F483653
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 856 | 397 | 772 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100422825|Ga0070665_1004228252 |
| Length | 338 |
| Sequence | VNEKINSGSVGGDAAADEAVTEAGAGWDGTVRPLYDQVRDVVEEDDPEHPARADTDLVIVTGLSGGGRSTVARALENVGYYVVDNLPQALMLDMAELAFRAGGAARRTAMVLDVRSRAFSSDLSSAVGALRASGFSPRVVFVDADDDVLIRRFENVRRSHPLQGNGRLADGIAAERELLTKARDTADVLIDTSHLNVNQLRNRVEELFGGEDARRIRVTVLSFGFKYGLPPDADFVLDARFLPNPFWVPELRELTGRDDAVSRYVLGQRGAGTFVETYARLITATAPGFEREGKRYLTVAVGCTGGKHRSVAIAEELSRRLRDQRVAAAAQHRDLGRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 5 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 6 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 7 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 8 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 9 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 10 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 11 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 12 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 13 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 14 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 15 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 16 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 17 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 18 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 19 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 20 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 21 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 22 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 23 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 24 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 25 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 26 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 27 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 28 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 29 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 30 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 31 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 32 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 33 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 34 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 35 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 36 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 37 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 38 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 39 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 40 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 41 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 42 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 43 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 44 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 45 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 46 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 47 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 48 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 49 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 50 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 51 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 52 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 53 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 54 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 55 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 56 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 57 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 58 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 59 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 60 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 61 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 62 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 63 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 64 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 65 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 66 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 67 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 68 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 69 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 70 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 71 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 72 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 73 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 74 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 75 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 76 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 77 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 83 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 105 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 115 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 117 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 118 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 119 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 120 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 121 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 122 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 123 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 129 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 130 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 131 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 132 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 134 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 135 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 136 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 137 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 138 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 139 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 140 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 141 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 142 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 143 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 144 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 172 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 227 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 228 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 229 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 235 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 236 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 237 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 251 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 252 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 253 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 254 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 255 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 256 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 264 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 273 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 276 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 284 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 374 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 375 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 381 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 382 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 385 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 386 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 387 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 388 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 389 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 390 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 391 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 392 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 393 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 394 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 395 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 396 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 397 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.49 |
| Metatranscriptomes | 0.7 |
| Isolates | 9.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.19 |
| Nodule | 0.7 |
| Rhizoplane | 5.37 |
| Rhizosphere | 76.75 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 10.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001950 | 3300000549 | Bacteria | 2976 |
| 2 | JGI24740J21852_10017937 | 3300001979 | Bacteria | 2521 |
| 3 | JGI24735J21928_10017984 | 3300002067 | Bacteria | 2183 |
| 4 | JGI24738J21930_10002669 | 3300002075 | Bacteria | 4596 |
| 5 | JGI24744J21845_10009967 | 3300002077 | Bacteria | 1949 |
| 6 | JGI25406J46586_10013023 | 3300003203 | Bacteria | 3590 |
| 7 | JGI25405J52794_10036554 | 3300003911 | Bacteria | 1031 |
| 8 | Ga0070658_10004741 | 3300005327 | Bacteria | 11062 |
| 9 | Ga0070658_10008837 | 3300005327 | Bacteria | 8099 |
| 10 | Ga0070658_10024882 | 3300005327 | Bacteria | 4802 |
| 11 | Ga0070658_10056825 | 3300005327 | Bacteria | 3182 |
| 12 | Ga0070658_10076206 | 3300005327 | Bacteria | 2751 |
| 13 | Ga0070658_10302874 | 3300005327 | Bacteria | 1363 |
| 14 | Ga0070683_100006892 | 3300005329 | Bacteria | 9547 |
| 15 | Ga0070683_100037841 | 3300005329 | Bacteria | 4418 |
| 16 | Ga0070683_100048582 | 3300005329 | Bacteria | 3923 |
| 17 | Ga0070670_100423524 | 3300005331 | Bacteria | 1177 |
| 18 | Ga0070670_100490437 | 3300005331 | Bacteria | 1092 |
| 19 | Ga0068869_100321004 | 3300005334 | Bacteria | 1256 |
| 20 | Ga0070680_100064662 | 3300005336 | Bacteria | 2998 |
| 21 | Ga0070682_100191002 | 3300005337 | Bacteria | 1438 |
| 22 | Ga0070682_100317702 | 3300005337 | Bacteria | 1149 |
| 23 | Ga0070682_100386734 | 3300005337 | Bacteria | 1054 |
| 24 | Ga0068868_100033227 | 3300005338 | Bacteria | 3975 |
| 25 | Ga0068868_100229451 | 3300005338 | Bacteria | 1557 |
| 26 | Ga0070660_100012121 | 3300005339 | Bacteria | 6154 |
| 27 | Ga0070660_100030880 | 3300005339 | Bacteria | 4021 |
| 28 | Ga0070660_100063770 | 3300005339 | Bacteria | 2864 |
| 29 | Ga0070660_100067509 | 3300005339 | Bacteria | 2786 |
| 30 | Ga0070689_100119070 | 3300005340 | Bacteria | 2108 |
| 31 | Ga0070689_100341453 | 3300005340 | Bacteria | 1254 |
| 32 | Ga0070661_100055263 | 3300005344 | Bacteria | 2907 |
| 33 | Ga0070661_100073099 | 3300005344 | Bacteria | 2524 |
| 34 | Ga0070661_100095772 | 3300005344 | Bacteria | 2202 |
| 35 | Ga0070668_100000746 | 3300005347 | Bacteria | 22311 |
| 36 | Ga0070668_100002337 | 3300005347 | Bacteria | 13935 |
| 37 | Ga0070675_100292324 | 3300005354 | Bacteria | 1434 |
| 38 | Ga0070671_100123045 | 3300005355 | Bacteria | 2184 |
| 39 | Ga0070674_100007204 | 3300005356 | Bacteria | 6546 |
| 40 | Ga0070674_100232098 | 3300005356 | Bacteria | 1440 |
| 41 | Ga0070688_100025042 | 3300005365 | Bacteria | 3529 |
| 42 | Ga0070659_100003361 | 3300005366 | Bacteria | 11386 |
| 43 | Ga0070659_100040200 | 3300005366 | Bacteria | 3653 |
| 44 | Ga0070659_100096753 | 3300005366 | Bacteria | 2372 |
| 45 | Ga0070667_100072824 | 3300005367 | Bacteria | 2928 |
| 46 | Ga0070714_100000006 | 3300005435 | Bacteria | 293311 |
| 47 | Ga0070714_100031128 | 3300005435 | Bacteria | 4449 |
| 48 | Ga0070710_10019260 | 3300005437 | Bacteria | 3524 |
| 49 | Ga0070701_10002064 | 3300005438 | Bacteria | 7632 |
| 50 | Ga0070711_100381426 | 3300005439 | Bacteria | 1140 |
| 51 | Ga0070700_100023760 | 3300005441 | Bacteria | 3590 |
| 52 | Ga0070700_100141433 | 3300005441 | Bacteria | 1636 |
| 53 | Ga0070700_100379414 | 3300005441 | Bacteria | 1057 |
| 54 | Ga0070663_100009158 | 3300005455 | Bacteria | 6121 |
| 55 | Ga0070678_100182505 | 3300005456 | Bacteria | 1719 |
| 56 | Ga0070681_10137649 | 3300005458 | Bacteria | 2372 |
| 57 | Ga0068867_100062511 | 3300005459 | Bacteria | 2766 |
| 58 | Ga0070685_10249073 | 3300005466 | Bacteria | 1176 |
| 59 | Ga0070698_100041904 | 3300005471 | Bacteria | 4699 |
| 60 | Ga0070679_100078799 | 3300005530 | Bacteria | 3283 |
| 61 | Ga0070679_100174550 | 3300005530 | Bacteria | 2121 |
| 62 | Ga0070684_100010744 | 3300005535 | Bacteria | 7268 |
| 63 | Ga0070684_100037698 | 3300005535 | Bacteria | 4148 |
| 64 | Ga0070684_100674877 | 3300005535 | Bacteria | 963 |
| 65 | Ga0068853_100076865 | 3300005539 | Bacteria | 2916 |
| 66 | Ga0068853_100124338 | 3300005539 | Bacteria | 2304 |
| 67 | Ga0068853_100329777 | 3300005539 | Bacteria | 1416 |
| 68 | Ga0070672_100206236 | 3300005543 | Bacteria | 1645 |
| 69 | Ga0070686_100009873 | 3300005544 | Bacteria | 5366 |
| 70 | Ga0070693_100137793 | 3300005547 | Bacteria | 1532 |
| 71 | Ga0070693_100218213 | 3300005547 | Bacteria | 1248 |
| 72 | Ga0070665_100022172 | 3300005548 | Bacteria | 6389 |
| 73 | Ga0070665_100050873 | 3300005548 | Bacteria | 4157 |
| 74 | Ga0070665_100422825 | 3300005548 | Bacteria | 1341 |
| 75 | Ga0068855_100164034 | 3300005563 | Bacteria | 2520 |
| 76 | Ga0070664_100042838 | 3300005564 | Bacteria | 3820 |
| 77 | Ga0068857_100007435 | 3300005577 | Bacteria | 9429 |
| 78 | Ga0068857_100021626 | 3300005577 | Bacteria | 5660 |
| 79 | Ga0068856_100122124 | 3300005614 | Bacteria | 2607 |
| 80 | Ga0068852_100004283 | 3300005616 | Bacteria | 10067 |
| 81 | Ga0068852_100032573 | 3300005616 | Bacteria | 4316 |
| 82 | Ga0068852_100055780 | 3300005616 | Bacteria | 3411 |
| 83 | Ga0068852_100072451 | 3300005616 | Bacteria | 3028 |
| 84 | Ga0068852_100085275 | 3300005616 | Bacteria | 2813 |
| 85 | Ga0068852_100173064 | 3300005616 | Bacteria | 2025 |
| 86 | Ga0068852_100508955 | 3300005616 | Bacteria | 1200 |
| 87 | Ga0068859_100333169 | 3300005617 | Bacteria | 1612 |
| 88 | Ga0068864_100109443 | 3300005618 | Bacteria | 2460 |
| 89 | Ga0068864_100124480 | 3300005618 | Bacteria | 2308 |
| 90 | Ga0068864_100167968 | 3300005618 | Bacteria | 1999 |
| 91 | Ga0068864_100209604 | 3300005618 | Bacteria | 1794 |
| 92 | Ga0068861_100088055 | 3300005719 | Bacteria | 2444 |
| 93 | Ga0068861_100252883 | 3300005719 | Bacteria | 1504 |
| 94 | Ga0068851_10000061 | 3300005834 | Bacteria | 60738 |
| 95 | Ga0068851_10128613 | 3300005834 | Bacteria | 1368 |
| 96 | Ga0068870_10011139 | 3300005840 | Bacteria | 4157 |
| 97 | Ga0068863_100018752 | 3300005841 | Bacteria | 6621 |
| 98 | Ga0068863_100039842 | 3300005841 | Bacteria | 4468 |
| 99 | Ga0068863_100077602 | 3300005841 | Bacteria | 3144 |
| 100 | Ga0068863_100210148 | 3300005841 | Bacteria | 1874 |
| 101 | Ga0068858_100000153 | 3300005842 | Bacteria | 72963 |
| 102 | Ga0068858_100027813 | 3300005842 | Bacteria | 5253 |
| 103 | Ga0068858_100035304 | 3300005842 | Bacteria | 4638 |
| 104 | Ga0068860_100118329 | 3300005843 | Bacteria | 2536 |
| 105 | Ga0068862_100063752 | 3300005844 | Bacteria | 3171 |
| 106 | Ga0081455_10003821 | 3300005937 | Bacteria | 17186 |
