified | 1316 |
| 422 | Ga0163163_10607984 | 3300014325 | Bacteria | 1156 |
| 423 | Ga0163163_10976793 | 3300014325 | Bacteria | 910 |
| 424 | Ga0157380_10015020 | 3300014326 | Bacteria | 5681 |
| 425 | Ga0157380_10176013 | 3300014326 | Bacteria | 1875 |
| 426 | Ga0157380_10416716 | 3300014326 | Bacteria | 1280 |
| 427 | Ga0157377_10007824 | 3300014745 | Bacteria | 5179 |
| 428 | Ga0157379_10079047 | 3300014968 | Bacteria | 2946 |
| 429 | Ga0157379_10167018 | 3300014968 | Bacteria | 1986 |
| 430 | Ga0157379_10362224 | 3300014968 | Bacteria | 1329 |
| 431 | Ga0157379_10630698 | 3300014968 | Unclassified | 1002 |
| 432 | Ga0157376_10049234 | 3300014969 | Bacteria | 3489 |
| 433 | Ga0157376_10231965 | 3300014969 | Bacteria | 1715 |
| 434 | Ga0157376_10273948 | 3300014969 | Bacteria | 1587 |
| 435 | Ga0157376_10441515 | 3300014969 | Unclassified | 1267 |
| 436 | Ga0157376_10802684 | 3300014969 | Bacteria | 954 |
| 437 | Ga0163161_10014405 | 3300017792 | Bacteria | 5506 |
| 438 | Ga0163161_10131957 | 3300017792 | Unclassified | 1885 |
| 439 | Ga0163161_10354872 | 3300017792 | Unclassified | 1166 |
| 440 | Ga0163161_10437857 | 3300017792 | Bacteria | 1055 |
| 441 | Ga0213874_10047563 | 3300021377 | Bacteria | 1306 |
| 442 | Ga0213876_10008368 | 3300021384 | Bacteria | 5598 |
| 443 | Ga0209455_1004878 | 3300025272 | Bacteria | 4270 |
| 444 | Ga0207653_10064092 | 3300025885 | Bacteria | 1245 |
| 445 | Ga0207653_10172840 | 3300025885 | Bacteria | 805 |
| 446 | Ga0207710_10001176 | 3300025900 | Bacteria | 13294 |
| 447 | Ga0207710_10190953 | 3300025900 | Bacteria | 1008 |
| 448 | Ga0207680_10632292 | 3300025903 | Unclassified | 766 |
| 449 | Ga0207647_10000445 | 3300025904 | Bacteria | 33611 |
| 450 | Ga0207647_10298592 | 3300025904 | Bacteria | 917 |
| 451 | Ga0207645_10028136 | 3300025907 | Bacteria | 3630 |
| 452 | Ga0207645_10119972 | 3300025907 | Bacteria | 1707 |
| 453 | Ga0207643_10001352 | 3300025908 | Bacteria | 14172 |
| 454 | Ga0207643_10013247 | 3300025908 | Bacteria | 4463 |
| 455 | Ga0207643_10036221 | 3300025908 | Bacteria | 2766 |
| 456 | Ga0207643_10064465 | 3300025908 | Bacteria | 2097 |
| 457 | Ga0207643_10202536 | 3300025908 | Bacteria | 1209 |
| 458 | Ga0207684_10000533 | 3300025910 | Bacteria | 47088 |
| 459 | Ga0207684_10003673 | 3300025910 | Bacteria | 14881 |
| 460 | Ga0207654_10059672 | 3300025911 | Bacteria | 2226 |
| 461 | Ga0207654_10378505 | 3300025911 | Unclassified | 980 |
| 462 | Ga0207654_10820222 | 3300025911 | Unclassified | 672 |
| 463 | Ga0207707_10023298 | 3300025912 | Bacteria | 5418 |
| 464 | Ga0207707_10549302 | 3300025912 | Unclassified | 981 |
| 465 | Ga0207707_10889786 | 3300025912 | Bacteria | 737 |
| 466 | Ga0207707_10917944 | 3300025912 | Bacteria | 723 |
| 467 | Ga0207695_10058106 | 3300025913 | Bacteria | 4016 |
| 468 | Ga0207695_10343027 | 3300025913 | Bacteria | 1381 |
| 469 | Ga0207695_10573449 | 3300025913 | Bacteria | 1010 |
| 470 | Ga0207695_10592542 | 3300025913 | Unclassified | 990 |
| 471 | Ga0207671_10087816 | 3300025914 | Bacteria | 2339 |
| 472 | Ga0207671_10235305 | 3300025914 | Bacteria | 1438 |
| 473 | Ga0207663_10038770 | 3300025916 | Bacteria | 2883 |
| 474 | Ga0207660_10089014 | 3300025917 | Bacteria | 2284 |
| 475 | Ga0207660_10110132 | 3300025917 | Unclassified | 2071 |
| 476 | Ga0207662_10007106 | 3300025918 | Bacteria | 6082 |
| 477 | Ga0207662_10017703 | 3300025918 | Bacteria | 4033 |
| 478 | Ga0207662_10117514 | 3300025918 | Bacteria | 1664 |
| 479 | Ga0207662_10185891 | 3300025918 | Bacteria | 1339 |
| 480 | Ga0207649_10036982 | 3300025920 | Bacteria | 2945 |
| 481 | Ga0207649_10236841 | 3300025920 | Bacteria | 1308 |
| 482 | Ga0207652_10291676 | 3300025921 | Bacteria | 1472 |
| 483 | Ga0207646_10153530 | 3300025922 | Bacteria | 2076 |
| 484 | Ga0207681_10039590 | 3300025923 | Bacteria | 3131 |
| 485 | Ga0207681_10057414 | 3300025923 | Bacteria | 2660 |
| 486 | Ga0207681_10278028 | 3300025923 | Unclassified | 1317 |
| 487 | Ga0207681_10359781 | 3300025923 | Unclassified | 1167 |
| 488 | Ga0207681_10793828 | 3300025923 | Unclassified | 791 |
| 489 | Ga0207694_10004561 | 3300025924 | Bacteria | 10801 |
| 490 | Ga0207694_10232774 | 3300025924 | Bacteria | 1505 |
| 491 | Ga0207694_10544966 | 3300025924 | Bacteria | 973 |
| 492 | Ga0207650_10000112 | 3300025925 | Bacteria | 106714 |
| 493 | Ga0207650_10160890 | 3300025925 | Bacteria | 1779 |
| 494 | Ga0207650_10463467 | 3300025925 | Bacteria | 1056 |
| 495 | Ga0207659_10106640 | 3300025926 | Bacteria | 2122 |
| 496 | Ga0207659_10582740 | 3300025926 | Unclassified | 953 |
| 497 | Ga0207659_11068451 | 3300025926 | Unclassified | 695 |
| 498 | Ga0207687_11267516 | 3300025927 | Unclassified | 634 |
| 499 | Ga0207644_10007284 | 3300025931 | Bacteria | 7201 |
| 500 | Ga0207644_10070744 | 3300025931 | Bacteria | 2551 |
| 501 | Ga0207644_10394374 | 3300025931 | Bacteria | 1130 |
| 502 | Ga0207644_10794844 | 3300025931 | Unclassified | 791 |
| 503 | Ga0207690_10032470 | 3300025932 | Bacteria | 3350 |
| 504 | Ga0207690_11234698 | 3300025932 | Unclassified | 624 |
| 505 | Ga0207706_10010103 | 3300025933 | Bacteria | 8644 |
| 506 | Ga0207706_10655378 | 3300025933 | Bacteria | 899 |
| 507 | Ga0207686_10058638 | 3300025934 | Bacteria | 2428 |
| 508 | Ga0207686_10133025 | 3300025934 | Bacteria | 1708 |
| 509 | Ga0207709_10005963 | 3300025935 | Bacteria | 6871 |
| 510 | Ga0207709_10009898 | 3300025935 | Bacteria | 5250 |
| 511 | Ga0207709_10062497 | 3300025935 | Bacteria | 2331 |
| 512 | Ga0207709_10671547 | 3300025935 | Bacteria | 827 |
| 513 | Ga0207709_11055027 | 3300025935 | Bacteria | 666 |
| 514 | Ga0207709_11087872 | 3300025935 | Unclassified | 656 |
| 515 | Ga0207670_10000957 | 3300025936 | Bacteria | 15223 |
| 516 | Ga0207670_10032374 | 3300025936 | Bacteria | 3362 |
| 517 | Ga0207670_10089005 | 3300025936 | Bacteria | 2178 |
| 518 | Ga0207670_10716294 | 3300025936 | Unclassified | 829 |
| 519 | Ga0207670_10800478 | 3300025936 | Unclassified | 785 |
| 520 | Ga0207669_10803261 | 3300025937 | Unclassified | 780 |
| 521 | Ga0207704_10023212 | 3300025938 | Bacteria | 3339 |
| 522 | Ga0207704_10055590 | 3300025938 | Bacteria | 2420 |
| 523 | Ga0207704_10160884 | 3300025938 | Unclassified | 1597 |
| 524 | Ga0207691_10001111 | 3300025940 | Bacteria | 26785 |
| 525 | Ga0207691_10146502 | 3300025940 | Bacteria | 2079 |
| 526 | Ga0207691_10215174 | 3300025940 | Unclassified | 1668 |
| 527 | Ga0207711_10007996 | 3300025941 | Bacteria | 8848 |
| 528 | Ga0207711_10023901 | 3300025941 | Bacteria | 5115 |
| 529 | Ga0207711_10119806 | 3300025941 | Unclassified | 2348 |
| 530 | Ga0207711_10571546 | 3300025941 | Bacteria | 1054 |
| 531 | Ga0207711_11125154 | 3300025941 | Bacteria | 726 |
| 532 | Ga0207689_10007769 | 3300025942 | Bacteria | 9384 |
| 533 | Ga0207689_10025774 | 3300025942 | Bacteria | 4926 |
| 534 | Ga0207689_10064726 | 3300025942 | Bacteria | 3007 |
| 535 | Ga0207689_10167071 | 3300025942 | Bacteria | 1813 |
| 536 | Ga0207679_10030908 | 3300025945 | Bacteria | 3744 |
| 537 | Ga0207679_10245404 | 3300025945 | Bacteria | 1520 |
| 538 | Ga0207679_10646701 | 3300025945 | Unclassified | 956 |
| 539 | Ga0207679_10761561 | 3300025945 | Bacteria | 881 |
