F483611

General Info

Members Datasets Scaffolds Average Seq Length
855 412 809 88

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_101393875|Ga0070714_1013938752
Length 101
Sequence MLDLNTQAKGTTMVGDEESIAAVLNRLRRAQGQLAGVISMIEQGRDCKDVVTQLAAVSRALDRAGFKIVATGLRECLAGNAEDGRAPMTEAELEKLFLSLA

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221604 Nocardioides sp. Root190 Isolate Unclassified
5 2643221692 Nocardia sp. Root136 Isolate Unclassified
6 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
13 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
14 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
15 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
16 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
17 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
18 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
19 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
20 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
21 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
22 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
23 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
24 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
25 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
26 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
27 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
28 2922554459 Rhodococcus sp. 66b Isolate Unclassified
29 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
30 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
31 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
32 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
33 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
34 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
35 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
203 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
211 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
292 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
347 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
348 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
352 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
366 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
374 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
377 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
378 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
379 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
380 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
381 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
382 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
383 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
384 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
385 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
388 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
389 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
390 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
391 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
392 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
393 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
394 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
395 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
396 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
397 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
398 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
399 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
400 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
401 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
404 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0.35
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 16.73
Nodule 0.12
Rhizoplane 7.37
Rhizosphere 65.15
Stem 0
Stem Tuber 0
Unclassified 10.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10262872 3300002067 Bacteria 504
2 rootH2_10014701 3300003320 Bacteria 1893
3 Ga0055540_1000151 3300003792 Bacteria 68564
4 Ga0055540_1002619 3300003792 Bacteria 9341
5 Ga0070658_11209786 3300005327 Bacteria 657
6 Ga0070683_100410732 3300005329 Bacteria 1291
7 Ga0070683_100785096 3300005329 Bacteria 913
8 Ga0070666_10190121 3300005335 Bacteria 1442
9 Ga0070680_101475501 3300005336 Bacteria 589
10 Ga0070682_100028453 3300005337 Bacteria 3361
11 Ga0068868_100572660 3300005338 Bacteria 998
12 Ga0070661_100338371 3300005344 Bacteria 1178
13 Ga0070692_10435347 3300005345 Bacteria 836
14 Ga0070668_100000135 3300005347 Bacteria 46315
15 Ga0070668_100246617 3300005347 Bacteria 1481
16 Ga0070668_101066142 3300005347 Bacteria 728
17 Ga0070668_101545761 3300005347 Bacteria 607
18 Ga0070668_101641947 3300005347 Bacteria 589
19 Ga0070674_100402110 3300005356 Bacteria 1119
20 Ga0070659_100469314 3300005366 Bacteria 1070
21 Ga0070667_100000042 3300005367 Bacteria 168902
22 Ga0070667_100000274 3300005367 Bacteria 58415
23 Ga0070709_10012787 3300005434 Bacteria 4704
24 Ga0070714_100001652 3300005435 Bacteria 16228
25 Ga0070714_100045388 3300005435 Bacteria 3724
26 Ga0070714_101393875 3300005435 Bacteria 684
27 Ga0070714_101619788 3300005435 Bacteria 632
28 Ga0070713_100301110 3300005436 Bacteria 1476
29 Ga0070713_100595319 3300005436 Bacteria 1050
30 Ga0070710_10016786 3300005437 Bacteria 3733
31 Ga0070711_101204552 3300005439 Bacteria 655
32 Ga0070705_101435470 3300005440 Bacteria 576
33 Ga0070700_100107259 3300005441 Bacteria 1851
34 Ga0070708_100584824 3300005445 Bacteria 1053
35 Ga0070663_100102737 3300005455 Bacteria 2136
36 Ga0070663_101587118 3300005455 Bacteria 583
37 Ga0070662_101879226 3300005457 Bacteria 517
38 Ga0070685_11553285 3300005466 Bacteria 511
39 Ga0070706_101941089 3300005467 Bacteria 534
40 Ga0070679_100205942 3300005530 Bacteria 1932
41 Ga0070684_100065536 3300005535 Bacteria 3188
42 Ga0070686_101938923 3300005544 Bacteria 503
43 Ga0070696_101361153 3300005546 Bacteria 604
44 Ga0070693_101080182 3300005547 Bacteria 611
45 Ga0070665_100004204 3300005548 Bacteria 15154
46 Ga0070665_100311437 3300005548 Bacteria 1578
47 Ga0070665_100821694 3300005548 Bacteria 942
48 Ga0070665_101369684 3300005548 Bacteria 717
49 Ga0070665_101429280 3300005548 Bacteria 701
50 Ga0070704_102237836 3300005549 Bacteria 508
51 Ga0068854_102050603 3300005578 Bacteria 528
52 Ga0070702_100945331 3300005615 Bacteria 678
53 Ga0068859_100000471 3300005617 Bacteria 39733
54 Ga0068859_100889849 3300005617 Bacteria 975
55 Ga0068859_102292451 3300005617 Bacteria 595
56 Ga0068864_100588681 3300005618 Bacteria 1079
57 Ga0068864_100698018 3300005618 Bacteria 991
58 Ga0068861_101103979 3300005719 Bacteria 762
59 Ga0068870_10521725 3300005840 Bacteria 795
60 Ga0068863_100000461 3300005841 Bacteria 41485
61 Ga0068858_100500442 3300005842 Bacteria 1174
62 Ga0068858_100560696 3300005842 Bacteria 1106
63 Ga0068858_101078361 3300005842 Bacteria 788
64 Ga0068858_101503276 3300005842 Bacteria 664
65 Ga0068860_100000020 3300005843 Bacteria 283324
66 Ga0068860_100779242 3300005843 Bacteria 969
67 Ga0068862_100000013 3300005844 Bacteria 263115
68 Ga0068862_101297974 3300005844 Bacteria 729
69 Ga0081455_10024225 3300005937 Bacteria 5627
70 Ga0075365_10074626 3300006038 Bacteria 2287
71 Ga0075365_10391308 3300006038 Bacteria 981
72 Ga0075368_10503722 3300006042 Bacteria 541
73 Ga0075363_100005406 3300006048 Bacteria 5677
74 Ga0075363_100005932 3300006048 Bacteria 5505
75 Ga0075363_100019867 3300006048 Bacteria 3363
76 Ga0075363_100200463 3300006048 Bacteria 1140
77 Ga0075363_100297706 3300006048 Bacteria 936
78 Ga0075363_100597962 3300006048 Bacteria 661
79 Ga0075363_100621748 3300006048 Bacteria 648
80 Ga0075363_100673127 3300006048 Bacteria 624
81 Ga0075364_10003432 3300006051 Bacteria 9008
82 Ga0075364_10014156 3300006051 Bacteria 4923
83 Ga0075364_10034551 3300006051 Bacteria 3262
84 Ga0075364_10086192 3300006051 Bacteria 2080
85 Ga0070716_100881368 3300006173 Bacteria 699
86 Ga0070716_100963608 3300006173 Bacteria 672
87 Ga0070712_100005080 3300006175 Bacteria 8149
88 Ga0075362_10019106 3300006177 Bacteria 2846
89 Ga0075362_10157816 3300006177 Bacteria 1091
90 Ga0075362_10306135 3300006177 Bacteria 789
91 Ga0075362_10337011 3300006177 Bacteria 753
92 Ga0075362_10584410 3300006177 Bacteria 576
93 Ga0075362_10617066 3300006177 Bacteria 561
94 Ga0075367_10103437 3300006178 Bacteria 1743
95 Ga0075367_10438805 3300006178 Bacteria 827
96 Ga0075367_10888451 3300006178 Bacteria 568
97 Ga0075367_10952805 3300006178 Bacteria 548
98 Ga0075369_10000373 3300006186 Bacteria 13427
99 Ga0075369_10022073 3300006186 Bacteria 2623
100 Ga0075369_10028716 3300006186 Bacteria 2333
101 Ga0075369_10035046 3300006186 Bacteria 2132
102 Ga0075369_10045729 3300006186 Bacteria 1883
103 Ga0075369_10046326 3300006186 Bacteria 1872
104 Ga0075369_10168304 3300006186 Bacteria 1006
105 Ga0075370_10003259 3300006353 Bacteria 7692
106 Ga0075370_10022515 3300006353 Bacteria 3461
107 Ga0075370_10080322 3300006353 Bacteria 1874
108 Ga0075370_10233640 3300006353 Bacteria 1088
109 Ga0075370_10405396 3300006353 Bacteria 818
110 Ga0075370_10731034 3300006353 Bacteria 602
111 Ga0075370_10823286 3300006353 Bacteria 566
112 Ga0068871_101646764 3300006358 Bacteria 608
113 Ga0075430_100200493 3300006846 Bacteria 1657
114 Ga0068865_100993388 3300006881 Bacteria 734
115 Ga0097620_100000471 3300006931 Bacteria 39733
116 Ga0097620_100889643 3300006931 Bacteria 975
117 Ga0097620_102293156 3300006931 Bacteria 595
118 Ga0105244_10150940 3300009036 Bacteria 1113
119 Ga0105250_10023932 3300009092 Bacteria 2462
120 Ga0105250_10562437 3300009092 Bacteria 524
121 Ga0111539_11999102 3300009094 Bacteria 672
122 Ga0105245_10085834 3300009098 Bacteria 2886
123 Ga0105245_10712316 3300009098 Bacteria 1037
124 Ga0105245_13252537 3300009098 Bacteria 503
125 Ga0105247_10000009 3300009101 Bacteria 385991
126 Ga0105247_10118015 3300009101 Bacteria 1716
127 Ga0105243_10000598 3300009148 Bacteria 36100
128 Ga0105243_10561769 3300009148 Bacteria 1092
129 Ga0105243_11656363 3300009148 Bacteria 668
130 Ga0105241_10275985 3300009174 Bacteria 1434
131 Ga0105248_10000197 3300009177 Bacteria 70131
132 Ga0105237_10061716 3300009545 Bacteria 3747
133 Ga0105237_12451415 3300009545 Bacteria 532
134 Ga0105238_11577667 3300009551 Bacteria 686
135 Ga0105249_10000057 3300009553 Bacteria 159358
136 Ga0105249_10000893 3300009553 Bacteria 26438
137 Ga0105249_11914622 3300009553 Bacteria 666
138 Ga0099796_10006106 3300010159 Bacteria 3063
139 Ga0105239_10026275 3300010375 Bacteria 6409
140 Ga0105239_10087947 3300010375 Bacteria 3425
141 Ga0105239_10118860 3300010375 Bacteria 2933
142 Ga0105239_10394938 3300010375 Bacteria 1565
143 Ga0105239_11951386 3300010375 Bacteria 681
144 Ga0105246_11109711 3300011119 Bacteria 723
145 Ga0105246_11170302 3300011119 Bacteria 706
146 Ga0157329_1026181 3300012491 Bacteria 580
147 Ga0157369_11159480 3300013105 Bacteria 789
148 Ga0157374_11586542 3300013296 Bacteria 678
149 Ga0163162_10671561 3300013306 Bacteria 1159
150 Ga0157372_10495502 3300013307 Bacteria 1425
151 Ga0157372_11540065 3300013307 Bacteria 766
152 Ga0157375_10225070 3300013308 Bacteria 2035
153 Ga0157375_11736707 3300013308 Bacteria 739
154 Ga0157375_12069732 3300013308 Bacteria 677
155 Ga0163163_10010646 3300014325 Bacteria 8288
156 Ga0157380_11136872 3300014326 Bacteria 822
157 Ga0157380_11284015 3300014326 Bacteria 779
158 Ga0157377_10283700 3300014745 Bacteria 1086
159 Ga0157379_10716254 3300014968 Bacteria 940
160 Ga0157379_11527198 3300014968 Bacteria 650
161 Ga0157379_11833539 3300014968 Bacteria 596
162 Ga0157376_11908841 3300014969 Bacteria 631
163 Ga0157376_12071362 3300014969 Bacteria 607
164 Ga0163161_11716767 3300017792 Bacteria 556
165 Ga0206352_10194983 3300020078 Bacteria 800
166 Ga0154015_1673388 3300020610 Bacteria 511
167 Ga0224712_10096383 3300022467 Bacteria 1247
168 Ga0209051_1000075 3300025303 Bacteria 205011
169 Ga0209051_1003563 3300025303 Bacteria 10122
170 Ga0207696_1101006 3300025711 Bacteria 785
171 Ga0207692_10450457 3300025898 Bacteria 810
172 Ga0207710_10000014 3300025900 Bacteria 408072