| 107 | Ga0081455_10180686 | 3300005937 | Bacteria | 1597 |
| 108 | Ga0081538_10000092 | 3300005981 | Bacteria | 87123 |
| 109 | Ga0081538_10033744 | 3300005981 | Bacteria | 3399 |
| 110 | Ga0081540_1004300 | 3300005983 | Bacteria | 10910 |
| 111 | Ga0081540_1009989 | 3300005983 | Bacteria | 6463 |
| 112 | Ga0081540_1084511 | 3300005983 | Bacteria | 1416 |
| 113 | Ga0081539_10000031 | 3300005985 | Bacteria | 313232 |
| 114 | Ga0081539_10000806 | 3300005985 | Bacteria | 61012 |
| 115 | Ga0081539_10001399 | 3300005985 | Bacteria | 41546 |
| 116 | Ga0081539_10002593 | 3300005985 | Bacteria | 24817 |
| 117 | Ga0081539_10003848 | 3300005985 | Bacteria | 17600 |
| 118 | Ga0081539_10011892 | 3300005985 | Bacteria | 6797 |
| 119 | Ga0081539_10024063 | 3300005985 | Bacteria | 3964 |
| 120 | Ga0081539_10181665 | 3300005985 | Bacteria | 986 |
| 121 | Ga0070717_10264922 | 3300006028 | Bacteria | 1521 |
| 122 | Ga0075365_10000677 | 3300006038 | Bacteria | 13683 |
| 123 | Ga0075365_10007206 | 3300006038 | Bacteria | 6210 |
| 124 | Ga0075365_10007416 | 3300006038 | Bacteria | 6138 |
| 125 | Ga0075365_10017026 | 3300006038 | Bacteria | 4437 |
| 126 | Ga0075365_10018660 | 3300006038 | Bacteria | 4270 |
| 127 | Ga0075365_10067606 | 3300006038 | Bacteria | 2399 |
| 128 | Ga0075365_10069423 | 3300006038 | Bacteria | 2368 |
| 129 | Ga0075368_10001597 | 3300006042 | Bacteria | 7279 |
| 130 | Ga0075363_100031748 | 3300006048 | Bacteria | 2739 |
| 131 | Ga0075363_100039613 | 3300006048 | Bacteria | 2481 |
| 132 | Ga0075364_10019212 | 3300006051 | Bacteria | 4287 |
| 133 | Ga0075364_10045913 | 3300006051 | Bacteria | 2843 |
| 134 | Ga0075364_10141780 | 3300006051 | Bacteria | 1617 |
| 135 | Ga0075364_10178823 | 3300006051 | Bacteria | 1435 |
| 136 | Ga0075362_10009973 | 3300006177 | Bacteria | 3693 |
| 137 | Ga0075367_10060857 | 3300006178 | Bacteria | 2252 |
| 138 | Ga0075367_10190494 | 3300006178 | Bacteria | 1280 |
| 139 | Ga0075370_10005572 | 3300006353 | Bacteria | 6275 |
| 140 | Ga0075370_10050676 | 3300006353 | Bacteria | 2355 |
| 141 | Ga0075370_10155983 | 3300006353 | Bacteria | 1339 |
| 142 | Ga0075428_100000304 | 3300006844 | Bacteria | 48365 |
| 143 | Ga0075428_100126151 | 3300006844 | Bacteria | 2785 |
| 144 | Ga0075430_100001144 | 3300006846 | Bacteria | 21152 |
| 145 | Ga0075431_100000395 | 3300006847 | Bacteria | 35082 |
| 146 | Ga0075431_100001906 | 3300006847 | Bacteria | 19810 |
| 147 | Ga0075431_100258091 | 3300006847 | Bacteria | 1769 |
| 148 | Ga0075429_100001175 | 3300006880 | Bacteria | 21152 |
| 149 | Ga0075429_100237965 | 3300006880 | Bacteria | 1595 |
| 150 | Ga0068865_100007170 | 3300006881 | Bacteria | 6846 |
| 151 | Ga0068865_100106221 | 3300006881 | Bacteria | 2064 |
| 152 | Ga0097620_100333155 | 3300006931 | Bacteria | 1612 |
| 153 | Ga0105240_10002502 | 3300009093 | Bacteria | 29534 |
| 154 | Ga0105240_10083204 | 3300009093 | Bacteria | 3928 |
| 155 | Ga0111539_10257316 | 3300009094 | Bacteria | 2033 |
| 156 | Ga0111539_10455252 | 3300009094 | Bacteria | 1490 |
| 157 | Ga0105245_10005677 | 3300009098 | Bacteria | 10967 |
| 158 | Ga0105245_10048474 | 3300009098 | Bacteria | 3800 |
| 159 | Ga0105245_10068656 | 3300009098 | Bacteria | 3212 |
| 160 | Ga0105245_10086467 | 3300009098 | Bacteria | 2875 |
| 161 | Ga0105245_10362222 | 3300009098 | Bacteria | 1439 |
| 162 | Ga0114129_10000016 | 3300009147 | Bacteria | 127415 |
| 163 | Ga0114129_10000041 | 3300009147 | Bacteria | 107656 |
| 164 | Ga0114129_10610277 | 3300009147 | Bacteria | 1412 |
| 165 | Ga0105243_10005990 | 3300009148 | Bacteria | 9416 |
| 166 | Ga0105243_10058312 | 3300009148 | Bacteria | 3077 |
| 167 | Ga0105243_10111970 | 3300009148 | Bacteria | 2286 |
| 168 | Ga0105243_10115243 | 3300009148 | Bacteria | 2256 |
| 169 | Ga0105243_10138736 | 3300009148 | Bacteria | 2072 |
| 170 | Ga0105241_10000229 | 3300009174 | Bacteria | 42324 |
| 171 | Ga0105242_10214205 | 3300009176 | Bacteria | 1718 |
| 172 | Ga0105248_10000378 | 3300009177 | Bacteria | 51937 |
| 173 | Ga0105248_10196506 | 3300009177 | Bacteria | 2273 |
| 174 | Ga0105248_10207724 | 3300009177 | Bacteria | 2206 |
| 175 | Ga0105248_10366772 | 3300009177 | Bacteria | 1621 |
| 176 | Ga0105237_10000827 | 3300009545 | Bacteria | 42359 |
| 177 | Ga0105237_10091866 | 3300009545 | Bacteria | 3025 |
| 178 | Ga0105238_10000640 | 3300009551 | Bacteria | 36820 |
| 179 | Ga0105238_10016050 | 3300009551 | Bacteria | 7575 |
| 180 | Ga0105238_10125629 | 3300009551 | Bacteria | 2544 |
| 181 | Ga0105238_10143897 | 3300009551 | Bacteria | 2361 |
| 182 | Ga0105238_10247464 | 3300009551 | Bacteria | 1760 |
| 183 | Ga0105238_10533405 | 3300009551 | Bacteria | 1177 |
| 184 | Ga0105238_10537860 | 3300009551 | Bacteria | 1172 |
| 185 | Ga0105238_10548134 | 3300009551 | Bacteria | 1160 |
| 186 | Ga0105249_10153183 | 3300009553 | Bacteria | 2221 |
| 187 | Ga0105249_10301809 | 3300009553 | Bacteria | 1606 |
| 188 | Ga0105239_10100291 | 3300010375 | Bacteria | 3203 |
| 189 | Ga0105239_10163297 | 3300010375 | Bacteria | 2489 |
| 190 | Ga0105239_10175097 | 3300010375 | Bacteria | 2400 |
| 191 | Ga0105239_10880529 | 3300010375 | Bacteria | 1027 |
| 192 | Ga0105246_10031884 | 3300011119 | Bacteria | 3490 |
| 193 | Ga0105246_10141631 | 3300011119 | Bacteria | 1809 |
| 194 | Ga0105246_10242152 | 3300011119 | Bacteria | 1426 |
| 195 | Ga0157369_10007844 | 3300013105 | Bacteria | 12281 |
| 196 | Ga0157369_10024472 | 3300013105 | Bacteria | 6716 |
| 197 | Ga0157369_10299025 | 3300013105 | Bacteria | 1674 |
| 198 | Ga0157374_10206858 | 3300013296 | Bacteria | 1923 |
| 199 | Ga0157378_10333730 | 3300013297 | Bacteria | 1476 |
| 200 | Ga0163162_10011203 | 3300013306 | Bacteria | 8741 |
| 201 | Ga0157372_10000022 | 3300013307 | Bacteria | 206038 |
| 202 | Ga0157372_10103274 | 3300013307 | Bacteria | 3257 |
| 203 | Ga0157372_10113774 | 3300013307 | Bacteria | 3101 |
| 204 | Ga0157372_10210312 | 3300013307 | Bacteria | 2254 |
| 205 | Ga0157372_10442237 | 3300013307 | Bacteria | 1515 |
| 206 | Ga0157372_10446240 | 3300013307 | Bacteria | 1508 |
| 207 | Ga0157375_10157924 | 3300013308 | Bacteria | 2408 |
| 208 | Ga0163163_10010338 | 3300014325 | Bacteria | 8384 |
| 209 | Ga0163163_10054247 | 3300014325 | Bacteria | 3960 |
| 210 | Ga0163163_10067697 | 3300014325 | Bacteria | 3551 |
| 211 | Ga0163163_10132902 | 3300014325 | Bacteria | 2528 |
| 212 | Ga0157380_10105561 | 3300014326 | Bacteria | 2355 |
| 213 | Ga0157379_10025522 | 3300014968 | Bacteria | 5251 |
| 214 | Ga0157379_10026551 | 3300014968 | Bacteria | 5155 |
| 215 | Ga0157376_10298142 | 3300014969 | Bacteria | 1525 |
| 216 | Ga0163161_10003339 | 3300017792 | Bacteria | 11257 |
| 217 | Ga0163161_10155469 | 3300017792 | Bacteria | 1741 |
| 218 | Ga0163161_10282474 | 3300017792 | Bacteria | 1302 |
| 219 | Ga0163161_10326698 | 3300017792 | Bacteria | 1214 |
| 220 | Ga0206353_10327152 | 3300020082 | Bacteria | 1845 |
| 221 | Ga0206353_11080514 | 3300020082 | Bacteria | 3778 |
| 222 | Ga0206353_11305621 | 3300020082 | Bacteria | 3430 |
| 223 | Ga0206353_11872740 | 3300020082 | Bacteria | 1466 |
| 224 | Ga0206353_11891153 | 3300020082 | Bacteria | 9416 |
| 225 | Ga0213875_10000991 | 3300021388 | Bacteria | 20278 |
| 226 | Ga0209148_1000498 | 3300025254 | Bacteria | 40127 |
| 227 | Ga0207656_10000012 | 3300025321 | Bacteria | 190545 |
| 228 | Ga0207692_10000319 | 3300025898 | Bacteria | 16677 |
| 229 | Ga0207688_10009412 | 3300025901 | Bacteria | 5319 |
| 230 | Ga0207647_10018631 | 3300025904 | Bacteria | 4688 |
| 231 | Ga0207647_10022571 | 3300025904 | Bacteria | 4177 |
| 232 | Ga0207699_10196696 | 3300025906 | Bacteria | 1364 |
| 233 | Ga0207643_10001623 | 3300025908 | Bacteria | 12680 |
| 234 | Ga0207643_10037042 | 3300025908 | Bacteria | 2737 |
| 235 | Ga0207643_10292450 | 3300025908 | Bacteria | 1012 |
| 236 | Ga0207705_10008427 | 3300025909 | Bacteria | 7527 |
| 237 | Ga0207705_10054767 | 3300025909 | Bacteria | 2875 |
| 238 | Ga0207705_10187628 | 3300025909 | Bacteria | 1562 |
| 239 | Ga0207705_10241215 | 3300025909 | Bacteria | 1377 |
| 240 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 241 | Ga0207707_10108249 | 3300025912 | Bacteria | 2430 |
| 242 | Ga0207707_10217321 | 3300025912 | Bacteria | 1664 |
| 243 | Ga0207695_10002929 | 3300025913 | Bacteria | 24640 |
| 244 | Ga0207695_10008719 | 3300025913 | Bacteria | 12643 |
| 245 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 246 | Ga0207660_10093174 | 3300025917 | Bacteria | 2237 |
| 247 | Ga0207662_10113405 | 3300025918 | Bacteria | 1692 |
| 248 | Ga0207657_10001763 | 3300025919 | Bacteria | 23366 |
| 249 | Ga0207657_10021256 | 3300025919 | Bacteria | 6112 |
| 250 | Ga0207657_10047218 | 3300025919 | Bacteria | 3767 |
| 251 | Ga0207652_10036394 | 3300025921 | Bacteria | 4161 |
| 252 | Ga0207652_10058263 | 3300025921 | Bacteria | 3328 |
| 253 | Ga0207652_10132970 | 3300025921 | Bacteria | 2220 |
| 254 | Ga0207694_10000061 | 3300025924 | Bacteria | 141236 |
| 255 | Ga0207694_10021073 | 3300025924 | Bacteria | 4935 |
| 256 | Ga0207694_10035507 | 3300025924 | Bacteria | 3825 |
| 257 | Ga0207694_10174088 | 3300025924 | Bacteria | 1743 |
| 258 | Ga0207694_10347566 | 3300025924 | Bacteria | 1227 |
| 259 | Ga0207650_10426372 | 3300025925 | Bacteria | 1101 |
| 260 | Ga0207659_10088490 | 3300025926 | Bacteria | 2307 |
| 261 | Ga0207687_10016680 | 3300025927 | Bacteria | 4827 |
| 262 | Ga0207687_10037986 | 3300025927 | Bacteria | 3288 |
| 263 | Ga0207687_10085552 | 3300025927 | Bacteria | 2288 |
| 264 | Ga0207687_10213786 | 3300025927 | Bacteria | 1514 |
| 265 | Ga0207664_10005906 | 3300025929 | Bacteria | 8376 |
| 266 | Ga0207644_10022889 | 3300025931 | Bacteria | 4273 |
| 267 | Ga0207690_10068894 | 3300025932 | Bacteria | 2432 |
| 268 | Ga0207709_10037921 | 3300025935 | Bacteria | 2866 |
| 269 | Ga0207670_10472103 | 3300025936 | Bacteria | 1015 |
| 270 | Ga0207669_10025009 | 3300025937 | Bacteria | 3219 |
| 271 | Ga0207669_10178191 | 3300025937 | Bacteria | 1521 |
| 272 | Ga0207704_10093574 | 3300025938 | Bacteria | 1982 |
| 273 | Ga0207704_10105211 | 3300025938 | Bacteria | 1892 |
| 274 | Ga0207691_10001326 | 3300025940 | Bacteria | 24697 |
| 275 | Ga0207691_10035052 | 3300025940 | Bacteria | 4663 |
| 276 | Ga0207691_10131467 | 3300025940 | Bacteria | 2211 |
| 277 | Ga0207711_10004464 | 3300025941 | Bacteria | 11926 |
| 278 | Ga0207711_10065562 | 3300025941 | Bacteria | 3140 |
| 279 | Ga0207689_10374698 | 3300025942 | Bacteria | 1185 |
| 280 | Ga0207661_10046750 | 3300025944 | Bacteria | 3432 |
| 281 | Ga0207661_10078612 | 3300025944 | Bacteria | 2716 |
| 282 | Ga0207661_10079712 | 3300025944 | Bacteria | 2699 |
| 283 | Ga0207661_10092349 | 3300025944 | Bacteria | 2523 |
| 284 | Ga0207679_10019322 | 3300025945 | Bacteria | 4574 |
| 285 | Ga0207679_10067407 | 3300025945 | Bacteria | 2685 |
| 286 | Ga0207667_10002096 | 3300025949 | Bacteria | 24999 |
| 287 | Ga0207668_10007736 | 3300025972 | Bacteria | 6395 |
| 288 | Ga0207640_10014069 | 3300025981 | Bacteria | 4599 |
| 289 | Ga0207658_10190809 | 3300025986 | Bacteria | 1703 |
| 290 | Ga0207677_10122563 | 3300026023 | Bacteria | 1958 |
| 291 | Ga0207677_10309437 | 3300026023 | Bacteria | 1308 |
| 292 | Ga0207677_10434271 | 3300026023 | Bacteria | 1121 |
| 293 | Ga0207703_10000044 | 3300026035 | Bacteria | 158471 |
| 294 | Ga0207703_10129444 | 3300026035 | Bacteria | 2178 |
| 295 | Ga0207639_10070078 | 3300026041 | Bacteria | 2738 |
| 296 | Ga0207639_10072809 | 3300026041 | Bacteria | 2692 |
| 297 | Ga0207639_10109597 | 3300026041 | Bacteria | 2247 |
| 298 | Ga0207678_10001596 | 3300026067 | Bacteria | 20859 |
| 299 | Ga0207678_10038470 | 3300026067 | Bacteria | 4156 |
| 300 | Ga0207678_10215012 | 3300026067 | Bacteria | 1645 |
| 301 | Ga0207708_10001578 | 3300026075 | Bacteria | 17017 |
| 302 | Ga0207708_10154504 | 3300026075 | Bacteria | 1809 |
| 303 | Ga0207708_10198133 | 3300026075 | Bacteria | 1601 |
| 304 | Ga0207702_10089540 | 3300026078 | Bacteria | 2691 |
| 305 | Ga0207702_10632736 | 3300026078 | Bacteria | 1051 |
| 306 | Ga0207641_10078624 | 3300026088 | Bacteria | 2857 |
| 307 | Ga0207641_10181576 | 3300026088 | Bacteria | 1928 |
| 308 | Ga0207641_10326522 | 3300026088 | Bacteria | 1456 |
| 309 | Ga0207648_10000901 | 3300026089 | Bacteria | 33502 |
| 310 | Ga0207674_10003026 | 3300026116 | Bacteria | 20834 |
| 311 | Ga0207674_10037413 | 3300026116 | Bacteria | 5048 |
| 312 | Ga0207674_10111534 | 3300026116 | Bacteria | 2709 |
| 313 | Ga0207674_10151138 | 3300026116 | Bacteria | 2279 |
| 314 | Ga0207674_10394474 | 3300026116 | Bacteria | 1338 |
| 315 | Ga0207675_100117587 | 3300026118 | Bacteria | 2513 |
| 316 | Ga0207675_100145782 | 3300026118 | Bacteria | 2251 |
| 317 | Ga0207683_10093523 | 3300026121 | Bacteria | 2679 |
| 318 | Ga0207683_10107174 | 3300026121 | Bacteria | 2499 |
| 319 | Ga0207698_10001433 | 3300026142 | Bacteria | 13851 |
| 320 | Ga0207698_10003011 | 3300026142 | Bacteria | 10110 |
| 321 | Ga0207698_10029837 | 3300026142 | Bacteria | 3912 |
| 322 | Ga0207698_10300780 | 3300026142 | Bacteria | 1493 |
| 323 | Ga0207698_10408485 | 3300026142 | Bacteria | 1299 |
| 324 | Ga0209813_10015554 | 3300027866 | Bacteria | 2064 |
| 325 | Ga0209974_10019824 | 3300027876 | Bacteria | 2229 |
| 326 | Ga0207428_10052631 | 3300027907 | Bacteria | 3250 |
| 327 | Ga0268266_10000855 | 3300028379 | Bacteria | 39694 |
| 328 | Ga0268266_10058929 | 3300028379 | Bacteria | 3307 |
| 329 | Ga0268265_10580436 | 3300028380 | Bacteria | 1068 |
| 330 | Ga0268264_10041902 | 3300028381 | Bacteria | 3788 |
| 331 | Ga0268264_10056216 | 3300028381 | Bacteria | 3289 |
| 332 | Ga0307517_10125964 | 3300028786 | Bacteria | 1869 |
| 333 | Ga0307515_10001347 | 3300028794 | Bacteria | 55605 |
| 334 | Ga0307515_10041718 | 3300028794 | Bacteria | 7203 |
| 335 | Ga0307515_10051091 | 3300028794 | Bacteria | 6175 |
| 336 | Ga0307515_10130247 | 3300028794 | Bacteria | 2777 |
| 337 | Ga0307511_10000625 | 3300030521 | Bacteria | 37858 |
| 338 | Ga0307512_10010454 | 3300030522 | Bacteria | 8846 |
| 339 | Ga0307512_10015468 | 3300030522 | Bacteria | 7073 |
| 340 | Ga0307512_10123742 | 3300030522 | Bacteria | 1650 |
| 341 | Ga0307513_10008310 | 3300031456 | Bacteria | 13299 |
| 342 | Ga0307513_10027824 | 3300031456 | Bacteria | 6480 |
| 343 | Ga0307513_10070913 | 3300031456 | Bacteria | 3639 |
| 344 | Ga0307513_10127828 | 3300031456 | Bacteria | 2492 |
| 345 | Ga0307509_10060837 | 3300031507 | Bacteria | 3990 |
| 346 | Ga0307509_10092815 | 3300031507 | Bacteria | 3084 |
| 347 | Ga0307408_100270851 | 3300031548 | Bacteria | 1410 |
| 348 | Ga0307508_10000287 | 3300031616 | Bacteria | 61945 |
| 349 | Ga0307508_10015594 | 3300031616 | Bacteria | 6923 |
| 350 | Ga0316575_10003465 | 3300031665 | Bacteria | 5446 |
| 351 | Ga0316579_10010071 | 3300031691 | Bacteria | 3987 |