| 540 | Ga0207667_10309137 | 3300025949 | Unclassified | 1615 |
| 541 | Ga0207667_10492617 | 3300025949 | Bacteria | 1244 |
| 542 | Ga0207651_10111153 | 3300025960 | Bacteria | 2057 |
| 543 | Ga0207651_10160424 | 3300025960 | Bacteria | 1762 |
| 544 | Ga0207651_10229712 | 3300025960 | Unclassified | 1505 |
| 545 | Ga0207651_10573349 | 3300025960 | Unclassified | 984 |
| 546 | Ga0207712_10007304 | 3300025961 | Bacteria | 6971 |
| 547 | Ga0207712_10011262 | 3300025961 | Bacteria | 5695 |
| 548 | Ga0207640_10091003 | 3300025981 | Unclassified | 2113 |
| 549 | Ga0207640_10181230 | 3300025981 | Bacteria | 1579 |
| 550 | Ga0207640_10462111 | 3300025981 | Bacteria | 1048 |
| 551 | Ga0207658_10277371 | 3300025986 | Unclassified | 1436 |
| 552 | Ga0207677_10130313 | 3300026023 | Unclassified | 1908 |
| 553 | Ga0207677_11203267 | 3300026023 | Bacteria | 694 |
| 554 | Ga0207703_10023842 | 3300026035 | Unclassified | 4812 |
| 555 | Ga0207703_10064235 | 3300026035 | Bacteria | 3012 |
| 556 | Ga0207703_10123140 | 3300026035 | Bacteria | 2229 |
| 557 | Ga0207703_10169600 | 3300026035 | Bacteria | 1918 |
| 558 | Ga0207703_10209192 | 3300026035 | Unclassified | 1738 |
| 559 | Ga0207703_10903207 | 3300026035 | Bacteria | 846 |
| 560 | Ga0207639_10014327 | 3300026041 | Bacteria | 5574 |
| 561 | Ga0207639_11254603 | 3300026041 | Unclassified | 695 |
| 562 | Ga0207708_10000074 | 3300026075 | Bacteria | 79215 |
| 563 | Ga0207708_10005201 | 3300026075 | Bacteria | 9594 |
| 564 | Ga0207708_10030970 | 3300026075 | Bacteria | 4060 |
| 565 | Ga0207708_10112728 | 3300026075 | Bacteria | 2112 |
| 566 | Ga0207708_10258485 | 3300026075 | Bacteria | 1405 |
| 567 | Ga0207708_10545479 | 3300026075 | Unclassified | 977 |
| 568 | Ga0207708_10849002 | 3300026075 | Unclassified | 788 |
| 569 | Ga0207702_10393618 | 3300026078 | Unclassified | 1335 |
| 570 | Ga0207641_10017575 | 3300026088 | Bacteria | 5855 |
| 571 | Ga0207641_10027580 | 3300026088 | Bacteria | 4691 |
| 572 | Ga0207641_10029218 | 3300026088 | Bacteria | 4558 |
| 573 | Ga0207641_10104130 | 3300026088 | Bacteria | 2505 |
| 574 | Ga0207641_10120209 | 3300026088 | Bacteria | 2343 |
| 575 | Ga0207641_10217080 | 3300026088 | Bacteria | 1772 |
| 576 | Ga0207641_10239560 | 3300026088 | Bacteria | 1690 |
| 577 | Ga0207641_10289323 | 3300026088 | Unclassified | 1544 |
| 578 | Ga0207641_10429838 | 3300026088 | Bacteria | 1273 |
| 579 | Ga0207648_10005481 | 3300026089 | Bacteria | 12788 |
| 580 | Ga0207648_10055692 | 3300026089 | Unclassified | 3451 |
| 581 | Ga0207648_10069594 | 3300026089 | Bacteria | 3066 |
| 582 | Ga0207648_10086829 | 3300026089 | Unclassified | 2729 |
| 583 | Ga0207648_10153051 | 3300026089 | Bacteria | 2035 |
| 584 | Ga0207648_10233480 | 3300026089 | Bacteria | 1636 |
| 585 | Ga0207648_10400948 | 3300026089 | Bacteria | 1243 |
| 586 | Ga0207676_10002972 | 3300026095 | Bacteria | 12095 |
| 587 | Ga0207676_10141770 | 3300026095 | Bacteria | 2058 |
| 588 | Ga0207676_10387513 | 3300026095 | Bacteria | 1303 |
| 589 | Ga0207676_10439810 | 3300026095 | Bacteria | 1227 |
| 590 | Ga0207676_10588524 | 3300026095 | Bacteria | 1067 |
| 591 | Ga0207676_10682231 | 3300026095 | Unclassified | 994 |
| 592 | Ga0207674_10004656 | 3300026116 | Bacteria | 16464 |
| 593 | Ga0207674_10075626 | 3300026116 | Bacteria | 3377 |
| 594 | Ga0207674_10146093 | 3300026116 | Bacteria | 2323 |
| 595 | Ga0207674_10232027 | 3300026116 | Bacteria | 1793 |
| 596 | Ga0207674_10473086 | 3300026116 | Unclassified | 1211 |
| 597 | Ga0207674_10671372 | 3300026116 | Bacteria | 1001 |
| 598 | Ga0207675_100013059 | 3300026118 | Bacteria | 7751 |
| 599 | Ga0207675_100088148 | 3300026118 | Unclassified | 2915 |
| 600 | Ga0207675_100098816 | 3300026118 | Bacteria | 2749 |
| 601 | Ga0207675_100158606 | 3300026118 | Bacteria | 2157 |
| 602 | Ga0207675_100348180 | 3300026118 | Unclassified | 1452 |
| 603 | Ga0207675_100372176 | 3300026118 | Bacteria | 1403 |
| 604 | Ga0207675_100949669 | 3300026118 | Unclassified | 877 |
| 605 | Ga0207683_10207617 | 3300026121 | Bacteria | 1782 |
| 606 | Ga0207683_10297668 | 3300026121 | Bacteria | 1476 |
| 607 | Ga0207698_10402321 | 3300026142 | Bacteria | 1309 |
| 608 | Ga0207698_10791867 | 3300026142 | Unclassified | 950 |
| 609 | Ga0209970_1035874 | 3300027614 | Unclassified | 872 |
| 610 | Ga0209983_1004828 | 3300027665 | Bacteria | 2814 |
| 611 | Ga0207428_10000019 | 3300027907 | Bacteria | 276945 |
| 612 | Ga0207428_10037183 | 3300027907 | Bacteria | 3963 |
| 613 | Ga0207428_10046498 | 3300027907 | Bacteria | 3490 |
| 614 | Ga0268265_10219121 | 3300028380 | Bacteria | 1664 |
| 615 | Ga0268265_10649961 | 3300028380 | Unclassified | 1013 |
| 616 | Ga0268265_10816311 | 3300028380 | Bacteria | 910 |
| 617 | Ga0268265_10956974 | 3300028380 | Bacteria | 844 |
| 618 | Ga0268264_10057234 | 3300028381 | Unclassified | 3261 |
| 619 | Ga0268264_10177548 | 3300028381 | Bacteria | 1931 |
| 620 | Ga0268264_10820378 | 3300028381 | Bacteria | 930 |
| 621 | Ga0268264_10920967 | 3300028381 | Unclassified | 878 |
| 622 | Ga0265323_10000323 | 3300028653 | Bacteria | 27404 |
| 623 | Ga0265336_10023629 | 3300028666 | Bacteria | 1948 |
| 624 | Ga0265330_10128302 | 3300031235 | Bacteria | 1080 |
| 625 | Ga0265332_10140877 | 3300031238 | Unclassified | 1010 |
| 626 | Ga0265332_10156065 | 3300031238 | Bacteria | 954 |
| 627 | Ga0265339_10151733 | 3300031249 | Bacteria | 1171 |
| 628 | Ga0265316_10032843 | 3300031344 | Bacteria | 4234 |
| 629 | Ga0265316_10052368 | 3300031344 | Unclassified | 3202 |
| 630 | Ga0265316_10203291 | 3300031344 | Bacteria | 1468 |
| 631 | Ga0265316_10542761 | 3300031344 | Unclassified | 828 |
| 632 | Ga0307513_10546948 | 3300031456 | Bacteria | 871 |
| 633 | Ga0307408_100033141 | 3300031548 | Unclassified | 3606 |
| 634 | Ga0307408_100070311 | 3300031548 | Bacteria | 2584 |
| 635 | Ga0307408_100971571 | 3300031548 | Unclassified | 781 |
| 636 | Ga0265314_10040041 | 3300031711 | Bacteria | 3368 |
| 637 | Ga0265342_10035846 | 3300031712 | Bacteria | 3033 |
| 638 | Ga0307405_10015144 | 3300031731 | Unclassified | 4167 |
| 639 | Ga0307405_10197420 | 3300031731 | Bacteria | 1458 |
| 640 | Ga0307410_10028486 | 3300031852 | Bacteria | 3544 |
| 641 | Ga0307406_10003612 | 3300031901 | Bacteria | 8426 |
| 642 | Ga0307406_10312163 | 3300031901 | Unclassified | 1213 |
| 643 | Ga0307412_10003279 | 3300031911 | Bacteria | 8982 |
| 644 | Ga0307412_10741772 | 3300031911 | Unclassified | 847 |
| 645 | Ga0307409_100238659 | 3300031995 | Unclassified | 1653 |
| 646 | Ga0307416_100195944 | 3300032002 | Bacteria | 1911 |
| 647 | Ga0307416_100236629 | 3300032002 | Bacteria | 1765 |
| 648 | Ga0307416_100243313 | 3300032002 | Unclassified | 1745 |
| 649 | Ga0307414_10002715 | 3300032004 | Bacteria | 9314 |
| 650 | Ga0307414_10089250 | 3300032004 | Bacteria | 2284 |
| 651 | Ga0307414_10137587 | 3300032004 | Bacteria | 1907 |
| 652 | Ga0307414_10617643 | 3300032004 | Bacteria | 974 |
| 653 | Ga0307411_10008953 | 3300032005 | Bacteria | 5226 |
| 654 | Ga0307415_100003868 | 3300032126 | Bacteria | 7682 |
| 655 | Ga0307415_100424826 | 3300032126 | Unclassified | 1142 |
| 656 | Ga0373926_0263485 | 3300035083 | Unclassified | 669 |
| 657 | Ga0373940_0200159 | 3300035088 | Bacteria | 656 |