173 Ga0207710_10320176 3300025900 Bacteria 786
174 Ga0207688_10163062 3300025901 Bacteria 1322
175 Ga0207688_10447529 3300025901 Bacteria 805
176 Ga0207680_10091100 3300025903 Bacteria 1940
177 Ga0207647_10295835 3300025904 Bacteria 922
178 Ga0207647_10404704 3300025904 Bacteria 769
179 Ga0207699_10008608 3300025906 Bacteria 5044
180 Ga0207699_10633728 3300025906 Bacteria 780
181 Ga0207643_10200708 3300025908 Bacteria 1214
182 Ga0207705_10778383 3300025909 Bacteria 743
183 Ga0207654_10539073 3300025911 Bacteria 828
184 Ga0207671_10040113 3300025914 Bacteria 3466
185 Ga0207660_10339002 3300025917 Bacteria 1203
186 Ga0207649_10627625 3300025920 Bacteria 829
187 Ga0207681_10005666 3300025923 Bacteria 7667
188 Ga0207700_10327227 3300025928 Bacteria 1329
189 Ga0207664_10006955 3300025929 Bacteria 7826
190 Ga0207664_10025334 3300025929 Bacteria 4467
191 Ga0207664_10075031 3300025929 Bacteria 2733
192 Ga0207690_11199894 3300025932 Bacteria 633
193 Ga0207706_11295728 3300025933 Bacteria 602
194 Ga0207709_10002071 3300025935 Bacteria 12954
195 Ga0207709_11014946 3300025935 Bacteria 679
196 Ga0207669_10412504 3300025937 Bacteria 1061
197 Ga0207704_10381250 3300025938 Bacteria 1107
198 Ga0207665_10706556 3300025939 Bacteria 793
199 Ga0207711_10000146 3300025941 Bacteria 74464
200 Ga0207712_10000050 3300025961 Bacteria 159469
201 Ga0207712_10394382 3300025961 Bacteria 1162
202 Ga0207712_11139535 3300025961 Bacteria 695
203 Ga0207668_10000867 3300025972 Bacteria 18255
204 Ga0207668_10581840 3300025972 Bacteria 973
205 Ga0207668_11008683 3300025972 Bacteria 744
206 Ga0207658_10000423 3300025986 Bacteria 40097
207 Ga0207658_10000540 3300025986 Bacteria 34297
208 Ga0207677_10319257 3300026023 Bacteria 1290
209 Ga0207703_10125009 3300026035 Bacteria 2213
210 Ga0207703_10299081 3300026035 Bacteria 1467
211 Ga0207703_11027484 3300026035 Bacteria 791
212 Ga0207703_12218416 3300026035 Bacteria 525
213 Ga0207639_10962036 3300026041 Bacteria 799
214 Ga0207678_10068893 3300026067 Bacteria 3034
215 Ga0207678_10767648 3300026067 Bacteria 850
216 Ga0207708_10560550 3300026075 Bacteria 964
217 Ga0207641_10000613 3300026088 Bacteria 39118
218 Ga0207676_10409403 3300026095 Bacteria 1269
219 Ga0207676_11956270 3300026095 Bacteria 585
220 Ga0207675_101813949 3300026118 Bacteria 629
221 Ga0207683_10893913 3300026121 Bacteria 825
222 Ga0268266_10018590 3300028379 Bacteria 5922
223 Ga0268266_10374901 3300028379 Bacteria 1341
224 Ga0268266_10958213 3300028379 Bacteria 828
225 Ga0268265_10000004 3300028380 Bacteria 648376
226 Ga0268265_12327120 3300028380 Bacteria 542
227 Ga0268264_10000024 3300028381 Bacteria 470081
228 Ga0268264_10844471 3300028381 Bacteria 917
229 Ga0307517_10017918 3300028786 Bacteria 9191
230 Ga0307511_10204626 3300030521 Bacteria 1018
231 Ga0307511_10407805 3300030521 Bacteria 555
232 Ga0265327_10000069 3300031251 Bacteria 217784
233 Ga0265327_10001438 3300031251 Bacteria 30041
234 Ga0265327_10019782 3300031251 Bacteria 4125
235 Ga0265327_10327421 3300031251 Bacteria 671
236 Ga0307509_10005545 3300031507 Bacteria 17503
237 Ga0307509_10030807 3300031507 Bacteria 5930
238 Ga0307509_10047201 3300031507 Bacteria 4633
239 Ga0307509_10454459 3300031507 Bacteria 974
240 Ga0307408_100611372 3300031548 Bacteria 970
241 Ga0307514_10169161 3300031649 Bacteria 1431
242 Ga0316575_10107901 3300031665 Bacteria 1135
243 Ga0307516_10388557 3300031730 Bacteria 1056
244 Ga0307516_10447551 3300031730 Bacteria 948
245 Ga0307405_10452489 3300031731 Bacteria 1018
246 Ga0307405_11705939 3300031731 Bacteria 558
247 Ga0307413_10151373 3300031824 Bacteria 1617
248 Ga0307413_11888227 3300031824 Bacteria 536
249 Ga0307413_11981530 3300031824 Bacteria 524
250 Ga0307518_10184284 3300031838 Bacteria 1407
251 Ga0307518_10217378 3300031838 Bacteria 1251
252 Ga0307410_10064909 3300031852 Bacteria 2510
253 Ga0307410_10221531 3300031852 Bacteria 1456
254 Ga0307410_10306619 3300031852 Bacteria 1255
255 Ga0307410_11655704 3300031852 Bacteria 566
256 Ga0307406_10832805 3300031901 Bacteria 781
257 Ga0307406_10993005 3300031901 Bacteria 720
258 Ga0307406_11228063 3300031901 Bacteria 652
259 Ga0307406_11860367 3300031901 Bacteria 536
260 Ga0307407_11033082 3300031903 Bacteria 636
261 Ga0307412_12263855 3300031911 Bacteria 507
262 Ga0307409_100057515 3300031995 Bacteria 3014
263 Ga0307409_100077870 3300031995 Bacteria 2665
264 Ga0307409_100303772 3300031995 Bacteria 1486
265 Ga0307409_100379638 3300031995 Bacteria 1343
266 Ga0307409_100510306 3300031995 Bacteria 1173
267 Ga0307409_101765499 3300031995 Bacteria 648
268 Ga0307416_102453787 3300032002 Bacteria 620
269 Ga0307414_10144368 3300032004 Bacteria 1868
270 Ga0307414_11100675 3300032004 Bacteria 734
271 Ga0307411_10820447 3300032005 Bacteria 821
272 Ga0307411_11164077 3300032005 Bacteria 698
273 Ga0307415_100231938 3300032126 Bacteria 1487
274 Ga0307415_100388882 3300032126 Bacteria 1187
275 Ga0307415_100559446 3300032126 Bacteria 1011
276 Ga0307507_10284885 3300033179 Bacteria 1029
277 Ga0307507_10648236 3300033179 Bacteria 536
278 Ga0307510_10241242 3300033180 Bacteria 1301
279 Ga0307510_10552553 3300033180 Bacteria 598
280 Ga0373934_0001480 3300035086 Bacteria 8616
281 Ga0373923_0003291 3300035111 Bacteria 5155
282 Ga0373936_0207360 3300035113 Bacteria 866
283 Ga0373953_0004185 3300035117 Bacteria 4578
284 Ga0373954_0019649 3300035118 Bacteria 3049
285 Ga0373956_0001640 3300035119 Bacteria 9220
286 Ga0373957_0006197 3300035120 Bacteria 3758
287 Ga0373960_0161396 3300035121 Bacteria 772
288 Ga0373946_0598720 3300035171 Bacteria 571
289 Ga0373924_0004028 3300035410 Bacteria 5105
290 Ga0373933_0006960 3300035724 Bacteria 6163
291 Ga0373937_0032958 3300036401 Bacteria 4700
292 Ga0395900_0092294 3300037418 Bacteria 3111
293 Ga0395898_0043522 3300037466 Bacteria 4424
294 Ga0395905_0722368 3300037471 Bacteria 898
295 Ga0395901_0196097 3300038443 Bacteria 2117
296 Ga0436361_0252756 3300039447 Bacteria 2012
297 Ga0439461_0000249 3300041410 Bacteria 7675
298 Ga0439461_0052714 3300041410 Bacteria 906
299 Ga0439461_0083337 3300041410 Bacteria 757
300 Ga0439466_0000731 3300041411 Bacteria 12437
301 Ga0439466_0034022 3300041411 Bacteria 1729
302 Ga0439466_0159818 3300041411 Bacteria 689
303 Ga0439465_0006081 3300041413 Bacteria 3837
304 Ga0439465_0007513 3300041413 Bacteria 3464
305 Ga0439465_0093910 3300041413 Bacteria 1029
306 Ga0451789_0123174 3300041443 Bacteria 514
307 Ga0451797_0476086 3300041453 Bacteria 675
308 Ga0451798_1141269 3300041458 Bacteria 694
309 Ga0451800_0113281 3300041459 Bacteria 513
310 Ga0451800_0426569 3300041459 Bacteria 1284
311 Ga0451802_0131784 3300041460 Bacteria 529
312 Ga0451802_1390458 3300041460 Bacteria 672
313 Ga0451802_2080905 3300041460 Bacteria 1218
314 Ga0451833_1288190 3300041491 Bacteria 797
315 Ga0451837_1558681 3300041494 Bacteria 663
316 Ga0451837_1582673 3300041494 Bacteria 606
317 Ga0451841_0221605 3300041498 Bacteria 600
318 Ga0451847_0332780 3300041503 Bacteria 729
319 Ga0451847_0676306 3300041503 Bacteria 643
320 Ga0451853_0038446 3300041512 Bacteria 2559
321 Ga0451853_0580394 3300041512 Bacteria 1255
322 Ga0439431_0086436 3300041997 Bacteria 850
323 Ga0439431_0132154 3300041997 Bacteria 701
324 Ga0439442_098970 3300042002 Bacteria 630
325 Ga0439445_0001278 3300042004 Bacteria 5449
326 Ga0439445_0062953 3300042004 Bacteria 1017
327 Ga0439449_0408523 3300042007 Bacteria 515
328 Ga0439446_0048867 3300042156 Bacteria 1260
329 Ga0439434_0014178 3300042435 Bacteria 2371
330 Ga0439434_0076795 3300042435 Bacteria 1056
331 Ga0439434_0082490 3300042435 Bacteria 1021
332 Ga0439459_0019225 3300042438 Bacteria 1292
333 Ga0466969_0010944 3300044656 Bacteria 4804
334 Ga0466972_0331971 3300044658 Bacteria 711
335 Ga0466972_0551732 3300044658 Bacteria 543
336 Ga0466965_0117270 3300044683 Bacteria 1372
337 Ga0466966_0007607 3300044684 Bacteria 7179
338 Ga0466961_0117841 3300044693 Bacteria 1668
339 Ga0466961_0758272 3300044693 Bacteria 580
340 Ga0466963_0627570 3300044694 Bacteria 759
341 Ga0466964_0574706 3300044706 Bacteria 615
342 Ga0466968_0001212 3300044735 Bacteria 9134
343 Ga0466970_0182169 3300044765 Bacteria 1165
344 Ga0466970_0334821 3300044765 Bacteria 857
345 Ga0466957_0594013 3300044842 Bacteria 774
346 Ga0466957_0675201 3300044842 Bacteria 728
347 Ga0466960_0040240 3300044901 Bacteria 2209
348 Ga0466959_0038359 3300045049 Bacteria 3540
349 Ga0466959_0146553 3300045049 Bacteria 1665
350 Ga0466967_0129620 3300045976 Bacteria 2340
351 Ga0466967_0989430 3300045976 Bacteria 837
352 Ga0466967_1341909 3300045976 Bacteria 712
353 Ga0495592_0016686 3300046454 Bacteria 5573
354 Ga0495592_0023605 3300046454 Bacteria 4678
355 Ga0495592_0061579 3300046454 Bacteria 2757
356 Ga0495592_0099107 3300046454 Bacteria 2079
357 Ga0495603_0066746 3300046455 Bacteria 2119
358 Ga0495603_0642203 3300046455 Bacteria 607
359 Ga0495603_0890677 3300046455 Bacteria 506
360 Ga0495629_0012064 3300046459 Bacteria 6264
361 Ga0495629_0144108 3300046459 Bacteria 1657
362 Ga0495629_0169068 3300046459 Bacteria 1518
363 Ga0495629_0339864 3300046459 Bacteria 1025
364 Ga0495629_1146408 3300046459 Bacteria 501
365 Ga0495638_0000703 3300046460 Bacteria 36244
366 Ga0495638_0021521 3300046460 Bacteria 4247
367 Ga0495638_0094292 3300046460 Bacteria 1799
368 Ga0495638_0170814 3300046460 Bacteria 1247
369 Ga0495641_0019456 3300046461 Bacteria 3472
370 Ga0495641_0059507 3300046461 Bacteria 1727
371 Ga0495641_0085904 3300046461 Bacteria 1408
372 Ga0495651_0006062 3300046462 Bacteria 9231
373 Ga0495651_0025606 3300046462 Bacteria 4593
374 Ga0495653_0025974 3300046463 Bacteria 4699
375 Ga0495580_0350017 3300046472 Bacteria 1001
376 Ga0495580_0415094 3300046472 Bacteria 906
377 Ga0495580_0483604 3300046472 Bacteria 828
378 Ga0495582_0034662 3300046473 Bacteria 2774
379 Ga0495582_0131685 3300046473 Bacteria 1413
380 Ga0495582_0250240 3300046473 Bacteria 1016
381 Ga0495639_0110399 3300046475 Bacteria 1305
382 Ga0495639_0122506 3300046475 Bacteria 1241
383 Ga0495662_0048716 3300046476 Bacteria 2045
384 Ga0495662_0089675 3300046476 Bacteria 1498
385 Ga0495664_0003965 3300046477 Bacteria 8078
386 Ga0495664_0138212 3300046477 Bacteria 1476
387 Ga0495664_0272753 3300046477 Bacteria 1022
388 Ga0495585_0131476 3300046492 Bacteria 1317
389 Ga0495594_0136541 3300046499 Bacteria 1390
390 Ga0495594_0158154 3300046499 Bacteria 1287
391 Ga0495594_0814536 3300046499 Bacteria 526
392 Ga0495583_0318590 3300046506 Bacteria 616
393 Ga0495583_0334764 3300046506 Bacteria 598
394 Ga0495608_0011148 3300046511 Bacteria 6258
395 Ga0495618_0015230 3300046514 Bacteria 4691
396 Ga0495618_0186191 3300046514 Bacteria 1318
397 Ga0495620_0341627 3300046515 Bacteria 568
398 Ga0495628_0019029 3300046516 Bacteria 5681
399 Ga0495628_0027174 3300046516 Bacteria 4658
400 Ga0495628_0125953 3300046516 Bacteria 1962
401 Ga0495630_0033150 3300046517 Bacteria 3851
402 Ga0495630_0472146 3300046517 Bacteria 961
403 Ga0495630_1170586 3300046517 Bacteria 582
404 Ga0495643_0017059 3300046522 Bacteria 4254
405 Ga0495648_0008525 3300046524 Bacteria 8053
406 Ga0495648_0019522 3300046524 Bacteria 4763
407 Ga0495648_0288433 3300046524 Bacteria 774
408 Ga0495666_0011433 3300046526 Bacteria 4423
409 Ga0495666_0065617 3300046526 Bacteria 1731
410 Ga0495666_0112900 3300046526 Bacteria 1276
411 Ga0495652_0003268 3300046529 Bacteria 16146
412 Ga0495652_0033397 3300046529 Bacteria 4491
413 Ga0495652_0488655 3300046529 Bacteria 855
414 Ga0495654_0015950 3300046530 Bacteria 3981
415 Ga0495654_0058658 3300046530 Bacteria 1856
416 Ga0495654_0064436 3300046530 Bacteria 1752
417 Ga0495665_0024791 3300046531 Bacteria 3222
418 Ga0495665_0027770 3300046531 Bacteria 3037
419 Ga0495665_0047488 3300046531 Bacteria 2277
420 Ga0495665_0120258 3300046531 Bacteria 1376
421 Ga0495640_0022762 3300046533 Bacteria 4576
422 Ga0495640_0098956 3300046533 Bacteria 1916
423 Ga0495640_0209947 3300046533 Bacteria 1231
424 Ga0495640_0377725 3300046533 Bacteria 872
425 Ga0495586_0014326 3300046535 Bacteria 4213
426 Ga0495586_0244879 3300046535 Bacteria 1022