| 352 | Ga0316579_10040114 | 3300031691 | Bacteria | 2170 |
| 353 | Ga0316576_10003068 | 3300031727 | Bacteria | 9724 |
| 354 | Ga0316576_10003940 | 3300031727 | Bacteria | 8813 |
| 355 | Ga0316576_10179594 | 3300031727 | Bacteria | 1596 |
| 356 | Ga0316578_10047438 | 3300031728 | Bacteria | 2506 |
| 357 | Ga0316578_10055049 | 3300031728 | Bacteria | 2334 |
| 358 | Ga0316578_10140796 | 3300031728 | Bacteria | 1453 |
| 359 | Ga0307516_10000451 | 3300031730 | Bacteria | 54345 |
| 360 | Ga0307516_10021347 | 3300031730 | Bacteria | 6667 |
| 361 | Ga0307516_10291117 | 3300031730 | Bacteria | 1311 |
| 362 | Ga0316577_10011220 | 3300031733 | Bacteria | 4852 |
| 363 | Ga0316577_10042523 | 3300031733 | Bacteria | 2542 |
| 364 | Ga0307413_10000161 | 3300031824 | Bacteria | 18416 |
| 365 | Ga0307518_10000054 | 3300031838 | Bacteria | 76765 |
| 366 | Ga0307410_10121295 | 3300031852 | Bacteria | 1907 |
| 367 | Ga0307406_10127237 | 3300031901 | Bacteria | 1782 |
| 368 | Ga0307406_10195422 | 3300031901 | Bacteria | 1485 |
| 369 | Ga0307407_10087898 | 3300031903 | Bacteria | 1897 |
| 370 | Ga0307407_10138690 | 3300031903 | Bacteria | 1566 |
| 371 | Ga0307412_10008265 | 3300031911 | Bacteria | 5933 |
| 372 | Ga0307412_10134944 | 3300031911 | Bacteria | 1799 |
| 373 | Ga0307409_100020093 | 3300031995 | Bacteria | 4543 |
| 374 | Ga0307409_100078881 | 3300031995 | Bacteria | 2651 |
| 375 | Ga0307409_100490206 | 3300031995 | Bacteria | 1194 |
| 376 | Ga0307416_100094852 | 3300032002 | Bacteria | 2574 |
| 377 | Ga0307416_100284934 | 3300032002 | Bacteria | 1632 |
| 378 | Ga0307411_10152889 | 3300032005 | Bacteria | 1717 |
| 379 | Ga0307415_100009454 | 3300032126 | Bacteria | 5466 |
| 380 | Ga0307415_100053088 | 3300032126 | Bacteria | 2760 |
| 381 | Ga0307415_100174311 | 3300032126 | Bacteria | 1680 |
| 382 | Ga0307415_100242234 | 3300032126 | Bacteria | 1459 |
| 383 | Ga0307415_100464955 | 3300032126 | Bacteria | 1097 |
| 384 | Ga0316583_10004161 | 3300032133 | Bacteria | 5147 |
| 385 | Ga0316583_10035045 | 3300032133 | Bacteria | 1781 |
| 386 | Ga0316585_10000165 | 3300032137 | Bacteria | 13274 |
| 387 | Ga0316580_10006992 | 3300032139 | Bacteria | 3345 |
| 388 | Ga0316580_10054246 | 3300032139 | Bacteria | 1234 |
| 389 | Ga0307507_10006894 | 3300033179 | Bacteria | 16944 |
| 390 | Ga0307507_10008648 | 3300033179 | Bacteria | 13959 |
| 391 | Ga0307507_10165888 | 3300033179 | Bacteria | 1619 |
| 392 | Ga0307510_10042254 | 3300033180 | Bacteria | 4969 |
| 393 | Ga0307510_10151754 | 3300033180 | Bacteria | 1934 |
| 394 | Ga0373926_0145645 | 3300035083 | Bacteria | 901 |
| 395 | Ga0373951_0000068 | 3300035091 | Bacteria | 41054 |
| 396 | Ga0373956_0023580 | 3300035119 | Bacteria | 2642 |
| 397 | Ga0373942_0000158 | 3300035207 | Bacteria | 16323 |
| 398 | Ga0373962_0001567 | 3300035242 | Bacteria | 5418 |
| 399 | Ga0316574_0032038 | 3300035398 | Bacteria | 3192 |
| 400 | Ga0373935_0046325 | 3300035692 | Bacteria | 2746 |
| 401 | Ga0373937_0051248 | 3300036401 | Bacteria | 3783 |
| 402 | Ga0316582_0000779 | 3300036647 | Bacteria | 12851 |
| 403 | Ga0316584_0002926 | 3300036712 | Bacteria | 10974 |
| 404 | Ga0316584_0039601 | 3300036712 | Bacteria | 3508 |
| 405 | Ga0316584_0060716 | 3300036712 | Bacteria | 2832 |
| 406 | Ga0395899_0009852 | 3300037312 | Bacteria | 7330 |
| 407 | Ga0395899_0030111 | 3300037312 | Bacteria | 4083 |
| 408 | Ga0395899_0251441 | 3300037312 | Bacteria | 1213 |
| 409 | Ga0395900_0010227 | 3300037418 | Bacteria | 9595 |
| 410 | Ga0395900_0063573 | 3300037418 | Bacteria | 3794 |
| 411 | Ga0395900_0086530 | 3300037418 | Bacteria | 3221 |
| 412 | Ga0395898_0007995 | 3300037466 | Bacteria | 11221 |
| 413 | Ga0395898_0008793 | 3300037466 | Bacteria | 10641 |
| 414 | Ga0395898_0060791 | 3300037466 | Bacteria | 3671 |
| 415 | Ga0395905_0004654 | 3300037471 | Bacteria | 14189 |
| 416 | Ga0395905_0055029 | 3300037471 | Bacteria | 3724 |
| 417 | Ga0395905_0105756 | 3300037471 | Bacteria | 2643 |
| 418 | Ga0395905_0118803 | 3300037471 | Bacteria | 2485 |
| 419 | Ga0436364_1185528 | 3300037853 | Bacteria | 2646 |
| 420 | Ga0436364_1297258 | 3300037853 | Bacteria | 42934 |
| 421 | Ga0395901_0021116 | 3300038443 | Bacteria | 6671 |
| 422 | Ga0395901_0041325 | 3300038443 | Bacteria | 4778 |
| 423 | Ga0395901_0222173 | 3300038443 | Bacteria | 1974 |
| 424 | Ga0395901_0305456 | 3300038443 | Bacteria | 1649 |
| 425 | Ga0395901_0704628 | 3300038443 | Bacteria | 1007 |
| 426 | Ga0436365_1732542 | 3300039437 | Bacteria | 1485 |
| 427 | Ga0439465_0009655 | 3300041413 | Bacteria | 3040 |
| 428 | Ga0451795_0740335 | 3300041456 | Bacteria | 1095 |
| 429 | Ga0451853_2671789 | 3300041512 | Bacteria | 2069 |
| 430 | Ga0439431_0002566 | 3300041997 | Bacteria | 4008 |
| 431 | Ga0439446_0005379 | 3300042156 | Bacteria | 3290 |
| 432 | Ga0466969_0015226 | 3300044656 | Bacteria | 4031 |
| 433 | Ga0466969_0019533 | 3300044656 | Bacteria | 3521 |
| 434 | Ga0466969_0049269 | 3300044656 | Bacteria | 2079 |
| 435 | Ga0466972_0000279 | 3300044658 | Bacteria | 31998 |
| 436 | Ga0466972_0021808 | 3300044658 | Bacteria | 3191 |
| 437 | Ga0466965_0004487 | 3300044683 | Bacteria | 6211 |
| 438 | Ga0466965_0021527 | 3300044683 | Bacteria | 3104 |
| 439 | Ga0466965_0032408 | 3300044683 | Bacteria | 2552 |
| 440 | Ga0466965_0036258 | 3300044683 | Bacteria | 2419 |
| 441 | Ga0466965_0042902 | 3300044683 | Bacteria | 2232 |
| 442 | Ga0466965_0043864 | 3300044683 | Bacteria | 2209 |
| 443 | Ga0466965_0123140 | 3300044683 | Bacteria | 1340 |
| 444 | Ga0466965_0216510 | 3300044683 | Bacteria | 1020 |
| 445 | Ga0466966_0003783 | 3300044684 | Bacteria | 9979 |
| 446 | Ga0466966_0256053 | 3300044684 | Bacteria | 1054 |
| 447 | Ga0466961_0005989 | 3300044693 | Bacteria | 7708 |
| 448 | Ga0466961_0009977 | 3300044693 | Bacteria | 6052 |
| 449 | Ga0466961_0025915 | 3300044693 | Bacteria | 3769 |
| 450 | Ga0466961_0091459 | 3300044693 | Bacteria | 1921 |
| 451 | Ga0466961_0093883 | 3300044693 | Bacteria | 1893 |
| 452 | Ga0466961_0134135 | 3300044693 | Bacteria | 1551 |
| 453 | Ga0466961_0164316 | 3300044693 | Bacteria | 1383 |
| 454 | Ga0466961_0192833 | 3300044693 | Bacteria | 1263 |
| 455 | Ga0466963_0017029 | 3300044694 | Bacteria | 4526 |
| 456 | Ga0466963_0017473 | 3300044694 | Bacteria | 4471 |
| 457 | Ga0466963_0046285 | 3300044694 | Bacteria | 2868 |
| 458 | Ga0466964_0002256 | 3300044706 | Bacteria | 6831 |
| 459 | Ga0466964_0010569 | 3300044706 | Bacteria | 3482 |
| 460 | Ga0466964_0134501 | 3300044706 | Bacteria | 1130 |
| 461 | Ga0466971_0042724 | 3300044719 | Bacteria | 2037 |
| 462 | Ga0466971_0061282 | 3300044719 | Bacteria | 1701 |
| 463 | Ga0466970_0004075 | 3300044765 | Bacteria | 7179 |
| 464 | Ga0466970_0079722 | 3300044765 | Bacteria | 1768 |
| 465 | Ga0466970_0133158 | 3300044765 | Bacteria | 1366 |
| 466 | Ga0466970_0238903 | 3300044765 | Bacteria | 1016 |
| 467 | Ga0466957_0002957 | 3300044842 | Bacteria | 9217 |
| 468 | Ga0466957_0023779 | 3300044842 | Bacteria | 3624 |
| 469 | Ga0466957_0061937 | 3300044842 | Bacteria | 2298 |
| 470 | Ga0466957_0070542 | 3300044842 | Bacteria | 2159 |
| 471 | Ga0466957_0071367 | 3300044842 | Bacteria | 2148 |
| 472 | Ga0466960_0001507 | 3300044901 | Bacteria | 8479 |
| 473 | Ga0466960_0018047 | 3300044901 | Bacteria | 3086 |
| 474 | Ga0466960_0029863 | 3300044901 | Bacteria | 2504 |
| 475 | Ga0466960_0036011 | 3300044901 | Bacteria | 2316 |
| 476 | Ga0466960_0053618 | 3300044901 | Bacteria | 1955 |
| 477 | Ga0466960_0070115 | 3300044901 | Bacteria | 1743 |
| 478 | Ga0466960_0143957 | 3300044901 | Bacteria | 1268 |
| 479 | Ga0466959_0007634 | 3300045049 | Bacteria | 7603 |
| 480 | Ga0466959_0065894 | 3300045049 | Bacteria | 2628 |
| 481 | Ga0466959_0329522 | 3300045049 | Bacteria | 1043 |
| 482 | Ga0466958_0019354 | 3300045836 | Bacteria | 3963 |
| 483 | Ga0466958_0023102 | 3300045836 | Bacteria | 3647 |
| 484 | Ga0466958_0040477 | 3300045836 | Bacteria | 2801 |
| 485 | Ga0466967_0003364 | 3300045976 | Bacteria | 10406 |
| 486 | Ga0466967_0003892 | 3300045976 | Bacteria | 9906 |
| 487 | Ga0466967_0029620 | 3300045976 | Bacteria | 4583 |
| 488 | Ga0466967_0033474 | 3300045976 | Bacteria | 4351 |
| 489 | Ga0466967_0041061 | 3300045976 | Bacteria | 3986 |
| 490 | Ga0466967_0047601 | 3300045976 | Bacteria | 3738 |
| 491 | Ga0466967_0055827 | 3300045976 | Bacteria | 3480 |
| 492 | Ga0466967_0073521 | 3300045976 | Bacteria | 3067 |
| 493 | Ga0466967_0090807 | 3300045976 | Bacteria | 2775 |
| 494 | Ga0466967_0099530 | 3300045976 | Bacteria | 2656 |
| 495 | Ga0466967_0183324 | 3300045976 | Bacteria | 1975 |
| 496 | Ga0466967_0258701 | 3300045976 | Bacteria | 1665 |
| 497 | Ga0466967_0313376 | 3300045976 | Bacteria | 1512 |
| 498 | Ga0495603_0040357 | 3300046455 | Bacteria | 2794 |
| 499 | Ga0495629_0080822 | 3300046459 | Bacteria | 2269 |
| 500 | Ga0495629_0098986 | 3300046459 | Bacteria | 2035 |
| 501 | Ga0495638_0014854 | 3300046460 | Bacteria | 5249 |
| 502 | Ga0495582_0056950 | 3300046473 | Bacteria | 2155 |
| 503 | Ga0495594_0070253 | 3300046499 | Bacteria | 1946 |
| 504 | Ga0495608_0152244 | 3300046511 | Bacteria | 1474 |
| 505 | Ga0495657_0237411 | 3300046675 | Bacteria | 1101 |
| 506 | Ga0495613_0058806 | 3300046689 | Bacteria | 2820 |
| 507 | Ga0495600_0215064 | 3300046809 | Bacteria | 1231 |
| 508 | Ga0495604_0185260 | 3300047317 | Bacteria | 1454 |
| 509 | Ga0495674_0219312 | 3300047319 | Bacteria | 1573 |
| 510 | Ga0495680_0223293 | 3300047322 | Bacteria | 1344 |
| 511 | Ga0495593_0020298 | 3300047673 | Bacteria | 3722 |
| 512 | Ga0496101_0111397 | 3300048904 | Bacteria | 2060 |
| 513 | Ga0496101_0236084 | 3300048904 | Bacteria | 1422 |
| 514 | Ga0496102_0004203 | 3300048905 | Bacteria | 12179 |
| 515 | Ga0496102_0036758 | 3300048905 | Bacteria | 4414 |
| 516 | Ga0496102_0044729 | 3300048905 | Bacteria | 4019 |
| 517 | Ga0496103_0029409 | 3300048906 | Bacteria | 3339 |
| 518 | Ga0496103_0345991 | 3300048906 | Bacteria | 956 |
| 519 | Ga0496104_0001885 | 3300048907 | Bacteria | 18176 |
| 520 | Ga0496104_0149001 | 3300048907 | Bacteria | 2246 |
| 521 | Ga0496105_0000343 | 3300048908 | Bacteria | 30543 |
| 522 | Ga0496105_0058386 | 3300048908 | Bacteria | 3185 |
| 523 | Ga0496106_0006613 | 3300048909 | Bacteria | 8578 |
| 524 | Ga0496106_0106131 | 3300048909 | Bacteria | 2183 |
| 525 | Ga0496106_0119560 | 3300048909 | Bacteria | 2058 |
| 526 | Ga0496107_0016463 | 3300048910 | Bacteria | 5193 |
| 527 | Ga0496107_0048650 | 3300048910 | Bacteria | 3055 |
| 528 | Ga0496108_0000050 | 3300048911 | Bacteria | 131829 |
| 529 | Ga0496108_0076827 | 3300048911 | Bacteria | 2823 |
| 530 | Ga0496108_0154850 | 3300048911 | Bacteria | 1979 |
| 531 | Ga0496108_0195915 | 3300048911 | Bacteria | 1752 |
| 532 | Ga0496108_0203036 | 3300048911 | Bacteria | 1720 |
| 533 | Ga0496108_0267460 | 3300048911 | Bacteria | 1488 |
| 534 | Ga0496108_0377042 | 3300048911 | Bacteria | 1239 |
| 535 | Ga0496109_0042715 | 3300048912 | Bacteria | 4108 |
| 536 | Ga0496109_0043845 | 3300048912 | Bacteria | 4055 |
| 537 | Ga0496109_0104815 | 3300048912 | Bacteria | 2626 |
| 538 | Ga0496109_0215541 | 3300048912 | Bacteria | 1805 |
| 539 | Ga0496109_0394890 | 3300048912 | Bacteria | 1307 |
| 540 | Ga0496110_0061854 | 3300048913 | Bacteria | 3305 |
| 541 | Ga0496110_0103654 | 3300048913 | Bacteria | 2552 |
| 542 | Ga0496110_0190836 | 3300048913 | Bacteria | 1861 |
| 543 | Ga0496110_0201292 | 3300048913 | Bacteria | 1809 |
| 544 | Ga0496111_0013524 | 3300048914 | Bacteria | 5557 |
| 545 | Ga0496111_0082832 | 3300048914 | Bacteria | 2343 |
| 546 | Ga0496112_0008708 | 3300048915 | Bacteria | 9099 |
| 547 | Ga0496112_0041992 | 3300048915 | Bacteria | 4474 |
| 548 | Ga0496112_0474172 | 3300048915 | Bacteria | 1188 |
| 549 | Ga0496112_0556393 | 3300048915 | Bacteria | 1081 |
| 550 | Ga0496113_0119762 | 3300048916 | Bacteria | 2057 |
| 551 | Ga0496113_0181392 | 3300048916 | Bacteria | 1669 |
| 552 | Ga0496114_0004652 | 3300048917 | Bacteria | 10666 |
| 553 | Ga0496114_0007243 | 3300048917 | Bacteria | 8763 |
| 554 | Ga0496114_0089069 | 3300048917 | Bacteria | 2618 |
| 555 | Ga0496114_0355801 | 3300048917 | Bacteria | 1295 |
| 556 | Ga0496115_0008918 | 3300048918 | Bacteria | 7437 |
| 557 | Ga0496117_0209546 | 3300048920 | Bacteria | 1094 |
| 558 | Ga0496118_0043209 | 3300048921 | Bacteria | 3546 |
| 559 | Ga0496118_0066617 | 3300048921 | Bacteria | 2628 |
| 560 | Ga0496119_0012511 | 3300048922 | Bacteria | 6883 |
| 561 | Ga0496120_0000566 | 3300048923 | Bacteria | 56431 |
| 562 | Ga0496120_0025930 | 3300048923 | Bacteria | 3630 |
| 563 | Ga0496124_0191072 | 3300048927 | Bacteria | 1567 |
| 564 | Ga0496125_0154109 | 3300048928 | Bacteria | 1573 |
| 565 | Ga0496125_0275040 | 3300048928 | Bacteria | 1047 |
| 566 | Ga0496126_0075618 | 3300048929 | Bacteria | 2989 |
| 567 | Ga0501310_000074 | 3300049130 | Bacteria | 9400 |
| 568 | Ga0501031_0001919 | 3300049568 | Bacteria | 13105 |
| 569 | Ga0501031_0002002 | 3300049568 | Bacteria | 12847 |
| 570 | Ga0501031_0007908 | 3300049568 | Bacteria | 6921 |
| 571 | Ga0501031_0025803 | 3300049568 | Bacteria | 3834 |
| 572 | Ga0501032_0057031 | 3300049569 | Bacteria | 2624 |
| 573 | Ga0501033_0004187 | 3300049570 | Bacteria | 11611 |
| 574 | Ga0501033_0005298 | 3300049570 | Bacteria | 10224 |
| 575 | Ga0501033_0009470 | 3300049570 | Bacteria | 7501 |
| 576 | Ga0501033_0029142 | 3300049570 | Bacteria | 4148 |
| 577 | Ga0501033_0029533 | 3300049570 | Bacteria | 4120 |
| 578 | Ga0501033_0033775 | 3300049570 | Bacteria | 3840 |
| 579 | Ga0501033_0057770 | 3300049570 | Bacteria | 2866 |
| 580 | Ga0501033_0188494 | 3300049570 | Bacteria | 1477 |
| 581 | Ga0501034_0013725 | 3300049571 | Bacteria | 8333 |
| 582 | Ga0501034_0033306 | 3300049571 | Bacteria | 5229 |
| 583 | Ga0501034_0045110 | 3300049571 | Bacteria | 4455 |
| 584 | Ga0501034_0072444 | 3300049571 | Bacteria | 3454 |
| 585 | Ga0501034_0083860 | 3300049571 | Bacteria | 3189 |
| 586 | Ga0501034_0112309 | 3300049571 | Bacteria | 2715 |
| 587 | Ga0501034_0199541 | 3300049571 | Bacteria | 1959 |
| 588 | Ga0501034_0321420 | 3300049571 | Bacteria | 1480 |
| 589 | Ga0501034_0585344 | 3300049571 | Bacteria | 1022 |
| 590 | Ga0501034_0787308 | 3300049571 | Bacteria | 844 |
| 591 | Ga0501036_0002680 | 3300049572 | Bacteria | 14045 |
| 592 | Ga0501036_0005083 | 3300049572 | Bacteria | 10646 |
| 593 | Ga0501036_0152569 | 3300049572 | Bacteria | 1949 |
| 594 | Ga0501036_0213567 | 3300049572 | Bacteria | 1621 |
| 595 | Ga0501037_0005053 | 3300049573 | Bacteria | 9600 |
| 596 | Ga0501037_0009863 | 3300049573 | Bacteria | 7008 |
| 597 | Ga0501037_0030778 | 3300049573 | Bacteria | 3964 |
| 598 | Ga0501037_0040243 | 3300049573 | Bacteria | 3440 |
| 599 | Ga0501037_0071644 | 3300049573 | Bacteria | 2521 |
| 600 | Ga0501037_0146854 | 3300049573 | Bacteria | 1686 |