| 658 | Ga0373951_0004792 | 3300035091 | Bacteria | 3186 |
| 659 | Ga0373943_0047284 | 3300035170 | Bacteria | 2103 |
| 660 | Ga0373946_0137236 | 3300035171 | Bacteria | 1130 |
| 661 | Ga0373961_0042099 | 3300035241 | Bacteria | 1323 |
| 662 | Ga0373931_0775267 | 3300035691 | Unclassified | 638 |
| 663 | Ga0373935_0086083 | 3300035692 | Unclassified | 2050 |
| 664 | Ga0373927_0000536 | 3300035695 | Bacteria | 28860 |
| 665 | Ga0373927_0147261 | 3300035695 | Unclassified | 1542 |
| 666 | Ga0373933_0235531 | 3300035724 | Bacteria | 1177 |
| 667 | Ga0373947_0007592 | 3300035725 | Bacteria | 6276 |
| 668 | Ga0373937_0655564 | 3300036401 | Bacteria | 995 |
| 669 | Ga0373937_1344854 | 3300036401 | Unclassified | 662 |
| 670 | Ga0373925_0000027 | 3300037068 | Bacteria | 154706 |
| 671 | Ga0373925_0490428 | 3300037068 | Bacteria | 1008 |
| 672 | Ga0373925_0708812 | 3300037068 | Unclassified | 830 |
| 673 | Ga0395900_0105505 | 3300037418 | Bacteria | 2895 |
| 674 | Ga0395898_0053030 | 3300037466 | Bacteria | 3961 |
| 675 | Ga0436364_0469743 | 3300037853 | Unclassified | 1400 |
| 676 | Ga0242422_01309 | 3300038699 | Unclassified | 1716 |
| 677 | Ga0436365_0466471 | 3300039437 | Bacteria | 8515 |
| 678 | Ga0436365_0746282 | 3300039437 | Bacteria | 2192 |
| 679 | Ga0436363_1523099 | 3300039450 | Bacteria | 1095 |
| 680 | Ga0439455_0017892 | 3300042012 | Bacteria | 1657 |
| 681 | Ga0450889_022670 | 3300042144 | Bacteria | 705 |
| 682 | Ga0439446_0078787 | 3300042156 | Bacteria | 1018 |
| 683 | Ga0439458_0002859 | 3300042157 | Bacteria | 4150 |
| 684 | Ga0450908_048562 | 3300042184 | Bacteria | 738 |
| 685 | Ga0439434_0017398 | 3300042435 | Bacteria | 2151 |
| 686 | Ga0466963_0379566 | 3300044694 | Unclassified | 996 |
| 687 | Ga0453684_1118939 | 3300044712 | Unclassified | 831 |
| 688 | Ga0466957_0303661 | 3300044842 | Bacteria | 1073 |
| 689 | Ga0466959_0423032 | 3300045049 | Bacteria | 904 |
| 690 | Ga0451576_0881052 | 3300045051 | Unclassified | 939 |
| 691 | Ga0451576_1026125 | 3300045051 | Unclassified | 864 |
| 692 | Ga0495592_0134920 | 3300046454 | Unclassified | 1723 |
| 693 | Ga0495651_0079753 | 3300046462 | Bacteria | 2473 |
| 694 | Ga0495651_0151974 | 3300046462 | Bacteria | 1668 |
| 695 | Ga0495653_0421660 | 3300046463 | Unclassified | 844 |
| 696 | Ga0495580_0001260 | 3300046472 | Bacteria | 22339 |
| 697 | Ga0495580_0043594 | 3300046472 | Bacteria | 3193 |
| 698 | Ga0495580_0111800 | 3300046472 | Bacteria | 1897 |
| 699 | Ga0495580_0406677 | 3300046472 | Unclassified | 917 |
| 700 | Ga0495662_0075355 | 3300046476 | Unclassified | 1637 |
| 701 | Ga0495662_0221612 | 3300046476 | Bacteria | 932 |
| 702 | Ga0495664_0006997 | 3300046477 | Bacteria | 6248 |
| 703 | Ga0495594_0088687 | 3300046499 | Bacteria | 1732 |
| 704 | Ga0495618_0132595 | 3300046514 | Bacteria | 1594 |
| 705 | Ga0495618_0172315 | 3300046514 | Unclassified | 1377 |
| 706 | Ga0495628_0312713 | 3300046516 | Unclassified | 1161 |
| 707 | Ga0495630_0026033 | 3300046517 | Unclassified | 4329 |
| 708 | Ga0495630_0591387 | 3300046517 | Unclassified | 851 |
| 709 | Ga0495666_0054372 | 3300046526 | Bacteria | 1920 |
| 710 | Ga0495652_0055394 | 3300046529 | Bacteria | 3372 |
| 711 | Ga0495665_0110074 | 3300046531 | Unclassified | 1445 |
| 712 | Ga0495665_0120023 | 3300046531 | Bacteria | 1377 |
| 713 | Ga0495665_0183308 | 3300046531 | Bacteria | 1087 |
| 714 | Ga0495640_0051269 | 3300046533 | Bacteria | 2837 |
| 715 | Ga0495586_0352486 | 3300046535 | Bacteria | 845 |
| 716 | Ga0495598_0000025 | 3300046537 | Bacteria | 24142 |
| 717 | Ga0495621_0001402 | 3300046539 | Bacteria | 6240 |
| 718 | Ga0495645_0097900 | 3300046543 | Bacteria | 2088 |
| 719 | Ga0495645_0350077 | 3300046543 | Unclassified | 952 |
| 720 | Ga0495645_0440222 | 3300046543 | Bacteria | 824 |
| 721 | Ga0495645_0590056 | 3300046543 | Unclassified | 684 |
| 722 | Ga0495667_0065648 | 3300046559 | Bacteria | 2374 |
| 723 | Ga0495656_0421787 | 3300046615 | Bacteria | 700 |
| 724 | Ga0495634_0298588 | 3300046642 | Unclassified | 974 |
| 725 | Ga0495635_0559005 | 3300046663 | Unclassified | 750 |
| 726 | Ga0495588_0058381 | 3300046674 | Bacteria | 1995 |
| 727 | Ga0495657_0137157 | 3300046675 | Bacteria | 1528 |
| 728 | Ga0495599_0067466 | 3300046678 | Bacteria | 2234 |
| 729 | Ga0495623_0136498 | 3300046679 | Bacteria | 1463 |
| 730 | Ga0495623_0164564 | 3300046679 | Unclassified | 1301 |
| 731 | Ga0495623_0178521 | 3300046679 | Unclassified | 1235 |
| 732 | Ga0495646_0038426 | 3300046680 | Unclassified | 2956 |
| 733 | Ga0495613_0043198 | 3300046689 | Unclassified | 3334 |
| 734 | Ga0495613_0322369 | 3300046689 | Bacteria | 1066 |
| 735 | Ga0495600_0055414 | 3300046809 | Bacteria | 2589 |
| 736 | Ga0495600_0116416 | 3300046809 | Bacteria | 1740 |
| 737 | Ga0495604_0013300 | 3300047317 | Bacteria | 6553 |
| 738 | Ga0495604_0032092 | 3300047317 | Bacteria | 4164 |
| 739 | Ga0495604_0151681 | 3300047317 | Unclassified | 1646 |
| 740 | Ga0495674_0016514 | 3300047319 | Bacteria | 6887 |
| 741 | Ga0495674_0016516 | 3300047319 | Bacteria | 6887 |
| 742 | Ga0495674_0593563 | 3300047319 | Unclassified | 878 |
| 743 | Ga0495672_0022123 | 3300047320 | Bacteria | 4138 |
| 744 | Ga0495675_0177684 | 3300047444 | Unclassified | 1305 |
| 745 | Ga0495684_0003936 | 3300047471 | Bacteria | 11578 |
| 746 | Ga0495684_0012823 | 3300047471 | Bacteria | 6469 |
| 747 | Ga0495684_0059490 | 3300047471 | Bacteria | 2909 |
| 748 | Ga0495684_0365936 | 3300047471 | Unclassified | 1020 |
| 749 | Ga0495602_0028403 | 3300048088 | Bacteria | 5353 |
| 750 | Ga0495614_0078217 | 3300048089 | Bacteria | 1431 |
| 751 | Ga0496104_1086693 | 3300048907 | Unclassified | 704 |
| 752 | Ga0496105_0647422 | 3300048908 | Unclassified | 816 |
| 753 | Ga0496108_0226242 | 3300048911 | Bacteria | 1626 |
| 754 | Ga0496108_0484139 | 3300048911 | Unclassified | 1081 |
| 755 | Ga0496110_0202483 | 3300048913 | Unclassified | 1804 |
| 756 | Ga0496110_0761472 | 3300048913 | Bacteria | 872 |
| 757 | Ga0496112_0140577 | 3300048915 | Bacteria | 2384 |
| 758 | Ga0496112_0182188 | 3300048915 | Bacteria | 2064 |
| 759 | Ga0496112_0481335 | 3300048915 | Bacteria | 1178 |
| 760 | Ga0496113_0013168 | 3300048916 | Bacteria | 5590 |
| 761 | Ga0496113_0747475 | 3300048916 | Bacteria | 779 |
| 762 | Ga0496114_0253513 | 3300048917 | Bacteria | 1549 |
| 763 | Ga0501291_011948 | 3300049514 | Bacteria | 1261 |
| 764 | Ga0501291_052662 | 3300049514 | Bacteria | 745 |
| 765 | Ga0501295_000894 | 3300049518 | Bacteria | 2875 |
| 766 | Ga0501295_063686 | 3300049518 | Unclassified | 812 |
| 767 | Ga0501296_022213 | 3300049519 | Bacteria | 816 |
| 768 | Ga0501297_010339 | 3300049520 | Bacteria | 1055 |
| 769 | Ga0501298_003744 | 3300049521 | Bacteria | 2370 |
| 770 | Ga0501299_062988 | 3300049522 | Bacteria | 789 |
| 771 | Ga0501299_084014 | 3300049522 | Unclassified | 712 |
| 772 | Ga0501031_0471994 | 3300049568 | Unclassified | 810 |
| 773 | Ga0501038_0001223 | 3300049574 | Bacteria | 23290 |
| 774 | Ga0501040_0398843 | 3300049576 | Bacteria | 988 |
| 775 | Ga0501041_0051377 | 3300049577 | Bacteria | 2513 |
| 776 | Ga0501042_0569594 | 3300049578 | Unclassified | 823 |
| 777 | Ga0501048_0522403 | 3300049582 | Bacteria | 851 |