427 Ga0495586_0796234 3300046535 Bacteria 545
428 Ga0495587_0006874 3300046536 Bacteria 7395
429 Ga0495587_0071684 3300046536 Bacteria 2014
430 Ga0495645_0045123 3300046543 Bacteria 3216
431 Ga0495645_0054818 3300046543 Bacteria 2895
432 Ga0495645_0414120 3300046543 Bacteria 856
433 Ga0495645_0859928 3300046543 Bacteria 541
434 Ga0495622_0320885 3300046557 Bacteria 673
435 Ga0495668_0012128 3300046616 Bacteria 5125
436 Ga0495668_0082396 3300046616 Bacteria 1765
437 Ga0495668_0538471 3300046616 Bacteria 644
438 Ga0495634_0015689 3300046642 Bacteria 5434
439 Ga0495634_0061064 3300046642 Bacteria 2507
440 Ga0495634_0189984 3300046642 Bacteria 1281
441 Ga0495634_0384440 3300046642 Bacteria 836
442 Ga0495611_0054878 3300046648 Bacteria 1802
443 Ga0495611_0082247 3300046648 Bacteria 1482
444 Ga0495635_0006391 3300046663 Bacteria 8212
445 Ga0495635_0029809 3300046663 Bacteria 3794
446 Ga0495635_0033891 3300046663 Bacteria 3542
447 Ga0495635_0066171 3300046663 Bacteria 2478
448 Ga0495588_0079881 3300046674 Bacteria 1707
449 Ga0495588_0096591 3300046674 Bacteria 1550
450 Ga0495588_0203676 3300046674 Bacteria 1045
451 Ga0495588_0266904 3300046674 Bacteria 902
452 Ga0495588_0366651 3300046674 Bacteria 757
453 Ga0495588_0581562 3300046674 Bacteria 587
454 Ga0495657_0032318 3300046675 Bacteria 3652
455 Ga0495599_0016021 3300046678 Bacteria 4651
456 Ga0495623_0026491 3300046679 Bacteria 3732
457 Ga0495623_0026593 3300046679 Bacteria 3723
458 Ga0495646_0006111 3300046680 Bacteria 7633
459 Ga0495646_0018729 3300046680 Bacteria 4385
460 Ga0495646_0191874 3300046680 Bacteria 1116
461 Ga0495658_0158081 3300046683 Bacteria 1396
462 Ga0495658_0598078 3300046683 Bacteria 707
463 Ga0495658_0807805 3300046683 Bacteria 600
464 Ga0495613_0018634 3300046689 Bacteria 5176
465 Ga0495613_0205198 3300046689 Bacteria 1388
466 Ga0495613_0567562 3300046689 Bacteria 758
467 Ga0495624_0079456 3300046690 Bacteria 2034
468 Ga0495624_0115614 3300046690 Bacteria 1649
469 Ga0495624_0158686 3300046690 Bacteria 1382
470 Ga0495624_0180502 3300046690 Bacteria 1286
471 Ga0495624_0243802 3300046690 Bacteria 1087
472 Ga0495670_0021740 3300046691 Bacteria 3166
473 Ga0495671_0278343 3300046692 Bacteria 806
474 Ga0495671_0569688 3300046692 Bacteria 539
475 Ga0495649_0085277 3300046694 Bacteria 1686
476 Ga0495649_0481648 3300046694 Bacteria 618
477 Ga0495649_0508407 3300046694 Bacteria 599
478 Ga0495589_0392610 3300046794 Bacteria 637
479 Ga0495600_0015518 3300046809 Bacteria 4816
480 Ga0495581_0017598 3300047315 Bacteria 4151
481 Ga0495581_0083003 3300047315 Bacteria 1856
482 Ga0495581_0108630 3300047315 Bacteria 1612
483 Ga0495581_0121613 3300047315 Bacteria 1519
484 Ga0495581_0129659 3300047315 Bacteria 1469
485 Ga0495581_0360709 3300047315 Bacteria 848
486 Ga0495604_0041494 3300047317 Bacteria 3609
487 Ga0495604_0075020 3300047317 Bacteria 2547
488 Ga0495604_0089960 3300047317 Bacteria 2280
489 Ga0495604_0136128 3300047317 Bacteria 1760
490 Ga0495674_0035475 3300047319 Bacteria 4499
491 Ga0495674_0490042 3300047319 Bacteria 984
492 Ga0495672_0001616 3300047320 Bacteria 21986
493 Ga0495672_0006905 3300047320 Bacteria 8653
494 Ga0495672_0006953 3300047320 Bacteria 8610
495 Ga0495672_0034185 3300047320 Bacteria 3143
496 Ga0495672_0425406 3300047320 Bacteria 603
497 Ga0495676_0436429 3300047321 Bacteria 865
498 Ga0495680_0050131 3300047322 Bacteria 3265
499 Ga0495687_050886 3300047443 Bacteria 1762
500 Ga0495675_0003097 3300047444 Bacteria 9987
501 Ga0495675_0504692 3300047444 Bacteria 694
502 Ga0495675_0596861 3300047444 Bacteria 626
503 Ga0495679_110918 3300047446 Bacteria 755
504 Ga0495685_000496 3300047447 Bacteria 12192
505 Ga0495673_0000243 3300047469 Bacteria 77026
506 Ga0495673_0036202 3300047469 Bacteria 2266
507 Ga0495673_0043455 3300047469 Bacteria 2011
508 Ga0495681_0014914 3300047470 Bacteria 4427
509 Ga0495684_0035539 3300047471 Bacteria 3820
510 Ga0495684_0850398 3300047471 Bacteria 592
511 Ga0495686_0008407 3300047472 Bacteria 7573
512 Ga0495686_0155781 3300047472 Bacteria 1338
513 Ga0495593_0020420 3300047673 Bacteria 3710
514 Ga0495593_0083003 3300047673 Bacteria 1656
515 Ga0495593_0192803 3300047673 Bacteria 1025
516 Ga0495593_0656649 3300047673 Bacteria 526
517 Ga0495593_0712888 3300047673 Bacteria 504
518 Ga0495602_0017114 3300048088 Bacteria 7272
519 Ga0495626_0263777 3300048091 Bacteria 688
520 Ga0496100_0000092 3300048903 Bacteria 50831
521 Ga0496100_0034053 3300048903 Bacteria 3192
522 Ga0496100_0044602 3300048903 Bacteria 2841
523 Ga0496100_0072521 3300048903 Bacteria 2302
524 Ga0496101_0000018 3300048904 Bacteria 236102
525 Ga0496101_0000247 3300048904 Bacteria 39381
526 Ga0496101_0013241 3300048904 Bacteria 5523
527 Ga0496101_1002349 3300048904 Bacteria 657
528 Ga0496101_1047407 3300048904 Bacteria 641
529 Ga0496102_0000239 3300048905 Bacteria 72112
530 Ga0496102_0000417 3300048905 Bacteria 49103
531 Ga0496102_0064190 3300048905 Bacteria 3363
532 Ga0496102_0067957 3300048905 Bacteria 3269
533 Ga0496102_0148879 3300048905 Bacteria 2198
534 Ga0496102_0200133 3300048905 Bacteria 1883
535 Ga0496102_0745557 3300048905 Bacteria 902
536 Ga0496103_0000148 3300048906 Bacteria 72710
537 Ga0496103_0000727 3300048906 Bacteria 24310
538 Ga0496103_0000795 3300048906 Bacteria 23202
539 Ga0496103_0415652 3300048906 Bacteria 863
540 Ga0496103_0423891 3300048906 Bacteria 854
541 Ga0496104_0900185 3300048907 Bacteria 790
542 Ga0496104_1032431 3300048907 Bacteria 726
543 Ga0496104_1354495 3300048907 Bacteria 615
544 Ga0496106_0020980 3300048909 Bacteria 4848
545 Ga0496106_0099680 3300048909 Bacteria 2252
546 Ga0496106_0177922 3300048909 Bacteria 1688
547 Ga0496107_0000367 3300048910 Bacteria 24467
548 Ga0496107_0009963 3300048910 Bacteria 6594
549 Ga0496107_0156006 3300048910 Bacteria 1690
550 Ga0496108_0001617 3300048911 Bacteria 17857
551 Ga0496108_0071966 3300048911 Bacteria 2918
552 Ga0496108_0413260 3300048911 Bacteria 1178
553 Ga0496108_0470473 3300048911 Bacteria 1098
554 Ga0496109_0000688 3300048912 Bacteria 28149
555 Ga0496109_0012643 3300048912 Bacteria 7291
556 Ga0496109_0127838 3300048912 Bacteria 2370
557 Ga0496109_0306795 3300048912 Bacteria 1497
558 Ga0496110_0000316 3300048913 Bacteria 31985
559 Ga0496110_0366965 3300048913 Bacteria 1312
560 Ga0496110_1076514 3300048913 Bacteria 712
561 Ga0496111_0604192 3300048914 Bacteria 803
562 Ga0496111_0820465 3300048914 Bacteria 672
563 Ga0496111_0909230 3300048914 Bacteria 634
564 Ga0496112_0011082 3300048915 Bacteria 8216
565 Ga0496112_0120571 3300048915 Bacteria 2593
566 Ga0496112_0225413 3300048915 Bacteria 1830
567 Ga0496113_0041862 3300048916 Bacteria 3383
568 Ga0496113_1061851 3300048916 Bacteria 636
569 Ga0496113_1145636 3300048916 Bacteria 609
570 Ga0496113_1297639 3300048916 Bacteria 566
571 Ga0496113_1462638 3300048916 Bacteria 528
572 Ga0496114_0000353 3300048917 Bacteria 33623
573 Ga0496115_0236643 3300048918 Bacteria 1505
574 Ga0496115_0813994 3300048918 Bacteria 726
575 Ga0496116_0000224 3300048919 Bacteria 106109
576 Ga0496116_0000355 3300048919 Bacteria 72106
577 Ga0496116_0005548 3300048919 Bacteria 11637
578 Ga0496116_0014633 3300048919 Bacteria 6252
579 Ga0496117_0000051 3300048920 Bacteria 285716
580 Ga0496117_0000909 3300048920 Bacteria 45378
581 Ga0496117_0012107 3300048920 Bacteria 7650
582 Ga0496117_0074800 3300048920 Bacteria 2253
583 Ga0496117_0099125 3300048920 Bacteria 1850
584 Ga0496117_0265821 3300048920 Bacteria 927
585 Ga0496118_0000043 3300048921 Bacteria 285716
586 Ga0496118_0000324 3300048921 Bacteria 82637
587 Ga0496118_0002530 3300048921 Bacteria 24503
588 Ga0496118_0028149 3300048921 Bacteria 4740
589 Ga0496118_0046458 3300048921 Bacteria 3377
590 Ga0496118_0404747 3300048921 Bacteria 707
591 Ga0496119_0000990 3300048922 Bacteria 36498
592 Ga0496119_0003073 3300048922 Bacteria 17626
593 Ga0496119_0010949 3300048922 Bacteria 7574
594 Ga0496119_0029615 3300048922 Bacteria 3708
595 Ga0496119_0130880 3300048922 Bacteria 1367
596 Ga0496120_0009746 3300048923 Bacteria 6775
597 Ga0496120_0014292 3300048923 Bacteria 5298
598 Ga0496120_0054158 3300048923 Bacteria 2275
599 Ga0496120_0192780 3300048923 Bacteria 992
600 Ga0496121_0000023 3300048924 Bacteria 463448
601 Ga0496121_0000924 3300048924 Bacteria 53089
602 Ga0496121_0002322 3300048924 Bacteria 29463
603 Ga0496121_0555430 3300048924 Bacteria 717
604 Ga0496122_0000164 3300048925 Bacteria 158055
605 Ga0496122_0246220 3300048925 Bacteria 1004
606 Ga0496123_0003496 3300048926 Bacteria 17538
607 Ga0496124_0000014 3300048927 Bacteria 463448
608 Ga0496124_0523991 3300048927 Bacteria 789
609 Ga0496125_0000020 3300048928 Bacteria 463448
610 Ga0496125_0079216 3300048928 Bacteria 2521
611 Ga0496125_0081795 3300048928 Bacteria 2465
612 Ga0496125_0116487 3300048928 Bacteria 1919
613 Ga0496125_0327620 3300048928 Bacteria 925
614 Ga0496126_0000023 3300048929 Bacteria 463448
615 Ga0496126_0002171 3300048929 Bacteria 27244
616 Ga0496126_0521685 3300048929 Bacteria 946
617 Ga0496126_0521688 3300048929 Bacteria 946
618 Ga0501031_0030529 3300049568 Bacteria 3516
619 Ga0501032_0001214 3300049569 Bacteria 20623
620 Ga0501032_0002928 3300049569 Bacteria 13276
621 Ga0501032_0180754 3300049569 Bacteria 1381
622 Ga0501032_0349463 3300049569 Bacteria 953
623 Ga0501034_0001356 3300049571 Bacteria 33085
624 Ga0501034_0002853 3300049571 Bacteria 20144
625 Ga0501034_0468555 3300049571 Bacteria 1176
626 Ga0501036_0002465 3300049572 Bacteria 14501
627 Ga0501036_0054599 3300049572 Bacteria 3384
628 Ga0501036_0230377 3300049572 Bacteria 1555
629 Ga0501036_0421975 3300049572 Bacteria 1112
630 Ga0501036_0854244 3300049572 Bacteria 748
631 Ga0501037_0000220 3300049573 Bacteria 49798
632 Ga0501037_0001017 3300049573 Bacteria 20741
633 Ga0501038_0000980 3300049574 Bacteria 25615
634 Ga0501038_0001589 3300049574 Bacteria 21073
635 Ga0501038_0012468 3300049574 Bacteria 7767
636 Ga0501038_1100872 3300049574 Bacteria 580
637 Ga0501038_1344011 3300049574 Bacteria 515
638 Ga0501039_0000976 3300049575 Bacteria 20785
639 Ga0501039_0001608 3300049575 Bacteria 16643
640 Ga0501039_0230430 3300049575 Bacteria 1456
641 Ga0501039_0754001 3300049575 Bacteria 760
642 Ga0501041_0795914 3300049577 Bacteria 606
643 Ga0501043_0001421 3300049579 Bacteria 20917
644 Ga0501043_0008835 3300049579 Bacteria 7928
645 Ga0501046_0139616 3300049580 Bacteria 1834
646 Ga0501047_0260279 3300049581 Bacteria 1583
647 Ga0501047_0660208 3300049581 Bacteria 865
648 Ga0501047_0949067 3300049581 Bacteria 673
649 Ga0501047_1115258 3300049581 Bacteria 602
650 Ga0501047_1216277 3300049581 Bacteria 567
651 Ga0501048_0412578 3300049582 Bacteria 966
652 Ga0501067_0007055 3300049583 Bacteria 6240
653 Ga0501067_0059179 3300049583 Bacteria 2121
654 Ga0501068_0172460 3300049584 Bacteria 1365
655 Ga0501068_0872432 3300049584 Bacteria 591
656 Ga0501069_0074776 3300049585 Bacteria 1902
657 Ga0501069_0732925 3300049585 Bacteria 597
658 Ga0501070_0001619 3300049586 Bacteria 19966
659 Ga0501070_0014548 3300049586 Bacteria 6620
660 Ga0501070_0064844 3300049586 Bacteria 3024
661 Ga0501070_0508200 3300049586 Bacteria 968
662 Ga0501071_0019804 3300049587 Bacteria 4673
663 Ga0501071_0080362 3300049587 Bacteria 2384
664 Ga0501071_0380886 3300049587 Bacteria 1076
665 Ga0501071_0472537 3300049587 Bacteria 961
666 Ga0501071_0990720 3300049587 Bacteria 649
667 Ga0501072_0475249 3300049588 Bacteria 989
668 Ga0501072_0697267 3300049588 Bacteria 798
669 Ga0501073_0008348 3300049589 Bacteria 7682
670 Ga0501073_0009592 3300049589 Bacteria 7139
671 Ga0501073_0012643 3300049589 Bacteria 6157
672 Ga0501073_0973500 3300049589 Bacteria 584
673 Ga0501074_0014245 3300049590 Bacteria 5782
674 Ga0501074_0180325 3300049590 Bacteria 1507
675 Ga0501074_0498355 3300049590 Bacteria 863
676 Ga0501075_0682249 3300049591 Bacteria 783
677 Ga0501076_0603012 3300049592 Bacteria 906
678 Ga0501077_0058401 3300049593 Bacteria 2449
679 Ga0501077_0074425 3300049593 Bacteria 2151
680 Ga0501079_0226620 3300049741 Bacteria 1460
681 Ga0501079_0357708 3300049741 Bacteria 1144