| 601 | Ga0501037_0193581 | 3300049573 | Bacteria | 1439 |
| 602 | Ga0501038_0000969 | 3300049574 | Bacteria | 25734 |
| 603 | Ga0501038_0025321 | 3300049574 | Bacteria | 5290 |
| 604 | Ga0501038_0056038 | 3300049574 | Bacteria | 3385 |
| 605 | Ga0501038_0057492 | 3300049574 | Bacteria | 3339 |
| 606 | Ga0501038_0088025 | 3300049574 | Bacteria | 2607 |
| 607 | Ga0501038_0246306 | 3300049574 | Bacteria | 1417 |
| 608 | Ga0501039_0006085 | 3300049575 | Bacteria | 9160 |
| 609 | Ga0501039_0013920 | 3300049575 | Bacteria | 6154 |
| 610 | Ga0501039_0103977 | 3300049575 | Bacteria | 2217 |
| 611 | Ga0501039_0135179 | 3300049575 | Bacteria | 1936 |
| 612 | Ga0501040_0001884 | 3300049576 | Bacteria | 13458 |
| 613 | Ga0501040_0014838 | 3300049576 | Bacteria | 5142 |
| 614 | Ga0501041_0001143 | 3300049577 | Bacteria | 14519 |
| 615 | Ga0501041_0147017 | 3300049577 | Bacteria | 1471 |
| 616 | Ga0501042_0001041 | 3300049578 | Bacteria | 15819 |
| 617 | Ga0501042_0011478 | 3300049578 | Bacteria | 5981 |
| 618 | Ga0501042_0012636 | 3300049578 | Bacteria | 5728 |
| 619 | Ga0501042_0025419 | 3300049578 | Bacteria | 4159 |
| 620 | Ga0501043_0008297 | 3300049579 | Bacteria | 8178 |
| 621 | Ga0501043_0010711 | 3300049579 | Bacteria | 7184 |
| 622 | Ga0501043_0014284 | 3300049579 | Bacteria | 6213 |
| 623 | Ga0501043_0121881 | 3300049579 | Bacteria | 2045 |
| 624 | Ga0501043_0247882 | 3300049579 | Bacteria | 1372 |
| 625 | Ga0501046_0000229 | 3300049580 | Bacteria | 57869 |
| 626 | Ga0501046_0003076 | 3300049580 | Bacteria | 15405 |
| 627 | Ga0501046_0009069 | 3300049580 | Bacteria | 8625 |
| 628 | Ga0501046_0010691 | 3300049580 | Bacteria | 7871 |
| 629 | Ga0501046_0020136 | 3300049580 | Bacteria | 5522 |
| 630 | Ga0501046_0070512 | 3300049580 | Bacteria | 2717 |
| 631 | Ga0501047_0007350 | 3300049581 | Bacteria | 10357 |
| 632 | Ga0501047_0052159 | 3300049581 | Bacteria | 3953 |
| 633 | Ga0501047_0079195 | 3300049581 | Bacteria | 3159 |
| 634 | Ga0501047_0242317 | 3300049581 | Bacteria | 1653 |
| 635 | Ga0501047_0297028 | 3300049581 | Bacteria | 1458 |
| 636 | Ga0501047_0383126 | 3300049581 | Bacteria | 1240 |
| 637 | Ga0501048_0004346 | 3300049582 | Bacteria | 10788 |
| 638 | Ga0501048_0282421 | 3300049582 | Bacteria | 1180 |
| 639 | Ga0501067_0016564 | 3300049583 | Bacteria | 4073 |
| 640 | Ga0501067_0056349 | 3300049583 | Bacteria | 2177 |
| 641 | Ga0501068_0035225 | 3300049584 | Bacteria | 2987 |
| 642 | Ga0501068_0035411 | 3300049584 | Bacteria | 2979 |
| 643 | Ga0501069_0005923 | 3300049585 | Bacteria | 6373 |
| 644 | Ga0501069_0020764 | 3300049585 | Bacteria | 3561 |
| 645 | Ga0501069_0032630 | 3300049585 | Bacteria | 2867 |
| 646 | Ga0501069_0035205 | 3300049585 | Bacteria | 2758 |
| 647 | Ga0501069_0092878 | 3300049585 | Bacteria | 1707 |
| 648 | Ga0501070_0009468 | 3300049586 | Bacteria | 8235 |
| 649 | Ga0501070_0016059 | 3300049586 | Bacteria | 6292 |
| 650 | Ga0501070_0023727 | 3300049586 | Bacteria | 5140 |
| 651 | Ga0501070_0034966 | 3300049586 | Bacteria | 4199 |
| 652 | Ga0501070_0045917 | 3300049586 | Bacteria | 3632 |
| 653 | Ga0501070_0054474 | 3300049586 | Bacteria | 3317 |
| 654 | Ga0501070_0092607 | 3300049586 | Bacteria | 2501 |
| 655 | Ga0501070_0136034 | 3300049586 | Bacteria | 2029 |
| 656 | Ga0501070_0196598 | 3300049586 | Bacteria | 1656 |
| 657 | Ga0501070_0492335 | 3300049586 | Bacteria | 985 |
| 658 | Ga0501071_0008474 | 3300049587 | Bacteria | 6798 |
| 659 | Ga0501071_0008876 | 3300049587 | Bacteria | 6665 |
| 660 | Ga0501071_0010871 | 3300049587 | Bacteria | 6107 |
| 661 | Ga0501071_0073812 | 3300049587 | Bacteria | 2489 |
| 662 | Ga0501071_0203157 | 3300049587 | Bacteria | 1489 |
| 663 | Ga0501072_0007748 | 3300049588 | Bacteria | 8154 |
| 664 | Ga0501072_0020621 | 3300049588 | Bacteria | 5108 |
| 665 | Ga0501072_0328501 | 3300049588 | Bacteria | 1215 |
| 666 | Ga0501073_0051417 | 3300049589 | Bacteria | 2886 |
| 667 | Ga0501073_0083714 | 3300049589 | Bacteria | 2219 |
| 668 | Ga0501073_0210030 | 3300049589 | Bacteria | 1345 |
| 669 | Ga0501074_0003143 | 3300049590 | Bacteria | 11647 |
| 670 | Ga0501074_0007814 | 3300049590 | Bacteria | 7745 |
| 671 | Ga0501074_0010978 | 3300049590 | Bacteria | 6576 |
| 672 | Ga0501074_0011618 | 3300049590 | Bacteria | 6400 |
| 673 | Ga0501074_0061709 | 3300049590 | Bacteria | 2700 |
| 674 | Ga0501076_0002268 | 3300049592 | Bacteria | 13148 |
| 675 | Ga0501076_0003800 | 3300049592 | Bacteria | 10634 |
| 676 | Ga0501077_0011876 | 3300049593 | Bacteria | 5447 |
| 677 | Ga0501077_0033366 | 3300049593 | Bacteria | 3276 |
| 678 | Ga0501077_0034368 | 3300049593 | Bacteria | 3227 |
| 679 | Ga0501079_0001954 | 3300049741 | Bacteria | 14764 |
| 680 | Ga0501079_0019110 | 3300049741 | Bacteria | 5235 |
| 681 | Ga0501079_0179269 | 3300049741 | Bacteria | 1653 |
| 682 | Ga0501079_0215057 | 3300049741 | Bacteria | 1501 |
| 683 | Ga0501080_0001505 | 3300049742 | Bacteria | 19670 |
| 684 | Ga0501080_0004814 | 3300049742 | Bacteria | 12036 |
| 685 | Ga0501080_0012257 | 3300049742 | Bacteria | 7854 |
| 686 | Ga0501080_0092132 | 3300049742 | Bacteria | 2815 |
| 687 | Ga0501080_0115073 | 3300049742 | Bacteria | 2494 |
| 688 | Ga0501080_0138458 | 3300049742 | Bacteria | 2251 |
| 689 | Ga0501080_0617234 | 3300049742 | Bacteria | 961 |
| 690 | Ga0501081_0008411 | 3300049743 | Bacteria | 6702 |
| 691 | Ga0501083_0000169 | 3300049744 | Bacteria | 42763 |
| 692 | Ga0501083_0013481 | 3300049744 | Bacteria | 5713 |
| 693 | Ga0501083_0170311 | 3300049744 | Bacteria | 1423 |
| 694 | Ga0501083_0291398 | 3300049744 | Bacteria | 1062 |
| 695 | Ga0501035_0001333 | 3300049822 | Bacteria | 25473 |
| 696 | Ga0501035_0007987 | 3300049822 | Bacteria | 9862 |
| 697 | Ga0501035_0022701 | 3300049822 | Bacteria | 5763 |
| 698 | Ga0501035_0036164 | 3300049822 | Bacteria | 4477 |
| 699 | Ga0501035_0073578 | 3300049822 | Bacteria | 3023 |
| 700 | Ga0501035_0074458 | 3300049822 | Bacteria | 3004 |
| 701 | Ga0501035_0140139 | 3300049822 | Bacteria | 2103 |
| 702 | Ga0501035_0198904 | 3300049822 | Bacteria | 1720 |
| 703 | Ga0501035_0285120 | 3300049822 | Bacteria | 1395 |
| 704 | Ga0501035_0319735 | 3300049822 | Bacteria | 1304 |
| 705 | Ga0501044_0005152 | 3300049823 | Bacteria | 14570 |
| 706 | Ga0501044_0029520 | 3300049823 | Bacteria | 5781 |
| 707 | Ga0501044_0033613 | 3300049823 | Bacteria | 5387 |
| 708 | Ga0501044_0069630 | 3300049823 | Bacteria | 3581 |
| 709 | Ga0501044_0110257 | 3300049823 | Bacteria | 2761 |
| 710 | Ga0501044_0179294 | 3300049823 | Bacteria | 2086 |
| 711 | Ga0501044_0563186 | 3300049823 | Bacteria | 1035 |
| 712 | Ga0501044_0563194 | 3300049823 | Bacteria | 1035 |
| 713 | Ga0501045_0003370 | 3300049824 | Bacteria | 10934 |
| 714 | Ga0501045_0039789 | 3300049824 | Bacteria | 3421 |
| 715 | Ga0501045_0115319 | 3300049824 | Bacteria | 1993 |
| 716 | Ga0501045_0128524 | 3300049824 | Bacteria | 1883 |
| 717 | Ga0501045_0141249 | 3300049824 | Bacteria | 1791 |
| 718 | nmdc:mga03n38_1053_c1 | 3300050490 | Bacteria | 7603 |
| 719 | nmdc:mga00v17_131734_c1 | 3300050491 | Bacteria | 1598 |
| 720 | nmdc:mga00v17_63546_c1 | 3300050491 | Bacteria | 2274 |
| 721 | nmdc:mga00v17_69246_c1 | 3300050491 | Bacteria | 2183 |
| 722 | nmdc:mga0yw44_10266_c1 | 3300050492 | Bacteria | 4776 |
| 723 | nmdc:mga0yw44_120363_c1 | 3300050492 | Bacteria | 1690 |
| 724 | nmdc:mga0yw44_138510_c2 | 3300050492 | Bacteria | 992 |
| 725 | nmdc:mga0yw44_20807_c1 | 3300050492 | Bacteria | 3648 |
| 726 | nmdc:mga0yw44_22881_c1 | 3300050492 | Bacteria | 3512 |
| 727 | nmdc:mga0yw44_24039_c1 | 3300050492 | Bacteria | 3442 |
| 728 | nmdc:mga0yw44_55546_c1 | 3300050492 | Bacteria | 2410 |
| 729 | nmdc:mga0yw44_612_c1 | 3300050492 | Bacteria | 12911 |
| 730 | nmdc:mga0yw44_84152_c2 | 3300050492 | Bacteria | 1606 |
| 731 | nmdc:mga06z11_43561_c1 | 3300050494 | Bacteria | 2259 |
| 732 | nmdc:mga06z11_907_c1 | 3300050494 | Bacteria | 10772 |
| 733 | nmdc:mga04h51_6579_c1 | 3300050495 | Bacteria | 3021 |
| 734 | nmdc:mga07m45_110096_c1 | 3300050496 | Bacteria | 1586 |
| 735 | nmdc:mga07m45_74174_c1 | 3300050496 | Bacteria | 1938 |
| 736 | nmdc:mga07m45_9984_c1 | 3300050496 | Bacteria | 4943 |
| 737 | nmdc:mga05p37_155_c1 | 3300050507 | Bacteria | 65410 |
| 738 | nmdc:mga05p37_35647_c1 | 3300050507 | Bacteria | 6102 |
| 739 | nmdc:mga09592_1_c1 | 3300050508 | Bacteria | 201102 |
| 740 | nmdc:mga09592_280559_c1 | 3300050508 | Bacteria | 1445 |
| 741 | nmdc:mga0qj67_12_c1 | 3300050509 | Bacteria | 76377 |
| 742 | nmdc:mga06r32_272_c2 | 3300050510 | Bacteria | 13716 |
| 743 | nmdc:mga06r32_59191_c1 | 3300050510 | Bacteria | 3683 |
| 744 | nmdc:mga06r32_656_c1 | 3300050510 | Bacteria | 30201 |
| 745 | nmdc:mga06r32_7_c1 | 3300050510 | Bacteria | 117700 |
| 746 | nmdc:mga08y16_188361_c1 | 3300050511 | Bacteria | 2141 |
| 747 | nmdc:mga08y16_229425_c1 | 3300050511 | Bacteria | 1920 |
| 748 | Ga0500635_0005249 | 3300053080 | Bacteria | 3384 |
| 749 | Ga0495619_0007885 | 3300053085 | Bacteria | 6739 |
| 750 | Ga0495619_0035584 | 3300053085 | Bacteria | 3239 |
| 751 | Ga0500644_0000047 | 3300053088 | Bacteria | 73844 |
| 752 | Ga0500644_0024438 | 3300053088 | Bacteria | 1847 |
| 753 | Ga0500583_0001661 | 3300053092 | Bacteria | 6483 |
| 754 | Ga0500651_0002023 | 3300053093 | Bacteria | 10523 |
| 755 | Ga0500641_0097230 | 3300053096 | Bacteria | 1261 |
| 756 | Ga0500654_128029 | 3300053099 | Bacteria | 972 |
| 757 | Ga0500556_0000917 | 3300053104 | Bacteria | 16230 |
| 758 | Ga0500593_000244 | 3300053117 | Bacteria | 22282 |
| 759 | Ga0500594_0017216 | 3300053118 | Bacteria | 1766 |
| 760 | Ga0500573_0005481 | 3300053140 | Bacteria | 6801 |
| 761 | Ga0500588_0002951 | 3300053146 | Bacteria | 3537 |
| 762 | Ga0501084_0007477 | 3300054114 | Bacteria | 9006 |
| 763 | Ga0501084_0024597 | 3300054114 | Bacteria | 5025 |
| 764 | Ga0501084_0116290 | 3300054114 | Bacteria | 2248 |
| 765 | Ga0501082_0004820 | 3300060353 | Bacteria | 11768 |
| 766 | Ga0501082_0006014 | 3300060353 | Bacteria | 10523 |
| 767 | Ga0501082_0562645 | 3300060353 | Bacteria | 997 |
| 768 | Ga0466962_0011493 | 3300061719 | Bacteria | 4263 |
| 769 | Ga0466962_0013209 | 3300061719 | Bacteria | 3972 |
| 770 | Ga0466962_0094554 | 3300061719 | Bacteria | 1433 |
| 771 | Ga0466962_0107416 | 3300061719 | Bacteria | 1343 |
| 772 | Ga0466962_0196300 | 3300061719 | Bacteria | 985 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0088025 | Ga0501038_0088025_897_1616 | 230 |
| 2 | 3300048923 | Ga0496120_0025930 | Ga0496120_0025930_2870_3616 | 247 |
| 3 | 3300048917 | Ga0496114_0355801 | Ga0496114_0355801_524_1276 | 248 |
| 4 | 3300049571 | Ga0501034_0787308 | Ga0501034_0787308_84_833 | 248 |
| 5 | 3300044684 | Ga0466966_0256053 | Ga0466966_0256053_58_888 | 266 |
| 6 | 3300045049 | Ga0466959_0065894 | Ga0466959_0065894_1322_2152 | 266 |
| 7 | 3300005327 | Ga0070658_10076206 | Ga0070658_100762062 | 267 |
| 8 | 3300036712 | Ga0316584_0060716 | Ga0316584_0060716_11_850 | 267 |
| 9 | 3300048928 | Ga0496125_0275040 | Ga0496125_0275040_12_818 | 267 |
| 10 | 3300005471 | Ga0070698_100041904 | Ga0070698_1000419043 | 270 |
| 11 | 3300003203 | JGI25406J46586_10013023 | JGI25406J46586_100130233 | 271 |
| 12 | 3300005985 | Ga0081539_10000031 | Ga0081539_10000031136 | 271 |
| 13 | 3300049585 | Ga0501069_0005923 | Ga0501069_0005923_2205_3104 | 272 |
| 14 | 3300049586 | Ga0501070_0045917 | Ga0501070_0045917_955_1854 | 272 |
| 15 | 3300049590 | Ga0501074_0007814 | Ga0501074_0007814_5750_6649 | 272 |
| 16 | 3300013105 | Ga0157369_10024472 | Ga0157369_100244723 | 274 |
| 17 | 3300044693 | Ga0466961_0164316 | Ga0466961_0164316_196_1026 | 274 |
| 18 | 3300044693 | Ga0466961_0192833 | Ga0466961_0192833_317_1147 | 274 |
| 19 | 3300048911 | Ga0496108_0377042 | Ga0496108_0377042_196_1026 | 274 |
| 20 | 3300049822 | Ga0501035_0319735 | Ga0501035_0319735_461_1291 | 275 |
| 21 | 3300050490 | nmdc:mga03n38_1053_c1 | nmdc:mga03n38_1053_c1_748_1575 | 275 |
| 22 | 3300050491 | nmdc:mga00v17_63546_c1 | nmdc:mga00v17_63546_c1_269_1096 | 275 |
| 23 | 3300050496 | nmdc:mga07m45_110096_c1 | nmdc:mga07m45_110096_c1_25_852 | 275 |
| 24 | 3300053088 | Ga0500644_0000047 | Ga0500644_0000047_71262_72089 | 275 |
| 25 | 3300044901 | Ga0466960_0070115 | Ga0466960_0070115_240_1109 | 276 |
| 26 | 3300005347 | Ga0070668_100000746 | Ga0070668_10000074615 | 277 |
| 27 | 3300005844 | Ga0068862_100063752 | Ga0068862_1000637521 | 277 |
| 28 | 3300025972 | Ga0207668_10007736 | Ga0207668_100077362 | 277 |
| 29 | 3300026142 | Ga0207698_10408485 | Ga0207698_104084851 | 277 |
| 30 | 3300050492 | nmdc:mga0yw44_120363_c1 | nmdc:mga0yw44_120363_c1_485_1372 | 278 |
| 31 | 3300049744 | Ga0501083_0291398 | Ga0501083_0291398_18_860 | 279 |
| 32 | 3300006038 | Ga0075365_10007416 | Ga0075365_100074166 | 280 |
| 33 | 3300006051 | Ga0075364_10141780 | Ga0075364_101417802 | 280 |
| 34 | 3300031691 | Ga0316579_10010071 | Ga0316579_100100712 | 280 |
| 35 | 3300031727 | Ga0316576_10179594 | Ga0316576_101795941 | 280 |
| 36 | 3300031728 | Ga0316578_10047438 | Ga0316578_100474382 | 280 |
| 37 | 3300031728 | Ga0316578_10140796 | Ga0316578_101407961 | 280 |
| 38 | 3300031733 | Ga0316577_10042523 | Ga0316577_100425232 | 280 |
| 39 | 3300032133 | Ga0316583_10035045 | Ga0316583_100350452 | 280 |
| 40 | 3300032139 | Ga0316580_10006992 | Ga0316580_100069923 | 280 |
| 41 | 3300032139 | Ga0316580_10054246 | Ga0316580_100542462 | 280 |
| 42 | 3300035083 | Ga0373926_0145645 | Ga0373926_0145645_21_863 | 280 |
| 43 | 3300036647 | Ga0316582_0000779 | Ga0316582_0000779_2126_3028 | 280 |
| 44 | 3300036712 | Ga0316584_0039601 | Ga0316584_0039601_2194_3096 | 280 |
| 45 | 3300048922 | Ga0496119_0012511 | Ga0496119_0012511_5175_6020 | 280 |
| 46 | 3300048923 | Ga0496120_0000566 | Ga0496120_0000566_38152_38997 | 280 |
| 47 | 3300050491 | nmdc:mga00v17_131734_c1 | nmdc:mga00v17_131734_c1_495_1337 | 280 |
| 48 | 3300050492 | nmdc:mga0yw44_612_c1 | nmdc:mga0yw44_612_c1_9587_10429 | 280 |
| 49 | 3300046460 | Ga0495638_0014854 | Ga0495638_0014854_1895_2743 | 281 |
| 50 | 3300005344 | Ga0070661_100095772 | Ga0070661_1000957722 | 282 |
| 51 | 3300005455 | Ga0070663_100009158 | Ga0070663_1000091585 | 282 |
| 52 | 3300005564 | Ga0070664_100042838 | Ga0070664_1000428382 | 282 |
| 53 | 3300025945 | Ga0207679_10019322 | Ga0207679_100193224 | 282 |
| 54 | 3300026067 | Ga0207678_10038470 | Ga0207678_100384702 | 282 |
| 55 | 3300005347 | Ga0070668_100002337 | Ga0070668_1000023372 | 283 |
| 56 | 3300031838 | Ga0307518_10000054 | Ga0307518_1000005430 | 283 |
| 57 | 3300044706 | Ga0466964_0134501 | Ga0466964_0134501_260_1117 | 283 |
| 58 | 3300049581 | Ga0501047_0052159 | Ga0501047_0052159_2580_3443 | 283 |
| 59 | 3300049582 | Ga0501048_0282421 | Ga0501048_0282421_13_867 | 283 |
| 60 | 3300049822 | Ga0501035_0074458 | Ga0501035_0074458_514_1377 | 283 |