| 778 | Ga0501076_0025214 | 3300049592 | Bacteria | 4601 |
| 779 | Ga0501077_0300852 | 3300049593 | Bacteria | 1022 |
| 780 | Ga0501198_020879 | 3300049649 | Unclassified | 1040 |
| 781 | Ga0501199_009152 | 3300049650 | Bacteria | 1045 |
| 782 | Ga0501202_001485 | 3300049652 | Unclassified | 3770 |
| 783 | Ga0501207_009305 | 3300049654 | Bacteria | 1434 |
| 784 | Ga0501210_006585 | 3300049657 | Unclassified | 855 |
| 785 | Ga0501214_009487 | 3300049659 | Bacteria | 1047 |
| 786 | Ga0501216_019529 | 3300049660 | Bacteria | 1177 |
| 787 | Ga0501217_000392 | 3300049661 | Bacteria | 7053 |
| 788 | Ga0501217_002225 | 3300049661 | Unclassified | 3785 |
| 789 | Ga0501217_005293 | 3300049661 | Unclassified | 2692 |
| 790 | Ga0501223_002306 | 3300049663 | Bacteria | 4257 |
| 791 | Ga0501224_004111 | 3300049664 | Unclassified | 2053 |
| 792 | Ga0501224_017389 | 3300049664 | Unclassified | 1069 |
| 793 | Ga0501227_000419 | 3300049665 | Bacteria | 9050 |
| 794 | Ga0501227_059249 | 3300049665 | Bacteria | 978 |
| 795 | Ga0501233_003913 | 3300049668 | Bacteria | 2700 |
| 796 | Ga0501235_006699 | 3300049669 | Bacteria | 2507 |
| 797 | Ga0501236_012587 | 3300049670 | Unclassified | 1143 |
| 798 | Ga0501240_003036 | 3300049673 | Bacteria | 1838 |
| 799 | Ga0501240_039507 | 3300049673 | Unclassified | 781 |
| 800 | Ga0501243_026896 | 3300049675 | Unclassified | 970 |
| 801 | Ga0501257_036952 | 3300049686 | Unclassified | 1190 |
| 802 | Ga0501259_009799 | 3300049688 | Bacteria | 1558 |
| 803 | Ga0501259_075802 | 3300049688 | Bacteria | 730 |
| 804 | Ga0501260_005810 | 3300049689 | Bacteria | 1171 |
| 805 | Ga0501225_0002302 | 3300049705 | Bacteria | 5901 |
| 806 | Ga0501225_0004997 | 3300049705 | Bacteria | 3919 |
| 807 | Ga0501225_0040090 | 3300049705 | Bacteria | 1290 |
| 808 | Ga0501225_0047624 | 3300049705 | Bacteria | 1190 |
| 809 | Ga0501229_012072 | 3300049706 | Unclassified | 1100 |
| 810 | Ga0501234_001008 | 3300049707 | Bacteria | 4471 |
| 811 | Ga0501245_007227 | 3300049708 | Bacteria | 1568 |
| 812 | Ga0501081_0180917 | 3300049743 | Unclassified | 1525 |
| 813 | Ga0501272_005995 | 3300049769 | Bacteria | 1293 |
| 814 | Ga0501273_004524 | 3300049770 | Bacteria | 1530 |
| 815 | Ga0501273_009252 | 3300049770 | Bacteria | 1193 |
| 816 | Ga0501279_009708 | 3300049775 | Bacteria | 1291 |
| 817 | Ga0501283_002976 | 3300049779 | Bacteria | 2223 |
| 818 | Ga0501283_025911 | 3300049779 | Unclassified | 962 |
| 819 | Ga0501035_0271942 | 3300049822 | Unclassified | 1434 |
| 820 | Ga0501045_0018591 | 3300049824 | Bacteria | 4945 |
| 821 | nmdc:mga05p37_331661_c1 | 3300050507 | Bacteria | 1797 |
| 822 | nmdc:mga05p37_409080_c1 | 3300050507 | Bacteria | 1582 |
| 823 | nmdc:mga05p37_59302_c1 | 3300050507 | Bacteria | 4713 |
| 824 | nmdc:mga05p37_680192_c1 | 3300050507 | Unclassified | 1147 |
| 825 | nmdc:mga05p37_82913_c1 | 3300050507 | Unclassified | 3951 |
| 826 | nmdc:mga05p37_871049_c1 | 3300050507 | Unclassified | 674 |
| 827 | nmdc:mga05p37_930104_c1 | 3300050507 | Unclassified | 933 |
| 828 | nmdc:mga09592_119509_c1 | 3300050508 | Bacteria | 2263 |
| 829 | nmdc:mga09592_150716_c1 | 3300050508 | Unclassified | 2006 |
| 830 | nmdc:mga09592_267694_c1 | 3300050508 | Bacteria | 1482 |
| 831 | nmdc:mga0qj67_189301_c1 | 3300050509 | Bacteria | 1672 |
| 832 | nmdc:mga0qj67_195935_c1 | 3300050509 | Bacteria | 1642 |
| 833 | nmdc:mga06r32_308879_c1 | 3300050510 | Bacteria | 1567 |
| 834 | nmdc:mga06r32_570618_c1 | 3300050510 | Unclassified | 1104 |
| 835 | nmdc:mga08y16_17931_c1 | 3300050511 | Bacteria | 7459 |
| 836 | nmdc:mga08y16_17_c1 | 3300050511 | Bacteria | 382598 |
| 837 | nmdc:mga08y16_22423_c1 | 3300050511 | Bacteria | 6665 |
| 838 | nmdc:mga08y16_244383_c1 | 3300050511 | Unclassified | 1855 |
| 839 | nmdc:mga0n895_463075_c1 | 3300050512 | Bacteria | 1279 |
| 840 | nmdc:mga0rr50_172513_c1 | 3300050513 | Bacteria | 1763 |
| 841 | nmdc:mga0rr50_419821_c1 | 3300050513 | Unclassified | 1131 |
| 842 | nmdc:mga0rr50_72054_c1 | 3300050513 | Bacteria | 2638 |
| 843 | nmdc:mga08x19_48465_c1 | 3300050514 | Bacteria | 2722 |
| 844 | nmdc:mga0a205_165146_c1 | 3300050515 | Bacteria | 2109 |
| 845 | nmdc:mga0a205_207441_c1 | 3300050515 | Unclassified | 1849 |
| 846 | nmdc:mga0a205_228715_c1 | 3300050515 | Unclassified | 1744 |
| 847 | nmdc:mga0a205_337285_c1 | 3300050515 | Bacteria | 1376 |
| 848 | nmdc:mga0a205_44105_c1 | 3300050515 | Bacteria | 4298 |
| 849 | nmdc:mga0a205_453235_c1 | 3300050515 | Unclassified | 1143 |
| 850 | nmdc:mga0a205_6715_c1 | 3300050515 | Bacteria | 10407 |
| 851 | Ga0495601_0228385 | 3300053077 | Unclassified | 1216 |
| 852 | Ga0501084_0750852 | 3300054114 | Unclassified | 822 |
| 853 | Ga0501082_0034590 | 3300060353 | Bacteria | 4355 |
| 854 | Ga0501082_0437827 | 3300060353 | Bacteria | 1142 |
| 855 | Ga0530510_0217000 | 3300061734 | Unclassified | 1421 |
| 856 | Ga0530510_0316199 | 3300061734 | Bacteria | 1170 |
| 857 | 2740031717 | 2739367866 | Bacteria | 4215900 |
| 858 | Ga0436363_1472361 | |||
| 859 | CNAas_1000674 | |||
| 860 | JGI24749J21850_1017327 | |||
| 861 | JGI24751J29686_10000023 | |||
| 862 | JGI25406J46586_10014833 | |||
| 863 | JGI26143J51219_1003133 | |||
| 864 | Ga0065714_10064432 | |||
| 865 | Ga0065712_10067730 | |||
| 866 | Ga0065712_10123696 | |||
| 867 | Ga0065715_10031331 | |||
| 868 | Ga0065715_10100075 | |||
| 869 | Ga0065715_10121787 | |||
| 870 | Ga0065715_10185734 | |||
| 871 | Ga0065715_10251049 | |||
| 872 | Ga0065715_10393182 | |||
| 873 | Ga0065715_10447176 | |||
| 874 | Ga0065715_10487911 | |||
| 875 | Ga0065707_10002957 | |||
| 876 | Ga0065707_10139226 | |||
| 877 | Ga0065707_10457469 | |||
| 878 | Ga0070658_10387144 | |||
| 879 | Ga0070658_10565625 | |||
| 880 | Ga0070676_10027009 | |||
| 881 | Ga0070676_10123541 | |||
| 882 | Ga0070683_100000049 | |||
| 883 | Ga0070690_100079526 | |||
| 884 | Ga0070690_100171911 | |||
| 885 | Ga0070670_100000324 | |||
| 886 | Ga0070670_100180022 | |||
| 887 | Ga0070670_100555808 | |||
| 888 | Ga0070670_100802968 | |||
| 889 | Ga0070677_10055399 | |||
| 890 | Ga0070677_10233167 | |||
| 891 | Ga0068869_100003254 | |||
| 892 | Ga0068869_100052330 | |||
| 893 | Ga0068869_100094368 | |||
| 894 | Ga0068869_100285710 | |||
| 895 | Ga0070680_100032700 | |||
| 896 | Ga0070682_100008637 | |||
| 897 | Ga0070682_100101249 | |||
| 898 | Ga0068868_100027093 | |||
| 899 | Ga0070660_100087326 | |||
| 900 | Ga0070660_100442413 | |||
| 901 | Ga0070689_100011673 | |||
| 902 | Ga0070689_100027432 | |||
| 903 | Ga0070689_100027477 | |||
| 904 | Ga0070689_100243944 | |||
| 905 | Ga0070689_100282558 | |||
| 906 | Ga0070689_100726742 | |||
| 907 | Ga0070689_100963003 | |||
| 908 | Ga0070691_10500327 | |||
| 909 | Ga0070687_100137190 | |||
| 910 | Ga0070661_100054282 | |||
| 911 | Ga0070692_10018538 | |||
| 912 | Ga0070692_10022138 | |||
| 913 | Ga0070692_10120201 | |||
| 914 | Ga0070692_10203427 | |||
| 915 | Ga0070692_10617741 | |||
| 916 | Ga0070669_100014481 | |||
| 917 | Ga0070669_100040070 | |||
| 918 | Ga0070669_100243313 | |||
| 919 | Ga0070675_100232182 | |||
| 920 | Ga0070671_100041883 | |||
| 921 | Ga0070671_100104459 | |||
| 922 | Ga0070671_100225242 | |||
| 923 | Ga0070671_100234716 | |||