682 Ga0501079_0504897 3300049741 Bacteria 951
683 Ga0501080_0059848 3300049742 Bacteria 3544
684 Ga0501080_0176297 3300049742 Bacteria 1969
685 Ga0501080_0626100 3300049742 Bacteria 954
686 Ga0501081_0351748 3300049743 Bacteria 1086
687 Ga0501083_0019481 3300049744 Bacteria 4727
688 Ga0501035_0023964 3300049822 Bacteria 5601
689 Ga0501035_0342772 3300049822 Bacteria 1252
690 Ga0501044_0003636 3300049823 Bacteria 17354
691 Ga0501044_0007721 3300049823 Bacteria 11828
692 Ga0501044_0041282 3300049823 Bacteria 4802
693 Ga0501044_0526391 3300049823 Bacteria 1081
694 Ga0501045_1431833 3300049824 Bacteria 501
695 nmdc:mga03683_122053_c1 3300050489 Bacteria 1159
696 nmdc:mga03683_296190_c1 3300050489 Bacteria 758
697 nmdc:mga03683_322237_c1 3300050489 Bacteria 728
698 nmdc:mga03683_517832_c1 3300050489 Bacteria 579
699 nmdc:mga03683_57907_c1 3300050489 Bacteria 1632
700 nmdc:mga03n38_126437_c1 3300050490 Bacteria 1262
701 nmdc:mga03n38_20349_c1 3300050490 Bacteria 2654
702 nmdc:mga03n38_233450_c1 3300050490 Bacteria 664
703 nmdc:mga03n38_38933_c1 3300050490 Bacteria 2059
704 nmdc:mga03n38_49574_c1 3300050490 Bacteria 1868
705 nmdc:mga03n38_765_c2 3300050490 Bacteria 7172
706 nmdc:mga03n38_822836_c1 3300050490 Bacteria 542
707 nmdc:mga03n38_86562_c1 3300050490 Bacteria 1483
708 nmdc:mga00v17_143978_c1 3300050491 Bacteria 1529
709 nmdc:mga00v17_267515_c1 3300050491 Bacteria 1109
710 nmdc:mga00v17_2753_c1 3300050491 Bacteria 9022
711 nmdc:mga00v17_2964_c1 3300050491 Bacteria 8714
712 nmdc:mga00v17_428857_c1 3300050491 Bacteria 859
713 nmdc:mga00v17_664666_c1 3300050491 Bacteria 669
714 nmdc:mga00v17_991052_c1 3300050491 Bacteria 529
715 nmdc:mga0yw44_141077_c1 3300050492 Bacteria 1566
716 nmdc:mga0yw44_236511_c1 3300050492 Bacteria 1213
717 nmdc:mga0yw44_314841_c1 3300050492 Bacteria 1050
718 nmdc:mga0yw44_901224_c1 3300050492 Bacteria 600
719 nmdc:mga06z11_212214_c1 3300050494 Bacteria 1128
720 nmdc:mga06z11_359481_c1 3300050494 Bacteria 872
721 nmdc:mga07m45_17718_c1 3300050496 Bacteria 3831
722 nmdc:mga07m45_259506_c1 3300050496 Bacteria 1011
723 nmdc:mga07m45_265485_c1 3300050496 Bacteria 998
724 nmdc:mga07m45_297351_c1 3300050496 Bacteria 939
725 nmdc:mga07m45_54135_c1 3300050496 Bacteria 2268
726 nmdc:mga07m45_73289_c1 3300050496 Bacteria 1949
727 nmdc:mga07m45_76649_c1 3300050496 Bacteria 1906
728 nmdc:mga0qj67_191131_c1 3300050509 Bacteria 1664
729 nmdc:mga08y16_1255093_c1 3300050511 Bacteria 709
730 nmdc:mga0sz30_1570_c3 3300050516 Bacteria 2621
731 nmdc:mga0sz30_184738_c1 3300050516 Bacteria 925
732 nmdc:mga0sz30_185756_c1 3300050516 Bacteria 923
733 nmdc:mga0sz30_196062_c2 3300050516 Bacteria 541
734 nmdc:mga0sz30_3198_c1 3300050516 Bacteria 5875
735 nmdc:mga0sz30_3903_c2 3300050516 Bacteria 2253
736 nmdc:mga0sz30_44034_c1 3300050516 Bacteria 1879
737 nmdc:mga0sz30_49002_c1 3300050516 Bacteria 1789
738 nmdc:mga0sz30_593234_c1 3300050516 Bacteria 501
739 nmdc:mga0sz30_79124_c1 3300050516 Bacteria 1421
740 Ga0495601_0036065 3300053077 Bacteria 3088
741 Ga0495601_0054952 3300053077 Bacteria 2520
742 Ga0495612_0008332 3300053078 Bacteria 4207
743 Ga0495612_0087097 3300053078 Bacteria 1318
744 Ga0500610_0386853 3300053079 Bacteria 575
745 Ga0500635_0010410 3300053080 Bacteria 2611
746 Ga0495595_0059266 3300053084 Bacteria 1789
747 Ga0495619_0027478 3300053085 Bacteria 3665
748 Ga0495619_0033191 3300053085 Bacteria 3352
749 Ga0500578_0300672 3300053086 Bacteria 951
750 Ga0500643_015487 3300053087 Bacteria 2613
751 Ga0500581_158927 3300053089 Bacteria 1052
752 Ga0500583_0543451 3300053092 Bacteria 541
753 Ga0500566_0037844 3300053094 Bacteria 2794
754 Ga0500566_0118491 3300053094 Bacteria 1430
755 Ga0500566_0201144 3300053094 Bacteria 1006
756 Ga0500640_039268 3300053095 Bacteria 2079
757 Ga0500641_0095792 3300053096 Bacteria 1270
758 Ga0500641_0108825 3300053096 Bacteria 1192
759 Ga0500650_0239772 3300053098 Bacteria 816
760 Ga0500654_033475 3300053099 Bacteria 3049
761 Ga0500553_024427 3300053101 Bacteria 3049
762 Ga0500553_065288 3300053101 Bacteria 1691
763 Ga0500556_0004758 3300053104 Bacteria 3851
764 Ga0500557_282067 3300053105 Bacteria 510
765 Ga0500560_003175 3300053107 Bacteria 3281
766 Ga0500560_026695 3300053107 Bacteria 1708
767 Ga0500560_141531 3300053107 Bacteria 802
768 Ga0500562_029104 3300053108 Bacteria 1453
769 Ga0500569_300851 3300053109 Bacteria 539
770 Ga0500595_022551 3300053119 Bacteria 2227
771 Ga0500608_145397 3300053122 Bacteria 1046
772 Ga0500614_003215 3300053123 Bacteria 3539
773 Ga0500614_004621 3300053123 Bacteria 2902
774 Ga0500628_001538 3300053129 Bacteria 3928
775 Ga0500628_130111 3300053129 Bacteria 690
776 Ga0500652_000813 3300053131 Bacteria 10457
777 Ga0500652_016845 3300053131 Bacteria 2667
778 Ga0500652_083240 3300053131 Bacteria 1333
779 Ga0500658_0031952 3300053134 Bacteria 2062
780 Ga0500658_0200313 3300053134 Bacteria 912
781 Ga0500559_0075300 3300053136 Bacteria 1526
782 Ga0500561_0236589 3300053137 Bacteria 580
783 Ga0500564_250523 3300053138 Bacteria 702
784 Ga0500573_0068501 3300053140 Bacteria 2026
785 Ga0500573_0553024 3300053140 Bacteria 509
786 Ga0500577_0207329 3300053142 Bacteria 847
787 Ga0500579_081841 3300053143 Bacteria 1800
788 Ga0500586_175224 3300053145 Bacteria 719
789 Ga0500588_0171020 3300053146 Bacteria 795
790 Ga0500588_0287378 3300053146 Bacteria 621
791 Ga0500600_0132375 3300053149 Bacteria 1267
792 Ga0500603_105942 3300053150 Bacteria 840
793 Ga0500603_172460 3300053150 Bacteria 678
794 Ga0500616_0007990 3300053153 Bacteria 6634
795 Ga0500633_0044639 3300053160 Bacteria 1505
796 Ga0500634_0106343 3300053161 Bacteria 1394
797 Ga0500636_0080281 3300053177 Bacteria 1880
798 Ga0500636_0136341 3300053177 Bacteria 1363
799 Ga0500637_0534790 3300053178 Bacteria 572
800 Ga0500645_000004 3300053730 Bacteria 305014
801 Ga0500645_000057 3300053730 Bacteria 92092
802 Ga0500645_000988 3300053730 Bacteria 16082
803 Ga0500587_069614 3300053739 Bacteria 551
804 Ga0501084_0738796 3300054114 Bacteria 829
805 Ga0501084_0986903 3300054114 Bacteria 708
806 Ga0501082_0008404 3300060353 Bacteria 8906
807 Ga0466962_0357367 3300061719 Bacteria 728
808 Ga0530510_0153763 3300061734 Bacteria 1700
809 Ga0530510_0648581 3300061734 Bacteria 804

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0334821 Ga0466970_0334821_571_813 79
2 3300053177 Ga0500636_0136341 Ga0500636_0136341_910_1152 79
3 iso_pu_bacteria 2643221561 2643826127 81
4 iso_pu_bacteria 2643221604 2644031796 81
5 iso_pu_bacteria 3001889506 3001889882 81
6 3300025303 Ga0209051_1000075 Ga0209051_1000075155 82
7 3300046694 Ga0495649_0508407 Ga0495649_0508407_101_349 82
8 iso_pu_bacteria 2816332119 2816426134 82
9 3300031548 Ga0307408_100611372 Ga0307408_1006113722 83
10 3300041459 Ga0451800_0426569 Ga0451800_0426569_944_1198 83
11 3300041460 Ga0451802_2080905 Ga0451802_2080905_94_348 83
12 3300041494 Ga0451837_1582673 Ga0451837_1582673_238_492 83
13 3300041503 Ga0451847_0676306 Ga0451847_0676306_172_426 83
14 3300041512 Ga0451853_0038446 Ga0451853_0038446_561_815 83
15 iso_pu_bacteria 2818991472 2819741623 83
16 iso_pu_bacteria 2995463766 2995463980 83
17 iso_pu_bacteria 3006486233 3006492531 83
18 3300005434 Ga0070709_10012787 Ga0070709_100127872 84
19 3300005435 Ga0070714_100001652 Ga0070714_1000016526 84
20 3300005436 Ga0070713_100301110 Ga0070713_1003011102 84
21 3300005437 Ga0070710_10016786 Ga0070710_100167864 84
22 3300006173 Ga0070716_100881368 Ga0070716_1008813682 84
23 3300006175 Ga0070712_100005080 Ga0070712_1000050806 84
24 3300025898 Ga0207692_10450457 Ga0207692_104504572 84
25 3300025906 Ga0207699_10008608 Ga0207699_100086084 84
26 3300025928 Ga0207700_10327227 Ga0207700_103272272 84
27 3300025929 Ga0207664_10006955 Ga0207664_100069557 84
28 3300035086 Ga0373934_0001480 Ga0373934_0001480_2587_2841 84
29 3300035111 Ga0373923_0003291 Ga0373923_0003291_625_879 84
30 3300035113 Ga0373936_0207360 Ga0373936_0207360_306_560 84
31 3300035117 Ga0373953_0004185 Ga0373953_0004185_2147_2401 84
32 3300035118 Ga0373954_0019649 Ga0373954_0019649_2596_2850 84
33 3300035119 Ga0373956_0001640 Ga0373956_0001640_5892_6146 84
34 3300035120 Ga0373957_0006197 Ga0373957_0006197_723_977 84
35 3300035410 Ga0373924_0004028 Ga0373924_0004028_1921_2175 84
36 3300035724 Ga0373933_0006960 Ga0373933_0006960_4062_4316 84
37 3300036401 Ga0373937_0032958 Ga0373937_0032958_2596_2850 84
38 3300046454 Ga0495592_0023605 Ga0495592_0023605_1829_2083 84
39 3300046459 Ga0495629_0012064 Ga0495629_0012064_4293_4547 84
40 3300046461 Ga0495641_0019456 Ga0495641_0019456_2242_2496 84
41 3300046463 Ga0495653_0025974 Ga0495653_0025974_2596_2850 84
42 3300046473 Ga0495582_0034662 Ga0495582_0034662_451_705 84
43 3300046476 Ga0495662_0089675 Ga0495662_0089675_932_1186 84
44 3300046477 Ga0495664_0003965 Ga0495664_0003965_2968_3222 84
45 3300046511 Ga0495608_0011148 Ga0495608_0011148_1839_2093 84
46 3300046514 Ga0495618_0015230 Ga0495618_0015230_2596_2850 84
47 3300046516 Ga0495628_0027174 Ga0495628_0027174_1831_2085 84
48 3300046517 Ga0495630_0033150 Ga0495630_0033150_1036_1290 84
49 3300046526 Ga0495666_0112900 Ga0495666_0112900_266_520 84
50 3300046529 Ga0495652_0033397 Ga0495652_0033397_1847_2101 84
51 3300046531 Ga0495665_0024791 Ga0495665_0024791_1116_1370 84
52 3300046533 Ga0495640_0022762 Ga0495640_0022762_1805_2059 84
53 3300046536 Ga0495587_0006874 Ga0495587_0006874_5189_5443 84
54 3300046543 Ga0495645_0414120 Ga0495645_0414120_326_580 84
55 3300046642 Ga0495634_0015689 Ga0495634_0015689_2519_2773 84
56 3300046663 Ga0495635_0029809 Ga0495635_0029809_2782_3036 84
57 3300046675 Ga0495657_0032318 Ga0495657_0032318_1008_1262 84
58 3300046678 Ga0495599_0016021 Ga0495599_0016021_2596_2850 84
59 3300046679 Ga0495623_0026593 Ga0495623_0026593_942_1196 84
60 3300046680 Ga0495646_0006111 Ga0495646_0006111_5171_5425 84
61 3300046689 Ga0495613_0018634 Ga0495613_0018634_2377_2631 84
62 3300046690 Ga0495624_0158686 Ga0495624_0158686_601_855 84
63 3300046809 Ga0495600_0015518 Ga0495600_0015518_2782_3036 84
64 3300047315 Ga0495581_0017598 Ga0495581_0017598_1172_1426 84
65 3300047317 Ga0495604_0075020 Ga0495604_0075020_788_1042 84
66 3300047319 Ga0495674_0035475 Ga0495674_0035475_1727_1981 84
67 3300047322 Ga0495680_0050131 Ga0495680_0050131_493_747 84
68 3300047444 Ga0495675_0003097 Ga0495675_0003097_3129_3383 84
69 3300047471 Ga0495684_0035539 Ga0495684_0035539_971_1225 84
70 3300047673 Ga0495593_0020420 Ga0495593_0020420_3041_3295 84
71 3300048088 Ga0495602_0017114 Ga0495602_0017114_1848_2102 84
72 3300053077 Ga0495601_0036065 Ga0495601_0036065_1724_1978 84
73 3300053078 Ga0495612_0087097 Ga0495612_0087097_314_568 84
74 3300053084 Ga0495595_0059266 Ga0495595_0059266_548_802 84
75 iso_pu_bacteria 2744054611 2744956003 84
76 3300025901 Ga0207688_10447529 Ga0207688_104475291 85
77 3300030521 Ga0307511_10204626 Ga0307511_102046261 85
78 3300031665 Ga0316575_10107901 Ga0316575_101079012 85
79 3300031995 Ga0307409_100510306 Ga0307409_1005103062 85
80 3300035171 Ga0373946_0598720 Ga0373946_0598720_227_487 85
81 3300037418 Ga0395900_0092294 Ga0395900_0092294_580_840 85
82 3300037466 Ga0395898_0043522 Ga0395898_0043522_1447_1707 85
83 3300037471 Ga0395905_0722368 Ga0395905_0722368_66_326 85
84 3300038443 Ga0395901_0196097 Ga0395901_0196097_776_1036 85
85 3300041997 Ga0439431_0086436 Ga0439431_0086436_324_584 85
86 3300042002 Ga0439442_098970 Ga0439442_098970_142_402 85
87 3300042156 Ga0439446_0048867 Ga0439446_0048867_178_438 85
88 3300042435 Ga0439434_0076795 Ga0439434_0076795_345_605 85
89 3300046459 Ga0495629_0169068 Ga0495629_0169068_1166_1426 85
90 3300046461 Ga0495641_0085904 Ga0495641_0085904_195_455 85
91 3300046475 Ga0495639_0122506 Ga0495639_0122506_821_1081 85
92 3300046689 Ga0495613_0567562 Ga0495613_0567562_157_417 85
93 3300048914 Ga0496111_0604192 Ga0496111_0604192_137_397 85
94 3300048915 Ga0496112_0225413 Ga0496112_0225413_457_717 85
95 3300048916 Ga0496113_0041862 Ga0496113_0041862_525_785 85
96 3300049574 Ga0501038_1100872 Ga0501038_1100872_45_305 85
97 3300049581 Ga0501047_0949067 Ga0501047_0949067_46_306 85