| 61 | 3300049823 | Ga0501044_0110257 | Ga0501044_0110257_1622_2485 | 283 |
| 62 | 3300053099 | Ga0500654_128029 | Ga0500654_128029_46_903 | 283 |
| 63 | 3300061719 | Ga0466962_0094554 | Ga0466962_0094554_476_1333 | 283 |
| 64 | iso_pu_bacteria | 2842888712 | 2842889391 | 283 |
| 65 | 3300027876 | Ga0209974_10019824 | Ga0209974_100198242 | 284 |
| 66 | 3300037312 | Ga0395899_0009852 | Ga0395899_0009852_3231_4091 | 284 |
| 67 | 3300037418 | Ga0395900_0086530 | Ga0395900_0086530_1537_2397 | 284 |
| 68 | 3300037466 | Ga0395898_0007995 | Ga0395898_0007995_3369_4229 | 284 |
| 69 | 3300044656 | Ga0466969_0019533 | Ga0466969_0019533_1686_2546 | 284 |
| 70 | 3300044683 | Ga0466965_0123140 | Ga0466965_0123140_158_1027 | 284 |
| 71 | 3300044693 | Ga0466961_0009977 | Ga0466961_0009977_494_1354 | 284 |
| 72 | 3300044694 | Ga0466963_0017029 | Ga0466963_0017029_2814_3674 | 284 |
| 73 | 3300044719 | Ga0466971_0042724 | Ga0466971_0042724_464_1324 | 284 |
| 74 | 3300044719 | Ga0466971_0061282 | Ga0466971_0061282_279_1148 | 284 |
| 75 | 3300044765 | Ga0466970_0079722 | Ga0466970_0079722_807_1667 | 284 |
| 76 | 3300045836 | Ga0466958_0019354 | Ga0466958_0019354_2627_3487 | 284 |
| 77 | 3300048920 | Ga0496117_0209546 | Ga0496117_0209546_21_878 | 284 |
| 78 | 3300049130 | Ga0501310_000074 | Ga0501310_000074_8234_9109 | 284 |
| 79 | 3300061719 | Ga0466962_0011493 | Ga0466962_0011493_2907_3767 | 284 |
| 80 | 3300061719 | Ga0466962_0107416 | Ga0466962_0107416_449_1318 | 284 |
| 81 | 3300005337 | Ga0070682_100386734 | Ga0070682_1003867342 | 285 |
| 82 | 3300005458 | Ga0070681_10137649 | Ga0070681_101376493 | 285 |
| 83 | 3300005616 | Ga0068852_100072451 | Ga0068852_1000724512 | 285 |
| 84 | 3300006038 | Ga0075365_10000677 | Ga0075365_100006777 | 285 |
| 85 | 3300006042 | Ga0075368_10001597 | Ga0075368_100015977 | 285 |
| 86 | 3300006048 | Ga0075363_100031748 | Ga0075363_1000317482 | 285 |
| 87 | 3300006051 | Ga0075364_10019212 | Ga0075364_100192123 | 285 |
| 88 | 3300006051 | Ga0075364_10045913 | Ga0075364_100459132 | 285 |
| 89 | 3300006177 | Ga0075362_10009973 | Ga0075362_100099731 | 285 |
| 90 | 3300006178 | Ga0075367_10060857 | Ga0075367_100608572 | 285 |
| 91 | 3300006353 | Ga0075370_10005572 | Ga0075370_100055725 | 285 |
| 92 | 3300006353 | Ga0075370_10050676 | Ga0075370_100506763 | 285 |
| 93 | 3300009551 | Ga0105238_10548134 | Ga0105238_105481342 | 285 |
| 94 | 3300013105 | Ga0157369_10299025 | Ga0157369_102990252 | 285 |
| 95 | 3300013307 | Ga0157372_10113774 | Ga0157372_101137744 | 285 |
| 96 | 3300013307 | Ga0157372_10446240 | Ga0157372_104462402 | 285 |
| 97 | 3300020082 | Ga0206353_11080514 | Ga0206353_110805142 | 285 |
| 98 | 3300025912 | Ga0207707_10108249 | Ga0207707_101082492 | 285 |
| 99 | 3300025921 | Ga0207652_10132970 | Ga0207652_101329702 | 285 |
| 100 | 3300027866 | Ga0209813_10015554 | Ga0209813_100155541 | 285 |
| 101 | 3300044842 | Ga0466957_0071367 | Ga0466957_0071367_948_1823 | 285 |
| 102 | 3300044901 | Ga0466960_0036011 | Ga0466960_0036011_1301_2176 | 285 |
| 103 | 3300045976 | Ga0466967_0003892 | Ga0466967_0003892_8372_9250 | 285 |
| 104 | 3300045976 | Ga0466967_0055827 | Ga0466967_0055827_77_952 | 285 |
| 105 | 3300045976 | Ga0466967_0073521 | Ga0466967_0073521_870_1733 | 285 |
| 106 | 3300045976 | Ga0466967_0313376 | Ga0466967_0313376_334_1200 | 285 |
| 107 | 3300046455 | Ga0495603_0040357 | Ga0495603_0040357_948_1850 | 285 |
| 108 | 3300046459 | Ga0495629_0098986 | Ga0495629_0098986_600_1502 | 285 |
| 109 | 3300049570 | Ga0501033_0033775 | Ga0501033_0033775_1535_2431 | 285 |
| 110 | 3300049744 | Ga0501083_0000169 | Ga0501083_0000169_30169_31047 | 285 |
| 111 | 3300050492 | nmdc:mga0yw44_55546_c1 | nmdc:mga0yw44_55546_c1_1081_1941 | 285 |
| 112 | 3300050494 | nmdc:mga06z11_907_c1 | nmdc:mga06z11_907_c1_3968_4828 | 285 |
| 113 | 3300050495 | nmdc:mga04h51_6579_c1 | nmdc:mga04h51_6579_c1_1345_2205 | 285 |
| 114 | 3300050496 | nmdc:mga07m45_9984_c1 | nmdc:mga07m45_9984_c1_3356_4216 | 285 |
| 115 | iso_pu_bacteria | 2515154088 | 2515495254 | 285 |
| 116 | iso_pu_bacteria | 2515154129 | 2515722255 | 285 |
| 117 | iso_pu_bacteria | 2515154137 | 2515754794 | 285 |
| 118 | iso_pu_bacteria | 2515154202 | 2516085393 | 285 |
| 119 | iso_pu_bacteria | 2515154203 | 2516088435 | 285 |
| 120 | iso_pu_bacteria | 2558860280 | 2559424540 | 285 |
| 121 | iso_pu_bacteria | 2643221615 | 2644088994 | 285 |
| 122 | iso_pu_bacteria | 2643221657 | 2644318839 | 285 |
| 123 | iso_pu_bacteria | 2721755702 | 2723642021 | 285 |
| 124 | iso_pu_bacteria | 2751185734 | 2753073964 | 285 |
| 125 | iso_pu_bacteria | 2775506925 | 2776372437 | 285 |
| 126 | iso_pu_bacteria | 2791354901 | 2791909934 | 285 |
| 127 | iso_pu_bacteria | 2863067949 | 2863068187 | 285 |
| 128 | iso_pu_bacteria | 2866552031 | 2866556802 | 285 |
| 129 | iso_pu_bacteria | 2866612099 | 2866614534 | 285 |
| 130 | iso_pu_bacteria | 2870721527 | 2870725768 | 285 |
| 131 | iso_pu_bacteria | 2899359706 | 2899365306 | 285 |
| 132 | iso_pu_bacteria | 2899370129 | 2899372911 | 285 |
| 133 | iso_pu_bacteria | 2915768154 | 2915770332 | 285 |
| 134 | iso_pu_bacteria | 2917736166 | 2917739501 | 285 |
| 135 | iso_pu_bacteria | 2935409751 | 2935411371 | 285 |
| 136 | iso_pu_bacteria | 649633069 | 649814134 | 285 |
| 137 | iso_pu_bacteria | 8003314358 | 8003323899 | 285 |
| 138 | iso_pu_bacteria | 8047710418 | 8047716886 | 285 |
| 139 | iso_pu_bacteria | 8055034563 | 8055035907 | 285 |
| 140 | iso_pu_bacteria | 8055037949 | 8055038539 | 285 |
| 141 | iso_pu_bacteria | 8056207758 | 8056211269 | 285 |
| 142 | 3300003911 | JGI25405J52794_10036554 | JGI25405J52794_100365541 | 286 |
| 143 | 3300005437 | Ga0070710_10019260 | Ga0070710_100192604 | 286 |
| 144 | 3300005439 | Ga0070711_100381426 | Ga0070711_1003814262 | 286 |
| 145 | 3300005937 | Ga0081455_10003821 | Ga0081455_100038213 | 286 |
| 146 | 3300006038 | Ga0075365_10018660 | Ga0075365_100186603 | 286 |
| 147 | 3300006038 | Ga0075365_10067606 | Ga0075365_100676063 | 286 |
| 148 | 3300006178 | Ga0075367_10190494 | Ga0075367_101904942 | 286 |
| 149 | 3300006353 | Ga0075370_10155983 | Ga0075370_101559832 | 286 |
| 150 | 3300020082 | Ga0206353_11891153 | Ga0206353_1189115311 | 286 |
| 151 | 3300025898 | Ga0207692_10000319 | Ga0207692_1000031916 | 286 |
| 152 | 3300031665 | Ga0316575_10003465 | Ga0316575_100034655 | 286 |
| 153 | 3300031691 | Ga0316579_10040114 | Ga0316579_100401142 | 286 |
| 154 | 3300031727 | Ga0316576_10003068 | Ga0316576_100030682 | 286 |
| 155 | 3300031727 | Ga0316576_10003940 | Ga0316576_100039405 | 286 |
| 156 | 3300031728 | Ga0316578_10055049 | Ga0316578_100550492 | 286 |
| 157 | 3300031733 | Ga0316577_10011220 | Ga0316577_100112202 | 286 |
| 158 | 3300032133 | Ga0316583_10004161 | Ga0316583_100041611 | 286 |
| 159 | 3300032137 | Ga0316585_10000165 | Ga0316585_100001659 | 286 |
| 160 | 3300035398 | Ga0316574_0032038 | Ga0316574_0032038_1271_2146 | 286 |
| 161 | 3300036712 | Ga0316584_0002926 | Ga0316584_0002926_6066_6941 | 286 |
| 162 | 3300044658 | Ga0466972_0000279 | Ga0466972_0000279_25968_26846 | 286 |
| 163 | 3300044683 | Ga0466965_0004487 | Ga0466965_0004487_3496_4374 | 286 |
| 164 | 3300044683 | Ga0466965_0021527 | Ga0466965_0021527_430_1308 | 286 |
| 165 | 3300044683 | Ga0466965_0043864 | Ga0466965_0043864_621_1487 | 286 |
| 166 | 3300044765 | Ga0466970_0238903 | Ga0466970_0238903_91_996 | 286 |
| 167 | 3300044901 | Ga0466960_0018047 | Ga0466960_0018047_832_1710 | 286 |
| 168 | 3300048912 | Ga0496109_0394890 | Ga0496109_0394890_333_1214 | 286 |
| 169 | 3300049589 | Ga0501073_0210030 | Ga0501073_0210030_148_1014 | 286 |
| 170 | 3300049741 | Ga0501079_0179269 | Ga0501079_0179269_623_1489 | 286 |
| 171 | 3300050492 | nmdc:mga0yw44_20807_c1 | nmdc:mga0yw44_20807_c1_1489_2355 | 286 |
| 172 | 3300050492 | nmdc:mga0yw44_24039_c1 | nmdc:mga0yw44_24039_c1_246_1124 | 286 |
| 173 | 3300050492 | nmdc:mga0yw44_84152_c2 | nmdc:mga0yw44_84152_c2_204_1070 | 286 |
| 174 | 3300050494 | nmdc:mga06z11_43561_c1 | nmdc:mga06z11_43561_c1_1366_2232 | 286 |
| 175 | 3300050496 | nmdc:mga07m45_74174_c1 | nmdc:mga07m45_74174_c1_542_1408 | 286 |
| 176 | iso_pu_bacteria | 2622736626 | 2623590682 | 286 |
| 177 | iso_pu_bacteria | 2643221549 | 2643767781 | 286 |
| 178 | iso_pu_bacteria | 2643221619 | 2644111156 | 286 |
| 179 | iso_pu_bacteria | 2738541305 | 2738868245 | 286 |
| 180 | iso_pu_bacteria | 2808606372 | 2808901999 | 286 |
| 181 | iso_pu_bacteria | 2862993130 | 2862996290 | 286 |
| 182 | iso_pu_bacteria | 2919443155 | 2919446226 | 286 |
| 183 | iso_pu_bacteria | 8003856774 | 8003857695 | 286 |
| 184 | 3300002075 | JGI24738J21930_10002669 | JGI24738J21930_100026692 | 287 |
| 185 | 3300002077 | JGI24744J21845_10009967 | JGI24744J21845_100099671 | 287 |
| 186 | 3300005329 | Ga0070683_100037841 | Ga0070683_1000378413 | 287 |
| 187 | 3300005331 | Ga0070670_100423524 | Ga0070670_1004235242 | 287 |
| 188 | 3300005339 | Ga0070660_100012121 | Ga0070660_1000121215 | 287 |
| 189 | 3300005340 | Ga0070689_100119070 | Ga0070689_1001190701 | 287 |
| 190 | 3300005356 | Ga0070674_100007204 | Ga0070674_1000072042 | 287 |
| 191 | 3300005365 | Ga0070688_100025042 | Ga0070688_1000250423 | 287 |
| 192 | 3300005366 | Ga0070659_100040200 | Ga0070659_1000402002 | 287 |
| 193 | 3300005435 | Ga0070714_100000006 | Ga0070714_100000006200 | 287 |
| 194 | 3300005438 | Ga0070701_10002064 | Ga0070701_100020644 | 287 |
| 195 | 3300005441 | Ga0070700_100023760 | Ga0070700_1000237602 | 287 |
| 196 | 3300005459 | Ga0068867_100062511 | Ga0068867_1000625111 | 287 |
| 197 | 3300005539 | Ga0068853_100076865 | Ga0068853_1000768653 | 287 |
| 198 | 3300005544 | Ga0070686_100009873 | Ga0070686_1000098732 | 287 |
| 199 | 3300005547 | Ga0070693_100137793 | Ga0070693_1001377932 | 287 |
| 200 | 3300005616 | Ga0068852_100055780 | Ga0068852_1000557802 | 287 |
| 201 | 3300005618 | Ga0068864_100209604 | Ga0068864_1002096042 | 287 |
| 202 | 3300005834 | Ga0068851_10128613 | Ga0068851_101286132 | 287 |
| 203 | 3300005840 | Ga0068870_10011139 | Ga0068870_100111392 | 287 |
| 204 | 3300005983 | Ga0081540_1009989 | Ga0081540_10099895 | 287 |
| 205 | 3300006038 | Ga0075365_10007206 | Ga0075365_100072064 | 287 |
| 206 | 3300006844 | Ga0075428_100000304 | Ga0075428_10000030446 | 287 |
| 207 | 3300006846 | Ga0075430_100001144 | Ga0075430_10000114422 | 287 |
| 208 | 3300006847 | Ga0075431_100000395 | Ga0075431_10000039537 | 287 |
| 209 | 3300006880 | Ga0075429_100001175 | Ga0075429_1000011751 | 287 |
| 210 | 3300006881 | Ga0068865_100007170 | Ga0068865_1000071703 | 287 |
| 211 | 3300009098 | Ga0105245_10086467 | Ga0105245_100864673 | 287 |
| 212 | 3300009147 | Ga0114129_10000016 | Ga0114129_10000016121 | 287 |
| 213 | 3300009148 | Ga0105243_10005990 | Ga0105243_100059902 | 287 |
| 214 | 3300009148 | Ga0105243_10111970 | Ga0105243_101119701 | 287 |
| 215 | 3300009176 | Ga0105242_10214205 | Ga0105242_102142052 | 287 |
| 216 | 3300009551 | Ga0105238_10143897 | Ga0105238_101438972 | 287 |
| 217 | 3300009551 | Ga0105238_10247464 | Ga0105238_102474642 | 287 |
| 218 | 3300009553 | Ga0105249_10153183 | Ga0105249_101531832 | 287 |
| 219 | 3300010375 | Ga0105239_10100291 | Ga0105239_101002912 | 287 |
| 220 | 3300013307 | Ga0157372_10000022 | Ga0157372_10000022125 | 287 |
| 221 | 3300013307 | Ga0157372_10442237 | Ga0157372_104422372 | 287 |
| 222 | 3300017792 | Ga0163161_10326698 | Ga0163161_103266981 | 287 |
| 223 | 3300020082 | Ga0206353_10327152 | Ga0206353_103271522 | 287 |
| 224 | 3300025901 | Ga0207688_10009412 | Ga0207688_100094122 | 287 |
| 225 | 3300025908 | Ga0207643_10001623 | Ga0207643_100016234 | 287 |
| 226 | 3300025909 | Ga0207705_10241215 | Ga0207705_102412152 | 287 |
| 227 | 3300025919 | Ga0207657_10001763 | Ga0207657_1000176317 | 287 |
| 228 | 3300025924 | Ga0207694_10174088 | Ga0207694_101740882 | 287 |
| 229 | 3300025927 | Ga0207687_10016680 | Ga0207687_100166802 | 287 |
| 230 | 3300025936 | Ga0207670_10472103 | Ga0207670_104721032 | 287 |
| 231 | 3300025940 | Ga0207691_10001326 | Ga0207691_1000132613 | 287 |
| 232 | 3300025942 | Ga0207689_10374698 | Ga0207689_103746982 | 287 |
| 233 | 3300025944 | Ga0207661_10092349 | Ga0207661_100923492 | 287 |
| 234 | 3300025981 | Ga0207640_10014069 | Ga0207640_100140693 | 287 |
| 235 | 3300026023 | Ga0207677_10122563 | Ga0207677_101225632 | 287 |
| 236 | 3300026041 | Ga0207639_10072809 | Ga0207639_100728092 | 287 |
| 237 | 3300026075 | Ga0207708_10001578 | Ga0207708_100015785 | 287 |
| 238 | 3300026089 | Ga0207648_10000901 | Ga0207648_1000090114 | 287 |
| 239 | 3300026118 | Ga0207675_100117587 | Ga0207675_1001175872 | 287 |
| 240 | 3300026142 | Ga0207698_10300780 | Ga0207698_103007802 | 287 |
| 241 | 3300027907 | Ga0207428_10052631 | Ga0207428_100526313 | 287 |
| 242 | 3300028794 | Ga0307515_10041718 | Ga0307515_100417184 | 287 |
| 243 | 3300031901 | Ga0307406_10127237 | Ga0307406_101272371 | 287 |
| 244 | 3300031995 | Ga0307409_100078881 | Ga0307409_1000788813 | 287 |
| 245 | 3300032002 | Ga0307416_100094852 | Ga0307416_1000948522 | 287 |
| 246 | 3300032126 | Ga0307415_100053088 | Ga0307415_1000530882 | 287 |
| 247 | 3300032126 | Ga0307415_100242234 | Ga0307415_1002422341 | 287 |
| 248 | 3300037471 | Ga0395905_0055029 | Ga0395905_0055029_1071_1979 | 287 |
| 249 | 3300037853 | Ga0436364_1185528 | Ga0436364_1185528_75_953 | 287 |
| 250 | 3300041413 | Ga0439465_0009655 | Ga0439465_0009655_991_1866 | 287 |
| 251 | 3300044656 | Ga0466969_0049269 | Ga0466969_0049269_1073_1984 | 287 |
| 252 | 3300044683 | Ga0466965_0036258 | Ga0466965_0036258_1520_2395 | 287 |
| 253 | 3300044693 | Ga0466961_0025915 | Ga0466961_0025915_2823_3734 | 287 |
| 254 | 3300044842 | Ga0466957_0070542 | Ga0466957_0070542_303_1187 | 287 |
| 255 | 3300045976 | Ga0466967_0003364 | Ga0466967_0003364_7631_8515 | 287 |
| 256 | 3300045976 | Ga0466967_0099530 | Ga0466967_0099530_797_1684 | 287 |
| 257 | 3300046689 | Ga0495613_0058806 | Ga0495613_0058806_1530_2405 | 287 |
| 258 | 3300048913 | Ga0496110_0201292 | Ga0496110_0201292_500_1378 | 287 |
| 259 | 3300048915 | Ga0496112_0556393 | Ga0496112_0556393_79_963 | 287 |
| 260 | 3300049571 | Ga0501034_0033306 | Ga0501034_0033306_449_1324 | 287 |
| 261 | 3300049580 | Ga0501046_0009069 | Ga0501046_0009069_6121_6996 | 287 |
| 262 | 3300049581 | Ga0501047_0007350 | Ga0501047_0007350_1078_1953 | 287 |
| 263 | 3300049586 | Ga0501070_0092607 | Ga0501070_0092607_103_978 | 287 |
| 264 | 3300049822 | Ga0501035_0285120 | Ga0501035_0285120_217_1092 | 287 |
| 265 | 3300049823 | Ga0501044_0029520 | Ga0501044_0029520_3865_4740 | 287 |
| 266 | 3300050507 | nmdc:mga05p37_155_c1 | nmdc:mga05p37_155_c1_26947_27843 | 287 |
| 267 | 3300050508 | nmdc:mga09592_1_c1 | nmdc:mga09592_1_c1_110475_111371 | 287 |
| 268 | 3300050509 | nmdc:mga0qj67_12_c1 | nmdc:mga0qj67_12_c1_72011_72907 | 287 |
| 269 | 3300050510 | nmdc:mga06r32_7_c1 | nmdc:mga06r32_7_c1_47822_48718 | 287 |