| 924 | Ga0070671_100304023 | |||
| 925 | Ga0070674_100204638 | |||
| 926 | Ga0070674_100210328 | |||
| 927 | Ga0070674_100468620 | |||
| 928 | Ga0070674_100566825 | |||
| 929 | Ga0070674_101118609 | |||
| 930 | Ga0070673_100017320 | |||
| 931 | Ga0070673_100021714 | |||
| 932 | Ga0070673_100176477 | |||
| 933 | Ga0070673_100418495 | |||
| 934 | Ga0070673_100778272 | |||
| 935 | Ga0070688_100086129 | |||
| 936 | Ga0070659_100239808 | |||
| 937 | Ga0070659_100733680 | |||
| 938 | Ga0070714_100028604 | |||
| 939 | Ga0070714_101158617 | |||
| 940 | Ga0070701_10040901 | |||
| 941 | Ga0070701_10084921 | |||
| 942 | Ga0070701_10150515 | |||
| 943 | Ga0070701_10205141 | |||
| 944 | Ga0070701_10468147 | |||
| 945 | Ga0070705_100063400 | |||
| 946 | Ga0070705_100091119 | |||
| 947 | Ga0070705_100602788 | |||
| 948 | Ga0070705_100672283 | |||
| 949 | Ga0070705_100735190 | |||
| 950 | Ga0070700_100000042 | |||
| 951 | Ga0070700_100007847 | |||
| 952 | Ga0070700_100008567 | |||
| 953 | Ga0070700_100169994 | |||
| 954 | Ga0070700_100192856 | |||
| 955 | Ga0070700_100221369 | |||
| 956 | Ga0070700_100810066 | |||
| 957 | Ga0070694_100007222 | |||
| 958 | Ga0070694_100210089 | |||
| 959 | Ga0070694_100218003 | |||
| 960 | Ga0070694_100222726 | |||
| 961 | Ga0070694_100587471 | |||
| 962 | Ga0070694_100904374 | |||
| 963 | Ga0070708_100477641 | |||
| 964 | Ga0070678_100167982 | |||
| 965 | Ga0070662_100083098 | |||
| 966 | Ga0070662_100914117 | |||
| 967 | Ga0070681_10004835 | |||
| 968 | Ga0070681_10012618 | |||
| 969 | Ga0070681_10238495 | |||
| 970 | Ga0070681_11286305 | |||
| 971 | Ga0068867_100003348 | |||
| 972 | Ga0068867_100107069 | |||
| 973 | Ga0068867_100304488 | |||
| 974 | Ga0068867_100307531 | |||
| 975 | Ga0070685_10105037 | |||
| 976 | Ga0070685_10817956 | |||
| 977 | Ga0070706_100000480 | |||
| 978 | Ga0070706_100004115 | |||
| 979 | Ga0070707_100246377 | |||
| 980 | Ga0070698_100040712 | |||
| 981 | Ga0070698_100045289 | |||
| 982 | Ga0070698_100124135 | |||
| 983 | Ga0070698_100798276 | |||
| 984 | Ga0070699_100002826 | |||
| 985 | Ga0070699_100013038 | |||
| 986 | Ga0070699_100089628 | |||
| 987 | Ga0070699_100238296 | |||
| 988 | Ga0070699_100394154 | |||
| 989 | Ga0070699_100749426 | |||
| 990 | Ga0070679_100145625 | |||
| 991 | Ga0070679_100216611 | |||
| 992 | Ga0070684_100798446 | |||
| 993 | Ga0070684_101221740 | |||
| 994 | Ga0070697_100002092 | |||
| 995 | Ga0070697_100605110 | |||
| 996 | Ga0068853_100011334 | |||
| 997 | Ga0068853_100810990 | |||
| 998 | Ga0070672_100025282 | |||
| 999 | Ga0070672_100085642 | |||
| 1000 | Ga0070672_100766123 | |||
| 1001 | Ga0070686_100011993 | |||
| 1002 | Ga0070686_100022711 | |||
| 1003 | Ga0070695_100157973 | |||
| 1004 | Ga0070695_100361549 | |||
| 1005 | Ga0070696_100009805 | |||
| 1006 | Ga0070696_100017946 | |||
| 1007 | Ga0070696_100161336 | |||
| 1008 | Ga0070696_100197066 | |||
| 1009 | Ga0070696_100246898 | |||
| 1010 | Ga0070696_100351331 | |||
| 1011 | Ga0070696_100597282 | |||
| 1012 | Ga0070696_100824637 | |||
| 1013 | Ga0070693_100000402 | |||
| 1014 | Ga0070693_100014015 | |||
| 1015 | Ga0070693_100715137 | |||
| 1016 | Ga0070693_100723639 | |||
| 1017 | Ga0070665_100380434 | |||
| 1018 | Ga0070704_100271634 | |||
| 1019 | Ga0070704_100420784 | |||
| 1020 | Ga0070704_100569847 | |||
| 1021 | Ga0070704_100785528 | |||
| 1022 | Ga0068855_100244418 | |||
| 1023 | Ga0068855_100362306 | |||
| 1024 | Ga0068855_100543156 | |||
| 1025 | Ga0070664_100025594 | |||
| 1026 | Ga0070664_100157169 | |||
| 1027 | Ga0070664_100175967 | |||
| 1028 | Ga0070664_100388068 | |||
| 1029 | Ga0070664_101205559 | |||
| 1030 | Ga0068857_100002908 | |||
| 1031 | Ga0068857_100275760 | |||
| 1032 | Ga0068857_100300568 | |||
| 1033 | Ga0068857_100348267 | |||
| 1034 | Ga0068854_100065434 | |||
| 1035 | Ga0068854_100190193 | |||
| 1036 | Ga0068854_100214561 | |||
| 1037 | Ga0068856_100499637 | |||
| 1038 | Ga0068856_100758793 | |||
| 1039 | Ga0070702_100121770 | |||
| 1040 | Ga0070702_100195789 | |||
| 1041 | Ga0070702_100371833 | |||
| 1042 | Ga0068852_100776519 | |||
| 1043 | Ga0068859_100041310 | |||
| 1044 | Ga0068859_100047427 | |||
| 1045 | Ga0068859_100057602 | |||
| 1046 | Ga0068859_100059419 | |||
| 1047 | Ga0068859_100158857 | |||
| 1048 | Ga0068859_100272047 | |||
| 1049 | Ga0068859_100295990 | |||
| 1050 | Ga0068859_100442786 | |||
| 1051 | Ga0068859_100541769 | |||
| 1052 | Ga0068859_100632463 | |||
| 1053 | Ga0068859_100754633 | |||
| 1054 | Ga0068859_101011296 | |||
| 1055 | Ga0068859_101154476 | |||
| 1056 | Ga0068859_101219473 | |||
| 1057 | Ga0068864_100003467 | |||
| 1058 | Ga0068864_100033289 | |||
| 1059 | Ga0068864_100056051 | |||
| 1060 | Ga0068864_100086157 | |||
| 1061 | Ga0068864_100107851 | |||
| 1062 | Ga0068864_100236543 | |||
| 1063 | Ga0068864_100311369 | |||
| 1064 | Ga0068864_100558243 | |||
| 1065 | Ga0068864_100669693 | |||
| 1066 | Ga0068864_100722005 | |||
| 1067 | Ga0068864_101025665 | |||
| 1068 | Ga0068866_10030747 | |||
| 1069 | Ga0068861_100011357 | |||
| 1070 | Ga0068861_100031108 | |||
| 1071 | Ga0068861_100178896 | |||
| 1072 | Ga0068861_101458992 | |||
| 1073 | Ga0068870_10015961 | |||
| 1074 | Ga0068870_10031416 | |||
| 1075 | Ga0068870_10057483 | |||
| 1076 | Ga0068870_10099471 | |||
| 1077 | Ga0068870_10343172 | |||
| 1078 | Ga0068863_100047941 | |||
| 1079 | Ga0068863_100050680 | |||
| 1080 | Ga0068863_100072922 | |||
| 1081 | Ga0068863_100148358 | |||
| 1082 | Ga0068863_100296654 | |||
| 1083 | Ga0068863_100440515 | |||
| 1084 | Ga0068863_100577168 | |||
| 1085 | Ga0068863_100814421 | |||
| 1086 | Ga0068858_100033656 | |||
| 1087 | Ga0068858_100038439 | |||
| 1088 | Ga0068858_100074702 | |||
| 1089 | Ga0068858_100247598 | |||
| 1090 | Ga0068858_100259811 | |||
| 1091 | Ga0068858_100522770 | |||
| 1092 | Ga0068860_100050177 | |||
| 1093 | Ga0068860_100074230 | |||
| 1094 | Ga0068860_100105920 | |||
| 1095 | Ga0068860_100113607 | |||
| 1096 | Ga0068860_100220328 | |||
| 1097 | Ga0068860_100255730 | |||
| 1098 | Ga0068860_100266308 | |||
| 1099 | Ga0068860_100482496 | |||
| 1100 | Ga0068862_100029204 | |||
| 1101 | Ga0068862_100122364 | |||
| 1102 | Ga0068862_100552675 | |||
| 1103 | Ga0068862_101391780 | |||
| 1104 | Ga0081539_10000395 | |||
| 1105 | Ga0081539_10003972 | |||
| 1106 | Ga0070717_10005114 | |||
| 1107 | Ga0097621_100005127 | |||
| 1108 | Ga0097621_100007032 | |||
| 1109 | Ga0097621_100011502 | |||
| 1110 | Ga0097621_100062212 | |||
| 1111 | Ga0097621_100103789 | |||
| 1112 | Ga0097621_100712539 | |||
| 1113 | Ga0097621_100810621 | |||
| 1114 | Ga0068871_100001848 | |||
| 1115 | Ga0068871_100019407 | |||
| 1116 | Ga0068871_100307594 | |||
| 1117 | Ga0068871_100355326 | |||
| 1118 | Ga0075428_100000005 | |||
| 1119 | Ga0075428_100023016 | |||
| 1120 | Ga0075428_100200086 | |||
| 1121 | Ga0075428_100712071 | |||
| 1122 | Ga0075428_101465039 | |||
| 1123 | Ga0075430_100018829 | |||
| 1124 | Ga0075430_100102245 | |||
| 1125 | Ga0075431_100113586 | |||
| 1126 | Ga0075431_100121061 | |||
| 1127 | Ga0075433_10011090 | |||
| 1128 | Ga0075433_10017396 | |||
| 1129 | Ga0075433_10055957 | |||
| 1130 | Ga0075433_10149512 | |||
| 1131 | Ga0075433_10304639 | |||
| 1132 | Ga0075433_10446298 | |||