98 3300049583 Ga0501067_0007055 Ga0501067_0007055_5144_5404 85
99 3300049584 Ga0501068_0172460 Ga0501068_0172460_213_473 85
100 3300049586 Ga0501070_0014548 Ga0501070_0014548_5524_5784 85
101 3300049587 Ga0501071_0472537 Ga0501071_0472537_199_459 85
102 3300049589 Ga0501073_0009592 Ga0501073_0009592_599_859 85
103 3300049590 Ga0501074_0014245 Ga0501074_0014245_457_717 85
104 3300049593 Ga0501077_0074425 Ga0501077_0074425_576_836 85
105 3300049741 Ga0501079_0357708 Ga0501079_0357708_303_563 85
106 3300049742 Ga0501080_0059848 Ga0501080_0059848_2565_2825 85
107 3300049744 Ga0501083_0019481 Ga0501083_0019481_3895_4155 85
108 3300053092 Ga0500583_0543451 Ga0500583_0543451_169_429 85
109 3300054114 Ga0501084_0738796 Ga0501084_0738796_203_463 85
110 3300060353 Ga0501082_0008404 Ga0501082_0008404_7914_8174 85
111 iso_pu_bacteria 2547132424 2548697074 85
112 iso_pu_bacteria 2565956761 2566996110 85
113 iso_pu_bacteria 2643221692 2644511782 85
114 iso_pu_bacteria 2738541264 2738667572 85
115 iso_pu_bacteria 2738541274 2738705510 85
116 iso_pu_bacteria 2738541308 2738892320 85
117 iso_pu_bacteria 2738541356 2739146642 85
118 iso_pu_bacteria 2738543011 2739236423 85
119 iso_pu_bacteria 2738543028 2739332299 85
120 iso_pu_bacteria 2842134933 2842135855 85
121 iso_pu_bacteria 2889300758 2889305904 85
122 iso_pu_bacteria 2902792274 2902793586 85
123 iso_pu_bacteria 2902792274 2902796805 85
124 iso_pu_bacteria 2902810491 2902813634 85
125 iso_pu_bacteria 2902810491 2902816746 85
126 iso_pu_bacteria 2902837492 2902843592 85
127 iso_pu_bacteria 2904535858 2904540745 85
128 iso_pu_bacteria 2904765812 2904766266 85
129 iso_pu_bacteria 2904770941 2904772331 85
130 iso_pu_bacteria 2908811453 2908812460 85
131 iso_pu_bacteria 2919420072 2919421308 85
132 iso_pu_bacteria 2919432681 2919432934 85
133 iso_pu_bacteria 2919713450 2919713567 85
134 iso_pu_bacteria 2922554459 2922554834 85
135 iso_pu_bacteria 2939743619 2939744039 85
136 iso_pu_bacteria 2974315732 2974318889 85
137 iso_pu_bacteria 2984523437 2984527159 85
138 3300003320 rootH2_10014701 rootH2_100147011 86
139 3300005329 Ga0070683_100785096 Ga0070683_1007850962 86
140 3300005336 Ga0070680_101475501 Ga0070680_1014755012 86
141 3300005467 Ga0070706_101941089 Ga0070706_1019410891 86
142 3300005530 Ga0070679_100205942 Ga0070679_1002059421 86
143 3300009551 Ga0105238_11577667 Ga0105238_115776672 86
144 3300013105 Ga0157369_11159480 Ga0157369_111594802 86
145 3300013307 Ga0157372_10495502 Ga0157372_104955023 86
146 3300020078 Ga0206352_10194983 Ga0206352_101949832 86
147 3300020610 Ga0154015_1673388 Ga0154015_16733882 86
148 3300022467 Ga0224712_10096383 Ga0224712_100963832 86
149 3300025904 Ga0207647_10295835 Ga0207647_102958353 86
150 3300025917 Ga0207660_10339002 Ga0207660_103390022 86
151 3300031730 Ga0307516_10388557 Ga0307516_103885572 86
152 3300031731 Ga0307405_10452489 Ga0307405_104524892 86
153 3300031731 Ga0307405_11705939 Ga0307405_117059391 86
154 3300031824 Ga0307413_10151373 Ga0307413_101513733 86
155 3300031838 Ga0307518_10217378 Ga0307518_102173782 86
156 3300031852 Ga0307410_10064909 Ga0307410_100649093 86
157 3300031852 Ga0307410_10221531 Ga0307410_102215312 86
158 3300031852 Ga0307410_11655704 Ga0307410_116557042 86
159 3300031901 Ga0307406_10832805 Ga0307406_108328051 86
160 3300031901 Ga0307406_10993005 Ga0307406_109930052 86
161 3300031903 Ga0307407_11033082 Ga0307407_110330821 86
162 3300031911 Ga0307412_12263855 Ga0307412_122638551 86
163 3300031995 Ga0307409_100057515 Ga0307409_1000575153 86
164 3300031995 Ga0307409_100077870 Ga0307409_1000778702 86
165 3300031995 Ga0307409_100303772 Ga0307409_1003037721 86
166 3300032004 Ga0307414_10144368 Ga0307414_101443683 86
167 3300032005 Ga0307411_11164077 Ga0307411_111640771 86
168 3300032126 Ga0307415_100231938 Ga0307415_1002319381 86
169 3300042007 Ga0439449_0408523 Ga0439449_0408523_47_313 86
170 3300044694 Ga0466963_0627570 Ga0466963_0627570_457_729 86
171 3300046455 Ga0495603_0642203 Ga0495603_0642203_36_302 86
172 3300046473 Ga0495582_0131685 Ga0495582_0131685_527_793 86
173 3300049568 Ga0501031_0030529 Ga0501031_0030529_1031_1294 86
174 3300049569 Ga0501032_0349463 Ga0501032_0349463_545_838 86
175 3300049571 Ga0501034_0468555 Ga0501034_0468555_157_450 86
176 3300049572 Ga0501036_0230377 Ga0501036_0230377_212_478 86
177 3300049572 Ga0501036_0421975 Ga0501036_0421975_242_505 86
178 3300049572 Ga0501036_0854244 Ga0501036_0854244_340_603 86
179 3300049574 Ga0501038_0012468 Ga0501038_0012468_3774_4067 86
180 3300049574 Ga0501038_1344011 Ga0501038_1344011_22_285 86
181 3300049575 Ga0501039_0230430 Ga0501039_0230430_330_623 86
182 3300049575 Ga0501039_0754001 Ga0501039_0754001_380_643 86
183 3300049581 Ga0501047_0660208 Ga0501047_0660208_368_661 86
184 3300049582 Ga0501048_0412578 Ga0501048_0412578_113_379 86
185 3300049585 Ga0501069_0074776 Ga0501069_0074776_857_1150 86
186 3300049586 Ga0501070_0508200 Ga0501070_0508200_498_761 86
187 3300049587 Ga0501071_0080362 Ga0501071_0080362_201_464 86
188 3300049587 Ga0501071_0380886 Ga0501071_0380886_333_596 86
189 3300049587 Ga0501071_0990720 Ga0501071_0990720_264_527 86
190 3300049588 Ga0501072_0475249 Ga0501072_0475249_635_898 86
191 3300049588 Ga0501072_0697267 Ga0501072_0697267_120_383 86
192 3300049589 Ga0501073_0973500 Ga0501073_0973500_230_523 86
193 3300049590 Ga0501074_0180325 Ga0501074_0180325_884_1177 86
194 3300049590 Ga0501074_0498355 Ga0501074_0498355_139_405 86
195 3300049591 Ga0501075_0682249 Ga0501075_0682249_379_645 86
196 3300049592 Ga0501076_0603012 Ga0501076_0603012_193_456 86
197 3300049741 Ga0501079_0504897 Ga0501079_0504897_166_429 86
198 3300049742 Ga0501080_0626100 Ga0501080_0626100_41_334 86
199 3300049743 Ga0501081_0351748 Ga0501081_0351748_559_825 86
200 3300049822 Ga0501035_0342772 Ga0501035_0342772_216_479 86
201 3300050492 nmdc:mga0yw44_236511_c1 nmdc:mga0yw44_236511_c1_766_1032 86
202 3300054114 Ga0501084_0986903 Ga0501084_0986903_360_653 86
203 3300061734 Ga0530510_0153763 Ga0530510_0153763_734_997 86
204 3300061734 Ga0530510_0648581 Ga0530510_0648581_447_710 86
205 3300009545 Ga0105237_12451415 Ga0105237_124514151 87
206 3300009553 Ga0105249_10000893 Ga0105249_100008937 87
207 3300013308 Ga0157375_12069732 Ga0157375_120697321 87
208 3300014968 Ga0157379_11833539 Ga0157379_118335392 87
209 3300014969 Ga0157376_12071362 Ga0157376_120713622 87
210 3300025961 Ga0207712_10394382 Ga0207712_103943821 87
211 3300028786 Ga0307517_10017918 Ga0307517_100179182 87
212 3300031507 Ga0307509_10047201 Ga0307509_100472015 87
213 3300031507 Ga0307509_10454459 Ga0307509_104544592 87
214 3300031649 Ga0307514_10169161 Ga0307514_101691611 87
215 3300031730 Ga0307516_10447551 Ga0307516_104475512 87
216 3300033179 Ga0307507_10284885 Ga0307507_102848852 87
217 3300033180 Ga0307510_10241242 Ga0307510_102412422 87
218 3300044656 Ga0466969_0010944 Ga0466969_0010944_3817_4083 87
219 3300044684 Ga0466966_0007607 Ga0466966_0007607_4010_4276 87
220 3300044693 Ga0466961_0117841 Ga0466961_0117841_358_624 87
221 3300044693 Ga0466961_0758272 Ga0466961_0758272_100_366 87
222 3300044842 Ga0466957_0675201 Ga0466957_0675201_399_665 87
223 3300045049 Ga0466959_0038359 Ga0466959_0038359_382_648 87
224 3300046454 Ga0495592_0016686 Ga0495592_0016686_4191_4496 87
225 3300046454 Ga0495592_0061579 Ga0495592_0061579_2010_2276 87
226 3300046454 Ga0495592_0099107 Ga0495592_0099107_1741_2013 87
227 3300046459 Ga0495629_0144108 Ga0495629_0144108_346_612 87
228 3300046462 Ga0495651_0006062 Ga0495651_0006062_1883_2149 87
229 3300046462 Ga0495651_0025606 Ga0495651_0025606_3875_4141 87
230 3300046472 Ga0495580_0350017 Ga0495580_0350017_202_468 87
231 3300046476 Ga0495662_0048716 Ga0495662_0048716_1392_1658 87
232 3300046477 Ga0495664_0138212 Ga0495664_0138212_162_428 87
233 3300046477 Ga0495664_0272753 Ga0495664_0272753_352_618 87
234 3300046492 Ga0495585_0131476 Ga0495585_0131476_1011_1277 87
235 3300046499 Ga0495594_0158154 Ga0495594_0158154_74_340 87
236 3300046499 Ga0495594_0814536 Ga0495594_0814536_123_389 87
237 3300046514 Ga0495618_0186191 Ga0495618_0186191_827_1093 87
238 3300046515 Ga0495620_0341627 Ga0495620_0341627_26_292 87
239 3300046516 Ga0495628_0019029 Ga0495628_0019029_4660_4932 87
240 3300046516 Ga0495628_0125953 Ga0495628_0125953_1111_1377 87
241 3300046517 Ga0495630_0472146 Ga0495630_0472146_357_623 87
242 3300046522 Ga0495643_0017059 Ga0495643_0017059_310_576 87
243 3300046526 Ga0495666_0011433 Ga0495666_0011433_4013_4279 87
244 3300046526 Ga0495666_0065617 Ga0495666_0065617_1070_1336 87
245 3300046529 Ga0495652_0003268 Ga0495652_0003268_2201_2473 87
246 3300046529 Ga0495652_0488655 Ga0495652_0488655_145_411 87
247 3300046531 Ga0495665_0047488 Ga0495665_0047488_1281_1547 87
248 3300046533 Ga0495640_0098956 Ga0495640_0098956_684_950 87
249 3300046535 Ga0495586_0014326 Ga0495586_0014326_2226_2492 87
250 3300046535 Ga0495586_0244879 Ga0495586_0244879_680_946 87
251 3300046536 Ga0495587_0071684 Ga0495587_0071684_445_711 87
252 3300046543 Ga0495645_0045123 Ga0495645_0045123_1812_2084 87
253 3300046543 Ga0495645_0054818 Ga0495645_0054818_1577_1843 87
254 3300046543 Ga0495645_0859928 Ga0495645_0859928_198_464 87
255 3300046616 Ga0495668_0538471 Ga0495668_0538471_227_493 87
256 3300046642 Ga0495634_0061064 Ga0495634_0061064_19_291 87
257 3300046642 Ga0495634_0189984 Ga0495634_0189984_842_1108 87
258 3300046663 Ga0495635_0033891 Ga0495635_0033891_1571_1843 87
259 3300046663 Ga0495635_0066171 Ga0495635_0066171_810_1076 87
260 3300046674 Ga0495588_0266904 Ga0495588_0266904_203_469 87
261 3300046674 Ga0495588_0581562 Ga0495588_0581562_144_443 87
262 3300046679 Ga0495623_0026491 Ga0495623_0026491_2903_3169 87
263 3300046680 Ga0495646_0018729 Ga0495646_0018729_1290_1562 87
264 3300046680 Ga0495646_0191874 Ga0495646_0191874_384_650 87
265 3300046683 Ga0495658_0807805 Ga0495658_0807805_245_511 87
266 3300046689 Ga0495613_0205198 Ga0495613_0205198_666_932 87
267 3300046690 Ga0495624_0180502 Ga0495624_0180502_496_771 87
268 3300046691 Ga0495670_0021740 Ga0495670_0021740_605_871 87
269 3300046692 Ga0495671_0569688 Ga0495671_0569688_182_448 87
270 3300046794 Ga0495589_0392610 Ga0495589_0392610_125_391 87
271 3300047315 Ga0495581_0083003 Ga0495581_0083003_641_907 87
272 3300047315 Ga0495581_0360709 Ga0495581_0360709_273_539 87
273 3300047317 Ga0495604_0041494 Ga0495604_0041494_2500_2766 87
274 3300047317 Ga0495604_0089960 Ga0495604_0089960_445_711 87
275 3300047317 Ga0495604_0136128 Ga0495604_0136128_989_1255 87
276 3300047443 Ga0495687_050886 Ga0495687_050886_401_667 87
277 3300047444 Ga0495675_0504692 Ga0495675_0504692_319_585 87
278 3300047444 Ga0495675_0596861 Ga0495675_0596861_117_383 87
279 3300047446 Ga0495679_110918 Ga0495679_110918_78_344 87
280 3300047447 Ga0495685_000496 Ga0495685_000496_8756_9022 87
281 3300047470 Ga0495681_0014914 Ga0495681_0014914_3573_3839 87
282 3300047471 Ga0495684_0850398 Ga0495684_0850398_103_375 87
283 3300047472 Ga0495686_0155781 Ga0495686_0155781_970_1236 87
284 3300047673 Ga0495593_0083003 Ga0495593_0083003_1146_1412 87
285 3300047673 Ga0495593_0192803 Ga0495593_0192803_233_508 87
286 3300047673 Ga0495593_0712888 Ga0495593_0712888_128_394 87
287 3300048091 Ga0495626_0263777 Ga0495626_0263777_385_651 87
288 3300048905 Ga0496102_0067957 Ga0496102_0067957_1669_1935 87
289 3300048919 Ga0496116_0000224 Ga0496116_0000224_101584_101850 87
290 3300048920 Ga0496117_0074800 Ga0496117_0074800_980_1246 87
291 3300048921 Ga0496118_0028149 Ga0496118_0028149_4260_4526 87
292 3300048922 Ga0496119_0010949 Ga0496119_0010949_2905_3171 87
293 3300048923 Ga0496120_0054158 Ga0496120_0054158_1787_2053 87
294 3300049569 Ga0501032_0180754 Ga0501032_0180754_753_1019 87
295 3300049822 Ga0501035_0023964 Ga0501035_0023964_3665_3931 87
296 3300049823 Ga0501044_0526391 Ga0501044_0526391_239_505 87
297 3300053077 Ga0495601_0054952 Ga0495601_0054952_2168_2434 87
298 3300053078 Ga0495612_0008332 Ga0495612_0008332_3865_4137 87
299 3300053079 Ga0500610_0386853 Ga0500610_0386853_293_559 87
300 3300053085 Ga0495619_0027478 Ga0495619_0027478_1384_1650 87