| 270 | 3300050511 | nmdc:mga08y16_188361_c1 | nmdc:mga08y16_188361_c1_1102_1980 | 287 |
| 271 | 3300053140 | Ga0500573_0005481 | Ga0500573_0005481_1931_2803 | 287 |
| 272 | iso_pu_bacteria | 2643221561 | 2643826006 | 287 |
| 273 | iso_pu_bacteria | 2643221632 | 2644183527 | 287 |
| 274 | iso_pu_bacteria | 2643221696 | 2644531994 | 287 |
| 275 | iso_pu_bacteria | 2675903059 | 2676485165 | 287 |
| 276 | iso_pu_bacteria | 2831935698 | 2831937394 | 287 |
| 277 | iso_pu_bacteria | 2832004796 | 2832008231 | 287 |
| 278 | iso_pu_bacteria | 2855386786 | 2855387081 | 287 |
| 279 | iso_pu_bacteria | 2858902515 | 2858906671 | 287 |
| 280 | iso_pu_bacteria | 2866065130 | 2866067932 | 287 |
| 281 | 3300005327 | Ga0070658_10004741 | Ga0070658_100047414 | 288 |
| 282 | 3300005327 | Ga0070658_10008837 | Ga0070658_100088372 | 288 |
| 283 | 3300005327 | Ga0070658_10302874 | Ga0070658_103028742 | 288 |
| 284 | 3300005329 | Ga0070683_100048582 | Ga0070683_1000485822 | 288 |
| 285 | 3300005334 | Ga0068869_100321004 | Ga0068869_1003210042 | 288 |
| 286 | 3300005337 | Ga0070682_100317702 | Ga0070682_1003177021 | 288 |
| 287 | 3300005338 | Ga0068868_100033227 | Ga0068868_1000332272 | 288 |
| 288 | 3300005339 | Ga0070660_100067509 | Ga0070660_1000675092 | 288 |
| 289 | 3300005344 | Ga0070661_100055263 | Ga0070661_1000552632 | 288 |
| 290 | 3300005344 | Ga0070661_100073099 | Ga0070661_1000730992 | 288 |
| 291 | 3300005355 | Ga0070671_100123045 | Ga0070671_1001230453 | 288 |
| 292 | 3300005366 | Ga0070659_100003361 | Ga0070659_1000033613 | 288 |
| 293 | 3300005367 | Ga0070667_100072824 | Ga0070667_1000728242 | 288 |
| 294 | 3300005435 | Ga0070714_100031128 | Ga0070714_1000311282 | 288 |
| 295 | 3300005456 | Ga0070678_100182505 | Ga0070678_1001825051 | 288 |
| 296 | 3300005530 | Ga0070679_100174550 | Ga0070679_1001745502 | 288 |
| 297 | 3300005539 | Ga0068853_100124338 | Ga0068853_1001243382 | 288 |
| 298 | 3300005543 | Ga0070672_100206236 | Ga0070672_1002062362 | 288 |
| 299 | 3300005577 | Ga0068857_100007435 | Ga0068857_1000074354 | 288 |
| 300 | 3300005614 | Ga0068856_100122124 | Ga0068856_1001221242 | 288 |
| 301 | 3300005616 | Ga0068852_100004283 | Ga0068852_1000042832 | 288 |
| 302 | 3300005616 | Ga0068852_100032573 | Ga0068852_1000325732 | 288 |
| 303 | 3300005616 | Ga0068852_100085275 | Ga0068852_1000852752 | 288 |
| 304 | 3300005616 | Ga0068852_100173064 | Ga0068852_1001730642 | 288 |
| 305 | 3300005616 | Ga0068852_100508955 | Ga0068852_1005089552 | 288 |
| 306 | 3300005618 | Ga0068864_100124480 | Ga0068864_1001244802 | 288 |
| 307 | 3300005719 | Ga0068861_100088055 | Ga0068861_1000880552 | 288 |
| 308 | 3300005834 | Ga0068851_10000061 | Ga0068851_1000006152 | 288 |
| 309 | 3300005841 | Ga0068863_100039842 | Ga0068863_1000398423 | 288 |
| 310 | 3300005841 | Ga0068863_100077602 | Ga0068863_1000776022 | 288 |
| 311 | 3300005842 | Ga0068858_100000153 | Ga0068858_10000015370 | 288 |
| 312 | 3300005983 | Ga0081540_1004300 | Ga0081540_10043007 | 288 |
| 313 | 3300005985 | Ga0081539_10024063 | Ga0081539_100240632 | 288 |
| 314 | 3300006880 | Ga0075429_100237965 | Ga0075429_1002379652 | 288 |
| 315 | 3300009093 | Ga0105240_10002502 | Ga0105240_1000250220 | 288 |
| 316 | 3300009093 | Ga0105240_10083204 | Ga0105240_100832042 | 288 |
| 317 | 3300009098 | Ga0105245_10005677 | Ga0105245_100056775 | 288 |
| 318 | 3300009098 | Ga0105245_10068656 | Ga0105245_100686562 | 288 |
| 319 | 3300009147 | Ga0114129_10000041 | Ga0114129_1000004130 | 288 |
| 320 | 3300009174 | Ga0105241_10000229 | Ga0105241_1000022932 | 288 |
| 321 | 3300009177 | Ga0105248_10000378 | Ga0105248_1000037851 | 288 |
| 322 | 3300009545 | Ga0105237_10000827 | Ga0105237_1000082731 | 288 |
| 323 | 3300009545 | Ga0105237_10091866 | Ga0105237_100918662 | 288 |
| 324 | 3300009551 | Ga0105238_10000640 | Ga0105238_100006408 | 288 |
| 325 | 3300009551 | Ga0105238_10016050 | Ga0105238_100160506 | 288 |
| 326 | 3300009551 | Ga0105238_10125629 | Ga0105238_101256292 | 288 |
| 327 | 3300010375 | Ga0105239_10880529 | Ga0105239_108805292 | 288 |
| 328 | 3300013296 | Ga0157374_10206858 | Ga0157374_102068582 | 288 |
| 329 | 3300013307 | Ga0157372_10210312 | Ga0157372_102103122 | 288 |
| 330 | 3300014325 | Ga0163163_10010338 | Ga0163163_100103384 | 288 |
| 331 | 3300014326 | Ga0157380_10105561 | Ga0157380_101055612 | 288 |
| 332 | 3300014968 | Ga0157379_10025522 | Ga0157379_100255222 | 288 |
| 333 | 3300020082 | Ga0206353_11872740 | Ga0206353_118727402 | 288 |
| 334 | 3300021388 | Ga0213875_10000991 | Ga0213875_100009918 | 288 |
| 335 | 3300025254 | Ga0209148_1000498 | Ga0209148_100049821 | 288 |
| 336 | 3300025321 | Ga0207656_10000012 | Ga0207656_10000012129 | 288 |
| 337 | 3300025906 | Ga0207699_10196696 | Ga0207699_101966961 | 288 |
| 338 | 3300025908 | Ga0207643_10037042 | Ga0207643_100370423 | 288 |
| 339 | 3300025909 | Ga0207705_10008427 | Ga0207705_100084272 | 288 |
| 340 | 3300025911 | Ga0207654_10000003 | Ga0207654_1000000398 | 288 |
| 341 | 3300025912 | Ga0207707_10217321 | Ga0207707_102173212 | 288 |
| 342 | 3300025913 | Ga0207695_10002929 | Ga0207695_100029298 | 288 |
| 343 | 3300025913 | Ga0207695_10008719 | Ga0207695_1000871912 | 288 |
| 344 | 3300025914 | Ga0207671_10000002 | Ga0207671_10000002237 | 288 |
| 345 | 3300025917 | Ga0207660_10093174 | Ga0207660_100931743 | 288 |
| 346 | 3300025919 | Ga0207657_10047218 | Ga0207657_100472182 | 288 |
| 347 | 3300025921 | Ga0207652_10058263 | Ga0207652_100582633 | 288 |
| 348 | 3300025924 | Ga0207694_10000061 | Ga0207694_1000006162 | 288 |
| 349 | 3300025924 | Ga0207694_10021073 | Ga0207694_100210736 | 288 |
| 350 | 3300025924 | Ga0207694_10035507 | Ga0207694_100355074 | 288 |
| 351 | 3300025927 | Ga0207687_10037986 | Ga0207687_100379862 | 288 |
| 352 | 3300025931 | Ga0207644_10022889 | Ga0207644_100228893 | 288 |
| 353 | 3300025940 | Ga0207691_10131467 | Ga0207691_101314672 | 288 |
| 354 | 3300025941 | Ga0207711_10004464 | Ga0207711_100044643 | 288 |
| 355 | 3300025944 | Ga0207661_10079712 | Ga0207661_100797123 | 288 |
| 356 | 3300025949 | Ga0207667_10002096 | Ga0207667_1000209620 | 288 |
| 357 | 3300026023 | Ga0207677_10434271 | Ga0207677_104342711 | 288 |
| 358 | 3300026035 | Ga0207703_10000044 | Ga0207703_10000044142 | 288 |
| 359 | 3300026041 | Ga0207639_10070078 | Ga0207639_100700782 | 288 |
| 360 | 3300026041 | Ga0207639_10109597 | Ga0207639_101095973 | 288 |
| 361 | 3300026078 | Ga0207702_10089540 | Ga0207702_100895402 | 288 |
| 362 | 3300026078 | Ga0207702_10632736 | Ga0207702_106327362 | 288 |
| 363 | 3300026116 | Ga0207674_10003026 | Ga0207674_1000302613 | 288 |
| 364 | 3300026116 | Ga0207674_10151138 | Ga0207674_101511382 | 288 |
| 365 | 3300026142 | Ga0207698_10001433 | Ga0207698_100014335 | 288 |
| 366 | 3300026142 | Ga0207698_10003011 | Ga0207698_100030118 | 288 |
| 367 | 3300026142 | Ga0207698_10029837 | Ga0207698_100298372 | 288 |
| 368 | 3300030521 | Ga0307511_10000625 | Ga0307511_100006254 | 288 |
| 369 | 3300031824 | Ga0307413_10000161 | Ga0307413_1000016110 | 288 |
| 370 | 3300031903 | Ga0307407_10138690 | Ga0307407_101386902 | 288 |
| 371 | 3300033179 | Ga0307507_10006894 | Ga0307507_100068948 | 288 |
| 372 | 3300037853 | Ga0436364_1297258 | Ga0436364_1297258_34296_35186 | 288 |
| 373 | 3300038443 | Ga0395901_0041325 | Ga0395901_0041325_803_1687 | 288 |
| 374 | 3300041456 | Ga0451795_0740335 | Ga0451795_0740335_189_1076 | 288 |
| 375 | 3300044656 | Ga0466969_0015226 | Ga0466969_0015226_351_1238 | 288 |
| 376 | 3300044684 | Ga0466966_0003783 | Ga0466966_0003783_7786_8673 | 288 |
| 377 | 3300044693 | Ga0466961_0005989 | Ga0466961_0005989_1956_2843 | 288 |
| 378 | 3300044693 | Ga0466961_0091459 | Ga0466961_0091459_682_1569 | 288 |
| 379 | 3300044694 | Ga0466963_0046285 | Ga0466963_0046285_52_972 | 288 |
| 380 | 3300044765 | Ga0466970_0004075 | Ga0466970_0004075_2008_2874 | 288 |
| 381 | 3300044901 | Ga0466960_0053618 | Ga0466960_0053618_256_1149 | 288 |
| 382 | 3300044901 | Ga0466960_0143957 | Ga0466960_0143957_35_901 | 288 |
| 383 | 3300045049 | Ga0466959_0007634 | Ga0466959_0007634_2794_3681 | 288 |
| 384 | 3300045836 | Ga0466958_0023102 | Ga0466958_0023102_166_1242 | 288 |
| 385 | 3300045976 | Ga0466967_0041061 | Ga0466967_0041061_3037_3930 | 288 |
| 386 | 3300048906 | Ga0496103_0345991 | Ga0496103_0345991_36_917 | 288 |
| 387 | 3300048911 | Ga0496108_0154850 | Ga0496108_0154850_363_1244 | 288 |
| 388 | 3300048911 | Ga0496108_0267460 | Ga0496108_0267460_377_1261 | 288 |
| 389 | 3300048915 | Ga0496112_0474172 | Ga0496112_0474172_50_934 | 288 |
| 390 | 3300048921 | Ga0496118_0043209 | Ga0496118_0043209_2069_2938 | 288 |
| 391 | 3300048928 | Ga0496125_0154109 | Ga0496125_0154109_11_880 | 288 |
| 392 | 3300048929 | Ga0496126_0075618 | Ga0496126_0075618_1128_1997 | 288 |
| 393 | 3300049568 | Ga0501031_0001919 | Ga0501031_0001919_11319_12212 | 288 |
| 394 | 3300049568 | Ga0501031_0007908 | Ga0501031_0007908_4637_5506 | 288 |
| 395 | 3300049570 | Ga0501033_0005298 | Ga0501033_0005298_3617_4510 | 288 |
| 396 | 3300049571 | Ga0501034_0045110 | Ga0501034_0045110_1761_2645 | 288 |
| 397 | 3300049572 | Ga0501036_0002680 | Ga0501036_0002680_7853_8746 | 288 |
| 398 | 3300049572 | Ga0501036_0152569 | Ga0501036_0152569_25_909 | 288 |
| 399 | 3300049573 | Ga0501037_0040243 | Ga0501037_0040243_1325_2209 | 288 |
| 400 | 3300049573 | Ga0501037_0193581 | Ga0501037_0193581_305_1174 | 288 |
| 401 | 3300049575 | Ga0501039_0013920 | Ga0501039_0013920_1288_2157 | 288 |
| 402 | 3300049576 | Ga0501040_0001884 | Ga0501040_0001884_11720_12613 | 288 |
| 403 | 3300049576 | Ga0501040_0014838 | Ga0501040_0014838_407_1276 | 288 |
| 404 | 3300049577 | Ga0501041_0001143 | Ga0501041_0001143_6281_7174 | 288 |
| 405 | 3300049578 | Ga0501042_0001041 | Ga0501042_0001041_3256_4149 | 288 |
| 406 | 3300049579 | Ga0501043_0010711 | Ga0501043_0010711_5068_5961 | 288 |
| 407 | 3300049580 | Ga0501046_0010691 | Ga0501046_0010691_2536_3429 | 288 |
| 408 | 3300049581 | Ga0501047_0242317 | Ga0501047_0242317_129_1013 | 288 |
| 409 | 3300049584 | Ga0501068_0035225 | Ga0501068_0035225_2037_2930 | 288 |
| 410 | 3300049586 | Ga0501070_0054474 | Ga0501070_0054474_1976_2860 | 288 |
| 411 | 3300049586 | Ga0501070_0492335 | Ga0501070_0492335_43_918 | 288 |
| 412 | 3300049587 | Ga0501071_0008474 | Ga0501071_0008474_3207_4100 | 288 |
| 413 | 3300049587 | Ga0501071_0008876 | Ga0501071_0008876_772_1641 | 288 |
| 414 | 3300049588 | Ga0501072_0007748 | Ga0501072_0007748_455_1351 | 288 |
| 415 | 3300049590 | Ga0501074_0011618 | Ga0501074_0011618_5112_6005 | 288 |
| 416 | 3300049592 | Ga0501076_0002268 | Ga0501076_0002268_4669_5562 | 288 |
| 417 | 3300049592 | Ga0501076_0003800 | Ga0501076_0003800_6512_7381 | 288 |
| 418 | 3300049593 | Ga0501077_0011876 | Ga0501077_0011876_815_1708 | 288 |
| 419 | 3300049593 | Ga0501077_0034368 | Ga0501077_0034368_1110_1979 | 288 |
| 420 | 3300049741 | Ga0501079_0001954 | Ga0501079_0001954_594_1487 | 288 |
| 421 | 3300049741 | Ga0501079_0019110 | Ga0501079_0019110_2044_2913 | 288 |
| 422 | 3300049742 | Ga0501080_0092132 | Ga0501080_0092132_592_1461 | 288 |
| 423 | 3300049742 | Ga0501080_0115073 | Ga0501080_0115073_1410_2303 | 288 |
| 424 | 3300049743 | Ga0501081_0008411 | Ga0501081_0008411_3308_4201 | 288 |
| 425 | 3300049822 | Ga0501035_0036164 | Ga0501035_0036164_2430_3314 | 288 |
| 426 | 3300049822 | Ga0501035_0140139 | Ga0501035_0140139_47_940 | 288 |
| 427 | 3300049823 | Ga0501044_0033613 | Ga0501044_0033613_3088_3972 | 288 |
| 428 | 3300049823 | Ga0501044_0179294 | Ga0501044_0179294_822_1715 | 288 |
| 429 | 3300049824 | Ga0501045_0003370 | Ga0501045_0003370_9249_10142 | 288 |
| 430 | 3300049824 | Ga0501045_0039789 | Ga0501045_0039789_2399_3268 | 288 |
| 431 | 3300050507 | nmdc:mga05p37_35647_c1 | nmdc:mga05p37_35647_c1_2055_2957 | 288 |
| 432 | 3300050508 | nmdc:mga09592_280559_c1 | nmdc:mga09592_280559_c1_292_1194 | 288 |
| 433 | 3300053080 | Ga0500635_0005249 | Ga0500635_0005249_675_1544 | 288 |
| 434 | 3300053092 | Ga0500583_0001661 | Ga0500583_0001661_3330_4277 | 288 |
| 435 | 3300053093 | Ga0500651_0002023 | Ga0500651_0002023_721_1590 | 288 |
| 436 | 3300053096 | Ga0500641_0097230 | Ga0500641_0097230_60_1007 | 288 |
| 437 | 3300053146 | Ga0500588_0002951 | Ga0500588_0002951_2361_3308 | 288 |
| 438 | 3300054114 | Ga0501084_0007477 | Ga0501084_0007477_7285_8178 | 288 |
| 439 | 3300060353 | Ga0501082_0004820 | Ga0501082_0004820_2392_3285 | 288 |
| 440 | 3300061719 | Ga0466962_0196300 | Ga0466962_0196300_103_969 | 288 |
| 441 | iso_pu_bacteria | 2501939600 | 2501939994 | 288 |
| 442 | iso_pu_bacteria | 2643221567 | 2643849757 | 288 |
| 443 | iso_pu_bacteria | 2643221624 | 2644135759 | 288 |
| 444 | iso_pu_bacteria | 2772190715 | 2772647005 | 288 |
| 445 | iso_pu_bacteria | 2855670206 | 2855675280 | 288 |
| 446 | iso_pu_bacteria | 2855676851 | 2855680051 | 288 |
| 447 | iso_pu_bacteria | 2855683550 | 2855688687 | 288 |
| 448 | iso_pu_bacteria | 2856858025 | 2856864338 | 288 |
| 449 | iso_pu_bacteria | 2857288857 | 2857290136 | 288 |
| 450 | iso_pu_bacteria | 2857729791 | 2857732594 | 288 |
| 451 | iso_pu_bacteria | 2858848962 | 2858852802 | 288 |
| 452 | iso_pu_bacteria | 2858868258 | 2858873192 | 288 |
| 453 | iso_pu_bacteria | 2858882152 | 2858885797 | 288 |
| 454 | iso_pu_bacteria | 2858888857 | 2858892974 | 288 |
| 455 | iso_pu_bacteria | 2858895516 | 2858897911 | 288 |
| 456 | iso_pu_bacteria | 2867302475 | 2867303671 | 288 |
| 457 | iso_pu_bacteria | 2867312974 | 2867318765 | 288 |
| 458 | iso_pu_bacteria | 2867319477 | 2867320822 | 288 |
| 459 | iso_pu_bacteria | 2869061728 | 2869063801 | 288 |
| 460 | iso_pu_bacteria | 2869068681 | 2869074850 | 288 |
| 461 | iso_pu_bacteria | 2880489317 | 2880489840 | 288 |
| 462 | iso_pu_bacteria | 2880495981 | 2880502746 | 288 |
| 463 | iso_pu_bacteria | 2902582711 | 2902585894 | 288 |
| 464 | iso_pu_bacteria | 2928121344 | 2928122936 | 288 |
| 465 | iso_pu_bacteria | 2929219909 | 2929224546 | 288 |
| 466 | iso_pu_bacteria | 2929226422 | 2929232520 | 288 |
| 467 | iso_pu_bacteria | 2996221748 | 2996223131 | 288 |
| 468 | iso_pu_bacteria | 8003830390 | 8003837131 | 288 |
| 469 | iso_pu_bacteria | 8003870546 | 8003873475 | 288 |
| 470 | iso_pu_bacteria | 8054704163 | 8054709844 | 288 |
| 471 | iso_pu_bacteria | 8054727385 | 8054727718 | 288 |
| 472 | iso_pu_bacteria | 8054734606 | 8054737412 | 288 |
| 473 | iso_pu_bacteria | 8055412473 | 8055415863 | 288 |
| 474 | 3300005331 | Ga0070670_100490437 | Ga0070670_1004904371 | 289 |
| 475 | 3300005337 | Ga0070682_100191002 | Ga0070682_1001910022 | 289 |
| 476 | 3300005339 | Ga0070660_100063770 | Ga0070660_1000637702 | 289 |
| 477 | 3300005356 | Ga0070674_100232098 | Ga0070674_1002320981 | 289 |
| 478 | 3300005441 | Ga0070700_100141433 | Ga0070700_1001414332 | 289 |
| 479 | 3300005441 | Ga0070700_100379414 | Ga0070700_1003794142 | 289 |