| 1133 | Ga0075434_100130601 | |||
| 1134 | Ga0075434_100361829 | |||
| 1135 | Ga0075434_100544209 | |||
| 1136 | Ga0075434_101110888 | |||
| 1137 | Ga0075429_100143689 | |||
| 1138 | Ga0075429_100164633 | |||
| 1139 | Ga0075429_100252538 | |||
| 1140 | Ga0068865_100012490 | |||
| 1141 | Ga0068865_100108352 | |||
| 1142 | Ga0075436_100057046 | |||
| 1143 | Ga0075436_100381594 | |||
| 1144 | Ga0097620_100041307 | |||
| 1145 | Ga0097620_100047428 | |||
| 1146 | Ga0097620_100057603 | |||
| 1147 | Ga0097620_100059419 | |||
| 1148 | Ga0097620_100158846 | |||
| 1149 | Ga0097620_100272035 | |||
| 1150 | Ga0097620_100295988 | |||
| 1151 | Ga0097620_100442759 | |||
| 1152 | Ga0097620_100541769 | |||
| 1153 | Ga0097620_100632460 | |||
| 1154 | Ga0097620_100754439 | |||
| 1155 | Ga0097620_101011248 | |||
| 1156 | Ga0097620_101154469 | |||
| 1157 | Ga0097620_101219408 | |||
| 1158 | Ga0075435_100095799 | |||
| 1159 | Ga0075435_100227399 | |||
| 1160 | Ga0105251_10143599 | |||
| 1161 | Ga0105240_10033317 | |||
| 1162 | Ga0105240_10235101 | |||
| 1163 | Ga0105240_10554141 | |||
| 1164 | Ga0105240_11017638 | |||
| 1165 | Ga0111539_10000008 | |||
| 1166 | Ga0111539_10000296 | |||
| 1167 | Ga0111539_10011429 | |||
| 1168 | Ga0111539_10081498 | |||
| 1169 | Ga0111539_10241896 | |||
| 1170 | Ga0105245_10388314 | |||
| 1171 | Ga0105245_10982530 | |||
| 1172 | Ga0105245_11086035 | |||
| 1173 | Ga0105247_10000635 | |||
| 1174 | Ga0105247_10049986 | |||
| 1175 | Ga0105247_10192937 | |||
| 1176 | Ga0114129_10033107 | |||
| 1177 | Ga0114129_10087466 | |||
| 1178 | Ga0114129_10110163 | |||
| 1179 | Ga0114129_10212214 | |||
| 1180 | Ga0114129_10255583 | |||
| 1181 | Ga0114129_10345850 | |||
| 1182 | Ga0114129_10520464 | |||
| 1183 | Ga0114129_10542574 | |||
| 1184 | Ga0114129_10700134 | |||
| 1185 | Ga0114129_10762196 | |||
| 1186 | Ga0114129_10887549 | |||
| 1187 | Ga0114129_10986819 | |||
| 1188 | Ga0114129_11051584 | |||
| 1189 | Ga0105243_10072678 | |||
| 1190 | Ga0105243_10207229 | |||
| 1191 | Ga0105243_10306799 | |||
| 1192 | Ga0105243_10916661 | |||
| 1193 | Ga0105243_10965942 | |||
| 1194 | Ga0105243_11255018 | |||
| 1195 | Ga0105243_11306423 | |||
| 1196 | Ga0105243_11472731 | |||
| 1197 | Ga0105241_10030898 | |||
| 1198 | Ga0105241_10260096 | |||
| 1199 | Ga0105241_10363570 | |||
| 1200 | Ga0105241_10457433 | |||
| 1201 | Ga0105241_10570045 | |||
| 1202 | Ga0105241_10720048 | |||
| 1203 | Ga0105241_10953702 | |||
| 1204 | Ga0105242_10010982 | |||
| 1205 | Ga0105242_10090605 | |||
| 1206 | Ga0105242_10753368 | |||
| 1207 | Ga0105248_10005991 | |||
| 1208 | Ga0105248_10019085 | |||
| 1209 | Ga0105248_10030093 | |||
| 1210 | Ga0105248_10156156 | |||
| 1211 | Ga0105248_10261700 | |||
| 1212 | Ga0105248_10264910 | |||
| 1213 | Ga0105248_10301738 | |||
| 1214 | Ga0105248_10351207 | |||
| 1215 | Ga0105248_10641958 | |||
| 1216 | Ga0105248_11227051 | |||
| 1217 | Ga0105248_11246593 | |||
| 1218 | Ga0105248_11462002 | |||
| 1219 | Ga0105237_10003124 | |||
| 1220 | Ga0105237_10042090 | |||
| 1221 | Ga0105238_10004387 | |||
| 1222 | Ga0105238_10104245 | |||
| 1223 | Ga0105238_10128368 | |||
| 1224 | Ga0105238_11082237 | |||
| 1225 | Ga0105238_11654762 | |||
| 1226 | Ga0105249_10262291 | |||
| 1227 | Ga0105249_10309965 | |||
| 1228 | Ga0105249_10508827 | |||
| 1229 | Ga0105249_11226261 | |||
| 1230 | Ga0105249_11885498 | |||
| 1231 | Ga0105239_10058566 | |||
| 1232 | Ga0105239_10327155 | |||
| 1233 | Ga0105239_10734793 | |||
| 1234 | Ga0105246_10009378 | |||
| 1235 | Ga0105246_10577735 | |||
| 1236 | Ga0105246_10820279 | |||
| 1237 | Ga0105246_11024316 | |||
| 1238 | Ga0157373_10002544 | |||
| 1239 | Ga0157373_10035422 | |||
| 1240 | Ga0157373_10444647 | |||
| 1241 | Ga0157371_10093967 | |||
| 1242 | Ga0157371_10840685 | |||
| 1243 | Ga0157369_10217396 | |||
| 1244 | Ga0157369_10356752 | |||
| 1245 | Ga0157374_10096087 | |||
| 1246 | Ga0157374_10367840 | |||
| 1247 | Ga0157374_10904502 | |||
| 1248 | Ga0157378_10006269 | |||
| 1249 | Ga0157378_10021443 | |||
| 1250 | Ga0157378_10295210 | |||
| 1251 | Ga0157378_10809448 | |||
| 1252 | Ga0163162_10012363 | |||
| 1253 | Ga0163162_10021338 | |||
| 1254 | Ga0163162_10028788 | |||
| 1255 | Ga0163162_10086569 | |||
| 1256 | Ga0163162_10148758 | |||
| 1257 | Ga0163162_10164738 | |||
| 1258 | Ga0163162_10196005 | |||
| 1259 | Ga0163162_11122967 | |||
| 1260 | Ga0163162_11289070 | |||
| 1261 | Ga0157372_10305288 | |||
| 1262 | Ga0157372_10470037 | |||
| 1263 | Ga0157372_10516606 | |||
| 1264 | Ga0157372_10556336 | |||
| 1265 | Ga0157372_10715772 | |||
| 1266 | Ga0157375_10024070 | |||
| 1267 | Ga0157375_10032881 | |||
| 1268 | Ga0157375_10309097 | |||
| 1269 | Ga0157375_10571728 | |||
| 1270 | Ga0157375_10888647 | |||
| 1271 | Ga0157375_11172318 | |||
| 1272 | Ga0157375_11390214 | |||
| 1273 | Ga0163163_10002165 | |||
| 1274 | Ga0163163_10013625 | |||
| 1275 | Ga0163163_10049856 | |||
| 1276 | Ga0163163_10239451 | |||
| 1277 | Ga0163163_10261649 | |||
| 1278 | Ga0163163_10471618 | |||
| 1279 | Ga0163163_10607984 | |||
| 1280 | Ga0163163_10976793 | |||
| 1281 | Ga0157380_10015020 | |||
| 1282 | Ga0157380_10176013 | |||
| 1283 | Ga0157380_10416716 | |||
| 1284 | Ga0157377_10007824 | |||
| 1285 | Ga0157379_10079047 | |||
| 1286 | Ga0157379_10167018 | |||
| 1287 | Ga0157379_10362224 | |||
| 1288 | Ga0157379_10630698 | |||
| 1289 | Ga0157376_10049234 | |||
| 1290 | Ga0157376_10231965 | |||
| 1291 | Ga0157376_10273948 | |||
| 1292 | Ga0157376_10441515 | |||
| 1293 | Ga0157376_10802684 | |||
| 1294 | Ga0163161_10014405 | |||
| 1295 | Ga0163161_10131957 | |||
| 1296 | Ga0163161_10354872 | |||
| 1297 | Ga0163161_10437857 | |||
| 1298 | Ga0213874_10047563 | |||
| 1299 | Ga0213876_10008368 | |||
| 1300 | Ga0209455_1004878 | |||
| 1301 | Ga0207653_10064092 | |||
| 1302 | Ga0207653_10172840 | |||
| 1303 | Ga0207710_10001176 | |||
| 1304 | Ga0207710_10190953 | |||
| 1305 | Ga0207680_10632292 | |||
| 1306 | Ga0207647_10000445 | |||
| 1307 | Ga0207647_10298592 | |||
| 1308 | Ga0207645_10028136 | |||
| 1309 | Ga0207645_10119972 | |||
| 1310 | Ga0207643_10001352 | |||
| 1311 | Ga0207643_10013247 | |||
| 1312 | Ga0207643_10036221 | |||
| 1313 | Ga0207643_10064465 | |||
| 1314 | Ga0207643_10202536 | |||
| 1315 | Ga0207684_10000533 | |||
| 1316 | Ga0207684_10003673 | |||
| 1317 | Ga0207654_10059672 | |||
| 1318 | Ga0207654_10378505 | |||
| 1319 | Ga0207654_10820222 | |||
| 1320 | Ga0207707_10023298 | |||
| 1321 | Ga0207707_10549302 | |||
| 1322 | Ga0207707_10889786 | |||
| 1323 | Ga0207707_10917944 | |||
| 1324 | Ga0207695_10058106 | |||
| 1325 | Ga0207695_10343027 | |||
| 1326 | Ga0207695_10573449 | |||
| 1327 | Ga0207695_10592542 | |||
| 1328 | Ga0207671_10087816 | |||
| 1329 | Ga0207671_10235305 | |||
| 1330 | Ga0207663_10038770 | |||
| 1331 | Ga0207660_10089014 | |||
| 1332 | Ga0207660_10110132 | |||
| 1333 | Ga0207662_10007106 | |||
| 1334 | Ga0207662_10017703 | |||
| 1335 | Ga0207662_10117514 | |||
| 1336 | Ga0207662_10185891 | |||
| 1337 | Ga0207649_10036982 | |||
| 1338 | Ga0207649_10236841 | |||
| 1339 | Ga0207652_10291676 | |||
| 1340 | Ga0207646_10153530 | |||
| 1341 | Ga0207681_10039590 | |||
| 1342 | Ga0207681_10057414 | |||
| 1343 | Ga0207681_10278028 | |||
| 1344 | Ga0207681_10359781 | |||
| 1345 | Ga0207681_10793828 | |||
| 1346 | Ga0207694_10004561 | |||
| 1347 | Ga0207694_10232774 | |||
| 1348 | Ga0207694_10544966 | |||
| 1349 | Ga0207650_10000112 | |||
| 1350 | Ga0207650_10160890 | |||
| 1351 | Ga0207650_10463467 | |||
| 1352 | Ga0207659_10106640 | |||
| 1353 | Ga0207659_10582740 | |||
| 1354 | Ga0207659_11068451 | |||
| 1355 | Ga0207687_11267516 | |||
| 1356 | Ga0207644_10007284 | |||
| 1357 | Ga0207644_10070744 | |||
| 1358 | Ga0207644_10394374 | |||
| 1359 | Ga0207644_10794844 | |||
| 1360 | Ga0207690_10032470 | |||
| 1361 | Ga0207690_11234698 | |||
| 1362 | Ga0207706_10010103 | |||
| 1363 | Ga0207706_10655378 | |||
| 1364 | Ga0207686_10058638 | |||
| 1365 | Ga0207686_10133025 | |||
| 1366 | Ga0207709_10005963 | |||
| 1367 | Ga0207709_10009898 | |||
| 1368 | Ga0207709_10062497 | |||
| 1369 | Ga0207709_10671547 | |||
| 1370 | Ga0207709_11055027 | |||
| 1371 | Ga0207709_11087872 | |||
| 1372 | Ga0207670_10000957 | |||
| 1373 | Ga0207670_10032374 | |||
| 1374 | Ga0207670_10089005 | |||
| 1375 | Ga0207670_10716294 | |||
| 1376 | Ga0207670_10800478 | |||
| 1377 | Ga0207669_10803261 | |||
| 1378 | Ga0207704_10023212 | |||
| 1379 | Ga0207704_10055590 | |||
| 1380 | Ga0207704_10160884 | |||
| 1381 | Ga0207691_10001111 | |||
| 1382 | Ga0207691_10146502 | |||
| 1383 | Ga0207691_10215174 | |||
| 1384 | Ga0207711_10007996 | |||
| 1385 | Ga0207711_10023901 | |||
| 1386 | Ga0207711_10119806 | |||
| 1387 | Ga0207711_10571546 | |||
| 1388 | Ga0207711_11125154 | |||
| 1389 | Ga0207689_10007769 | |||
| 1390 | Ga0207689_10025774 | |||
| 1391 | Ga0207689_10064726 | |||
| 1392 | Ga0207689_10167071 | |||
| 1393 | Ga0207679_10030908 | |||
| 1394 | Ga0207679_10245404 | |||
| 1395 | Ga0207679_10646701 | |||
| 1396 | Ga0207679_10761561 | |||
| 1397 | Ga0207667_10309137 | |||
| 1398 | Ga0207667_10492617 | |||
| 1399 | Ga0207651_10111153 | |||
| 1400 | Ga0207651_10160424 | |||
| 1401 | Ga0207651_10229712 | |||
| 1402 | Ga0207651_10573349 | |||
| 1403 | Ga0207712_10007304 | |||
| 1404 | Ga0207712_10011262 | |||
| 1405 | Ga0207640_10091003 | |||
| 1406 | Ga0207640_10181230 | |||
| 1407 | Ga0207640_10462111 | |||
| 1408 | Ga0207658_10277371 | |||
| 1409 | Ga0207677_10130313 | |||
| 1410 | Ga0207677_11203267 | |||
| 1411 | Ga0207703_10023842 | |||
| 1412 | Ga0207703_10064235 | |||
| 1413 | Ga0207703_10123140 | |||
| 1414 | Ga0207703_10169600 | |||
| 1415 | Ga0207703_10209192 | |||
| 1416 | Ga0207703_10903207 | |||
| 1417 | Ga0207639_10014327 | |||
| 1418 | Ga0207639_11254603 | |||
| 1419 | Ga0207708_10000074 | |||
| 1420 | Ga0207708_10005201 | |||
| 1421 | Ga0207708_10030970 | |||
| 1422 | Ga0207708_10112728 | |||
| 1423 | Ga0207708_10258485 | |||
| 1424 | Ga0207708_10545479 | |||
| 1425 | Ga0207708_10849002 | |||
| 1426 | Ga0207702_10393618 | |||
| 1427 | Ga0207641_10017575 | |||
| 1428 | Ga0207641_10027580 | |||
| 1429 | Ga0207641_10029218 | |||
| 1430 | Ga0207641_10104130 | |||
| 1431 | Ga0207641_10120209 | |||
| 1432 | Ga0207641_10217080 | |||
| 1433 | Ga0207641_10239560 | |||
| 1434 | Ga0207641_10289323 | |||
| 1435 | Ga0207641_10429838 | |||
| 1436 | Ga0207648_10005481 | |||
| 1437 | Ga0207648_10055692 | |||
| 1438 | Ga0207648_10069594 | |||
| 1439 | Ga0207648_10086829 | |||
| 1440 | Ga0207648_10153051 | |||
| 1441 | Ga0207648_10233480 | |||
| 1442 | Ga0207648_10400948 | |||
| 1443 | Ga0207676_10002972 | |||
| 1444 | Ga0207676_10141770 | |||
| 1445 | Ga0207676_10387513 | |||
| 1446 | Ga0207676_10439810 | |||
| 1447 | Ga0207676_10588524 | |||
| 1448 | Ga0207676_10682231 | |||
| 1449 | Ga0207674_10004656 | |||
| 1450 | Ga0207674_10075626 | |||
| 1451 | Ga0207674_10146093 | |||
| 1452 | Ga0207674_10232027 | |||
| 1453 | Ga0207674_10473086 | |||
| 1454 | Ga0207674_10671372 | |||
| 1455 | Ga0207675_100013059 | |||
| 1456 | Ga0207675_100088148 | |||
| 1457 | Ga0207675_100098816 | |||
| 1458 | Ga0207675_100158606 | |||
| 1459 | Ga0207675_100348180 | |||
| 1460 | Ga0207675_100372176 | |||
| 1461 | Ga0207675_100949669 | |||
| 1462 | Ga0207683_10207617 | |||
| 1463 | Ga0207683_10297668 | |||
| 1464 | Ga0207698_10402321 | |||
| 1465 | Ga0207698_10791867 | |||
| 1466 | Ga0209970_1035874 | |||
| 1467 | Ga0209983_1004828 | |||
| 1468 | Ga0207428_10000019 | |||
| 1469 | Ga0207428_10037183 | |||
| 1470 | Ga0207428_10046498 | |||
| 1471 | Ga0268265_10219121 | |||
| 1472 | Ga0268265_10649961 | |||
| 1473 | Ga0268265_10816311 | |||
| 1474 | Ga0268265_10956974 | |||
| 1475 | Ga0268264_10057234 | |||
| 1476 | Ga0268264_10177548 | |||
| 1477 | Ga0268264_10820378 | |||
| 1478 | Ga0268264_10920967 | |||
| 1479 | Ga0265323_10000323 | |||
| 1480 | Ga0265336_10023629 | |||
| 1481 | Ga0265330_10128302 | |||
| 1482 | Ga0265332_10140877 | |||
| 1483 | Ga0265332_10156065 | |||
| 1484 | Ga0265339_10151733 | |||
| 1485 | Ga0265316_10032843 | |||
| 1486 | Ga0265316_10052368 | |||
| 1487 | Ga0265316_10203291 | |||
| 1488 | Ga0265316_10542761 | |||
| 1489 | Ga0307513_10546948 | |||
| 1490 | Ga0307408_100033141 | |||
| 1491 | Ga0307408_100070311 | |||
| 1492 | Ga0307408_100971571 | |||
| 1493 | Ga0265314_10040041 | |||
| 1494 | Ga0265342_10035846 | |||
| 1495 | Ga0307405_10015144 | |||
| 1496 | Ga0307405_10197420 | |||
| 1497 | Ga0307410_10028486 | |||
| 1498 | Ga0307406_10003612 | |||
| 1499 | Ga0307406_10312163 | |||
| 1500 | Ga0307412_10003279 | |||
| 1501 | Ga0307412_10741772 | |||
| 1502 | Ga0307409_100238659 | |||
| 1503 | Ga0307416_100195944 | |||
| 1504 | Ga0307416_100236629 | |||
| 1505 | Ga0307416_100243313 | |||
| 1506 | Ga0307414_10002715 | |||
| 1507 | Ga0307414_10089250 | |||
| 1508 | Ga0307414_10137587 | |||
| 1509 | Ga0307414_10617643 | |||
| 1510 | Ga0307411_10008953 | |||
| 1511 | Ga0307415_100003868 | |||
| 1512 | Ga0307415_100424826 | |||
| 1513 | Ga0373926_0263485 | |||
| 1514 | Ga0373940_0200159 | |||
| 1515 | Ga0373951_0004792 | |||
| 1516 | Ga0373943_0047284 | |||
| 1517 | Ga0373946_0137236 | |||
| 1518 | Ga0373961_0042099 | |||
| 1519 | Ga0373931_0775267 | |||
| 1520 | Ga0373935_0086083 | |||
| 1521 | Ga0373927_0000536 | |||
| 1522 | Ga0373927_0147261 | |||
| 1523 | Ga0373933_0235531 | |||
| 1524 | Ga0373947_0007592 | |||
| 1525 | Ga0373937_0655564 | |||
| 1526 | Ga0373937_1344854 | |||
| 1527 | Ga0373925_0000027 | |||
| 1528 | Ga0373925_0490428 | |||
| 1529 | Ga0373925_0708812 | |||
| 1530 | Ga0395900_0105505 | |||
| 1531 | Ga0395898_0053030 | |||
| 1532 | Ga0436364_0469743 | |||
| 1533 | Ga0242422_01309 | |||
| 1534 | Ga0436365_0466471 | |||
| 1535 | Ga0436365_0746282 | |||
| 1536 | Ga0436363_1523099 | |||
| 1537 | Ga0439455_0017892 | |||
| 1538 | Ga0450889_022670 | |||
| 1539 | Ga0439446_0078787 | |||
| 1540 | Ga0439458_0002859 | |||
| 1541 | Ga0450908_048562 | |||
| 1542 | Ga0439434_0017398 | |||
| 1543 | Ga0466963_0379566 | |||
| 1544 | Ga0453684_1118939 | |||
| 1545 | Ga0466957_0303661 | |||
| 1546 | Ga0466959_0423032 | |||
| 1547 | Ga0451576_0881052 | |||
| 1548 | Ga0451576_1026125 | |||
| 1549 | Ga0495592_0134920 | |||
| 1550 | Ga0495651_0079753 | |||
| 1551 | Ga0495651_0151974 | |||
| 1552 | Ga0495653_0421660 | |||
| 1553 | Ga0495580_0001260 | |||
| 1554 | Ga0495580_0043594 | |||
| 1555 | Ga0495580_0111800 | |||
| 1556 | Ga0495580_0406677 | |||
| 1557 | Ga0495662_0075355 | |||
| 1558 | Ga0495662_0221612 | |||
| 1559 | Ga0495664_0006997 | |||
| 1560 | Ga0495594_0088687 | |||
| 1561 | Ga0495618_0132595 | |||
| 1562 | Ga0495618_0172315 | |||
| 1563 | Ga0495628_0312713 | |||
| 1564 | Ga0495630_0026033 | |||
| 1565 | Ga0495630_0591387 | |||
| 1566 | Ga0495666_0054372 | |||
| 1567 | Ga0495652_0055394 | |||
| 1568 | Ga0495665_0110074 | |||
| 1569 | Ga0495665_0120023 | |||
| 1570 | Ga0495665_0183308 | |||
| 1571 | Ga0495640_0051269 | |||
| 1572 | Ga0495586_0352486 | |||
| 1573 | Ga0495598_0000025 | |||
| 1574 | Ga0495621_0001402 | |||
| 1575 | Ga0495645_0097900 | |||
| 1576 | Ga0495645_0350077 | |||
| 1577 | Ga0495645_0440222 | |||
| 1578 | Ga0495645_0590056 | |||
| 1579 | Ga0495667_0065648 | |||
| 1580 | Ga0495656_0421787 | |||
| 1581 | Ga0495634_0298588 | |||
| 1582 | Ga0495635_0559005 | |||
| 1583 | Ga0495588_0058381 | |||
| 1584 | Ga0495657_0137157 | |||
| 1585 | Ga0495599_0067466 | |||
| 1586 | Ga0495623_0136498 | |||
| 1587 | Ga0495623_0164564 | |||
| 1588 | Ga0495623_0178521 | |||
| 1589 | Ga0495646_0038426 | |||
| 1590 | Ga0495613_0043198 | |||
| 1591 | Ga0495613_0322369 | |||
| 1592 | Ga0495600_0055414 | |||
| 1593 | Ga0495600_0116416 | |||
| 1594 | Ga0495604_0013300 | |||
| 1595 | Ga0495604_0032092 | |||
| 1596 | Ga0495604_0151681 | |||
| 1597 | Ga0495674_0016514 | |||
| 1598 | Ga0495674_0016516 | |||
| 1599 | Ga0495674_0593563 | |||
| 1600 | Ga0495672_0022123 | |||
| 1601 | Ga0495675_0177684 | |||
| 1602 | Ga0495684_0003936 | |||
| 1603 | Ga0495684_0012823 | |||
| 1604 | Ga0495684_0059490 | |||
| 1605 | Ga0495684_0365936 | |||
| 1606 | Ga0495602_0028403 | |||
| 1607 | Ga0495614_0078217 | |||
| 1608 | Ga0496104_1086693 | |||
| 1609 | Ga0496105_0647422 | |||
| 1610 | Ga0496108_0226242 | |||
| 1611 | Ga0496108_0484139 | |||
| 1612 | Ga0496110_0202483 | |||
| 1613 | Ga0496110_0761472 | |||
| 1614 | Ga0496112_0140577 | |||
| 1615 | Ga0496112_0182188 | |||
| 1616 | Ga0496112_0481335 | |||
| 1617 | Ga0496113_0013168 | |||
| 1618 | Ga0496113_0747475 | |||
| 1619 | Ga0496114_0253513 | |||
| 1620 | Ga0501291_011948 | |||
| 1621 | Ga0501291_052662 | |||
| 1622 | Ga0501295_000894 | |||
| 1623 | Ga0501295_063686 | |||
| 1624 | Ga0501296_022213 | |||
| 1625 | Ga0501297_010339 | |||
| 1626 | Ga0501298_003744 | |||
| 1627 | Ga0501299_062988 | |||
| 1628 | Ga0501299_084014 | |||
| 1629 | Ga0501031_0471994 | |||
| 1630 | Ga0501038_0001223 | |||
| 1631 | Ga0501040_0398843 | |||
| 1632 | Ga0501041_0051377 | |||
| 1633 | Ga0501042_0569594 | |||
| 1634 | Ga0501048_0522403 | |||
| 1635 | Ga0501076_0025214 | |||
| 1636 | Ga0501077_0300852 | |||
| 1637 | Ga0501198_020879 | |||
| 1638 | Ga0501199_009152 | |||
| 1639 | Ga0501202_001485 | |||
| 1640 | Ga0501207_009305 | |||
| 1641 | Ga0501210_006585 | |||
| 1642 | Ga0501214_009487 | |||
| 1643 | Ga0501216_019529 | |||
| 1644 | Ga0501217_000392 | |||
| 1645 | Ga0501217_002225 | |||
| 1646 | Ga0501217_005293 | |||
| 1647 | Ga0501223_002306 | |||
| 1648 | Ga0501224_004111 | |||
| 1649 | Ga0501224_017389 | |||
| 1650 | Ga0501227_000419 | |||
| 1651 | Ga0501227_059249 | |||
| 1652 | Ga0501233_003913 | |||
| 1653 | Ga0501235_006699 | |||
| 1654 | Ga0501236_012587 | |||
| 1655 | Ga0501240_003036 | |||
| 1656 | Ga0501240_039507 | |||
| 1657 | Ga0501243_026896 | |||
| 1658 | Ga0501257_036952 | |||
| 1659 | Ga0501259_009799 | |||
| 1660 | Ga0501259_075802 | |||
| 1661 | Ga0501260_005810 | |||
| 1662 | Ga0501225_0002302 | |||
| 1663 | Ga0501225_0004997 | |||
| 1664 | Ga0501225_0040090 | |||
| 1665 | Ga0501225_0047624 | |||
| 1666 | Ga0501229_012072 | |||
| 1667 | Ga0501234_001008 | |||
| 1668 | Ga0501245_007227 | |||
| 1669 | Ga0501081_0180917 | |||
| 1670 | Ga0501272_005995 | |||
| 1671 | Ga0501273_004524 | |||
| 1672 | Ga0501273_009252 | |||
| 1673 | Ga0501279_009708 | |||
| 1674 | Ga0501283_002976 | |||
| 1675 | Ga0501283_025911 | |||
| 1676 | Ga0501035_0271942 | |||
| 1677 | Ga0501045_0018591 | |||
| 1678 | nmdc:mga05p37_331661_c1 | |||
| 1679 | nmdc:mga05p37_409080_c1 | |||
| 1680 | nmdc:mga05p37_59302_c1 | |||
| 1681 | nmdc:mga05p37_680192_c1 | |||
| 1682 | nmdc:mga05p37_82913_c1 | |||
| 1683 | nmdc:mga05p37_871049_c1 | |||
| 1684 | nmdc:mga05p37_930104_c1 | |||
| 1685 | nmdc:mga09592_119509_c1 | |||
| 1686 | nmdc:mga09592_150716_c1 | |||
| 1687 | nmdc:mga09592_267694_c1 | |||
| 1688 | nmdc:mga0qj67_189301_c1 | |||
| 1689 | nmdc:mga0qj67_195935_c1 | |||
| 1690 | nmdc:mga06r32_308879_c1 | |||
| 1691 | nmdc:mga06r32_570618_c1 | |||
| 1692 | nmdc:mga08y16_17931_c1 | |||
| 1693 | nmdc:mga08y16_17_c1 | |||
| 1694 | nmdc:mga08y16_22423_c1 | |||
| 1695 | nmdc:mga08y16_244383_c1 | |||
| 1696 | nmdc:mga0n895_463075_c1 | |||
| 1697 | nmdc:mga0rr50_172513_c1 | |||
| 1698 | nmdc:mga0rr50_419821_c1 | |||
| 1699 | nmdc:mga0rr50_72054_c1 | |||
| 1700 | nmdc:mga08x19_48465_c1 | |||
| 1701 | nmdc:mga0a205_165146_c1 | |||
| 1702 | nmdc:mga0a205_207441_c1 | |||
| 1703 | nmdc:mga0a205_228715_c1 | |||
| 1704 | nmdc:mga0a205_337285_c1 | |||
| 1705 | nmdc:mga0a205_44105_c1 | |||
| 1706 | nmdc:mga0a205_453235_c1 | |||
| 1707 | nmdc:mga0a205_6715_c1 | |||
| 1708 | Ga0495601_0228385 | |||
| 1709 | Ga0501084_0750852 | |||
| 1710 | Ga0501082_0034590 | |||
| 1711 | Ga0501082_0437827 | |||
| 1712 | Ga0530510_0217000 | |||
| 1713 | Ga0530510_0316199 | |||
| 1714 | 2740031717 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4paw-assembly1.cif.gz_A | structure of hypothetical protein hp1257. | 0.9036 | 6 | 185 |
| 4rv4-assembly1.cif.gz_B | 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) | 0.8714 | 3 | 163 |
| 2aee-assembly1.cif.gz_B | crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes | 0.8678 | 1 | 162 |
| 2aee-assembly1.cif.gz_A | crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes | 0.8582 | 1 | 162 |
| 4ohc-assembly1.cif.gz_D | crystal structure of orotate phosphoribosyltransferase (oprtase) from burkholderia cenocepacia | 0.8548 | 3 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rv4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8714 | 3 | 163 | 3.40.50.2020 |
| af_G5EDZ2_3_216_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8577 | 3 | 163 | 3.40.50.2020 |
| af_P09556_2_207_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8568 | 2 | 163 | 3.40.50.2020 |
| af_Q59040_42_210_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8559 | 32 | 168 | 3.40.50.2020 |
| af_O61790_6_212_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8553 | 5 | 162 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G1GAB1-F1-model_v4 | Orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.9855 | 8 | 133 |
GO:0004588
GO:0019856 GO:0044205 |
| AF-A0A7C7L353-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9826 | 1 | 188 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A836SE06-F1-model_v4 | orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.9814 | 1 | 142 |
GO:0004588
GO:0019856 GO:0044205 |
| AF-A0A7C7L353-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9775 | 1 | 188 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A838U9J1-F1-model_v4 | orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.977 | 6 | 129 |
GO:0004588
GO:0016020 GO:0019856 GO:0044205 |