301 3300053086 Ga0500578_0300672 Ga0500578_0300672_192_458 87
302 3300053094 Ga0500566_0118491 Ga0500566_0118491_1038_1304 87
303 3300053099 Ga0500654_033475 Ga0500654_033475_1119_1385 87
304 3300053101 Ga0500553_065288 Ga0500553_065288_1278_1544 87
305 3300053105 Ga0500557_282067 Ga0500557_282067_14_280 87
306 3300053107 Ga0500560_003175 Ga0500560_003175_788_1063 87
307 3300053109 Ga0500569_300851 Ga0500569_300851_162_428 87
308 3300053123 Ga0500614_004621 Ga0500614_004621_90_356 87
309 3300053129 Ga0500628_001538 Ga0500628_001538_2293_2559 87
310 3300053131 Ga0500652_016845 Ga0500652_016845_2338_2604 87
311 3300053134 Ga0500658_0200313 Ga0500658_0200313_69_335 87
312 3300053137 Ga0500561_0236589 Ga0500561_0236589_32_298 87
313 3300053140 Ga0500573_0068501 Ga0500573_0068501_530_805 87
314 3300053140 Ga0500573_0553024 Ga0500573_0553024_16_282 87
315 3300053142 Ga0500577_0207329 Ga0500577_0207329_549_815 87
316 3300053143 Ga0500579_081841 Ga0500579_081841_853_1119 87
317 3300053146 Ga0500588_0287378 Ga0500588_0287378_244_510 87
318 3300053149 Ga0500600_0132375 Ga0500600_0132375_638_904 87
319 3300053150 Ga0500603_172460 Ga0500603_172460_308_574 87
320 3300053153 Ga0500616_0007990 Ga0500616_0007990_553_819 87
321 3300053160 Ga0500633_0044639 Ga0500633_0044639_1195_1461 87
322 3300053161 Ga0500634_0106343 Ga0500634_0106343_162_428 87
323 3300053177 Ga0500636_0080281 Ga0500636_0080281_525_800 87
324 3300053739 Ga0500587_069614 Ga0500587_069614_80_346 87
325 iso_pu_bacteria 2902799365 2902800310 87
326 3300030521 Ga0307511_10407805 Ga0307511_104078051 88
327 3300031507 Ga0307509_10005545 Ga0307509_100055459 88
328 3300031507 Ga0307509_10030807 Ga0307509_100308074 88
329 3300031838 Ga0307518_10184284 Ga0307518_101842842 88
330 3300033179 Ga0307507_10648236 Ga0307507_106482361 88
331 3300033180 Ga0307510_10552553 Ga0307510_105525532 88
332 3300046459 Ga0495629_1146408 Ga0495629_1146408_216_485 88
333 3300046499 Ga0495594_0136541 Ga0495594_0136541_772_1077 88
334 3300046533 Ga0495640_0209947 Ga0495640_0209947_360_629 88
335 3300046663 Ga0495635_0006391 Ga0495635_0006391_7483_7752 88
336 3300046674 Ga0495588_0079881 Ga0495588_0079881_978_1247 88
337 3300046674 Ga0495588_0203676 Ga0495588_0203676_480_749 88
338 3300046683 Ga0495658_0598078 Ga0495658_0598078_132_401 88
339 3300046690 Ga0495624_0079456 Ga0495624_0079456_54_359 88
340 3300047315 Ga0495581_0108630 Ga0495581_0108630_461_730 88
341 3300049742 Ga0501080_0176297 Ga0501080_0176297_684_950 88
342 3300053085 Ga0495619_0033191 Ga0495619_0033191_2533_2802 88
343 3300053094 Ga0500566_0037844 Ga0500566_0037844_1347_1652 88
344 3300053094 Ga0500566_0201144 Ga0500566_0201144_438_707 88
345 3300053095 Ga0500640_039268 Ga0500640_039268_1350_1619 88
346 3300053101 Ga0500553_024427 Ga0500553_024427_1685_1954 88
347 3300053107 Ga0500560_026695 Ga0500560_026695_238_543 88
348 3300053107 Ga0500560_141531 Ga0500560_141531_38_307 88
349 3300053145 Ga0500586_175224 Ga0500586_175224_192_497 88
350 3300053150 Ga0500603_105942 Ga0500603_105942_35_304 88
351 3300002067 JGI24735J21928_10262872 JGI24735J21928_102628722 89
352 3300003792 Ga0055540_1000151 Ga0055540_100015117 89
353 3300003792 Ga0055540_1002619 Ga0055540_10026193 89
354 3300005327 Ga0070658_11209786 Ga0070658_112097862 89
355 3300005329 Ga0070683_100410732 Ga0070683_1004107322 89
356 3300005335 Ga0070666_10190121 Ga0070666_101901212 89
357 3300005337 Ga0070682_100028453 Ga0070682_1000284532 89
358 3300005338 Ga0068868_100572660 Ga0068868_1005726602 89
359 3300005344 Ga0070661_100338371 Ga0070661_1003383712 89
360 3300005345 Ga0070692_10435347 Ga0070692_104353472 89
361 3300005347 Ga0070668_100000135 Ga0070668_10000013543 89
362 3300005347 Ga0070668_100246617 Ga0070668_1002466172 89
363 3300005347 Ga0070668_101066142 Ga0070668_1010661421 89
364 3300005347 Ga0070668_101545761 Ga0070668_1015457611 89
365 3300005347 Ga0070668_101641947 Ga0070668_1016419471 89
366 3300005356 Ga0070674_100402110 Ga0070674_1004021102 89
367 3300005366 Ga0070659_100469314 Ga0070659_1004693141 89
368 3300005367 Ga0070667_100000042 Ga0070667_10000004219 89
369 3300005367 Ga0070667_100000274 Ga0070667_10000027434 89
370 3300005435 Ga0070714_100045388 Ga0070714_1000453884 89
371 3300005435 Ga0070714_101393875 Ga0070714_1013938752 89
372 3300005435 Ga0070714_101619788 Ga0070714_1016197882 89
373 3300005436 Ga0070713_100595319 Ga0070713_1005953192 89
374 3300005439 Ga0070711_101204552 Ga0070711_1012045521 89
375 3300005440 Ga0070705_101435470 Ga0070705_1014354701 89
376 3300005441 Ga0070700_100107259 Ga0070700_1001072592 89
377 3300005445 Ga0070708_100584824 Ga0070708_1005848242 89
378 3300005455 Ga0070663_100102737 Ga0070663_1001027372 89
379 3300005455 Ga0070663_101587118 Ga0070663_1015871181 89
380 3300005457 Ga0070662_101879226 Ga0070662_1018792262 89
381 3300005466 Ga0070685_11553285 Ga0070685_115532852 89
382 3300005535 Ga0070684_100065536 Ga0070684_1000655363 89
383 3300005544 Ga0070686_101938923 Ga0070686_1019389231 89
384 3300005546 Ga0070696_101361153 Ga0070696_1013611531 89
385 3300005547 Ga0070693_101080182 Ga0070693_1010801821 89
386 3300005548 Ga0070665_100004204 Ga0070665_10000420414 89
387 3300005548 Ga0070665_100311437 Ga0070665_1003114372 89
388 3300005548 Ga0070665_100821694 Ga0070665_1008216942 89
389 3300005548 Ga0070665_101369684 Ga0070665_1013696842 89
390 3300005548 Ga0070665_101429280 Ga0070665_1014292801 89
391 3300005549 Ga0070704_102237836 Ga0070704_1022378361 89
392 3300005578 Ga0068854_102050603 Ga0068854_1020506031 89
393 3300005615 Ga0070702_100945331 Ga0070702_1009453312 89
394 3300005617 Ga0068859_100000471 Ga0068859_1000004718 89
395 3300005617 Ga0068859_100889849 Ga0068859_1008898492 89
396 3300005617 Ga0068859_102292451 Ga0068859_1022924511 89
397 3300005618 Ga0068864_100588681 Ga0068864_1005886811 89
398 3300005618 Ga0068864_100698018 Ga0068864_1006980182 89
399 3300005719 Ga0068861_101103979 Ga0068861_1011039792 89
400 3300005840 Ga0068870_10521725 Ga0068870_105217252 89
401 3300005841 Ga0068863_100000461 Ga0068863_10000046125 89
402 3300005842 Ga0068858_100500442 Ga0068858_1005004422 89
403 3300005842 Ga0068858_100560696 Ga0068858_1005606962 89
404 3300005842 Ga0068858_101078361 Ga0068858_1010783612 89
405 3300005842 Ga0068858_101503276 Ga0068858_1015032761 89
406 3300005843 Ga0068860_100000020 Ga0068860_100000020139 89
407 3300005843 Ga0068860_100779242 Ga0068860_1007792422 89
408 3300005844 Ga0068862_100000013 Ga0068862_100000013121 89
409 3300005844 Ga0068862_101297974 Ga0068862_1012979742 89
410 3300005937 Ga0081455_10024225 Ga0081455_100242251 89
411 3300006038 Ga0075365_10074626 Ga0075365_100746263 89
412 3300006038 Ga0075365_10391308 Ga0075365_103913082 89
413 3300006042 Ga0075368_10503722 Ga0075368_105037222 89
414 3300006048 Ga0075363_100005406 Ga0075363_1000054063 89
415 3300006048 Ga0075363_100005932 Ga0075363_1000059323 89
416 3300006048 Ga0075363_100019867 Ga0075363_1000198674 89
417 3300006048 Ga0075363_100200463 Ga0075363_1002004633 89
418 3300006048 Ga0075363_100297706 Ga0075363_1002977061 89
419 3300006048 Ga0075363_100597962 Ga0075363_1005979622 89
420 3300006048 Ga0075363_100621748 Ga0075363_1006217482 89
421 3300006048 Ga0075363_100673127 Ga0075363_1006731272 89
422 3300006051 Ga0075364_10003432 Ga0075364_100034329 89
423 3300006051 Ga0075364_10014156 Ga0075364_100141565 89
424 3300006051 Ga0075364_10034551 Ga0075364_100345513 89
425 3300006051 Ga0075364_10086192 Ga0075364_100861923 89
426 3300006173 Ga0070716_100963608 Ga0070716_1009636082 89
427 3300006177 Ga0075362_10019106 Ga0075362_100191062 89
428 3300006177 Ga0075362_10157816 Ga0075362_101578162 89
429 3300006177 Ga0075362_10306135 Ga0075362_103061352 89
430 3300006177 Ga0075362_10337011 Ga0075362_103370112 89
431 3300006177 Ga0075362_10584410 Ga0075362_105844101 89
432 3300006177 Ga0075362_10617066 Ga0075362_106170661 89
433 3300006178 Ga0075367_10103437 Ga0075367_101034373 89
434 3300006178 Ga0075367_10438805 Ga0075367_104388051 89
435 3300006178 Ga0075367_10888451 Ga0075367_108884511 89
436 3300006178 Ga0075367_10952805 Ga0075367_109528052 89
437 3300006186 Ga0075369_10000373 Ga0075369_100003733 89
438 3300006186 Ga0075369_10022073 Ga0075369_100220735 89
439 3300006186 Ga0075369_10028716 Ga0075369_100287162 89
440 3300006186 Ga0075369_10035046 Ga0075369_100350462 89
441 3300006186 Ga0075369_10045729 Ga0075369_100457293 89
442 3300006186 Ga0075369_10046326 Ga0075369_100463262 89
443 3300006186 Ga0075369_10168304 Ga0075369_101683041 89
444 3300006353 Ga0075370_10003259 Ga0075370_100032592 89
445 3300006353 Ga0075370_10022515 Ga0075370_100225152 89
446 3300006353 Ga0075370_10080322 Ga0075370_100803221 89
447 3300006353 Ga0075370_10233640 Ga0075370_102336403 89
448 3300006353 Ga0075370_10405396 Ga0075370_104053962 89
449 3300006353 Ga0075370_10731034 Ga0075370_107310342 89
450 3300006353 Ga0075370_10823286 Ga0075370_108232862 89
451 3300006358 Ga0068871_101646764 Ga0068871_1016467642 89
452 3300006846 Ga0075430_100200493 Ga0075430_1002004932 89
453 3300006881 Ga0068865_100993388 Ga0068865_1009933882 89
454 3300006931 Ga0097620_100000471 Ga0097620_10000047128 89
455 3300006931 Ga0097620_100889643 Ga0097620_1008896432 89
456 3300006931 Ga0097620_102293156 Ga0097620_1022931561 89
457 3300009036 Ga0105244_10150940 Ga0105244_101509402 89
458 3300009092 Ga0105250_10023932 Ga0105250_100239324 89
459 3300009092 Ga0105250_10562437 Ga0105250_105624371 89
460 3300009094 Ga0111539_11999102 Ga0111539_119991022 89
461 3300009098 Ga0105245_10085834 Ga0105245_100858341 89
462 3300009098 Ga0105245_10712316 Ga0105245_107123162 89
463 3300009098 Ga0105245_13252537 Ga0105245_132525372 89
464 3300009101 Ga0105247_10000009 Ga0105247_10000009238 89
465 3300009101 Ga0105247_10118015 Ga0105247_101180152 89
466 3300009148 Ga0105243_10000598 Ga0105243_1000059826 89
467 3300009148 Ga0105243_10561769 Ga0105243_105617692 89
468 3300009148 Ga0105243_11656363 Ga0105243_116563632 89
469 3300009174 Ga0105241_10275985 Ga0105241_102759852 89
470 3300009177 Ga0105248_10000197 Ga0105248_1000019763 89
471 3300009545 Ga0105237_10061716 Ga0105237_100617163 89
472 3300009553 Ga0105249_10000057 Ga0105249_1000005724 89
473 3300009553 Ga0105249_11914622 Ga0105249_119146222 89
474 3300010159 Ga0099796_10006106 Ga0099796_100061063 89
475 3300010375 Ga0105239_10026275 Ga0105239_100262752 89
476 3300010375 Ga0105239_10087947 Ga0105239_100879471 89
477 3300010375 Ga0105239_10118860 Ga0105239_101188601 89
478 3300010375 Ga0105239_10394938 Ga0105239_103949382 89
479 3300010375 Ga0105239_11951386 Ga0105239_119513862 89
480 3300011119 Ga0105246_11109711 Ga0105246_111097112 89
481 3300011119 Ga0105246_11170302 Ga0105246_111703022 89
482 3300012491 Ga0157329_1026181 Ga0157329_10261811 89
483 3300013296 Ga0157374_11586542 Ga0157374_115865421 89
484 3300013306 Ga0163162_10671561 Ga0163162_106715612 89
485 3300013307 Ga0157372_11540065 Ga0157372_115400652 89
486 3300013308 Ga0157375_10225070 Ga0157375_102250702 89
487 3300013308 Ga0157375_11736707 Ga0157375_117367071 89
488 3300014325 Ga0163163_10010646 Ga0163163_100106467 89
489 3300014326 Ga0157380_11136872 Ga0157380_111368722 89
490 3300014326 Ga0157380_11284015 Ga0157380_112840151 89
491 3300014745 Ga0157377_10283700 Ga0157377_102837002 89
492 3300014968 Ga0157379_10716254 Ga0157379_107162542 89
493 3300014968 Ga0157379_11527198 Ga0157379_115271981 89
494 3300014969 Ga0157376_11908841 Ga0157376_119088412 89
495 3300017792 Ga0163161_11716767 Ga0163161_117167671 89
496 3300025303 Ga0209051_1003563 Ga0209051_10035634 89
497 3300025711 Ga0207696_1101006 Ga0207696_11010062 89
498 3300025900 Ga0207710_10000014 Ga0207710_10000014254 89
499 3300025900 Ga0207710_10320176 Ga0207710_103201762 89
500 3300025901 Ga0207688_10163062 Ga0207688_101630622 89
501 3300025903 Ga0207680_10091100 Ga0207680_100911001 89
502 3300025904 Ga0207647_10404704 Ga0207647_104047042 89
503 3300025906 Ga0207699_10633728 Ga0207699_106337282 89
504 3300025908 Ga0207643_10200708 Ga0207643_102007081 89
505 3300025909 Ga0207705_10778383 Ga0207705_107783831 89
506 3300025911 Ga0207654_10539073 Ga0207654_105390732 89
507 3300025914 Ga0207671_10040113 Ga0207671_100401133 89
508 3300025920 Ga0207649_10627625 Ga0207649_106276252 89
509 3300025923 Ga0207681_10005666 Ga0207681_100056669 89
510 3300025929 Ga0207664_10025334 Ga0207664_100253346 89
511 3300025929 Ga0207664_10075031 Ga0207664_100750312 89
512 3300025932 Ga0207690_11199894 Ga0207690_111998942 89
513 3300025933 Ga0207706_11295728 Ga0207706_112957282 89
514 3300025935 Ga0207709_10002071 Ga0207709_100020719 89
515 3300025935 Ga0207709_11014946 Ga0207709_110149461 89
516 3300025937 Ga0207669_10412504 Ga0207669_104125042 89
517 3300025938 Ga0207704_10381250 Ga0207704_103812501 89
518 3300025939 Ga0207665_10706556 Ga0207665_107065562 89
519 3300025941 Ga0207711_10000146 Ga0207711_100001468 89
520 3300025961 Ga0207712_10000050 Ga0207712_10000050132 89
521 3300025961 Ga0207712_11139535 Ga0207712_111395351 89
522 3300025972 Ga0207668_10000867 Ga0207668_100008677 89
523 3300025972 Ga0207668_10581840 Ga0207668_105818402 89
524 3300025972 Ga0207668_11008683 Ga0207668_110086832 89
525 3300025986 Ga0207658_10000423 Ga0207658_1000042311 89
526 3300025986 Ga0207658_10000540 Ga0207658_1000054016 89
527 3300026023 Ga0207677_10319257 Ga0207677_103192572 89
528 3300026035 Ga0207703_10125009 Ga0207703_101250093 89
529 3300026035 Ga0207703_10299081 Ga0207703_102990812 89
530 3300026035 Ga0207703_11027484 Ga0207703_110274842 89
531 3300026035 Ga0207703_12218416 Ga0207703_122184161 89
532 3300026041 Ga0207639_10962036 Ga0207639_109620361 89
533 3300026067 Ga0207678_10068893 Ga0207678_100688933 89
534 3300026067 Ga0207678_10767648 Ga0207678_107676481 89
535 3300026075 Ga0207708_10560550 Ga0207708_105605502 89
536 3300026088 Ga0207641_10000613 Ga0207641_1000061324 89
537 3300026095 Ga0207676_10409403 Ga0207676_104094032 89
538 3300026095 Ga0207676_11956270 Ga0207676_119562701 89
539 3300026118 Ga0207675_101813949 Ga0207675_1018139492 89
540 3300026121 Ga0207683_10893913 Ga0207683_108939132 89
541 3300028379 Ga0268266_10018590 Ga0268266_100185902 89
542 3300028379 Ga0268266_10374901 Ga0268266_103749012 89
543 3300028379 Ga0268266_10958213 Ga0268266_109582132 89
544 3300028380 Ga0268265_10000004 Ga0268265_10000004132 89
545 3300028380 Ga0268265_12327120 Ga0268265_123271201 89
546 3300028381 Ga0268264_10000024 Ga0268264_10000024131 89
547 3300028381 Ga0268264_10844471 Ga0268264_108444712 89
548 3300031251 Ga0265327_10000069 Ga0265327_1000006956 89
549 3300031251 Ga0265327_10001438 Ga0265327_100014386 89
550 3300031251 Ga0265327_10019782 Ga0265327_100197825 89
551 3300031251 Ga0265327_10327421 Ga0265327_103274211 89
552 3300031824 Ga0307413_11888227 Ga0307413_118882272 89
553 3300031824 Ga0307413_11981530 Ga0307413_119815301 89
554 3300031852 Ga0307410_10306619 Ga0307410_103066192 89
555 3300031901 Ga0307406_11228063 Ga0307406_112280631 89
556 3300031901 Ga0307406_11860367 Ga0307406_118603671 89
557 3300031995 Ga0307409_100379638 Ga0307409_1003796382 89
558 3300031995 Ga0307409_101765499 Ga0307409_1017654991 89
559 3300032002 Ga0307416_102453787 Ga0307416_1024537872 89
560 3300032004 Ga0307414_11100675 Ga0307414_111006752 89
561 3300032005 Ga0307411_10820447 Ga0307411_108204472 89
562 3300032126 Ga0307415_100388882 Ga0307415_1003888823 89
563 3300032126 Ga0307415_100559446 Ga0307415_1005594461 89
564 3300035121 Ga0373960_0161396 Ga0373960_0161396_207_476 89
565 3300039447 Ga0436361_0252756 Ga0436361_0252756_45_314 89
566 3300041410 Ga0439461_0000249 Ga0439461_0000249_1364_1633 89
567 3300041410 Ga0439461_0052714 Ga0439461_0052714_225_494 89
568 3300041410 Ga0439461_0083337 Ga0439461_0083337_19_288 89
569 3300041411 Ga0439466_0000731 Ga0439466_0000731_969_1238 89
570 3300041411 Ga0439466_0034022 Ga0439466_0034022_1312_1581 89
571 3300041411 Ga0439466_0159818 Ga0439466_0159818_27_296 89
572 3300041413 Ga0439465_0006081 Ga0439465_0006081_1310_1579 89
573 3300041413 Ga0439465_0007513 Ga0439465_0007513_1192_1461 89
574 3300041413 Ga0439465_0093910 Ga0439465_0093910_670_939 89
575 3300041443 Ga0451789_0123174 Ga0451789_0123174_115_387 89
576 3300041453 Ga0451797_0476086 Ga0451797_0476086_213_482 89
577 3300041458 Ga0451798_1141269 Ga0451798_1141269_318_587 89
578 3300041459 Ga0451800_0113281 Ga0451800_0113281_60_335 89
579 3300041460 Ga0451802_0131784 Ga0451802_0131784_91_360 89
580 3300041460 Ga0451802_1390458 Ga0451802_1390458_50_319 89
581 3300041491 Ga0451833_1288190 Ga0451833_1288190_349_618 89
582 3300041494 Ga0451837_1558681 Ga0451837_1558681_162_431 89
583 3300041498 Ga0451841_0221605 Ga0451841_0221605_85_354 89
584 3300041503 Ga0451847_0332780 Ga0451847_0332780_152_421 89
585 3300041512 Ga0451853_0580394 Ga0451853_0580394_867_1136 89
586 3300041997 Ga0439431_0132154 Ga0439431_0132154_230_499 89
587 3300042004 Ga0439445_0001278 Ga0439445_0001278_260_529 89
588 3300042004 Ga0439445_0062953 Ga0439445_0062953_185_454 89
589 3300042435 Ga0439434_0014178 Ga0439434_0014178_1027_1296 89
590 3300042435 Ga0439434_0082490 Ga0439434_0082490_309_578 89
591 3300042438 Ga0439459_0019225 Ga0439459_0019225_338_607 89
592 3300044658 Ga0466972_0331971 Ga0466972_0331971_15_284 89
593 3300044658 Ga0466972_0551732 Ga0466972_0551732_49_318 89
594 3300044683 Ga0466965_0117270 Ga0466965_0117270_75_344 89
595 3300044706 Ga0466964_0574706 Ga0466964_0574706_221_490 89
596 3300044735 Ga0466968_0001212 Ga0466968_0001212_2350_2619 89
597 3300044765 Ga0466970_0182169 Ga0466970_0182169_376_645 89
598 3300044842 Ga0466957_0594013 Ga0466957_0594013_57_326 89
599 3300044901 Ga0466960_0040240 Ga0466960_0040240_1906_2175 89
600 3300045049 Ga0466959_0146553 Ga0466959_0146553_699_968 89
601 3300045976 Ga0466967_0129620 Ga0466967_0129620_1001_1270 89
602 3300045976 Ga0466967_0989430 Ga0466967_0989430_189_458 89
603 3300045976 Ga0466967_1341909 Ga0466967_1341909_282_551 89
604 3300046455 Ga0495603_0066746 Ga0495603_0066746_1421_1690 89
605 3300046455 Ga0495603_0890677 Ga0495603_0890677_168_437 89
606 3300046459 Ga0495629_0339864 Ga0495629_0339864_153_422 89
607 3300046460 Ga0495638_0000703 Ga0495638_0000703_25218_25487 89
608 3300046460 Ga0495638_0021521 Ga0495638_0021521_2088_2357 89
609 3300046460 Ga0495638_0094292 Ga0495638_0094292_1370_1639 89
610 3300046460 Ga0495638_0170814 Ga0495638_0170814_35_304 89
611 3300046461 Ga0495641_0059507 Ga0495641_0059507_726_995 89
612 3300046472 Ga0495580_0415094 Ga0495580_0415094_372_641 89
613 3300046472 Ga0495580_0483604 Ga0495580_0483604_188_457 89
614 3300046473 Ga0495582_0250240 Ga0495582_0250240_100_369 89
615 3300046475 Ga0495639_0110399 Ga0495639_0110399_582_851 89
616 3300046506 Ga0495583_0318590 Ga0495583_0318590_325_594 89
617 3300046506 Ga0495583_0334764 Ga0495583_0334764_238_513 89
618 3300046517 Ga0495630_1170586 Ga0495630_1170586_124_393 89
619 3300046524 Ga0495648_0008525 Ga0495648_0008525_3190_3465 89
620 3300046524 Ga0495648_0019522 Ga0495648_0019522_61_330 89
621 3300046524 Ga0495648_0288433 Ga0495648_0288433_333_602 89
622 3300046530 Ga0495654_0015950 Ga0495654_0015950_3113_3382 89
623 3300046530 Ga0495654_0058658 Ga0495654_0058658_11_280 89
624 3300046530 Ga0495654_0064436 Ga0495654_0064436_996_1271 89
625 3300046531 Ga0495665_0027770 Ga0495665_0027770_984_1253 89
626 3300046531 Ga0495665_0120258 Ga0495665_0120258_149_418 89
627 3300046533 Ga0495640_0377725 Ga0495640_0377725_51_320 89
628 3300046535 Ga0495586_0796234 Ga0495586_0796234_251_520 89
629 3300046557 Ga0495622_0320885 Ga0495622_0320885_72_341 89
630 3300046616 Ga0495668_0012128 Ga0495668_0012128_3823_4092 89
631 3300046616 Ga0495668_0082396 Ga0495668_0082396_1142_1411 89
632 3300046642 Ga0495634_0384440 Ga0495634_0384440_540_809 89
633 3300046648 Ga0495611_0054878 Ga0495611_0054878_837_1106 89
634 3300046648 Ga0495611_0082247 Ga0495611_0082247_589_864 89
635 3300046674 Ga0495588_0096591 Ga0495588_0096591_1176_1445 89
636 3300046674 Ga0495588_0366651 Ga0495588_0366651_161_430 89
637 3300046683 Ga0495658_0158081 Ga0495658_0158081_256_525 89
638 3300046690 Ga0495624_0115614 Ga0495624_0115614_390_659 89
639 3300046690 Ga0495624_0243802 Ga0495624_0243802_233_502 89
640 3300046692 Ga0495671_0278343 Ga0495671_0278343_154_429 89
641 3300046694 Ga0495649_0085277 Ga0495649_0085277_1016_1285 89
642 3300046694 Ga0495649_0481648 Ga0495649_0481648_148_417 89
643 3300047315 Ga0495581_0121613 Ga0495581_0121613_1137_1406 89
644 3300047315 Ga0495581_0129659 Ga0495581_0129659_679_948 89
645 3300047319 Ga0495674_0490042 Ga0495674_0490042_257_526 89
646 3300047320 Ga0495672_0001616 Ga0495672_0001616_18522_18797 89
647 3300047320 Ga0495672_0006905 Ga0495672_0006905_3473_3742 89
648 3300047320 Ga0495672_0006953 Ga0495672_0006953_3593_3862 89
649 3300047320 Ga0495672_0034185 Ga0495672_0034185_588_857 89
650 3300047320 Ga0495672_0425406 Ga0495672_0425406_92_361 89
651 3300047321 Ga0495676_0436429 Ga0495676_0436429_263_532 89
652 3300047469 Ga0495673_0000243 Ga0495673_0000243_74009_74278 89
653 3300047469 Ga0495673_0036202 Ga0495673_0036202_1112_1381 89
654 3300047469 Ga0495673_0043455 Ga0495673_0043455_403_678 89
655 3300047472 Ga0495686_0008407 Ga0495686_0008407_4059_4328 89
656 3300047673 Ga0495593_0656649 Ga0495593_0656649_48_317 89
657 3300048903 Ga0496100_0000092 Ga0496100_0000092_46219_46488 89
658 3300048903 Ga0496100_0034053 Ga0496100_0034053_183_452 89
659 3300048903 Ga0496100_0044602 Ga0496100_0044602_47_316 89
660 3300048903 Ga0496100_0072521 Ga0496100_0072521_835_1104 89
661 3300048904 Ga0496101_0000018 Ga0496101_0000018_46093_46362 89
662 3300048904 Ga0496101_0000247 Ga0496101_0000247_34212_34481 89
663 3300048904 Ga0496101_0013241 Ga0496101_0013241_4556_4825 89
664 3300048904 Ga0496101_1002349 Ga0496101_1002349_231_500 89
665 3300048904 Ga0496101_1047407 Ga0496101_1047407_64_333 89
666 3300048905 Ga0496102_0000239 Ga0496102_0000239_33133_33402 89
667 3300048905 Ga0496102_0000417 Ga0496102_0000417_45877_46146 89
668 3300048905 Ga0496102_0064190 Ga0496102_0064190_583_852 89
669 3300048905 Ga0496102_0148879 Ga0496102_0148879_535_804 89
670 3300048905 Ga0496102_0200133 Ga0496102_0200133_430_699 89
671 3300048905 Ga0496102_0745557 Ga0496102_0745557_338_607 89
672 3300048906 Ga0496103_0000148 Ga0496103_0000148_33676_33945 89
673 3300048906 Ga0496103_0000727 Ga0496103_0000727_2284_2553 89
674 3300048906 Ga0496103_0000795 Ga0496103_0000795_15536_15805 89
675 3300048906 Ga0496103_0415652 Ga0496103_0415652_224_493 89
676 3300048906 Ga0496103_0423891 Ga0496103_0423891_94_363 89
677 3300048907 Ga0496104_0900185 Ga0496104_0900185_346_615 89
678 3300048907 Ga0496104_1032431 Ga0496104_1032431_431_700 89
679 3300048907 Ga0496104_1354495 Ga0496104_1354495_309_578 89
680 3300048909 Ga0496106_0020980 Ga0496106_0020980_4297_4566 89
681 3300048909 Ga0496106_0099680 Ga0496106_0099680_636_905 89
682 3300048909 Ga0496106_0177922 Ga0496106_0177922_27_296 89
683 3300048910 Ga0496107_0000367 Ga0496107_0000367_19682_19951 89
684 3300048910 Ga0496107_0009963 Ga0496107_0009963_4934_5203 89
685 3300048910 Ga0496107_0156006 Ga0496107_0156006_692_961 89
686 3300048911 Ga0496108_0001617 Ga0496108_0001617_5527_5796 89
687 3300048911 Ga0496108_0071966 Ga0496108_0071966_500_769 89
688 3300048911 Ga0496108_0413260 Ga0496108_0413260_165_434 89
689 3300048911 Ga0496108_0470473 Ga0496108_0470473_464_733 89
690 3300048912 Ga0496109_0000688 Ga0496109_0000688_23434_23703 89
691 3300048912 Ga0496109_0012643 Ga0496109_0012643_5404_5673 89
692 3300048912 Ga0496109_0127838 Ga0496109_0127838_637_906 89
693 3300048912 Ga0496109_0306795 Ga0496109_0306795_18_287 89
694 3300048913 Ga0496110_0000316 Ga0496110_0000316_11118_11387 89
695 3300048913 Ga0496110_0366965 Ga0496110_0366965_1008_1277 89
696 3300048913 Ga0496110_1076514 Ga0496110_1076514_389_658 89
697 3300048914 Ga0496111_0820465 Ga0496111_0820465_305_574 89
698 3300048914 Ga0496111_0909230 Ga0496111_0909230_188_457 89
699 3300048915 Ga0496112_0011082 Ga0496112_0011082_2975_3244 89
700 3300048915 Ga0496112_0120571 Ga0496112_0120571_846_1115 89
701 3300048916 Ga0496113_1061851 Ga0496113_1061851_54_323 89
702 3300048916 Ga0496113_1145636 Ga0496113_1145636_109_378 89
703 3300048916 Ga0496113_1297639 Ga0496113_1297639_194_463 89
704 3300048916 Ga0496113_1462638 Ga0496113_1462638_26_295 89
705 3300048917 Ga0496114_0000353 Ga0496114_0000353_6199_6468 89
706 3300048918 Ga0496115_0236643 Ga0496115_0236643_715_984 89
707 3300048918 Ga0496115_0813994 Ga0496115_0813994_352_621 89
708 3300048919 Ga0496116_0000355 Ga0496116_0000355_38566_38835 89
709 3300048919 Ga0496116_0005548 Ga0496116_0005548_9523_9792 89
710 3300048919 Ga0496116_0014633 Ga0496116_0014633_2464_2733 89
711 3300048920 Ga0496117_0000051 Ga0496117_0000051_252299_252568 89
712 3300048920 Ga0496117_0000909 Ga0496117_0000909_16612_16881 89
713 3300048920 Ga0496117_0012107 Ga0496117_0012107_5673_5942 89
714 3300048920 Ga0496117_0099125 Ga0496117_0099125_1306_1575 89
715 3300048920 Ga0496117_0265821 Ga0496117_0265821_185_454 89
716 3300048921 Ga0496118_0000043 Ga0496118_0000043_252299_252568 89
717 3300048921 Ga0496118_0000324 Ga0496118_0000324_44646_44915 89
718 3300048921 Ga0496118_0002530 Ga0496118_0002530_10398_10667 89
719 3300048921 Ga0496118_0046458 Ga0496118_0046458_2198_2467 89
720 3300048921 Ga0496118_0404747 Ga0496118_0404747_293_562 89
721 3300048922 Ga0496119_0000990 Ga0496119_0000990_23246_23515 89
722 3300048922 Ga0496119_0003073 Ga0496119_0003073_9191_9460 89
723 3300048922 Ga0496119_0029615 Ga0496119_0029615_1975_2244 89
724 3300048922 Ga0496119_0130880 Ga0496119_0130880_396_665 89
725 3300048923 Ga0496120_0009746 Ga0496120_0009746_4832_5101 89
726 3300048923 Ga0496120_0014292 Ga0496120_0014292_1141_1410 89
727 3300048923 Ga0496120_0192780 Ga0496120_0192780_57_326 89
728 3300048924 Ga0496121_0000023 Ga0496121_0000023_407143_407412 89
729 3300048924 Ga0496121_0000924 Ga0496121_0000924_29651_29920 89
730 3300048924 Ga0496121_0002322 Ga0496121_0002322_9657_9926 89
731 3300048924 Ga0496121_0555430 Ga0496121_0555430_150_419 89
732 3300048925 Ga0496122_0000164 Ga0496122_0000164_111480_111749 89
733 3300048925 Ga0496122_0246220 Ga0496122_0246220_643_912 89
734 3300048926 Ga0496123_0003496 Ga0496123_0003496_15978_16247 89
735 3300048927 Ga0496124_0000014 Ga0496124_0000014_407143_407412 89
736 3300048927 Ga0496124_0523991 Ga0496124_0523991_404_673 89
737 3300048928 Ga0496125_0000020 Ga0496125_0000020_56037_56306 89
738 3300048928 Ga0496125_0079216 Ga0496125_0079216_969_1238 89
739 3300048928 Ga0496125_0081795 Ga0496125_0081795_1352_1621 89
740 3300048928 Ga0496125_0116487 Ga0496125_0116487_370_639 89
741 3300048928 Ga0496125_0327620 Ga0496125_0327620_328_597 89
742 3300048929 Ga0496126_0000023 Ga0496126_0000023_407143_407412 89
743 3300048929 Ga0496126_0002171 Ga0496126_0002171_1333_1602 89
744 3300048929 Ga0496126_0521685 Ga0496126_0521685_524_793 89
745 3300048929 Ga0496126_0521688 Ga0496126_0521688_154_423 89
746 3300049569 Ga0501032_0001214 Ga0501032_0001214_12334_12603 89
747 3300049569 Ga0501032_0001214 Ga0501032_0001214_7543_7812 89
748 3300049569 Ga0501032_0002928 Ga0501032_0002928_4340_4609 89
749 3300049571 Ga0501034_0001356 Ga0501034_0001356_20002_20271 89
750 3300049571 Ga0501034_0002853 Ga0501034_0002853_11835_12104 89
751 3300049571 Ga0501034_0002853 Ga0501034_0002853_7044_7313 89
752 3300049572 Ga0501036_0002465 Ga0501036_0002465_4804_5073 89
753 3300049572 Ga0501036_0002465 Ga0501036_0002465_9595_9864 89
754 3300049572 Ga0501036_0054599 Ga0501036_0054599_2011_2280 89
755 3300049573 Ga0501037_0000220 Ga0501037_0000220_8540_8809 89
756 3300049573 Ga0501037_0001017 Ga0501037_0001017_12851_13120 89
757 3300049573 Ga0501037_0001017 Ga0501037_0001017_8060_8329 89
758 3300049574 Ga0501038_0000980 Ga0501038_0000980_11861_12130 89
759 3300049574 Ga0501038_0001589 Ga0501038_0001589_14262_14531 89
760 3300049574 Ga0501038_0001589 Ga0501038_0001589_9471_9740 89
761 3300049575 Ga0501039_0000976 Ga0501039_0000976_12873_13142 89
762 3300049575 Ga0501039_0000976 Ga0501039_0000976_8082_8351 89
763 3300049575 Ga0501039_0001608 Ga0501039_0001608_643_912 89
764 3300049577 Ga0501041_0795914 Ga0501041_0795914_127_396 89
765 3300049579 Ga0501043_0001421 Ga0501043_0001421_12873_13142 89
766 3300049579 Ga0501043_0001421 Ga0501043_0001421_8082_8351 89
767 3300049579 Ga0501043_0008835 Ga0501043_0008835_1722_1991 89
768 3300049580 Ga0501046_0139616 Ga0501046_0139616_1287_1556 89
769 3300049581 Ga0501047_0260279 Ga0501047_0260279_584_853 89
770 3300049581 Ga0501047_1115258 Ga0501047_1115258_73_342 89
771 3300049581 Ga0501047_1216277 Ga0501047_1216277_152_421 89
772 3300049583 Ga0501067_0059179 Ga0501067_0059179_307_576 89
773 3300049584 Ga0501068_0872432 Ga0501068_0872432_196_465 89
774 3300049585 Ga0501069_0732925 Ga0501069_0732925_312_581 89
775 3300049586 Ga0501070_0001619 Ga0501070_0001619_11880_12149 89
776 3300049586 Ga0501070_0001619 Ga0501070_0001619_7089_7358 89
777 3300049586 Ga0501070_0064844 Ga0501070_0064844_1105_1374 89
778 3300049587 Ga0501071_0019804 Ga0501071_0019804_1923_2192 89
779 3300049589 Ga0501073_0008348 Ga0501073_0008348_7203_7472 89
780 3300049589 Ga0501073_0012643 Ga0501073_0012643_2628_2897 89
781 3300049593 Ga0501077_0058401 Ga0501077_0058401_248_517 89
782 3300049741 Ga0501079_0226620 Ga0501079_0226620_1014_1283 89
783 3300049823 Ga0501044_0003636 Ga0501044_0003636_11623_11892 89
784 3300049823 Ga0501044_0003636 Ga0501044_0003636_6832_7101 89
785 3300049823 Ga0501044_0007721 Ga0501044_0007721_9465_9734 89
786 3300049823 Ga0501044_0041282 Ga0501044_0041282_2876_3145 89
787 3300049824 Ga0501045_1431833 Ga0501045_1431833_11_280 89
788 3300050489 nmdc:mga03683_122053_c1 nmdc:mga03683_122053_c1_208_477 89
789 3300050489 nmdc:mga03683_296190_c1 nmdc:mga03683_296190_c1_107_376 89
790 3300050489 nmdc:mga03683_322237_c1 nmdc:mga03683_322237_c1_131_400 89
791 3300050489 nmdc:mga03683_517832_c1 nmdc:mga03683_517832_c1_277_546 89
792 3300050489 nmdc:mga03683_57907_c1 nmdc:mga03683_57907_c1_731_1000 89
793 3300050490 nmdc:mga03n38_126437_c1 nmdc:mga03n38_126437_c1_446_715 89
794 3300050490 nmdc:mga03n38_20349_c1 nmdc:mga03n38_20349_c1_1025_1294 89
795 3300050490 nmdc:mga03n38_233450_c1 nmdc:mga03n38_233450_c1_64_333 89
796 3300050490 nmdc:mga03n38_38933_c1 nmdc:mga03n38_38933_c1_1082_1351 89
797 3300050490 nmdc:mga03n38_49574_c1 nmdc:mga03n38_49574_c1_967_1236 89
798 3300050490 nmdc:mga03n38_765_c2 nmdc:mga03n38_765_c2_6008_6277 89
799 3300050490 nmdc:mga03n38_822836_c1 nmdc:mga03n38_822836_c1_69_338 89
800 3300050490 nmdc:mga03n38_86562_c1 nmdc:mga03n38_86562_c1_638_907 89
801 3300050491 nmdc:mga00v17_143978_c1 nmdc:mga00v17_143978_c1_734_1003 89
802 3300050491 nmdc:mga00v17_267515_c1 nmdc:mga00v17_267515_c1_732_1001 89
803 3300050491 nmdc:mga00v17_2753_c1 nmdc:mga00v17_2753_c1_5398_5667 89
804 3300050491 nmdc:mga00v17_2964_c1 nmdc:mga00v17_2964_c1_7744_8013 89
805 3300050491 nmdc:mga00v17_428857_c1 nmdc:mga00v17_428857_c1_58_327 89
806 3300050491 nmdc:mga00v17_664666_c1 nmdc:mga00v17_664666_c1_349_618 89
807 3300050491 nmdc:mga00v17_991052_c1 nmdc:mga00v17_991052_c1_232_501 89
808 3300050492 nmdc:mga0yw44_141077_c1 nmdc:mga0yw44_141077_c1_39_308 89
809 3300050492 nmdc:mga0yw44_314841_c1 nmdc:mga0yw44_314841_c1_233_502 89
810 3300050492 nmdc:mga0yw44_901224_c1 nmdc:mga0yw44_901224_c1_219_488 89
811 3300050494 nmdc:mga06z11_212214_c1 nmdc:mga06z11_212214_c1_460_729 89
812 3300050494 nmdc:mga06z11_359481_c1 nmdc:mga06z11_359481_c1_583_852 89
813 3300050496 nmdc:mga07m45_17718_c1 nmdc:mga07m45_17718_c1_3213_3482 89
814 3300050496 nmdc:mga07m45_259506_c1 nmdc:mga07m45_259506_c1_178_450 89
815 3300050496 nmdc:mga07m45_265485_c1 nmdc:mga07m45_265485_c1_457_726 89
816 3300050496 nmdc:mga07m45_297351_c1 nmdc:mga07m45_297351_c1_106_375 89
817 3300050496 nmdc:mga07m45_54135_c1 nmdc:mga07m45_54135_c1_544_813 89
818 3300050496 nmdc:mga07m45_73289_c1 nmdc:mga07m45_73289_c1_511_780 89
819 3300050496 nmdc:mga07m45_76649_c1 nmdc:mga07m45_76649_c1_905_1174 89
820 3300050509 nmdc:mga0qj67_191131_c1 nmdc:mga0qj67_191131_c1_1048_1317 89
821 3300050511 nmdc:mga08y16_1255093_c1 nmdc:mga08y16_1255093_c1_141_410 89
822 3300050516 nmdc:mga0sz30_1570_c3 nmdc:mga0sz30_1570_c3_423_692 89
823 3300050516 nmdc:mga0sz30_184738_c1 nmdc:mga0sz30_184738_c1_146_415 89
824 3300050516 nmdc:mga0sz30_185756_c1 nmdc:mga0sz30_185756_c1_239_508 89
825 3300050516 nmdc:mga0sz30_196062_c2 nmdc:mga0sz30_196062_c2_248_517 89
826 3300050516 nmdc:mga0sz30_3198_c1 nmdc:mga0sz30_3198_c1_3959_4228 89
827 3300050516 nmdc:mga0sz30_3903_c2 nmdc:mga0sz30_3903_c2_1212_1487 89
828 3300050516 nmdc:mga0sz30_44034_c1 nmdc:mga0sz30_44034_c1_749_1018 89
829 3300050516 nmdc:mga0sz30_49002_c1 nmdc:mga0sz30_49002_c1_417_686 89
830 3300050516 nmdc:mga0sz30_593234_c1 nmdc:mga0sz30_593234_c1_114_383 89
831 3300050516 nmdc:mga0sz30_79124_c1 nmdc:mga0sz30_79124_c1_353_622 89
832 3300053080 Ga0500635_0010410 Ga0500635_0010410_805_1074 89
833 3300053087 Ga0500643_015487 Ga0500643_015487_1294_1563 89
834 3300053089 Ga0500581_158927 Ga0500581_158927_268_537 89
835 3300053096 Ga0500641_0095792 Ga0500641_0095792_134_403 89
836 3300053096 Ga0500641_0108825 Ga0500641_0108825_611_880 89
837 3300053098 Ga0500650_0239772 Ga0500650_0239772_157_432 89
838 3300053104 Ga0500556_0004758 Ga0500556_0004758_2447_2716 89
839 3300053108 Ga0500562_029104 Ga0500562_029104_232_501 89
840 3300053119 Ga0500595_022551 Ga0500595_022551_180_449 89
841 3300053122 Ga0500608_145397 Ga0500608_145397_550_819 89
842 3300053123 Ga0500614_003215 Ga0500614_003215_3065_3346 89
843 3300053129 Ga0500628_130111 Ga0500628_130111_396_665 89
844 3300053131 Ga0500652_000813 Ga0500652_000813_5948_6217 89
845 3300053131 Ga0500652_083240 Ga0500652_083240_298_567 89
846 3300053134 Ga0500658_0031952 Ga0500658_0031952_1609_1878 89
847 3300053136 Ga0500559_0075300 Ga0500559_0075300_197_466 89
848 3300053138 Ga0500564_250523 Ga0500564_250523_65_334 89
849 3300053146 Ga0500588_0171020 Ga0500588_0171020_447_716 89
850 3300053178 Ga0500637_0534790 Ga0500637_0534790_150_419 89
851 3300053730 Ga0500645_000004 Ga0500645_000004_291448_291717 89
852 3300053730 Ga0500645_000057 Ga0500645_000057_49594_49863 89
853 3300053730 Ga0500645_000988 Ga0500645_000988_9780_10049 89
854 3300061719 Ga0466962_0357367 Ga0466962_0357367_134_403 89
855 iso_pu_bacteria 2939582691 2939587606 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02583

Trns_repr_metal

Metal-sensitive transcriptional repressor

19

99

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b87-assembly1.cif.gz_A-2 crystal structure of transmembrane protein tmhc2_e 0.8904 8 58
6b87-assembly2.cif.gz_B-3 crystal structure of transmembrane protein tmhc2_e 0.8748 8 58
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.8724 10 64
6wa9-assembly1.cif.gz_T structure of the chlamydia pneumoniae cdsv and cdso protein complex 0.8702 6 63
8cws-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.8225 8 59
ID Description Score Start End Superfamily
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.889 2 51 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.8856 2 51 4.10.860.20
af_Q0IZV2_506_799_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8453 6 60 1.20.1270.60
af_A0A1D6M4L8_452_775_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8287 6 61 1.20.1270.60
af_I1MM63_213_618_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8204 11 70 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A356JXN1-F1-model_v4 Metal-sensitive transcriptional repressor 0.914 1 62 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A399EMS7-F1-model_v4 Metal-sensitive transcriptional repressor 0.9083 1 59 GO:0003677
GO:0045892
GO:0046872
AF-A0A350TLH5-F1-model_v4 CsoR family transcriptional regulator 0.9054 1 62 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A4U9CZE0-F1-model_v4 Transcriptional repressor FrmR 0.892 1 63 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A522VW15-F1-model_v4 Transcriptional regulator 0.8677 1 62 GO:0003677
GO:0045892
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.72 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map