| 480 | 3300005617 | Ga0068859_100333169 | Ga0068859_1003331691 | 289 |
| 481 | 3300005719 | Ga0068861_100252883 | Ga0068861_1002528832 | 289 |
| 482 | 3300005842 | Ga0068858_100027813 | Ga0068858_1000278135 | 289 |
| 483 | 3300005981 | Ga0081538_10000092 | Ga0081538_100000922 | 289 |
| 484 | 3300005981 | Ga0081538_10033744 | Ga0081538_100337443 | 289 |
| 485 | 3300005985 | Ga0081539_10000806 | Ga0081539_1000080634 | 289 |
| 486 | 3300005985 | Ga0081539_10001399 | Ga0081539_1000139921 | 289 |
| 487 | 3300005985 | Ga0081539_10002593 | Ga0081539_100025933 | 289 |
| 488 | 3300005985 | Ga0081539_10011892 | Ga0081539_100118923 | 289 |
| 489 | 3300006028 | Ga0070717_10264922 | Ga0070717_102649222 | 289 |
| 490 | 3300006038 | Ga0075365_10017026 | Ga0075365_100170264 | 289 |
| 491 | 3300006038 | Ga0075365_10069423 | Ga0075365_100694231 | 289 |
| 492 | 3300006048 | Ga0075363_100039613 | Ga0075363_1000396132 | 289 |
| 493 | 3300006051 | Ga0075364_10178823 | Ga0075364_101788232 | 289 |
| 494 | 3300006847 | Ga0075431_100001906 | Ga0075431_10000190613 | 289 |
| 495 | 3300006847 | Ga0075431_100258091 | Ga0075431_1002580912 | 289 |
| 496 | 3300006931 | Ga0097620_100333155 | Ga0097620_1003331551 | 289 |
| 497 | 3300009148 | Ga0105243_10058312 | Ga0105243_100583123 | 289 |
| 498 | 3300009177 | Ga0105248_10366772 | Ga0105248_103667722 | 289 |
| 499 | 3300009551 | Ga0105238_10533405 | Ga0105238_105334052 | 289 |
| 500 | 3300010375 | Ga0105239_10163297 | Ga0105239_101632973 | 289 |
| 501 | 3300011119 | Ga0105246_10242152 | Ga0105246_102421522 | 289 |
| 502 | 3300013297 | Ga0157378_10333730 | Ga0157378_103337301 | 289 |
| 503 | 3300014325 | Ga0163163_10054247 | Ga0163163_100542474 | 289 |
| 504 | 3300017792 | Ga0163161_10003339 | Ga0163161_1000333911 | 289 |
| 505 | 3300017792 | Ga0163161_10282474 | Ga0163161_102824742 | 289 |
| 506 | 3300025908 | Ga0207643_10292450 | Ga0207643_102924502 | 289 |
| 507 | 3300025918 | Ga0207662_10113405 | Ga0207662_101134051 | 289 |
| 508 | 3300025929 | Ga0207664_10005906 | Ga0207664_100059066 | 289 |
| 509 | 3300025937 | Ga0207669_10178191 | Ga0207669_101781912 | 289 |
| 510 | 3300025940 | Ga0207691_10035052 | Ga0207691_100350524 | 289 |
| 511 | 3300026067 | Ga0207678_10001596 | Ga0207678_100015968 | 289 |
| 512 | 3300026067 | Ga0207678_10215012 | Ga0207678_102150122 | 289 |
| 513 | 3300026075 | Ga0207708_10154504 | Ga0207708_101545042 | 289 |
| 514 | 3300026075 | Ga0207708_10198133 | Ga0207708_101981332 | 289 |
| 515 | 3300026088 | Ga0207641_10326522 | Ga0207641_103265222 | 289 |
| 516 | 3300026116 | Ga0207674_10111534 | Ga0207674_101115342 | 289 |
| 517 | 3300026116 | Ga0207674_10394474 | Ga0207674_103944742 | 289 |
| 518 | 3300026118 | Ga0207675_100145782 | Ga0207675_1001457822 | 289 |
| 519 | 3300026121 | Ga0207683_10093523 | Ga0207683_100935233 | 289 |
| 520 | 3300028380 | Ga0268265_10580436 | Ga0268265_105804361 | 289 |
| 521 | 3300028381 | Ga0268264_10056216 | Ga0268264_100562161 | 289 |
| 522 | 3300028786 | Ga0307517_10125964 | Ga0307517_101259642 | 289 |
| 523 | 3300028794 | Ga0307515_10001347 | Ga0307515_1000134743 | 289 |
| 524 | 3300028794 | Ga0307515_10051091 | Ga0307515_100510912 | 289 |
| 525 | 3300028794 | Ga0307515_10130247 | Ga0307515_101302472 | 289 |
| 526 | 3300030522 | Ga0307512_10010454 | Ga0307512_100104544 | 289 |
| 527 | 3300030522 | Ga0307512_10015468 | Ga0307512_100154685 | 289 |
| 528 | 3300030522 | Ga0307512_10123742 | Ga0307512_101237421 | 289 |
| 529 | 3300031456 | Ga0307513_10027824 | Ga0307513_100278242 | 289 |
| 530 | 3300031456 | Ga0307513_10070913 | Ga0307513_100709132 | 289 |
| 531 | 3300031456 | Ga0307513_10127828 | Ga0307513_101278282 | 289 |
| 532 | 3300031507 | Ga0307509_10060837 | Ga0307509_100608373 | 289 |
| 533 | 3300031507 | Ga0307509_10092815 | Ga0307509_100928152 | 289 |
| 534 | 3300031548 | Ga0307408_100270851 | Ga0307408_1002708512 | 289 |
| 535 | 3300031616 | Ga0307508_10000287 | Ga0307508_100002872 | 289 |
| 536 | 3300031616 | Ga0307508_10015594 | Ga0307508_100155944 | 289 |
| 537 | 3300031730 | Ga0307516_10000451 | Ga0307516_1000045124 | 289 |
| 538 | 3300031730 | Ga0307516_10021347 | Ga0307516_100213473 | 289 |
| 539 | 3300031730 | Ga0307516_10291117 | Ga0307516_102911171 | 289 |
| 540 | 3300031852 | Ga0307410_10121295 | Ga0307410_101212952 | 289 |
| 541 | 3300031901 | Ga0307406_10195422 | Ga0307406_101954222 | 289 |
| 542 | 3300031911 | Ga0307412_10008265 | Ga0307412_100082655 | 289 |
| 543 | 3300031995 | Ga0307409_100020093 | Ga0307409_1000200934 | 289 |
| 544 | 3300032002 | Ga0307416_100284934 | Ga0307416_1002849342 | 289 |
| 545 | 3300032126 | Ga0307415_100464955 | Ga0307415_1004649552 | 289 |
| 546 | 3300033179 | Ga0307507_10008648 | Ga0307507_1000864810 | 289 |
| 547 | 3300033179 | Ga0307507_10165888 | Ga0307507_101658882 | 289 |
| 548 | 3300033180 | Ga0307510_10042254 | Ga0307510_100422542 | 289 |
| 549 | 3300033180 | Ga0307510_10151754 | Ga0307510_101517542 | 289 |
| 550 | 3300035091 | Ga0373951_0000068 | Ga0373951_0000068_26774_27673 | 289 |
| 551 | 3300035207 | Ga0373942_0000158 | Ga0373942_0000158_14625_15521 | 289 |
| 552 | 3300035242 | Ga0373962_0001567 | Ga0373962_0001567_4213_5109 | 289 |
| 553 | 3300035692 | Ga0373935_0046325 | Ga0373935_0046325_1342_2253 | 289 |
| 554 | 3300037312 | Ga0395899_0030111 | Ga0395899_0030111_1152_2093 | 289 |
| 555 | 3300037312 | Ga0395899_0251441 | Ga0395899_0251441_183_1082 | 289 |
| 556 | 3300037418 | Ga0395900_0010227 | Ga0395900_0010227_3706_4647 | 289 |
| 557 | 3300037418 | Ga0395900_0063573 | Ga0395900_0063573_2500_3399 | 289 |
| 558 | 3300037466 | Ga0395898_0008793 | Ga0395898_0008793_9626_10567 | 289 |
| 559 | 3300037466 | Ga0395898_0060791 | Ga0395898_0060791_2244_3143 | 289 |
| 560 | 3300037471 | Ga0395905_0004654 | Ga0395905_0004654_3130_4071 | 289 |
| 561 | 3300037471 | Ga0395905_0105756 | Ga0395905_0105756_1270_2169 | 289 |
| 562 | 3300038443 | Ga0395901_0021116 | Ga0395901_0021116_2735_3676 | 289 |
| 563 | 3300038443 | Ga0395901_0222173 | Ga0395901_0222173_888_1787 | 289 |
| 564 | 3300038443 | Ga0395901_0305456 | Ga0395901_0305456_159_1049 | 289 |
| 565 | 3300038443 | Ga0395901_0704628 | Ga0395901_0704628_16_939 | 289 |
| 566 | 3300041997 | Ga0439431_0002566 | Ga0439431_0002566_665_1552 | 289 |
| 567 | 3300042156 | Ga0439446_0005379 | Ga0439446_0005379_1248_2135 | 289 |
| 568 | 3300044658 | Ga0466972_0021808 | Ga0466972_0021808_496_1425 | 289 |
| 569 | 3300044842 | Ga0466957_0061937 | Ga0466957_0061937_232_1149 | 289 |
| 570 | 3300045976 | Ga0466967_0033474 | Ga0466967_0033474_3309_4184 | 289 |
| 571 | 3300046473 | Ga0495582_0056950 | Ga0495582_0056950_24_908 | 289 |
| 572 | 3300046809 | Ga0495600_0215064 | Ga0495600_0215064_201_1094 | 289 |
| 573 | 3300048904 | Ga0496101_0111397 | Ga0496101_0111397_793_1713 | 289 |
| 574 | 3300048905 | Ga0496102_0036758 | Ga0496102_0036758_2896_3816 | 289 |
| 575 | 3300048905 | Ga0496102_0044729 | Ga0496102_0044729_2809_3738 | 289 |
| 576 | 3300048906 | Ga0496103_0029409 | Ga0496103_0029409_1902_2822 | 289 |
| 577 | 3300048907 | Ga0496104_0001885 | Ga0496104_0001885_4591_5529 | 289 |
| 578 | 3300048907 | Ga0496104_0149001 | Ga0496104_0149001_397_1290 | 289 |
| 579 | 3300048908 | Ga0496105_0000343 | Ga0496105_0000343_18966_19895 | 289 |
| 580 | 3300048908 | Ga0496105_0058386 | Ga0496105_0058386_339_1229 | 289 |
| 581 | 3300048909 | Ga0496106_0006613 | Ga0496106_0006613_6320_7249 | 289 |
| 582 | 3300048910 | Ga0496107_0016463 | Ga0496107_0016463_2950_3879 | 289 |
| 583 | 3300048910 | Ga0496107_0048650 | Ga0496107_0048650_530_1450 | 289 |
| 584 | 3300048911 | Ga0496108_0000050 | Ga0496108_0000050_65459_66391 | 289 |
| 585 | 3300048911 | Ga0496108_0195915 | Ga0496108_0195915_609_1538 | 289 |
| 586 | 3300048911 | Ga0496108_0203036 | Ga0496108_0203036_112_1008 | 289 |
| 587 | 3300048912 | Ga0496109_0042715 | Ga0496109_0042715_230_1159 | 289 |
| 588 | 3300048912 | Ga0496109_0215541 | Ga0496109_0215541_664_1584 | 289 |
| 589 | 3300048913 | Ga0496110_0103654 | Ga0496110_0103654_1195_2124 | 289 |
| 590 | 3300048913 | Ga0496110_0190836 | Ga0496110_0190836_648_1538 | 289 |
| 591 | 3300048914 | Ga0496111_0082832 | Ga0496111_0082832_288_1172 | 289 |
| 592 | 3300048916 | Ga0496113_0181392 | Ga0496113_0181392_113_1033 | 289 |
| 593 | 3300048917 | Ga0496114_0004652 | Ga0496114_0004652_8703_9611 | 289 |
| 594 | 3300048917 | Ga0496114_0007243 | Ga0496114_0007243_195_1115 | 289 |
| 595 | 3300048917 | Ga0496114_0089069 | Ga0496114_0089069_227_1156 | 289 |
| 596 | 3300048918 | Ga0496115_0008918 | Ga0496115_0008918_5646_6575 | 289 |
| 597 | 3300049568 | Ga0501031_0002002 | Ga0501031_0002002_7680_8555 | 289 |
| 598 | 3300049568 | Ga0501031_0025803 | Ga0501031_0025803_312_1202 | 289 |
| 599 | 3300049569 | Ga0501032_0057031 | Ga0501032_0057031_711_1601 | 289 |
| 600 | 3300049570 | Ga0501033_0004187 | Ga0501033_0004187_2623_3495 | 289 |
| 601 | 3300049570 | Ga0501033_0009470 | Ga0501033_0009470_4033_4923 | 289 |
| 602 | 3300049570 | Ga0501033_0029533 | Ga0501033_0029533_1180_2055 | 289 |
| 603 | 3300049570 | Ga0501033_0057770 | Ga0501033_0057770_876_1766 | 289 |
| 604 | 3300049571 | Ga0501034_0013725 | Ga0501034_0013725_528_1403 | 289 |
| 605 | 3300049571 | Ga0501034_0072444 | Ga0501034_0072444_389_1264 | 289 |
| 606 | 3300049571 | Ga0501034_0321420 | Ga0501034_0321420_113_1003 | 289 |
| 607 | 3300049571 | Ga0501034_0585344 | Ga0501034_0585344_20_910 | 289 |
| 608 | 3300049572 | Ga0501036_0005083 | Ga0501036_0005083_2666_3541 | 289 |
| 609 | 3300049572 | Ga0501036_0213567 | Ga0501036_0213567_582_1472 | 289 |
| 610 | 3300049573 | Ga0501037_0005053 | Ga0501037_0005053_6526_7401 | 289 |
| 611 | 3300049573 | Ga0501037_0009863 | Ga0501037_0009863_5664_6539 | 289 |
| 612 | 3300049573 | Ga0501037_0146854 | Ga0501037_0146854_20_910 | 289 |
| 613 | 3300049574 | Ga0501038_0000969 | Ga0501038_0000969_17905_18780 | 289 |
| 614 | 3300049574 | Ga0501038_0025321 | Ga0501038_0025321_2370_3245 | 289 |
| 615 | 3300049574 | Ga0501038_0057492 | Ga0501038_0057492_1752_2642 | 289 |
| 616 | 3300049575 | Ga0501039_0006085 | Ga0501039_0006085_2565_3440 | 289 |
| 617 | 3300049575 | Ga0501039_0135179 | Ga0501039_0135179_631_1506 | 289 |
| 618 | 3300049578 | Ga0501042_0011478 | Ga0501042_0011478_2667_3542 | 289 |
| 619 | 3300049578 | Ga0501042_0012636 | Ga0501042_0012636_2065_2940 | 289 |
| 620 | 3300049578 | Ga0501042_0025419 | Ga0501042_0025419_1571_2461 | 289 |
| 621 | 3300049579 | Ga0501043_0008297 | Ga0501043_0008297_1387_2262 | 289 |
| 622 | 3300049579 | Ga0501043_0014284 | Ga0501043_0014284_5211_6101 | 289 |
| 623 | 3300049579 | Ga0501043_0121881 | Ga0501043_0121881_459_1331 | 289 |
| 624 | 3300049580 | Ga0501046_0000229 | Ga0501046_0000229_50420_51295 | 289 |
| 625 | 3300049580 | Ga0501046_0003076 | Ga0501046_0003076_5582_6457 | 289 |
| 626 | 3300049580 | Ga0501046_0020136 | Ga0501046_0020136_4521_5411 | 289 |
| 627 | 3300049580 | Ga0501046_0070512 | Ga0501046_0070512_823_1698 | 289 |
| 628 | 3300049581 | Ga0501047_0079195 | Ga0501047_0079195_113_1003 | 289 |
| 629 | 3300049581 | Ga0501047_0383126 | Ga0501047_0383126_238_1128 | 289 |
| 630 | 3300049582 | Ga0501048_0004346 | Ga0501048_0004346_5794_6669 | 289 |
| 631 | 3300049585 | Ga0501069_0032630 | Ga0501069_0032630_259_1137 | 289 |
| 632 | 3300049585 | Ga0501069_0035205 | Ga0501069_0035205_112_1002 | 289 |
| 633 | 3300049586 | Ga0501070_0009468 | Ga0501070_0009468_4478_5353 | 289 |
| 634 | 3300049586 | Ga0501070_0023727 | Ga0501070_0023727_2507_3424 | 289 |
| 635 | 3300049589 | Ga0501073_0083714 | Ga0501073_0083714_1298_2188 | 289 |
| 636 | 3300049742 | Ga0501080_0004814 | Ga0501080_0004814_6115_6990 | 289 |
| 637 | 3300049742 | Ga0501080_0138458 | Ga0501080_0138458_33_923 | 289 |
| 638 | 3300049742 | Ga0501080_0617234 | Ga0501080_0617234_39_929 | 289 |
| 639 | 3300049822 | Ga0501035_0001333 | Ga0501035_0001333_22074_22949 | 289 |
| 640 | 3300049822 | Ga0501035_0007987 | Ga0501035_0007987_5582_6457 | 289 |
| 641 | 3300049822 | Ga0501035_0022701 | Ga0501035_0022701_722_1612 | 289 |
| 642 | 3300049822 | Ga0501035_0073578 | Ga0501035_0073578_1682_2572 | 289 |
| 643 | 3300049823 | Ga0501044_0005152 | Ga0501044_0005152_4966_5841 | 289 |
| 644 | 3300049823 | Ga0501044_0069630 | Ga0501044_0069630_502_1377 | 289 |
| 645 | 3300049823 | Ga0501044_0563186 | Ga0501044_0563186_33_923 | 289 |
| 646 | 3300049823 | Ga0501044_0563194 | Ga0501044_0563194_33_923 | 289 |
| 647 | 3300049824 | Ga0501045_0115319 | Ga0501045_0115319_107_982 | 289 |
| 648 | 3300049824 | Ga0501045_0128524 | Ga0501045_0128524_474_1364 | 289 |
| 649 | 3300050491 | nmdc:mga00v17_69246_c1 | nmdc:mga00v17_69246_c1_1017_1895 | 289 |
| 650 | 3300050492 | nmdc:mga0yw44_10266_c1 | nmdc:mga0yw44_10266_c1_2715_3596 | 289 |
| 651 | 3300050492 | nmdc:mga0yw44_138510_c2 | nmdc:mga0yw44_138510_c2_88_966 | 289 |
| 652 | 3300050510 | nmdc:mga06r32_272_c2 | nmdc:mga06r32_272_c2_161_1063 | 289 |
| 653 | 3300050510 | nmdc:mga06r32_656_c1 | nmdc:mga06r32_656_c1_19268_20155 | 289 |
| 654 | 3300053085 | Ga0495619_0007885 | Ga0495619_0007885_2917_3810 | 289 |
| 655 | 3300053088 | Ga0500644_0024438 | Ga0500644_0024438_417_1313 | 289 |
| 656 | 3300053117 | Ga0500593_000244 | Ga0500593_000244_15393_16268 | 289 |
| 657 | 3300053118 | Ga0500594_0017216 | Ga0500594_0017216_378_1304 | 289 |
| 658 | iso_pu_bacteria | 2585427649 | 2586062308 | 289 |
| 659 | iso_pu_bacteria | 2751185782 | 2753268178 | 289 |
| 660 | iso_pu_bacteria | 2795385472 | 2795797801 | 289 |
| 661 | iso_pu_bacteria | 2808606522 | 2809588521 | 289 |
| 662 | iso_pu_bacteria | 2857481737 | 2857482191 | 289 |
| 663 | 3300001979 | JGI24740J21852_10017937 | JGI24740J21852_100179372 | 290 |
| 664 | 3300002067 | JGI24735J21928_10017984 | JGI24735J21928_100179842 | 290 |
| 665 | 3300005327 | Ga0070658_10024882 | Ga0070658_100248822 | 290 |
| 666 | 3300005327 | Ga0070658_10056825 | Ga0070658_100568252 | 290 |
| 667 | 3300005329 | Ga0070683_100006892 | Ga0070683_1000068923 | 290 |
| 668 | 3300005336 | Ga0070680_100064662 | Ga0070680_1000646622 | 290 |
| 669 | 3300005338 | Ga0068868_100229451 | Ga0068868_1002294512 | 290 |
| 670 | 3300005339 | Ga0070660_100030880 | Ga0070660_1000308802 | 290 |
| 671 | 3300005354 | Ga0070675_100292324 | Ga0070675_1002923242 | 290 |
| 672 | 3300005366 | Ga0070659_100096753 | Ga0070659_1000967532 | 290 |
| 673 | 3300005466 | Ga0070685_10249073 | Ga0070685_102490731 | 290 |
| 674 | 3300005530 | Ga0070679_100078799 | Ga0070679_1000787993 | 290 |
| 675 | 3300005535 | Ga0070684_100010744 | Ga0070684_1000107444 | 290 |
| 676 | 3300005535 | Ga0070684_100037698 | Ga0070684_1000376982 | 290 |
| 677 | 3300005535 | Ga0070684_100674877 | Ga0070684_1006748771 | 290 |
| 678 | 3300005539 | Ga0068853_100329777 | Ga0068853_1003297771 | 290 |
| 679 | 3300005547 | Ga0070693_100218213 | Ga0070693_1002182132 | 290 |
| 680 | 3300005548 | Ga0070665_100022172 | Ga0070665_1000221725 | 290 |
| 681 | 3300005548 | Ga0070665_100050873 | Ga0070665_1000508732 | 290 |
| 682 | 3300005548 | Ga0070665_100422825 | Ga0070665_1004228252 | 290 |
| 683 | 3300005563 | Ga0068855_100164034 | Ga0068855_1001640342 | 290 |
| 684 | 3300005577 | Ga0068857_100021626 | Ga0068857_1000216264 | 290 |
| 685 | 3300005618 | Ga0068864_100109443 | Ga0068864_1001094432 | 290 |
| 686 | 3300005618 | Ga0068864_100167968 | Ga0068864_1001679682 | 290 |
| 687 | 3300005841 | Ga0068863_100018752 | Ga0068863_1000187524 | 290 |
| 688 | 3300005842 | Ga0068858_100035304 | Ga0068858_1000353042 | 290 |
| 689 | 3300005843 | Ga0068860_100118329 | Ga0068860_1001183292 | 290 |
| 690 | 3300005983 | Ga0081540_1084511 | Ga0081540_10845112 | 290 |
| 691 | 3300005985 | Ga0081539_10003848 | Ga0081539_100038489 | 290 |
| 692 | 3300005985 | Ga0081539_10181665 | Ga0081539_101816652 | 290 |
| 693 | 3300006881 | Ga0068865_100106221 | Ga0068865_1001062211 | 290 |
| 694 | 3300009098 | Ga0105245_10048474 | Ga0105245_100484743 | 290 |
| 695 | 3300009098 | Ga0105245_10362222 | Ga0105245_103622221 | 290 |
| 696 | 3300009148 | Ga0105243_10115243 | Ga0105243_101152432 | 290 |
| 697 | 3300009148 | Ga0105243_10138736 | Ga0105243_101387362 | 290 |
| 698 | 3300009177 | Ga0105248_10196506 | Ga0105248_101965062 | 290 |
| 699 | 3300009177 | Ga0105248_10207724 | Ga0105248_102077242 | 290 |
| 700 | 3300009551 | Ga0105238_10537860 | Ga0105238_105378602 | 290 |
| 701 | 3300009553 | Ga0105249_10301809 | Ga0105249_103018091 | 290 |
| 702 | 3300010375 | Ga0105239_10175097 | Ga0105239_101750972 | 290 |
| 703 | 3300011119 | Ga0105246_10031884 | Ga0105246_100318842 | 290 |
| 704 | 3300011119 | Ga0105246_10141631 | Ga0105246_101416312 | 290 |
| 705 | 3300013105 | Ga0157369_10007844 | Ga0157369_100078444 | 290 |
| 706 | 3300013306 | Ga0163162_10011203 | Ga0163162_100112032 | 290 |
| 707 | 3300013307 | Ga0157372_10103274 | Ga0157372_101032742 | 290 |
| 708 | 3300013308 | Ga0157375_10157924 | Ga0157375_101579241 | 290 |
| 709 | 3300014325 | Ga0163163_10067697 | Ga0163163_100676972 | 290 |
| 710 | 3300014968 | Ga0157379_10026551 | Ga0157379_100265512 | 290 |
| 711 | 3300014969 | Ga0157376_10298142 | Ga0157376_102981422 | 290 |
| 712 | 3300017792 | Ga0163161_10155469 | Ga0163161_101554692 | 290 |
| 713 | 3300020082 | Ga0206353_11305621 | Ga0206353_113056212 | 290 |
| 714 | 3300025904 | Ga0207647_10018631 | Ga0207647_100186314 | 290 |
| 715 | 3300025904 | Ga0207647_10022571 | Ga0207647_100225712 | 290 |
| 716 | 3300025909 | Ga0207705_10054767 | Ga0207705_100547672 | 290 |
| 717 | 3300025909 | Ga0207705_10187628 | Ga0207705_101876282 | 290 |
| 718 | 3300025919 | Ga0207657_10021256 | Ga0207657_100212565 | 290 |
| 719 | 3300025921 | Ga0207652_10036394 | Ga0207652_100363943 | 290 |
| 720 | 3300025924 | Ga0207694_10347566 | Ga0207694_103475661 | 290 |
| 721 | 3300025925 | Ga0207650_10426372 | Ga0207650_104263722 | 290 |
| 722 | 3300025926 | Ga0207659_10088490 | Ga0207659_100884902 | 290 |
| 723 | 3300025927 | Ga0207687_10085552 | Ga0207687_100855522 | 290 |
| 724 | 3300025927 | Ga0207687_10213786 | Ga0207687_102137862 | 290 |
| 725 | 3300025932 | Ga0207690_10068894 | Ga0207690_100688942 | 290 |
| 726 | 3300025935 | Ga0207709_10037921 | Ga0207709_100379212 | 290 |
| 727 | 3300025937 | Ga0207669_10025009 | Ga0207669_100250092 | 290 |
| 728 | 3300025938 | Ga0207704_10093574 | Ga0207704_100935742 | 290 |
| 729 | 3300025938 | Ga0207704_10105211 | Ga0207704_101052112 | 290 |
| 730 | 3300025941 | Ga0207711_10065562 | Ga0207711_100655623 | 290 |
| 731 | 3300025944 | Ga0207661_10046750 | Ga0207661_100467504 | 290 |
| 732 | 3300025944 | Ga0207661_10078612 | Ga0207661_100786122 | 290 |
| 733 | 3300026023 | Ga0207677_10309437 | Ga0207677_103094372 | 290 |
| 734 | 3300026035 | Ga0207703_10129444 | Ga0207703_101294442 | 290 |
| 735 | 3300026088 | Ga0207641_10078624 | Ga0207641_100786242 | 290 |
| 736 | 3300026116 | Ga0207674_10037413 | Ga0207674_100374132 | 290 |
| 737 | 3300026121 | Ga0207683_10107174 | Ga0207683_101071742 | 290 |
| 738 | 3300028379 | Ga0268266_10000855 | Ga0268266_1000085539 | 290 |
| 739 | 3300028379 | Ga0268266_10058929 | Ga0268266_100589294 | 290 |
| 740 | 3300028381 | Ga0268264_10041902 | Ga0268264_100419024 | 290 |
| 741 | 3300031456 | Ga0307513_10008310 | Ga0307513_1000831011 | 290 |
| 742 | 3300031911 | Ga0307412_10134944 | Ga0307412_101349442 | 290 |
| 743 | 3300035119 | Ga0373956_0023580 | Ga0373956_0023580_731_1666 | 290 |
| 744 | 3300039437 | Ga0436365_1732542 | Ga0436365_1732542_89_985 | 290 |
| 745 | 3300041512 | Ga0451853_2671789 | Ga0451853_2671789_670_1548 | 290 |
| 746 | 3300044683 | Ga0466965_0032408 | Ga0466965_0032408_760_1686 | 290 |
| 747 | 3300044683 | Ga0466965_0042902 | Ga0466965_0042902_589_1461 | 290 |
| 748 | 3300044683 | Ga0466965_0216510 | Ga0466965_0216510_62_943 | 290 |
| 749 | 3300044693 | Ga0466961_0093883 | Ga0466961_0093883_395_1300 | 290 |
| 750 | 3300044693 | Ga0466961_0134135 | Ga0466961_0134135_287_1255 | 290 |
| 751 | 3300044694 | Ga0466963_0017473 | Ga0466963_0017473_2860_3765 | 290 |
| 752 | 3300044706 | Ga0466964_0002256 | Ga0466964_0002256_2756_3661 | 290 |
| 753 | 3300044706 | Ga0466964_0010569 | Ga0466964_0010569_507_1397 | 290 |
| 754 | 3300044765 | Ga0466970_0133158 | Ga0466970_0133158_379_1284 | 290 |
| 755 | 3300044842 | Ga0466957_0002957 | Ga0466957_0002957_6580_7485 | 290 |
| 756 | 3300044842 | Ga0466957_0023779 | Ga0466957_0023779_1092_1997 | 290 |
| 757 | 3300044901 | Ga0466960_0001507 | Ga0466960_0001507_1252_2124 | 290 |
| 758 | 3300044901 | Ga0466960_0029863 | Ga0466960_0029863_502_1392 | 290 |
| 759 | 3300045049 | Ga0466959_0329522 | Ga0466959_0329522_102_974 | 290 |
| 760 | 3300045836 | Ga0466958_0040477 | Ga0466958_0040477_629_1534 | 290 |
| 761 | 3300045976 | Ga0466967_0029620 | Ga0466967_0029620_2201_3091 | 290 |
| 762 | 3300045976 | Ga0466967_0047601 | Ga0466967_0047601_2352_3251 | 290 |
| 763 | 3300045976 | Ga0466967_0090807 | Ga0466967_0090807_1069_1959 | 290 |
| 764 | 3300045976 | Ga0466967_0183324 | Ga0466967_0183324_186_1076 | 290 |
| 765 | 3300045976 | Ga0466967_0258701 | Ga0466967_0258701_728_1630 | 290 |
| 766 | 3300046459 | Ga0495629_0080822 | Ga0495629_0080822_936_1922 | 290 |
| 767 | 3300046499 | Ga0495594_0070253 | Ga0495594_0070253_179_1165 | 290 |
| 768 | 3300046511 | Ga0495608_0152244 | Ga0495608_0152244_25_903 | 290 |
| 769 | 3300046675 | Ga0495657_0237411 | Ga0495657_0237411_94_972 | 290 |
| 770 | 3300047322 | Ga0495680_0223293 | Ga0495680_0223293_260_1138 | 290 |
| 771 | 3300048904 | Ga0496101_0236084 | Ga0496101_0236084_305_1195 | 290 |
| 772 | 3300048905 | Ga0496102_0004203 | Ga0496102_0004203_2702_3592 | 290 |
| 773 | 3300048909 | Ga0496106_0106131 | Ga0496106_0106131_868_1758 | 290 |
| 774 | 3300048911 | Ga0496108_0076827 | Ga0496108_0076827_1462_2352 | 290 |
| 775 | 3300048912 | Ga0496109_0043845 | Ga0496109_0043845_1662_2552 | 290 |
| 776 | 3300048913 | Ga0496110_0061854 | Ga0496110_0061854_836_1726 | 290 |
| 777 | 3300048914 | Ga0496111_0013524 | Ga0496111_0013524_3529_4419 | 290 |
| 778 | 3300048915 | Ga0496112_0008708 | Ga0496112_0008708_4878_5873 | 290 |
| 779 | 3300048915 | Ga0496112_0041992 | Ga0496112_0041992_1863_2858 | 290 |
| 780 | 3300048916 | Ga0496113_0119762 | Ga0496113_0119762_494_1489 | 290 |
| 781 | 3300048921 | Ga0496118_0066617 | Ga0496118_0066617_885_1808 | 290 |
| 782 | 3300049570 | Ga0501033_0029142 | Ga0501033_0029142_1598_2509 | 290 |
| 783 | 3300049571 | Ga0501034_0112309 | Ga0501034_0112309_674_1564 | 290 |
| 784 | 3300049571 | Ga0501034_0199541 | Ga0501034_0199541_291_1181 | 290 |
| 785 | 3300049573 | Ga0501037_0071644 | Ga0501037_0071644_325_1215 | 290 |
| 786 | 3300049574 | Ga0501038_0246306 | Ga0501038_0246306_405_1295 | 290 |
| 787 | 3300049579 | Ga0501043_0247882 | Ga0501043_0247882_65_976 | 290 |
| 788 | 3300049583 | Ga0501067_0016564 | Ga0501067_0016564_2510_3400 | 290 |
| 789 | 3300049583 | Ga0501067_0056349 | Ga0501067_0056349_221_1111 | 290 |
| 790 | 3300049584 | Ga0501068_0035411 | Ga0501068_0035411_1139_2029 | 290 |
| 791 | 3300049585 | Ga0501069_0020764 | Ga0501069_0020764_873_1760 | 290 |
| 792 | 3300049585 | Ga0501069_0092878 | Ga0501069_0092878_215_1105 | 290 |
| 793 | 3300049586 | Ga0501070_0016059 | Ga0501070_0016059_1646_2536 | 290 |
| 794 | 3300049586 | Ga0501070_0034966 | Ga0501070_0034966_3217_4107 | 290 |
| 795 | 3300049586 | Ga0501070_0136034 | Ga0501070_0136034_376_1263 | 290 |
| 796 | 3300049586 | Ga0501070_0196598 | Ga0501070_0196598_720_1610 | 290 |
| 797 | 3300049587 | Ga0501071_0010871 | Ga0501071_0010871_4117_5007 | 290 |
| 798 | 3300049587 | Ga0501071_0073812 | Ga0501071_0073812_1166_2056 | 290 |
| 799 | 3300049588 | Ga0501072_0020621 | Ga0501072_0020621_3700_4590 | 290 |
| 800 | 3300049589 | Ga0501073_0051417 | Ga0501073_0051417_1225_2115 | 290 |
| 801 | 3300049590 | Ga0501074_0003143 | Ga0501074_0003143_7260_8150 | 290 |
| 802 | 3300049590 | Ga0501074_0061709 | Ga0501074_0061709_658_1548 | 290 |
| 803 | 3300049593 | Ga0501077_0033366 | Ga0501077_0033366_782_1672 | 290 |
| 804 | 3300049741 | Ga0501079_0215057 | Ga0501079_0215057_368_1258 | 290 |
| 805 | 3300049742 | Ga0501080_0001505 | Ga0501080_0001505_17955_18845 | 290 |
| 806 | 3300049742 | Ga0501080_0012257 | Ga0501080_0012257_664_1554 | 290 |
| 807 | 3300049744 | Ga0501083_0013481 | Ga0501083_0013481_3015_3905 | 290 |
| 808 | 3300049744 | Ga0501083_0170311 | Ga0501083_0170311_111_1001 | 290 |
| 809 | 3300049822 | Ga0501035_0198904 | Ga0501035_0198904_766_1677 | 290 |
| 810 | 3300050510 | nmdc:mga06r32_59191_c1 | nmdc:mga06r32_59191_c1_2183_3187 | 290 |
| 811 | 3300053104 | Ga0500556_0000917 | Ga0500556_0000917_9261_10139 | 290 |
| 812 | 3300054114 | Ga0501084_0024597 | Ga0501084_0024597_3065_3955 | 290 |
| 813 | 3300054114 | Ga0501084_0116290 | Ga0501084_0116290_1125_2015 | 290 |
| 814 | 3300060353 | Ga0501082_0006014 | Ga0501082_0006014_5976_6866 | 290 |
| 815 | 3300060353 | Ga0501082_0562645 | Ga0501082_0562645_82_972 | 290 |
| 816 | 3300061719 | Ga0466962_0013209 | Ga0466962_0013209_158_1063 | 290 |
| 817 | iso_pu_bacteria | 2867507094 | 2867511902 | 290 |
| 818 | 3300000549 | LJQas_1001950 | LJQas_10019501 | 291 |
| 819 | 3300005340 | Ga0070689_100341453 | Ga0070689_1003414532 | 291 |
| 820 | 3300005841 | Ga0068863_100210148 | Ga0068863_1002101482 | 291 |
| 821 | 3300005937 | Ga0081455_10180686 | Ga0081455_101806862 | 291 |
| 822 | 3300006844 | Ga0075428_100126151 | Ga0075428_1001261513 | 291 |
| 823 | 3300009094 | Ga0111539_10257316 | Ga0111539_102573162 | 291 |
| 824 | 3300009094 | Ga0111539_10455252 | Ga0111539_104552522 | 291 |
| 825 | 3300009147 | Ga0114129_10610277 | Ga0114129_106102771 | 291 |
| 826 | 3300014325 | Ga0163163_10132902 | Ga0163163_101329022 | 291 |
| 827 | 3300025945 | Ga0207679_10067407 | Ga0207679_100674072 | 291 |
| 828 | 3300025986 | Ga0207658_10190809 | Ga0207658_101908092 | 291 |
| 829 | 3300026088 | Ga0207641_10181576 | Ga0207641_101815762 | 291 |
| 830 | 3300031903 | Ga0307407_10087898 | Ga0307407_100878982 | 291 |
| 831 | 3300031995 | Ga0307409_100490206 | Ga0307409_1004902062 | 291 |
| 832 | 3300032005 | Ga0307411_10152889 | Ga0307411_101528892 | 291 |
| 833 | 3300032126 | Ga0307415_100009454 | Ga0307415_1000094543 | 291 |
| 834 | 3300032126 | Ga0307415_100174311 | Ga0307415_1001743111 | 291 |
| 835 | 3300036401 | Ga0373937_0051248 | Ga0373937_0051248_1090_2022 | 291 |
| 836 | 3300037471 | Ga0395905_0118803 | Ga0395905_0118803_109_993 | 291 |
| 837 | 3300047317 | Ga0495604_0185260 | Ga0495604_0185260_372_1304 | 291 |
| 838 | 3300047319 | Ga0495674_0219312 | Ga0495674_0219312_546_1478 | 291 |
| 839 | 3300047673 | Ga0495593_0020298 | Ga0495593_0020298_1850_2782 | 291 |
| 840 | 3300048909 | Ga0496106_0119560 | Ga0496106_0119560_1097_1972 | 291 |
| 841 | 3300048912 | Ga0496109_0104815 | Ga0496109_0104815_42_938 | 291 |
| 842 | 3300048927 | Ga0496124_0191072 | Ga0496124_0191072_605_1486 | 291 |
| 843 | 3300049570 | Ga0501033_0188494 | Ga0501033_0188494_230_1168 | 291 |
| 844 | 3300049571 | Ga0501034_0083860 | Ga0501034_0083860_647_1585 | 291 |
| 845 | 3300049573 | Ga0501037_0030778 | Ga0501037_0030778_2313_3251 | 291 |
| 846 | 3300049574 | Ga0501038_0056038 | Ga0501038_0056038_1568_2506 | 291 |
| 847 | 3300049575 | Ga0501039_0103977 | Ga0501039_0103977_817_1755 | 291 |
| 848 | 3300049577 | Ga0501041_0147017 | Ga0501041_0147017_73_951 | 291 |
| 849 | 3300049581 | Ga0501047_0297028 | Ga0501047_0297028_161_1099 | 291 |
| 850 | 3300049587 | Ga0501071_0203157 | Ga0501071_0203157_354_1238 | 291 |
| 851 | 3300049588 | Ga0501072_0328501 | Ga0501072_0328501_78_962 | 291 |
| 852 | 3300049590 | Ga0501074_0010978 | Ga0501074_0010978_5480_6418 | 291 |
| 853 | 3300049824 | Ga0501045_0141249 | Ga0501045_0141249_278_1156 | 291 |
| 854 | 3300050492 | nmdc:mga0yw44_22881_c1 | nmdc:mga0yw44_22881_c1_2313_3194 | 291 |
| 855 | 3300050511 | nmdc:mga08y16_229425_c1 | nmdc:mga08y16_229425_c1_579_1457 | 291 |
| 856 | 3300053085 | Ga0495619_0035584 | Ga0495619_0035584_1725_2657 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o5s-assembly1.cif.gz_A-2 | x-ray crystal structure of the rapz c-terminal domain from escherichia coli | 0.9537 | 169 | 288 |
| 5o5s-assembly1.cif.gz_A-2 | x-ray crystal structure of the rapz c-terminal domain from escherichia coli | 0.9241 | 169 | 288 |
| 7e9v-assembly1.cif.gz_A | the crystal structure of human ump-cmp kinase from biortus. | 0.714 | 9 | 161 |
| 2dft-assembly1.cif.gz_B | structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and mg at 2.8 angstrons of resolution | 0.7109 | 9 | 161 |
| 1u8a-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution | 0.7104 | 9 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G039_182_303_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9673 | 176 | 288 | 3.40.50.720 |
| af_P0A894_1_282_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8928 | 10 | 291 | 3.40.50.300 |
| af_Q2G039_182_303_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8906 | 176 | 288 | 3.40.50.720 |
| af_P0A894_1_282_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8869 | 10 | 291 | 3.40.50.300 |
| af_Q10242_7_192_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6939 | 8 | 160 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A644XCL4-F1-model_v4 | Nucleotide-binding protein | 0.9848 | 171 | 288 |
GO:0005524
|
| AF-A0A355FQ69-F1-model_v4 | RNase adaptor protein RapZ | 0.9778 | 168 | 287 |
GO:0005524
|
| AF-X0TVE7-F1-model_v4 | RapZ C-terminal domain-containing protein | 0.9738 | 168 | 291 |
GO:0005524
|
| AF-A0A662DSW2-F1-model_v4 | RNase adaptor protein RapZ | 0.9717 | 168 | 290 |
GO:0005524
|
| AF-A0A317IT69-F1-model_v4 | RNase adaptor protein RapZ | 0.9706 | 167 | 285 |
GO:0005524
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar