F483611
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 855 | 412 | 809 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_101393875|Ga0070714_1013938752 |
| Length | 101 |
| Sequence | MLDLNTQAKGTTMVGDEESIAAVLNRLRRAQGQLAGVISMIEQGRDCKDVVTQLAAVSRALDRAGFKIVATGLRECLAGNAEDGRAPMTEAELEKLFLSLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 4 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 5 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 6 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 7 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 8 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 9 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 10 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 13 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 14 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 15 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 16 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 17 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 18 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 19 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 20 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 21 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 22 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 23 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 24 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 25 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 26 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 27 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 28 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 29 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 30 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 31 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 32 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 33 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 34 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 35 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 36 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 37 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 169 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 184 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 203 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 204 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 211 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 212 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 213 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 221 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 224 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 315 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 316 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 317 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 318 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 319 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 322 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 323 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 372 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 373 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 375 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 377 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 378 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 379 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 381 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 383 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 384 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 385 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 386 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 388 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 389 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 390 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 391 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 393 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 396 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 398 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 399 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 400 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 401 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 404 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.32 |
| Metatranscriptomes | 0.35 |
| Isolates | 4.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 16.73 |
| Nodule | 0.12 |
| Rhizoplane | 7.37 |
| Rhizosphere | 65.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10262872 | 3300002067 | Bacteria | 504 |
| 2 | rootH2_10014701 | 3300003320 | Bacteria | 1893 |
| 3 | Ga0055540_1000151 | 3300003792 | Bacteria | 68564 |
| 4 | Ga0055540_1002619 | 3300003792 | Bacteria | 9341 |
| 5 | Ga0070658_11209786 | 3300005327 | Bacteria | 657 |
| 6 | Ga0070683_100410732 | 3300005329 | Bacteria | 1291 |
| 7 | Ga0070683_100785096 | 3300005329 | Bacteria | 913 |
| 8 | Ga0070666_10190121 | 3300005335 | Bacteria | 1442 |
| 9 | Ga0070680_101475501 | 3300005336 | Bacteria | 589 |
| 10 | Ga0070682_100028453 | 3300005337 | Bacteria | 3361 |
| 11 | Ga0068868_100572660 | 3300005338 | Bacteria | 998 |
| 12 | Ga0070661_100338371 | 3300005344 | Bacteria | 1178 |
| 13 | Ga0070692_10435347 | 3300005345 | Bacteria | 836 |
| 14 | Ga0070668_100000135 | 3300005347 | Bacteria | 46315 |
| 15 | Ga0070668_100246617 | 3300005347 | Bacteria | 1481 |
| 16 | Ga0070668_101066142 | 3300005347 | Bacteria | 728 |
| 17 | Ga0070668_101545761 | 3300005347 | Bacteria | 607 |
| 18 | Ga0070668_101641947 | 3300005347 | Bacteria | 589 |
| 19 | Ga0070674_100402110 | 3300005356 | Bacteria | 1119 |
| 20 | Ga0070659_100469314 | 3300005366 | Bacteria | 1070 |
| 21 | Ga0070667_100000042 | 3300005367 | Bacteria | 168902 |
| 22 | Ga0070667_100000274 | 3300005367 | Bacteria | 58415 |
| 23 | Ga0070709_10012787 | 3300005434 | Bacteria | 4704 |
| 24 | Ga0070714_100001652 | 3300005435 | Bacteria | 16228 |
| 25 | Ga0070714_100045388 | 3300005435 | Bacteria | 3724 |
| 26 | Ga0070714_101393875 | 3300005435 | Bacteria | 684 |
| 27 | Ga0070714_101619788 | 3300005435 | Bacteria | 632 |
| 28 | Ga0070713_100301110 | 3300005436 | Bacteria | 1476 |
| 29 | Ga0070713_100595319 | 3300005436 | Bacteria | 1050 |
| 30 | Ga0070710_10016786 | 3300005437 | Bacteria | 3733 |
| 31 | Ga0070711_101204552 | 3300005439 | Bacteria | 655 |
| 32 | Ga0070705_101435470 | 3300005440 | Bacteria | 576 |
| 33 | Ga0070700_100107259 | 3300005441 | Bacteria | 1851 |
| 34 | Ga0070708_100584824 | 3300005445 | Bacteria | 1053 |
| 35 | Ga0070663_100102737 | 3300005455 | Bacteria | 2136 |
| 36 | Ga0070663_101587118 | 3300005455 | Bacteria | 583 |
| 37 | Ga0070662_101879226 | 3300005457 | Bacteria | 517 |
| 38 | Ga0070685_11553285 | 3300005466 | Bacteria | 511 |
| 39 | Ga0070706_101941089 | 3300005467 | Bacteria | 534 |
| 40 | Ga0070679_100205942 | 3300005530 | Bacteria | 1932 |
| 41 | Ga0070684_100065536 | 3300005535 | Bacteria | 3188 |
| 42 | Ga0070686_101938923 | 3300005544 | Bacteria | 503 |
| 43 | Ga0070696_101361153 | 3300005546 | Bacteria | 604 |
| 44 | Ga0070693_101080182 | 3300005547 | Bacteria | 611 |
| 45 | Ga0070665_100004204 | 3300005548 | Bacteria | 15154 |
| 46 | Ga0070665_100311437 | 3300005548 | Bacteria | 1578 |
| 47 | Ga0070665_100821694 | 3300005548 | Bacteria | 942 |
| 48 | Ga0070665_101369684 | 3300005548 | Bacteria | 717 |
| 49 | Ga0070665_101429280 | 3300005548 | Bacteria | 701 |
| 50 | Ga0070704_102237836 | 3300005549 | Bacteria | 508 |
| 51 | Ga0068854_102050603 | 3300005578 | Bacteria | 528 |
| 52 | Ga0070702_100945331 | 3300005615 | Bacteria | 678 |
| 53 | Ga0068859_100000471 | 3300005617 | Bacteria | 39733 |
| 54 | Ga0068859_100889849 | 3300005617 | Bacteria | 975 |
| 55 | Ga0068859_102292451 | 3300005617 | Bacteria | 595 |
| 56 | Ga0068864_100588681 | 3300005618 | Bacteria | 1079 |
| 57 | Ga0068864_100698018 | 3300005618 | Bacteria | 991 |
| 58 | Ga0068861_101103979 | 3300005719 | Bacteria | 762 |
| 59 | Ga0068870_10521725 | 3300005840 | Bacteria | 795 |
| 60 | Ga0068863_100000461 | 3300005841 | Bacteria | 41485 |
| 61 | Ga0068858_100500442 | 3300005842 | Bacteria | 1174 |
| 62 | Ga0068858_100560696 | 3300005842 | Bacteria | 1106 |
| 63 | Ga0068858_101078361 | 3300005842 | Bacteria | 788 |
| 64 | Ga0068858_101503276 | 3300005842 | Bacteria | 664 |
| 65 | Ga0068860_100000020 | 3300005843 | Bacteria | 283324 |
| 66 | Ga0068860_100779242 | 3300005843 | Bacteria | 969 |
| 67 | Ga0068862_100000013 | 3300005844 | Bacteria | 263115 |
| 68 | Ga0068862_101297974 | 3300005844 | Bacteria | 729 |
| 69 | Ga0081455_10024225 | 3300005937 | Bacteria | 5627 |
| 70 | Ga0075365_10074626 | 3300006038 | Bacteria | 2287 |
| 71 | Ga0075365_10391308 | 3300006038 | Bacteria | 981 |
| 72 | Ga0075368_10503722 | 3300006042 | Bacteria | 541 |
| 73 | Ga0075363_100005406 | 3300006048 | Bacteria | 5677 |
| 74 | Ga0075363_100005932 | 3300006048 | Bacteria | 5505 |
| 75 | Ga0075363_100019867 | 3300006048 | Bacteria | 3363 |
| 76 | Ga0075363_100200463 | 3300006048 | Bacteria | 1140 |
| 77 | Ga0075363_100297706 | 3300006048 | Bacteria | 936 |
| 78 | Ga0075363_100597962 | 3300006048 | Bacteria | 661 |
| 79 | Ga0075363_100621748 | 3300006048 | Bacteria | 648 |
| 80 | Ga0075363_100673127 | 3300006048 | Bacteria | 624 |
| 81 | Ga0075364_10003432 | 3300006051 | Bacteria | 9008 |
| 82 | Ga0075364_10014156 | 3300006051 | Bacteria | 4923 |
| 83 | Ga0075364_10034551 | 3300006051 | Bacteria | 3262 |
| 84 | Ga0075364_10086192 | 3300006051 | Bacteria | 2080 |
| 85 | Ga0070716_100881368 | 3300006173 | Bacteria | 699 |
| 86 | Ga0070716_100963608 | 3300006173 | Bacteria | 672 |
| 87 | Ga0070712_100005080 | 3300006175 | Bacteria | 8149 |
| 88 | Ga0075362_10019106 | 3300006177 | Bacteria | 2846 |
| 89 | Ga0075362_10157816 | 3300006177 | Bacteria | 1091 |
| 90 | Ga0075362_10306135 | 3300006177 | Bacteria | 789 |
| 91 | Ga0075362_10337011 | 3300006177 | Bacteria | 753 |
| 92 | Ga0075362_10584410 | 3300006177 | Bacteria | 576 |
| 93 | Ga0075362_10617066 | 3300006177 | Bacteria | 561 |
| 94 | Ga0075367_10103437 | 3300006178 | Bacteria | 1743 |
| 95 | Ga0075367_10438805 | 3300006178 | Bacteria | 827 |
| 96 | Ga0075367_10888451 | 3300006178 | Bacteria | 568 |
| 97 | Ga0075367_10952805 | 3300006178 | Bacteria | 548 |
| 98 | Ga0075369_10000373 | 3300006186 | Bacteria | 13427 |
| 99 | Ga0075369_10022073 | 3300006186 | Bacteria | 2623 |
| 100 | Ga0075369_10028716 | 3300006186 | Bacteria | 2333 |
| 101 | Ga0075369_10035046 | 3300006186 | Bacteria | 2132 |
| 102 | Ga0075369_10045729 | 3300006186 | Bacteria | 1883 |
| 103 | Ga0075369_10046326 | 3300006186 | Bacteria | 1872 |
| 104 | Ga0075369_10168304 | 3300006186 | Bacteria | 1006 |
| 105 | Ga0075370_10003259 | 3300006353 | Bacteria | 7692 |
| 106 | Ga0075370_10022515 | 3300006353 | Bacteria | 3461 |
| 107 | Ga0075370_10080322 | 3300006353 | Bacteria | 1874 |
| 108 | Ga0075370_10233640 | 3300006353 | Bacteria | 1088 |
| 109 | Ga0075370_10405396 | 3300006353 | Bacteria | 818 |
| 110 | Ga0075370_10731034 | 3300006353 | Bacteria | 602 |
| 111 | Ga0075370_10823286 | 3300006353 | Bacteria | 566 |
| 112 | Ga0068871_101646764 | 3300006358 | Bacteria | 608 |
| 113 | Ga0075430_100200493 | 3300006846 | Bacteria | 1657 |
| 114 | Ga0068865_100993388 | 3300006881 | Bacteria | 734 |
| 115 | Ga0097620_100000471 | 3300006931 | Bacteria | 39733 |
| 116 | Ga0097620_100889643 | 3300006931 | Bacteria | 975 |
| 117 | Ga0097620_102293156 | 3300006931 | Bacteria | 595 |
| 118 | Ga0105244_10150940 | 3300009036 | Bacteria | 1113 |
| 119 | Ga0105250_10023932 | 3300009092 | Bacteria | 2462 |
| 120 | Ga0105250_10562437 | 3300009092 | Bacteria | 524 |
| 121 | Ga0111539_11999102 | 3300009094 | Bacteria | 672 |
| 122 | Ga0105245_10085834 | 3300009098 | Bacteria | 2886 |
| 123 | Ga0105245_10712316 | 3300009098 | Bacteria | 1037 |
| 124 | Ga0105245_13252537 | 3300009098 | Bacteria | 503 |
| 125 | Ga0105247_10000009 | 3300009101 | Bacteria | 385991 |
| 126 | Ga0105247_10118015 | 3300009101 | Bacteria | 1716 |
| 127 | Ga0105243_10000598 | 3300009148 | Bacteria | 36100 |
| 128 | Ga0105243_10561769 | 3300009148 | Bacteria | 1092 |
| 129 | Ga0105243_11656363 | 3300009148 | Bacteria | 668 |
| 130 | Ga0105241_10275985 | 3300009174 | Bacteria | 1434 |
| 131 | Ga0105248_10000197 | 3300009177 | Bacteria | 70131 |
| 132 | Ga0105237_10061716 | 3300009545 | Bacteria | 3747 |
| 133 | Ga0105237_12451415 | 3300009545 | Bacteria | 532 |
| 134 | Ga0105238_11577667 | 3300009551 | Bacteria | 686 |
| 135 | Ga0105249_10000057 | 3300009553 | Bacteria | 159358 |
| 136 | Ga0105249_10000893 | 3300009553 | Bacteria | 26438 |
| 137 | Ga0105249_11914622 | 3300009553 | Bacteria | 666 |
| 138 | Ga0099796_10006106 | 3300010159 | Bacteria | 3063 |
| 139 | Ga0105239_10026275 | 3300010375 | Bacteria | 6409 |
| 140 | Ga0105239_10087947 | 3300010375 | Bacteria | 3425 |
| 141 | Ga0105239_10118860 | 3300010375 | Bacteria | 2933 |
| 142 | Ga0105239_10394938 | 3300010375 | Bacteria | 1565 |
| 143 | Ga0105239_11951386 | 3300010375 | Bacteria | 681 |
| 144 | Ga0105246_11109711 | 3300011119 | Bacteria | 723 |
| 145 | Ga0105246_11170302 | 3300011119 | Bacteria | 706 |
| 146 | Ga0157329_1026181 | 3300012491 | Bacteria | 580 |
| 147 | Ga0157369_11159480 | 3300013105 | Bacteria | 789 |
| 148 | Ga0157374_11586542 | 3300013296 | Bacteria | 678 |
| 149 | Ga0163162_10671561 | 3300013306 | Bacteria | 1159 |
| 150 | Ga0157372_10495502 | 3300013307 | Bacteria | 1425 |
| 151 | Ga0157372_11540065 | 3300013307 | Bacteria | 766 |
| 152 | Ga0157375_10225070 | 3300013308 | Bacteria | 2035 |
| 153 | Ga0157375_11736707 | 3300013308 | Bacteria | 739 |
| 154 | Ga0157375_12069732 | 3300013308 | Bacteria | 677 |
| 155 | Ga0163163_10010646 | 3300014325 | Bacteria | 8288 |
| 156 | Ga0157380_11136872 | 3300014326 | Bacteria | 822 |
| 157 | Ga0157380_11284015 | 3300014326 | Bacteria | 779 |
| 158 | Ga0157377_10283700 | 3300014745 | Bacteria | 1086 |
| 159 | Ga0157379_10716254 | 3300014968 | Bacteria | 940 |
| 160 | Ga0157379_11527198 | 3300014968 | Bacteria | 650 |
| 161 | Ga0157379_11833539 | 3300014968 | Bacteria | 596 |
| 162 | Ga0157376_11908841 | 3300014969 | Bacteria | 631 |
| 163 | Ga0157376_12071362 | 3300014969 | Bacteria | 607 |
| 164 | Ga0163161_11716767 | 3300017792 | Bacteria | 556 |
| 165 | Ga0206352_10194983 | 3300020078 | Bacteria | 800 |
| 166 | Ga0154015_1673388 | 3300020610 | Bacteria | 511 |
| 167 | Ga0224712_10096383 | 3300022467 | Bacteria | 1247 |
| 168 | Ga0209051_1000075 | 3300025303 | Bacteria | 205011 |
| 169 | Ga0209051_1003563 | 3300025303 | Bacteria | 10122 |
| 170 | Ga0207696_1101006 | 3300025711 | Bacteria | 785 |
| 171 | Ga0207692_10450457 | 3300025898 | Bacteria | 810 |
| 172 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 173 | Ga0207710_10320176 | 3300025900 | Bacteria | 786 |
| 174 | Ga0207688_10163062 | 3300025901 | Bacteria | 1322 |
| 175 | Ga0207688_10447529 | 3300025901 | Bacteria | 805 |
| 176 | Ga0207680_10091100 | 3300025903 | Bacteria | 1940 |
| 177 | Ga0207647_10295835 | 3300025904 | Bacteria | 922 |
| 178 | Ga0207647_10404704 | 3300025904 | Bacteria | 769 |
| 179 | Ga0207699_10008608 | 3300025906 | Bacteria | 5044 |
| 180 | Ga0207699_10633728 | 3300025906 | Bacteria | 780 |
| 181 | Ga0207643_10200708 | 3300025908 | Bacteria | 1214 |
| 182 | Ga0207705_10778383 | 3300025909 | Bacteria | 743 |
| 183 | Ga0207654_10539073 | 3300025911 | Bacteria | 828 |
| 184 | Ga0207671_10040113 | 3300025914 | Bacteria | 3466 |
| 185 | Ga0207660_10339002 | 3300025917 | Bacteria | 1203 |
| 186 | Ga0207649_10627625 | 3300025920 | Bacteria | 829 |
| 187 | Ga0207681_10005666 | 3300025923 | Bacteria | 7667 |
| 188 | Ga0207700_10327227 | 3300025928 | Bacteria | 1329 |
| 189 | Ga0207664_10006955 | 3300025929 | Bacteria | 7826 |
| 190 | Ga0207664_10025334 | 3300025929 | Bacteria | 4467 |
| 191 | Ga0207664_10075031 | 3300025929 | Bacteria | 2733 |
| 192 | Ga0207690_11199894 | 3300025932 | Bacteria | 633 |
| 193 | Ga0207706_11295728 | 3300025933 | Bacteria | 602 |
| 194 | Ga0207709_10002071 | 3300025935 | Bacteria | 12954 |
| 195 | Ga0207709_11014946 | 3300025935 | Bacteria | 679 |
| 196 | Ga0207669_10412504 | 3300025937 | Bacteria | 1061 |
| 197 | Ga0207704_10381250 | 3300025938 | Bacteria | 1107 |
| 198 | Ga0207665_10706556 | 3300025939 | Bacteria | 793 |
| 199 | Ga0207711_10000146 | 3300025941 | Bacteria | 74464 |
| 200 | Ga0207712_10000050 | 3300025961 | Bacteria | 159469 |
| 201 | Ga0207712_10394382 | 3300025961 | Bacteria | 1162 |
| 202 | Ga0207712_11139535 | 3300025961 | Bacteria | 695 |
| 203 | Ga0207668_10000867 | 3300025972 | Bacteria | 18255 |
| 204 | Ga0207668_10581840 | 3300025972 | Bacteria | 973 |
| 205 | Ga0207668_11008683 | 3300025972 | Bacteria | 744 |
| 206 | Ga0207658_10000423 | 3300025986 | Bacteria | 40097 |
| 207 | Ga0207658_10000540 | 3300025986 | Bacteria | 34297 |
| 208 | Ga0207677_10319257 | 3300026023 | Bacteria | 1290 |
| 209 | Ga0207703_10125009 | 3300026035 | Bacteria | 2213 |
| 210 | Ga0207703_10299081 | 3300026035 | Bacteria | 1467 |
| 211 | Ga0207703_11027484 | 3300026035 | Bacteria | 791 |
| 212 | Ga0207703_12218416 | 3300026035 | Bacteria | 525 |
| 213 | Ga0207639_10962036 | 3300026041 | Bacteria | 799 |
| 214 | Ga0207678_10068893 | 3300026067 | Bacteria | 3034 |
| 215 | Ga0207678_10767648 | 3300026067 | Bacteria | 850 |
| 216 | Ga0207708_10560550 | 3300026075 | Bacteria | 964 |
| 217 | Ga0207641_10000613 | 3300026088 | Bacteria | 39118 |
| 218 | Ga0207676_10409403 | 3300026095 | Bacteria | 1269 |
| 219 | Ga0207676_11956270 | 3300026095 | Bacteria | 585 |
| 220 | Ga0207675_101813949 | 3300026118 | Bacteria | 629 |
| 221 | Ga0207683_10893913 | 3300026121 | Bacteria | 825 |
| 222 | Ga0268266_10018590 | 3300028379 | Bacteria | 5922 |
| 223 | Ga0268266_10374901 | 3300028379 | Bacteria | 1341 |
| 224 | Ga0268266_10958213 | 3300028379 | Bacteria | 828 |
| 225 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 226 | Ga0268265_12327120 | 3300028380 | Bacteria | 542 |
| 227 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 228 | Ga0268264_10844471 | 3300028381 | Bacteria | 917 |
| 229 | Ga0307517_10017918 | 3300028786 | Bacteria | 9191 |
| 230 | Ga0307511_10204626 | 3300030521 | Bacteria | 1018 |
| 231 | Ga0307511_10407805 | 3300030521 | Bacteria | 555 |
| 232 | Ga0265327_10000069 | 3300031251 | Bacteria | 217784 |
| 233 | Ga0265327_10001438 | 3300031251 | Bacteria | 30041 |
| 234 | Ga0265327_10019782 | 3300031251 | Bacteria | 4125 |
| 235 | Ga0265327_10327421 | 3300031251 | Bacteria | 671 |
| 236 | Ga0307509_10005545 | 3300031507 | Bacteria | 17503 |
| 237 | Ga0307509_10030807 | 3300031507 | Bacteria | 5930 |
| 238 | Ga0307509_10047201 | 3300031507 | Bacteria | 4633 |
| 239 | Ga0307509_10454459 | 3300031507 | Bacteria | 974 |
| 240 | Ga0307408_100611372 | 3300031548 | Bacteria | 970 |
| 241 | Ga0307514_10169161 | 3300031649 | Bacteria | 1431 |
| 242 | Ga0316575_10107901 | 3300031665 | Bacteria | 1135 |
| 243 | Ga0307516_10388557 | 3300031730 | Bacteria | 1056 |
| 244 | Ga0307516_10447551 | 3300031730 | Bacteria | 948 |
| 245 | Ga0307405_10452489 | 3300031731 | Bacteria | 1018 |
| 246 | Ga0307405_11705939 | 3300031731 | Bacteria | 558 |
| 247 | Ga0307413_10151373 | 3300031824 | Bacteria | 1617 |
| 248 | Ga0307413_11888227 | 3300031824 | Bacteria | 536 |
| 249 | Ga0307413_11981530 | 3300031824 | Bacteria | 524 |
| 250 | Ga0307518_10184284 | 3300031838 | Bacteria | 1407 |
| 251 | Ga0307518_10217378 | 3300031838 | Bacteria | 1251 |
| 252 | Ga0307410_10064909 | 3300031852 | Bacteria | 2510 |
| 253 | Ga0307410_10221531 | 3300031852 | Bacteria | 1456 |
| 254 | Ga0307410_10306619 | 3300031852 | Bacteria | 1255 |
| 255 | Ga0307410_11655704 | 3300031852 | Bacteria | 566 |
| 256 | Ga0307406_10832805 | 3300031901 | Bacteria | 781 |
| 257 | Ga0307406_10993005 | 3300031901 | Bacteria | 720 |
| 258 | Ga0307406_11228063 | 3300031901 | Bacteria | 652 |
| 259 | Ga0307406_11860367 | 3300031901 | Bacteria | 536 |
| 260 | Ga0307407_11033082 | 3300031903 | Bacteria | 636 |
| 261 | Ga0307412_12263855 | 3300031911 | Bacteria | 507 |
| 262 | Ga0307409_100057515 | 3300031995 | Bacteria | 3014 |
| 263 | Ga0307409_100077870 | 3300031995 | Bacteria | 2665 |
| 264 | Ga0307409_100303772 | 3300031995 | Bacteria | 1486 |
| 265 | Ga0307409_100379638 | 3300031995 | Bacteria | 1343 |
| 266 | Ga0307409_100510306 | 3300031995 | Bacteria | 1173 |
| 267 | Ga0307409_101765499 | 3300031995 | Bacteria | 648 |
| 268 | Ga0307416_102453787 | 3300032002 | Bacteria | 620 |
| 269 | Ga0307414_10144368 | 3300032004 | Bacteria | 1868 |
| 270 | Ga0307414_11100675 | 3300032004 | Bacteria | 734 |
| 271 | Ga0307411_10820447 | 3300032005 | Bacteria | 821 |
| 272 | Ga0307411_11164077 | 3300032005 | Bacteria | 698 |
| 273 | Ga0307415_100231938 | 3300032126 | Bacteria | 1487 |
| 274 | Ga0307415_100388882 | 3300032126 | Bacteria | 1187 |
| 275 | Ga0307415_100559446 | 3300032126 | Bacteria | 1011 |
| 276 | Ga0307507_10284885 | 3300033179 | Bacteria | 1029 |
| 277 | Ga0307507_10648236 | 3300033179 | Bacteria | 536 |
| 278 | Ga0307510_10241242 | 3300033180 | Bacteria | 1301 |
| 279 | Ga0307510_10552553 | 3300033180 | Bacteria | 598 |
| 280 | Ga0373934_0001480 | 3300035086 | Bacteria | 8616 |
| 281 | Ga0373923_0003291 | 3300035111 | Bacteria | 5155 |
| 282 | Ga0373936_0207360 | 3300035113 | Bacteria | 866 |
| 283 | Ga0373953_0004185 | 3300035117 | Bacteria | 4578 |
| 284 | Ga0373954_0019649 | 3300035118 | Bacteria | 3049 |
| 285 | Ga0373956_0001640 | 3300035119 | Bacteria | 9220 |
| 286 | Ga0373957_0006197 | 3300035120 | Bacteria | 3758 |
| 287 | Ga0373960_0161396 | 3300035121 | Bacteria | 772 |
| 288 | Ga0373946_0598720 | 3300035171 | Bacteria | 571 |
| 289 | Ga0373924_0004028 | 3300035410 | Bacteria | 5105 |
| 290 | Ga0373933_0006960 | 3300035724 | Bacteria | 6163 |
| 291 | Ga0373937_0032958 | 3300036401 | Bacteria | 4700 |
| 292 | Ga0395900_0092294 | 3300037418 | Bacteria | 3111 |
| 293 | Ga0395898_0043522 | 3300037466 | Bacteria | 4424 |
| 294 | Ga0395905_0722368 | 3300037471 | Bacteria | 898 |
| 295 | Ga0395901_0196097 | 3300038443 | Bacteria | 2117 |
| 296 | Ga0436361_0252756 | 3300039447 | Bacteria | 2012 |
| 297 | Ga0439461_0000249 | 3300041410 | Bacteria | 7675 |
| 298 | Ga0439461_0052714 | 3300041410 | Bacteria | 906 |
| 299 | Ga0439461_0083337 | 3300041410 | Bacteria | 757 |
| 300 | Ga0439466_0000731 | 3300041411 | Bacteria | 12437 |
| 301 | Ga0439466_0034022 | 3300041411 | Bacteria | 1729 |
| 302 | Ga0439466_0159818 | 3300041411 | Bacteria | 689 |
| 303 | Ga0439465_0006081 | 3300041413 | Bacteria | 3837 |
| 304 | Ga0439465_0007513 | 3300041413 | Bacteria | 3464 |
| 305 | Ga0439465_0093910 | 3300041413 | Bacteria | 1029 |
| 306 | Ga0451789_0123174 | 3300041443 | Bacteria | 514 |
| 307 | Ga0451797_0476086 | 3300041453 | Bacteria | 675 |
| 308 | Ga0451798_1141269 | 3300041458 | Bacteria | 694 |
| 309 | Ga0451800_0113281 | 3300041459 | Bacteria | 513 |
| 310 | Ga0451800_0426569 | 3300041459 | Bacteria | 1284 |
| 311 | Ga0451802_0131784 | 3300041460 | Bacteria | 529 |
| 312 | Ga0451802_1390458 | 3300041460 | Bacteria | 672 |
| 313 | Ga0451802_2080905 | 3300041460 | Bacteria | 1218 |
| 314 | Ga0451833_1288190 | 3300041491 | Bacteria | 797 |
| 315 | Ga0451837_1558681 | 3300041494 | Bacteria | 663 |
| 316 | Ga0451837_1582673 | 3300041494 | Bacteria | 606 |
| 317 | Ga0451841_0221605 | 3300041498 | Bacteria | 600 |
| 318 | Ga0451847_0332780 | 3300041503 | Bacteria | 729 |
| 319 | Ga0451847_0676306 | 3300041503 | Bacteria | 643 |
| 320 | Ga0451853_0038446 | 3300041512 | Bacteria | 2559 |
| 321 | Ga0451853_0580394 | 3300041512 | Bacteria | 1255 |
| 322 | Ga0439431_0086436 | 3300041997 | Bacteria | 850 |
| 323 | Ga0439431_0132154 | 3300041997 | Bacteria | 701 |
| 324 | Ga0439442_098970 | 3300042002 | Bacteria | 630 |
| 325 | Ga0439445_0001278 | 3300042004 | Bacteria | 5449 |
| 326 | Ga0439445_0062953 | 3300042004 | Bacteria | 1017 |
| 327 | Ga0439449_0408523 | 3300042007 | Bacteria | 515 |
| 328 | Ga0439446_0048867 | 3300042156 | Bacteria | 1260 |
| 329 | Ga0439434_0014178 | 3300042435 | Bacteria | 2371 |
| 330 | Ga0439434_0076795 | 3300042435 | Bacteria | 1056 |
| 331 | Ga0439434_0082490 | 3300042435 | Bacteria | 1021 |
| 332 | Ga0439459_0019225 | 3300042438 | Bacteria | 1292 |
| 333 | Ga0466969_0010944 | 3300044656 | Bacteria | 4804 |
| 334 | Ga0466972_0331971 | 3300044658 | Bacteria | 711 |
| 335 | Ga0466972_0551732 | 3300044658 | Bacteria | 543 |
| 336 | Ga0466965_0117270 | 3300044683 | Bacteria | 1372 |
| 337 | Ga0466966_0007607 | 3300044684 | Bacteria | 7179 |
| 338 | Ga0466961_0117841 | 3300044693 | Bacteria | 1668 |
| 339 | Ga0466961_0758272 | 3300044693 | Bacteria | 580 |
| 340 | Ga0466963_0627570 | 3300044694 | Bacteria | 759 |
| 341 | Ga0466964_0574706 | 3300044706 | Bacteria | 615 |
| 342 | Ga0466968_0001212 | 3300044735 | Bacteria | 9134 |
| 343 | Ga0466970_0182169 | 3300044765 | Bacteria | 1165 |
| 344 | Ga0466970_0334821 | 3300044765 | Bacteria | 857 |
| 345 | Ga0466957_0594013 | 3300044842 | Bacteria | 774 |
| 346 | Ga0466957_0675201 | 3300044842 | Bacteria | 728 |
| 347 | Ga0466960_0040240 | 3300044901 | Bacteria | 2209 |
| 348 | Ga0466959_0038359 | 3300045049 | Bacteria | 3540 |
| 349 | Ga0466959_0146553 | 3300045049 | Bacteria | 1665 |
| 350 | Ga0466967_0129620 | 3300045976 | Bacteria | 2340 |
| 351 | Ga0466967_0989430 | 3300045976 | Bacteria | 837 |
| 352 | Ga0466967_1341909 | 3300045976 | Bacteria | 712 |
| 353 | Ga0495592_0016686 | 3300046454 | Bacteria | 5573 |
| 354 | Ga0495592_0023605 | 3300046454 | Bacteria | 4678 |
| 355 | Ga0495592_0061579 | 3300046454 | Bacteria | 2757 |
| 356 | Ga0495592_0099107 | 3300046454 | Bacteria | 2079 |
| 357 | Ga0495603_0066746 | 3300046455 | Bacteria | 2119 |
| 358 | Ga0495603_0642203 | 3300046455 | Bacteria | 607 |
| 359 | Ga0495603_0890677 | 3300046455 | Bacteria | 506 |
| 360 | Ga0495629_0012064 | 3300046459 | Bacteria | 6264 |
| 361 | Ga0495629_0144108 | 3300046459 | Bacteria | 1657 |
| 362 | Ga0495629_0169068 | 3300046459 | Bacteria | 1518 |
| 363 | Ga0495629_0339864 | 3300046459 | Bacteria | 1025 |
| 364 | Ga0495629_1146408 | 3300046459 | Bacteria | 501 |
| 365 | Ga0495638_0000703 | 3300046460 | Bacteria | 36244 |
| 366 | Ga0495638_0021521 | 3300046460 | Bacteria | 4247 |
| 367 | Ga0495638_0094292 | 3300046460 | Bacteria | 1799 |
| 368 | Ga0495638_0170814 | 3300046460 | Bacteria | 1247 |
| 369 | Ga0495641_0019456 | 3300046461 | Bacteria | 3472 |
| 370 | Ga0495641_0059507 | 3300046461 | Bacteria | 1727 |
| 371 | Ga0495641_0085904 | 3300046461 | Bacteria | 1408 |
| 372 | Ga0495651_0006062 | 3300046462 | Bacteria | 9231 |
| 373 | Ga0495651_0025606 | 3300046462 | Bacteria | 4593 |
| 374 | Ga0495653_0025974 | 3300046463 | Bacteria | 4699 |
| 375 | Ga0495580_0350017 | 3300046472 | Bacteria | 1001 |
| 376 | Ga0495580_0415094 | 3300046472 | Bacteria | 906 |
| 377 | Ga0495580_0483604 | 3300046472 | Bacteria | 828 |
| 378 | Ga0495582_0034662 | 3300046473 | Bacteria | 2774 |
| 379 | Ga0495582_0131685 | 3300046473 | Bacteria | 1413 |
| 380 | Ga0495582_0250240 | 3300046473 | Bacteria | 1016 |
| 381 | Ga0495639_0110399 | 3300046475 | Bacteria | 1305 |
| 382 | Ga0495639_0122506 | 3300046475 | Bacteria | 1241 |
| 383 | Ga0495662_0048716 | 3300046476 | Bacteria | 2045 |
| 384 | Ga0495662_0089675 | 3300046476 | Bacteria | 1498 |
| 385 | Ga0495664_0003965 | 3300046477 | Bacteria | 8078 |
| 386 | Ga0495664_0138212 | 3300046477 | Bacteria | 1476 |
| 387 | Ga0495664_0272753 | 3300046477 | Bacteria | 1022 |
| 388 | Ga0495585_0131476 | 3300046492 | Bacteria | 1317 |
| 389 | Ga0495594_0136541 | 3300046499 | Bacteria | 1390 |
| 390 | Ga0495594_0158154 | 3300046499 | Bacteria | 1287 |
| 391 | Ga0495594_0814536 | 3300046499 | Bacteria | 526 |
| 392 | Ga0495583_0318590 | 3300046506 | Bacteria | 616 |
| 393 | Ga0495583_0334764 | 3300046506 | Bacteria | 598 |
| 394 | Ga0495608_0011148 | 3300046511 | Bacteria | 6258 |
| 395 | Ga0495618_0015230 | 3300046514 | Bacteria | 4691 |
| 396 | Ga0495618_0186191 | 3300046514 | Bacteria | 1318 |
| 397 | Ga0495620_0341627 | 3300046515 | Bacteria | 568 |
| 398 | Ga0495628_0019029 | 3300046516 | Bacteria | 5681 |
| 399 | Ga0495628_0027174 | 3300046516 | Bacteria | 4658 |
| 400 | Ga0495628_0125953 | 3300046516 | Bacteria | 1962 |
| 401 | Ga0495630_0033150 | 3300046517 | Bacteria | 3851 |
| 402 | Ga0495630_0472146 | 3300046517 | Bacteria | 961 |
| 403 | Ga0495630_1170586 | 3300046517 | Bacteria | 582 |
| 404 | Ga0495643_0017059 | 3300046522 | Bacteria | 4254 |
| 405 | Ga0495648_0008525 | 3300046524 | Bacteria | 8053 |
| 406 | Ga0495648_0019522 | 3300046524 | Bacteria | 4763 |
| 407 | Ga0495648_0288433 | 3300046524 | Bacteria | 774 |
| 408 | Ga0495666_0011433 | 3300046526 | Bacteria | 4423 |
| 409 | Ga0495666_0065617 | 3300046526 | Bacteria | 1731 |
| 410 | Ga0495666_0112900 | 3300046526 | Bacteria | 1276 |
| 411 | Ga0495652_0003268 | 3300046529 | Bacteria | 16146 |
| 412 | Ga0495652_0033397 | 3300046529 | Bacteria | 4491 |
| 413 | Ga0495652_0488655 | 3300046529 | Bacteria | 855 |
| 414 | Ga0495654_0015950 | 3300046530 | Bacteria | 3981 |
| 415 | Ga0495654_0058658 | 3300046530 | Bacteria | 1856 |
| 416 | Ga0495654_0064436 | 3300046530 | Bacteria | 1752 |
| 417 | Ga0495665_0024791 | 3300046531 | Bacteria | 3222 |
| 418 | Ga0495665_0027770 | 3300046531 | Bacteria | 3037 |
| 419 | Ga0495665_0047488 | 3300046531 | Bacteria | 2277 |
| 420 | Ga0495665_0120258 | 3300046531 | Bacteria | 1376 |
| 421 | Ga0495640_0022762 | 3300046533 | Bacteria | 4576 |
| 422 | Ga0495640_0098956 | 3300046533 | Bacteria | 1916 |
| 423 | Ga0495640_0209947 | 3300046533 | Bacteria | 1231 |
| 424 | Ga0495640_0377725 | 3300046533 | Bacteria | 872 |
| 425 | Ga0495586_0014326 | 3300046535 | Bacteria | 4213 |
| 426 | Ga0495586_0244879 | 3300046535 | Bacteria | 1022 |
| 427 | Ga0495586_0796234 | 3300046535 | Bacteria | 545 |
| 428 | Ga0495587_0006874 | 3300046536 | Bacteria | 7395 |
| 429 | Ga0495587_0071684 | 3300046536 | Bacteria | 2014 |
| 430 | Ga0495645_0045123 | 3300046543 | Bacteria | 3216 |
| 431 | Ga0495645_0054818 | 3300046543 | Bacteria | 2895 |
| 432 | Ga0495645_0414120 | 3300046543 | Bacteria | 856 |
| 433 | Ga0495645_0859928 | 3300046543 | Bacteria | 541 |
| 434 | Ga0495622_0320885 | 3300046557 | Bacteria | 673 |
| 435 | Ga0495668_0012128 | 3300046616 | Bacteria | 5125 |
| 436 | Ga0495668_0082396 | 3300046616 | Bacteria | 1765 |
| 437 | Ga0495668_0538471 | 3300046616 | Bacteria | 644 |
| 438 | Ga0495634_0015689 | 3300046642 | Bacteria | 5434 |
| 439 | Ga0495634_0061064 | 3300046642 | Bacteria | 2507 |
| 440 | Ga0495634_0189984 | 3300046642 | Bacteria | 1281 |
| 441 | Ga0495634_0384440 | 3300046642 | Bacteria | 836 |
| 442 | Ga0495611_0054878 | 3300046648 | Bacteria | 1802 |
| 443 | Ga0495611_0082247 | 3300046648 | Bacteria | 1482 |
| 444 | Ga0495635_0006391 | 3300046663 | Bacteria | 8212 |
| 445 | Ga0495635_0029809 | 3300046663 | Bacteria | 3794 |
| 446 | Ga0495635_0033891 | 3300046663 | Bacteria | 3542 |
| 447 | Ga0495635_0066171 | 3300046663 | Bacteria | 2478 |
| 448 | Ga0495588_0079881 | 3300046674 | Bacteria | 1707 |
| 449 | Ga0495588_0096591 | 3300046674 | Bacteria | 1550 |
| 450 | Ga0495588_0203676 | 3300046674 | Bacteria | 1045 |
| 451 | Ga0495588_0266904 | 3300046674 | Bacteria | 902 |
| 452 | Ga0495588_0366651 | 3300046674 | Bacteria | 757 |
| 453 | Ga0495588_0581562 | 3300046674 | Bacteria | 587 |
| 454 | Ga0495657_0032318 | 3300046675 | Bacteria | 3652 |
| 455 | Ga0495599_0016021 | 3300046678 | Bacteria | 4651 |
| 456 | Ga0495623_0026491 | 3300046679 | Bacteria | 3732 |
| 457 | Ga0495623_0026593 | 3300046679 | Bacteria | 3723 |
| 458 | Ga0495646_0006111 | 3300046680 | Bacteria | 7633 |
| 459 | Ga0495646_0018729 | 3300046680 | Bacteria | 4385 |
| 460 | Ga0495646_0191874 | 3300046680 | Bacteria | 1116 |
| 461 | Ga0495658_0158081 | 3300046683 | Bacteria | 1396 |
| 462 | Ga0495658_0598078 | 3300046683 | Bacteria | 707 |
| 463 | Ga0495658_0807805 | 3300046683 | Bacteria | 600 |
| 464 | Ga0495613_0018634 | 3300046689 | Bacteria | 5176 |
| 465 | Ga0495613_0205198 | 3300046689 | Bacteria | 1388 |
| 466 | Ga0495613_0567562 | 3300046689 | Bacteria | 758 |
| 467 | Ga0495624_0079456 | 3300046690 | Bacteria | 2034 |
| 468 | Ga0495624_0115614 | 3300046690 | Bacteria | 1649 |
| 469 | Ga0495624_0158686 | 3300046690 | Bacteria | 1382 |
| 470 | Ga0495624_0180502 | 3300046690 | Bacteria | 1286 |
| 471 | Ga0495624_0243802 | 3300046690 | Bacteria | 1087 |
| 472 | Ga0495670_0021740 | 3300046691 | Bacteria | 3166 |
| 473 | Ga0495671_0278343 | 3300046692 | Bacteria | 806 |
| 474 | Ga0495671_0569688 | 3300046692 | Bacteria | 539 |
| 475 | Ga0495649_0085277 | 3300046694 | Bacteria | 1686 |
| 476 | Ga0495649_0481648 | 3300046694 | Bacteria | 618 |
| 477 | Ga0495649_0508407 | 3300046694 | Bacteria | 599 |
| 478 | Ga0495589_0392610 | 3300046794 | Bacteria | 637 |
| 479 | Ga0495600_0015518 | 3300046809 | Bacteria | 4816 |
| 480 | Ga0495581_0017598 | 3300047315 | Bacteria | 4151 |
| 481 | Ga0495581_0083003 | 3300047315 | Bacteria | 1856 |
| 482 | Ga0495581_0108630 | 3300047315 | Bacteria | 1612 |
| 483 | Ga0495581_0121613 | 3300047315 | Bacteria | 1519 |
| 484 | Ga0495581_0129659 | 3300047315 | Bacteria | 1469 |
| 485 | Ga0495581_0360709 | 3300047315 | Bacteria | 848 |
| 486 | Ga0495604_0041494 | 3300047317 | Bacteria | 3609 |
| 487 | Ga0495604_0075020 | 3300047317 | Bacteria | 2547 |
| 488 | Ga0495604_0089960 | 3300047317 | Bacteria | 2280 |
| 489 | Ga0495604_0136128 | 3300047317 | Bacteria | 1760 |
| 490 | Ga0495674_0035475 | 3300047319 | Bacteria | 4499 |
| 491 | Ga0495674_0490042 | 3300047319 | Bacteria | 984 |
| 492 | Ga0495672_0001616 | 3300047320 | Bacteria | 21986 |
| 493 | Ga0495672_0006905 | 3300047320 | Bacteria | 8653 |
| 494 | Ga0495672_0006953 | 3300047320 | Bacteria | 8610 |
| 495 | Ga0495672_0034185 | 3300047320 | Bacteria | 3143 |
| 496 | Ga0495672_0425406 | 3300047320 | Bacteria | 603 |
| 497 | Ga0495676_0436429 | 3300047321 | Bacteria | 865 |
| 498 | Ga0495680_0050131 | 3300047322 | Bacteria | 3265 |
| 499 | Ga0495687_050886 | 3300047443 | Bacteria | 1762 |
| 500 | Ga0495675_0003097 | 3300047444 | Bacteria | 9987 |
| 501 | Ga0495675_0504692 | 3300047444 | Bacteria | 694 |
| 502 | Ga0495675_0596861 | 3300047444 | Bacteria | 626 |
| 503 | Ga0495679_110918 | 3300047446 | Bacteria | 755 |
| 504 | Ga0495685_000496 | 3300047447 | Bacteria | 12192 |
| 505 | Ga0495673_0000243 | 3300047469 | Bacteria | 77026 |
| 506 | Ga0495673_0036202 | 3300047469 | Bacteria | 2266 |
| 507 | Ga0495673_0043455 | 3300047469 | Bacteria | 2011 |
| 508 | Ga0495681_0014914 | 3300047470 | Bacteria | 4427 |
| 509 | Ga0495684_0035539 | 3300047471 | Bacteria | 3820 |
| 510 | Ga0495684_0850398 | 3300047471 | Bacteria | 592 |
| 511 | Ga0495686_0008407 | 3300047472 | Bacteria | 7573 |
| 512 | Ga0495686_0155781 | 3300047472 | Bacteria | 1338 |
| 513 | Ga0495593_0020420 | 3300047673 | Bacteria | 3710 |
| 514 | Ga0495593_0083003 | 3300047673 | Bacteria | 1656 |
| 515 | Ga0495593_0192803 | 3300047673 | Bacteria | 1025 |
| 516 | Ga0495593_0656649 | 3300047673 | Bacteria | 526 |
| 517 | Ga0495593_0712888 | 3300047673 | Bacteria | 504 |
| 518 | Ga0495602_0017114 | 3300048088 | Bacteria | 7272 |
| 519 | Ga0495626_0263777 | 3300048091 | Bacteria | 688 |
| 520 | Ga0496100_0000092 | 3300048903 | Bacteria | 50831 |
| 521 | Ga0496100_0034053 | 3300048903 | Bacteria | 3192 |
| 522 | Ga0496100_0044602 | 3300048903 | Bacteria | 2841 |
| 523 | Ga0496100_0072521 | 3300048903 | Bacteria | 2302 |
| 524 | Ga0496101_0000018 | 3300048904 | Bacteria | 236102 |
| 525 | Ga0496101_0000247 | 3300048904 | Bacteria | 39381 |
| 526 | Ga0496101_0013241 | 3300048904 | Bacteria | 5523 |
| 527 | Ga0496101_1002349 | 3300048904 | Bacteria | 657 |
| 528 | Ga0496101_1047407 | 3300048904 | Bacteria | 641 |
| 529 | Ga0496102_0000239 | 3300048905 | Bacteria | 72112 |
| 530 | Ga0496102_0000417 | 3300048905 | Bacteria | 49103 |
| 531 | Ga0496102_0064190 | 3300048905 | Bacteria | 3363 |
| 532 | Ga0496102_0067957 | 3300048905 | Bacteria | 3269 |
| 533 | Ga0496102_0148879 | 3300048905 | Bacteria | 2198 |
| 534 | Ga0496102_0200133 | 3300048905 | Bacteria | 1883 |
| 535 | Ga0496102_0745557 | 3300048905 | Bacteria | 902 |
| 536 | Ga0496103_0000148 | 3300048906 | Bacteria | 72710 |
| 537 | Ga0496103_0000727 | 3300048906 | Bacteria | 24310 |
| 538 | Ga0496103_0000795 | 3300048906 | Bacteria | 23202 |
| 539 | Ga0496103_0415652 | 3300048906 | Bacteria | 863 |
| 540 | Ga0496103_0423891 | 3300048906 | Bacteria | 854 |
| 541 | Ga0496104_0900185 | 3300048907 | Bacteria | 790 |
| 542 | Ga0496104_1032431 | 3300048907 | Bacteria | 726 |
| 543 | Ga0496104_1354495 | 3300048907 | Bacteria | 615 |
| 544 | Ga0496106_0020980 | 3300048909 | Bacteria | 4848 |
| 545 | Ga0496106_0099680 | 3300048909 | Bacteria | 2252 |
| 546 | Ga0496106_0177922 | 3300048909 | Bacteria | 1688 |
| 547 | Ga0496107_0000367 | 3300048910 | Bacteria | 24467 |
| 548 | Ga0496107_0009963 | 3300048910 | Bacteria | 6594 |
| 549 | Ga0496107_0156006 | 3300048910 | Bacteria | 1690 |
| 550 | Ga0496108_0001617 | 3300048911 | Bacteria | 17857 |
| 551 | Ga0496108_0071966 | 3300048911 | Bacteria | 2918 |
| 552 | Ga0496108_0413260 | 3300048911 | Bacteria | 1178 |
| 553 | Ga0496108_0470473 | 3300048911 | Bacteria | 1098 |
| 554 | Ga0496109_0000688 | 3300048912 | Bacteria | 28149 |
| 555 | Ga0496109_0012643 | 3300048912 | Bacteria | 7291 |
| 556 | Ga0496109_0127838 | 3300048912 | Bacteria | 2370 |
| 557 | Ga0496109_0306795 | 3300048912 | Bacteria | 1497 |
| 558 | Ga0496110_0000316 | 3300048913 | Bacteria | 31985 |
| 559 | Ga0496110_0366965 | 3300048913 | Bacteria | 1312 |
| 560 | Ga0496110_1076514 | 3300048913 | Bacteria | 712 |
| 561 | Ga0496111_0604192 | 3300048914 | Bacteria | 803 |
| 562 | Ga0496111_0820465 | 3300048914 | Bacteria | 672 |
| 563 | Ga0496111_0909230 | 3300048914 | Bacteria | 634 |
| 564 | Ga0496112_0011082 | 3300048915 | Bacteria | 8216 |
| 565 | Ga0496112_0120571 | 3300048915 | Bacteria | 2593 |
| 566 | Ga0496112_0225413 | 3300048915 | Bacteria | 1830 |
| 567 | Ga0496113_0041862 | 3300048916 | Bacteria | 3383 |
| 568 | Ga0496113_1061851 | 3300048916 | Bacteria | 636 |
| 569 | Ga0496113_1145636 | 3300048916 | Bacteria | 609 |
| 570 | Ga0496113_1297639 | 3300048916 | Bacteria | 566 |
| 571 | Ga0496113_1462638 | 3300048916 | Bacteria | 528 |
| 572 | Ga0496114_0000353 | 3300048917 | Bacteria | 33623 |
| 573 | Ga0496115_0236643 | 3300048918 | Bacteria | 1505 |
| 574 | Ga0496115_0813994 | 3300048918 | Bacteria | 726 |
| 575 | Ga0496116_0000224 | 3300048919 | Bacteria | 106109 |
| 576 | Ga0496116_0000355 | 3300048919 | Bacteria | 72106 |
| 577 | Ga0496116_0005548 | 3300048919 | Bacteria | 11637 |
| 578 | Ga0496116_0014633 | 3300048919 | Bacteria | 6252 |
| 579 | Ga0496117_0000051 | 3300048920 | Bacteria | 285716 |
| 580 | Ga0496117_0000909 | 3300048920 | Bacteria | 45378 |
| 581 | Ga0496117_0012107 | 3300048920 | Bacteria | 7650 |
| 582 | Ga0496117_0074800 | 3300048920 | Bacteria | 2253 |
| 583 | Ga0496117_0099125 | 3300048920 | Bacteria | 1850 |
| 584 | Ga0496117_0265821 | 3300048920 | Bacteria | 927 |
| 585 | Ga0496118_0000043 | 3300048921 | Bacteria | 285716 |
| 586 | Ga0496118_0000324 | 3300048921 | Bacteria | 82637 |
| 587 | Ga0496118_0002530 | 3300048921 | Bacteria | 24503 |
| 588 | Ga0496118_0028149 | 3300048921 | Bacteria | 4740 |
| 589 | Ga0496118_0046458 | 3300048921 | Bacteria | 3377 |
| 590 | Ga0496118_0404747 | 3300048921 | Bacteria | 707 |
| 591 | Ga0496119_0000990 | 3300048922 | Bacteria | 36498 |
| 592 | Ga0496119_0003073 | 3300048922 | Bacteria | 17626 |
| 593 | Ga0496119_0010949 | 3300048922 | Bacteria | 7574 |
| 594 | Ga0496119_0029615 | 3300048922 | Bacteria | 3708 |
| 595 | Ga0496119_0130880 | 3300048922 | Bacteria | 1367 |
| 596 | Ga0496120_0009746 | 3300048923 | Bacteria | 6775 |
| 597 | Ga0496120_0014292 | 3300048923 | Bacteria | 5298 |
| 598 | Ga0496120_0054158 | 3300048923 | Bacteria | 2275 |
| 599 | Ga0496120_0192780 | 3300048923 | Bacteria | 992 |
| 600 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 601 | Ga0496121_0000924 | 3300048924 | Bacteria | 53089 |
| 602 | Ga0496121_0002322 | 3300048924 | Bacteria | 29463 |
| 603 | Ga0496121_0555430 | 3300048924 | Bacteria | 717 |
| 604 | Ga0496122_0000164 | 3300048925 | Bacteria | 158055 |
| 605 | Ga0496122_0246220 | 3300048925 | Bacteria | 1004 |
| 606 | Ga0496123_0003496 | 3300048926 | Bacteria | 17538 |
| 607 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 608 | Ga0496124_0523991 | 3300048927 | Bacteria | 789 |
| 609 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 610 | Ga0496125_0079216 | 3300048928 | Bacteria | 2521 |
| 611 | Ga0496125_0081795 | 3300048928 | Bacteria | 2465 |
| 612 | Ga0496125_0116487 | 3300048928 | Bacteria | 1919 |
| 613 | Ga0496125_0327620 | 3300048928 | Bacteria | 925 |
| 614 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 615 | Ga0496126_0002171 | 3300048929 | Bacteria | 27244 |
| 616 | Ga0496126_0521685 | 3300048929 | Bacteria | 946 |
| 617 | Ga0496126_0521688 | 3300048929 | Bacteria | 946 |
| 618 | Ga0501031_0030529 | 3300049568 | Bacteria | 3516 |
| 619 | Ga0501032_0001214 | 3300049569 | Bacteria | 20623 |
| 620 | Ga0501032_0002928 | 3300049569 | Bacteria | 13276 |
| 621 | Ga0501032_0180754 | 3300049569 | Bacteria | 1381 |
| 622 | Ga0501032_0349463 | 3300049569 | Bacteria | 953 |
| 623 | Ga0501034_0001356 | 3300049571 | Bacteria | 33085 |
| 624 | Ga0501034_0002853 | 3300049571 | Bacteria | 20144 |
| 625 | Ga0501034_0468555 | 3300049571 | Bacteria | 1176 |
| 626 | Ga0501036_0002465 | 3300049572 | Bacteria | 14501 |
| 627 | Ga0501036_0054599 | 3300049572 | Bacteria | 3384 |
| 628 | Ga0501036_0230377 | 3300049572 | Bacteria | 1555 |
| 629 | Ga0501036_0421975 | 3300049572 | Bacteria | 1112 |
| 630 | Ga0501036_0854244 | 3300049572 | Bacteria | 748 |
| 631 | Ga0501037_0000220 | 3300049573 | Bacteria | 49798 |
| 632 | Ga0501037_0001017 | 3300049573 | Bacteria | 20741 |
| 633 | Ga0501038_0000980 | 3300049574 | Bacteria | 25615 |
| 634 | Ga0501038_0001589 | 3300049574 | Bacteria | 21073 |
| 635 | Ga0501038_0012468 | 3300049574 | Bacteria | 7767 |
| 636 | Ga0501038_1100872 | 3300049574 | Bacteria | 580 |
| 637 | Ga0501038_1344011 | 3300049574 | Bacteria | 515 |
| 638 | Ga0501039_0000976 | 3300049575 | Bacteria | 20785 |
| 639 | Ga0501039_0001608 | 3300049575 | Bacteria | 16643 |
| 640 | Ga0501039_0230430 | 3300049575 | Bacteria | 1456 |
| 641 | Ga0501039_0754001 | 3300049575 | Bacteria | 760 |
| 642 | Ga0501041_0795914 | 3300049577 | Bacteria | 606 |
| 643 | Ga0501043_0001421 | 3300049579 | Bacteria | 20917 |
| 644 | Ga0501043_0008835 | 3300049579 | Bacteria | 7928 |
| 645 | Ga0501046_0139616 | 3300049580 | Bacteria | 1834 |
| 646 | Ga0501047_0260279 | 3300049581 | Bacteria | 1583 |
| 647 | Ga0501047_0660208 | 3300049581 | Bacteria | 865 |
| 648 | Ga0501047_0949067 | 3300049581 | Bacteria | 673 |
| 649 | Ga0501047_1115258 | 3300049581 | Bacteria | 602 |
| 650 | Ga0501047_1216277 | 3300049581 | Bacteria | 567 |
| 651 | Ga0501048_0412578 | 3300049582 | Bacteria | 966 |
| 652 | Ga0501067_0007055 | 3300049583 | Bacteria | 6240 |
| 653 | Ga0501067_0059179 | 3300049583 | Bacteria | 2121 |
| 654 | Ga0501068_0172460 | 3300049584 | Bacteria | 1365 |
| 655 | Ga0501068_0872432 | 3300049584 | Bacteria | 591 |
| 656 | Ga0501069_0074776 | 3300049585 | Bacteria | 1902 |
| 657 | Ga0501069_0732925 | 3300049585 | Bacteria | 597 |
| 658 | Ga0501070_0001619 | 3300049586 | Bacteria | 19966 |
| 659 | Ga0501070_0014548 | 3300049586 | Bacteria | 6620 |
| 660 | Ga0501070_0064844 | 3300049586 | Bacteria | 3024 |
| 661 | Ga0501070_0508200 | 3300049586 | Bacteria | 968 |
| 662 | Ga0501071_0019804 | 3300049587 | Bacteria | 4673 |
| 663 | Ga0501071_0080362 | 3300049587 | Bacteria | 2384 |
| 664 | Ga0501071_0380886 | 3300049587 | Bacteria | 1076 |
| 665 | Ga0501071_0472537 | 3300049587 | Bacteria | 961 |
| 666 | Ga0501071_0990720 | 3300049587 | Bacteria | 649 |
| 667 | Ga0501072_0475249 | 3300049588 | Bacteria | 989 |
| 668 | Ga0501072_0697267 | 3300049588 | Bacteria | 798 |
| 669 | Ga0501073_0008348 | 3300049589 | Bacteria | 7682 |
| 670 | Ga0501073_0009592 | 3300049589 | Bacteria | 7139 |
| 671 | Ga0501073_0012643 | 3300049589 | Bacteria | 6157 |
| 672 | Ga0501073_0973500 | 3300049589 | Bacteria | 584 |
| 673 | Ga0501074_0014245 | 3300049590 | Bacteria | 5782 |
| 674 | Ga0501074_0180325 | 3300049590 | Bacteria | 1507 |
| 675 | Ga0501074_0498355 | 3300049590 | Bacteria | 863 |
| 676 | Ga0501075_0682249 | 3300049591 | Bacteria | 783 |
| 677 | Ga0501076_0603012 | 3300049592 | Bacteria | 906 |
| 678 | Ga0501077_0058401 | 3300049593 | Bacteria | 2449 |
| 679 | Ga0501077_0074425 | 3300049593 | Bacteria | 2151 |
| 680 | Ga0501079_0226620 | 3300049741 | Bacteria | 1460 |
| 681 | Ga0501079_0357708 | 3300049741 | Bacteria | 1144 |
| 682 | Ga0501079_0504897 | 3300049741 | Bacteria | 951 |
| 683 | Ga0501080_0059848 | 3300049742 | Bacteria | 3544 |
| 684 | Ga0501080_0176297 | 3300049742 | Bacteria | 1969 |
| 685 | Ga0501080_0626100 | 3300049742 | Bacteria | 954 |
| 686 | Ga0501081_0351748 | 3300049743 | Bacteria | 1086 |
| 687 | Ga0501083_0019481 | 3300049744 | Bacteria | 4727 |
| 688 | Ga0501035_0023964 | 3300049822 | Bacteria | 5601 |
| 689 | Ga0501035_0342772 | 3300049822 | Bacteria | 1252 |
| 690 | Ga0501044_0003636 | 3300049823 | Bacteria | 17354 |
| 691 | Ga0501044_0007721 | 3300049823 | Bacteria | 11828 |
| 692 | Ga0501044_0041282 | 3300049823 | Bacteria | 4802 |
| 693 | Ga0501044_0526391 | 3300049823 | Bacteria | 1081 |
| 694 | Ga0501045_1431833 | 3300049824 | Bacteria | 501 |
| 695 | nmdc:mga03683_122053_c1 | 3300050489 | Bacteria | 1159 |
| 696 | nmdc:mga03683_296190_c1 | 3300050489 | Bacteria | 758 |
| 697 | nmdc:mga03683_322237_c1 | 3300050489 | Bacteria | 728 |
| 698 | nmdc:mga03683_517832_c1 | 3300050489 | Bacteria | 579 |
| 699 | nmdc:mga03683_57907_c1 | 3300050489 | Bacteria | 1632 |
| 700 | nmdc:mga03n38_126437_c1 | 3300050490 | Bacteria | 1262 |
| 701 | nmdc:mga03n38_20349_c1 | 3300050490 | Bacteria | 2654 |
| 702 | nmdc:mga03n38_233450_c1 | 3300050490 | Bacteria | 664 |
| 703 | nmdc:mga03n38_38933_c1 | 3300050490 | Bacteria | 2059 |
| 704 | nmdc:mga03n38_49574_c1 | 3300050490 | Bacteria | 1868 |
| 705 | nmdc:mga03n38_765_c2 | 3300050490 | Bacteria | 7172 |
| 706 | nmdc:mga03n38_822836_c1 | 3300050490 | Bacteria | 542 |
| 707 | nmdc:mga03n38_86562_c1 | 3300050490 | Bacteria | 1483 |
| 708 | nmdc:mga00v17_143978_c1 | 3300050491 | Bacteria | 1529 |
| 709 | nmdc:mga00v17_267515_c1 | 3300050491 | Bacteria | 1109 |
| 710 | nmdc:mga00v17_2753_c1 | 3300050491 | Bacteria | 9022 |
| 711 | nmdc:mga00v17_2964_c1 | 3300050491 | Bacteria | 8714 |
| 712 | nmdc:mga00v17_428857_c1 | 3300050491 | Bacteria | 859 |
| 713 | nmdc:mga00v17_664666_c1 | 3300050491 | Bacteria | 669 |
| 714 | nmdc:mga00v17_991052_c1 | 3300050491 | Bacteria | 529 |
| 715 | nmdc:mga0yw44_141077_c1 | 3300050492 | Bacteria | 1566 |
| 716 | nmdc:mga0yw44_236511_c1 | 3300050492 | Bacteria | 1213 |
| 717 | nmdc:mga0yw44_314841_c1 | 3300050492 | Bacteria | 1050 |
| 718 | nmdc:mga0yw44_901224_c1 | 3300050492 | Bacteria | 600 |
| 719 | nmdc:mga06z11_212214_c1 | 3300050494 | Bacteria | 1128 |
| 720 | nmdc:mga06z11_359481_c1 | 3300050494 | Bacteria | 872 |
| 721 | nmdc:mga07m45_17718_c1 | 3300050496 | Bacteria | 3831 |
| 722 | nmdc:mga07m45_259506_c1 | 3300050496 | Bacteria | 1011 |
| 723 | nmdc:mga07m45_265485_c1 | 3300050496 | Bacteria | 998 |
| 724 | nmdc:mga07m45_297351_c1 | 3300050496 | Bacteria | 939 |
| 725 | nmdc:mga07m45_54135_c1 | 3300050496 | Bacteria | 2268 |
| 726 | nmdc:mga07m45_73289_c1 | 3300050496 | Bacteria | 1949 |
| 727 | nmdc:mga07m45_76649_c1 | 3300050496 | Bacteria | 1906 |
| 728 | nmdc:mga0qj67_191131_c1 | 3300050509 | Bacteria | 1664 |
| 729 | nmdc:mga08y16_1255093_c1 | 3300050511 | Bacteria | 709 |
| 730 | nmdc:mga0sz30_1570_c3 | 3300050516 | Bacteria | 2621 |
| 731 | nmdc:mga0sz30_184738_c1 | 3300050516 | Bacteria | 925 |
| 732 | nmdc:mga0sz30_185756_c1 | 3300050516 | Bacteria | 923 |
| 733 | nmdc:mga0sz30_196062_c2 | 3300050516 | Bacteria | 541 |
| 734 | nmdc:mga0sz30_3198_c1 | 3300050516 | Bacteria | 5875 |
| 735 | nmdc:mga0sz30_3903_c2 | 3300050516 | Bacteria | 2253 |
| 736 | nmdc:mga0sz30_44034_c1 | 3300050516 | Bacteria | 1879 |
| 737 | nmdc:mga0sz30_49002_c1 | 3300050516 | Bacteria | 1789 |
| 738 | nmdc:mga0sz30_593234_c1 | 3300050516 | Bacteria | 501 |
| 739 | nmdc:mga0sz30_79124_c1 | 3300050516 | Bacteria | 1421 |
| 740 | Ga0495601_0036065 | 3300053077 | Bacteria | 3088 |
| 741 | Ga0495601_0054952 | 3300053077 | Bacteria | 2520 |
| 742 | Ga0495612_0008332 | 3300053078 | Bacteria | 4207 |
| 743 | Ga0495612_0087097 | 3300053078 | Bacteria | 1318 |
| 744 | Ga0500610_0386853 | 3300053079 | Bacteria | 575 |
| 745 | Ga0500635_0010410 | 3300053080 | Bacteria | 2611 |
| 746 | Ga0495595_0059266 | 3300053084 | Bacteria | 1789 |
| 747 | Ga0495619_0027478 | 3300053085 | Bacteria | 3665 |
| 748 | Ga0495619_0033191 | 3300053085 | Bacteria | 3352 |
| 749 | Ga0500578_0300672 | 3300053086 | Bacteria | 951 |
| 750 | Ga0500643_015487 | 3300053087 | Bacteria | 2613 |
| 751 | Ga0500581_158927 | 3300053089 | Bacteria | 1052 |
| 752 | Ga0500583_0543451 | 3300053092 | Bacteria | 541 |
| 753 | Ga0500566_0037844 | 3300053094 | Bacteria | 2794 |
| 754 | Ga0500566_0118491 | 3300053094 | Bacteria | 1430 |
| 755 | Ga0500566_0201144 | 3300053094 | Bacteria | 1006 |
| 756 | Ga0500640_039268 | 3300053095 | Bacteria | 2079 |
| 757 | Ga0500641_0095792 | 3300053096 | Bacteria | 1270 |
| 758 | Ga0500641_0108825 | 3300053096 | Bacteria | 1192 |
| 759 | Ga0500650_0239772 | 3300053098 | Bacteria | 816 |
| 760 | Ga0500654_033475 | 3300053099 | Bacteria | 3049 |
| 761 | Ga0500553_024427 | 3300053101 | Bacteria | 3049 |
| 762 | Ga0500553_065288 | 3300053101 | Bacteria | 1691 |
| 763 | Ga0500556_0004758 | 3300053104 | Bacteria | 3851 |
| 764 | Ga0500557_282067 | 3300053105 | Bacteria | 510 |
| 765 | Ga0500560_003175 | 3300053107 | Bacteria | 3281 |
| 766 | Ga0500560_026695 | 3300053107 | Bacteria | 1708 |
| 767 | Ga0500560_141531 | 3300053107 | Bacteria | 802 |
| 768 | Ga0500562_029104 | 3300053108 | Bacteria | 1453 |
| 769 | Ga0500569_300851 | 3300053109 | Bacteria | 539 |
| 770 | Ga0500595_022551 | 3300053119 | Bacteria | 2227 |
| 771 | Ga0500608_145397 | 3300053122 | Bacteria | 1046 |
| 772 | Ga0500614_003215 | 3300053123 | Bacteria | 3539 |
| 773 | Ga0500614_004621 | 3300053123 | Bacteria | 2902 |
| 774 | Ga0500628_001538 | 3300053129 | Bacteria | 3928 |
| 775 | Ga0500628_130111 | 3300053129 | Bacteria | 690 |
| 776 | Ga0500652_000813 | 3300053131 | Bacteria | 10457 |
| 777 | Ga0500652_016845 | 3300053131 | Bacteria | 2667 |
| 778 | Ga0500652_083240 | 3300053131 | Bacteria | 1333 |
| 779 | Ga0500658_0031952 | 3300053134 | Bacteria | 2062 |
| 780 | Ga0500658_0200313 | 3300053134 | Bacteria | 912 |
| 781 | Ga0500559_0075300 | 3300053136 | Bacteria | 1526 |
| 782 | Ga0500561_0236589 | 3300053137 | Bacteria | 580 |
| 783 | Ga0500564_250523 | 3300053138 | Bacteria | 702 |
| 784 | Ga0500573_0068501 | 3300053140 | Bacteria | 2026 |
| 785 | Ga0500573_0553024 | 3300053140 | Bacteria | 509 |
| 786 | Ga0500577_0207329 | 3300053142 | Bacteria | 847 |
| 787 | Ga0500579_081841 | 3300053143 | Bacteria | 1800 |
| 788 | Ga0500586_175224 | 3300053145 | Bacteria | 719 |
| 789 | Ga0500588_0171020 | 3300053146 | Bacteria | 795 |
| 790 | Ga0500588_0287378 | 3300053146 | Bacteria | 621 |
| 791 | Ga0500600_0132375 | 3300053149 | Bacteria | 1267 |
| 792 | Ga0500603_105942 | 3300053150 | Bacteria | 840 |
| 793 | Ga0500603_172460 | 3300053150 | Bacteria | 678 |
| 794 | Ga0500616_0007990 | 3300053153 | Bacteria | 6634 |
| 795 | Ga0500633_0044639 | 3300053160 | Bacteria | 1505 |
| 796 | Ga0500634_0106343 | 3300053161 | Bacteria | 1394 |
| 797 | Ga0500636_0080281 | 3300053177 | Bacteria | 1880 |
| 798 | Ga0500636_0136341 | 3300053177 | Bacteria | 1363 |
| 799 | Ga0500637_0534790 | 3300053178 | Bacteria | 572 |
| 800 | Ga0500645_000004 | 3300053730 | Bacteria | 305014 |
| 801 | Ga0500645_000057 | 3300053730 | Bacteria | 92092 |
| 802 | Ga0500645_000988 | 3300053730 | Bacteria | 16082 |
| 803 | Ga0500587_069614 | 3300053739 | Bacteria | 551 |
| 804 | Ga0501084_0738796 | 3300054114 | Bacteria | 829 |
| 805 | Ga0501084_0986903 | 3300054114 | Bacteria | 708 |
| 806 | Ga0501082_0008404 | 3300060353 | Bacteria | 8906 |
| 807 | Ga0466962_0357367 | 3300061719 | Bacteria | 728 |
| 808 | Ga0530510_0153763 | 3300061734 | Bacteria | 1700 |
| 809 | Ga0530510_0648581 | 3300061734 | Bacteria | 804 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0334821 | Ga0466970_0334821_571_813 | 79 |
| 2 | 3300053177 | Ga0500636_0136341 | Ga0500636_0136341_910_1152 | 79 |
| 3 | iso_pu_bacteria | 2643221561 | 2643826127 | 81 |
| 4 | iso_pu_bacteria | 2643221604 | 2644031796 | 81 |
| 5 | iso_pu_bacteria | 3001889506 | 3001889882 | 81 |
| 6 | 3300025303 | Ga0209051_1000075 | Ga0209051_1000075155 | 82 |
| 7 | 3300046694 | Ga0495649_0508407 | Ga0495649_0508407_101_349 | 82 |
| 8 | iso_pu_bacteria | 2816332119 | 2816426134 | 82 |
| 9 | 3300031548 | Ga0307408_100611372 | Ga0307408_1006113722 | 83 |
| 10 | 3300041459 | Ga0451800_0426569 | Ga0451800_0426569_944_1198 | 83 |
| 11 | 3300041460 | Ga0451802_2080905 | Ga0451802_2080905_94_348 | 83 |
| 12 | 3300041494 | Ga0451837_1582673 | Ga0451837_1582673_238_492 | 83 |
| 13 | 3300041503 | Ga0451847_0676306 | Ga0451847_0676306_172_426 | 83 |
| 14 | 3300041512 | Ga0451853_0038446 | Ga0451853_0038446_561_815 | 83 |
| 15 | iso_pu_bacteria | 2818991472 | 2819741623 | 83 |
| 16 | iso_pu_bacteria | 2995463766 | 2995463980 | 83 |
| 17 | iso_pu_bacteria | 3006486233 | 3006492531 | 83 |
| 18 | 3300005434 | Ga0070709_10012787 | Ga0070709_100127872 | 84 |
| 19 | 3300005435 | Ga0070714_100001652 | Ga0070714_1000016526 | 84 |
| 20 | 3300005436 | Ga0070713_100301110 | Ga0070713_1003011102 | 84 |
| 21 | 3300005437 | Ga0070710_10016786 | Ga0070710_100167864 | 84 |
| 22 | 3300006173 | Ga0070716_100881368 | Ga0070716_1008813682 | 84 |
| 23 | 3300006175 | Ga0070712_100005080 | Ga0070712_1000050806 | 84 |
| 24 | 3300025898 | Ga0207692_10450457 | Ga0207692_104504572 | 84 |
| 25 | 3300025906 | Ga0207699_10008608 | Ga0207699_100086084 | 84 |
| 26 | 3300025928 | Ga0207700_10327227 | Ga0207700_103272272 | 84 |
| 27 | 3300025929 | Ga0207664_10006955 | Ga0207664_100069557 | 84 |
| 28 | 3300035086 | Ga0373934_0001480 | Ga0373934_0001480_2587_2841 | 84 |
| 29 | 3300035111 | Ga0373923_0003291 | Ga0373923_0003291_625_879 | 84 |
| 30 | 3300035113 | Ga0373936_0207360 | Ga0373936_0207360_306_560 | 84 |
| 31 | 3300035117 | Ga0373953_0004185 | Ga0373953_0004185_2147_2401 | 84 |
| 32 | 3300035118 | Ga0373954_0019649 | Ga0373954_0019649_2596_2850 | 84 |
| 33 | 3300035119 | Ga0373956_0001640 | Ga0373956_0001640_5892_6146 | 84 |
| 34 | 3300035120 | Ga0373957_0006197 | Ga0373957_0006197_723_977 | 84 |
| 35 | 3300035410 | Ga0373924_0004028 | Ga0373924_0004028_1921_2175 | 84 |
| 36 | 3300035724 | Ga0373933_0006960 | Ga0373933_0006960_4062_4316 | 84 |
| 37 | 3300036401 | Ga0373937_0032958 | Ga0373937_0032958_2596_2850 | 84 |
| 38 | 3300046454 | Ga0495592_0023605 | Ga0495592_0023605_1829_2083 | 84 |
| 39 | 3300046459 | Ga0495629_0012064 | Ga0495629_0012064_4293_4547 | 84 |
| 40 | 3300046461 | Ga0495641_0019456 | Ga0495641_0019456_2242_2496 | 84 |
| 41 | 3300046463 | Ga0495653_0025974 | Ga0495653_0025974_2596_2850 | 84 |
| 42 | 3300046473 | Ga0495582_0034662 | Ga0495582_0034662_451_705 | 84 |
| 43 | 3300046476 | Ga0495662_0089675 | Ga0495662_0089675_932_1186 | 84 |
| 44 | 3300046477 | Ga0495664_0003965 | Ga0495664_0003965_2968_3222 | 84 |
| 45 | 3300046511 | Ga0495608_0011148 | Ga0495608_0011148_1839_2093 | 84 |
| 46 | 3300046514 | Ga0495618_0015230 | Ga0495618_0015230_2596_2850 | 84 |
| 47 | 3300046516 | Ga0495628_0027174 | Ga0495628_0027174_1831_2085 | 84 |
| 48 | 3300046517 | Ga0495630_0033150 | Ga0495630_0033150_1036_1290 | 84 |
| 49 | 3300046526 | Ga0495666_0112900 | Ga0495666_0112900_266_520 | 84 |
| 50 | 3300046529 | Ga0495652_0033397 | Ga0495652_0033397_1847_2101 | 84 |
| 51 | 3300046531 | Ga0495665_0024791 | Ga0495665_0024791_1116_1370 | 84 |
| 52 | 3300046533 | Ga0495640_0022762 | Ga0495640_0022762_1805_2059 | 84 |
| 53 | 3300046536 | Ga0495587_0006874 | Ga0495587_0006874_5189_5443 | 84 |
| 54 | 3300046543 | Ga0495645_0414120 | Ga0495645_0414120_326_580 | 84 |
| 55 | 3300046642 | Ga0495634_0015689 | Ga0495634_0015689_2519_2773 | 84 |
| 56 | 3300046663 | Ga0495635_0029809 | Ga0495635_0029809_2782_3036 | 84 |
| 57 | 3300046675 | Ga0495657_0032318 | Ga0495657_0032318_1008_1262 | 84 |
| 58 | 3300046678 | Ga0495599_0016021 | Ga0495599_0016021_2596_2850 | 84 |
| 59 | 3300046679 | Ga0495623_0026593 | Ga0495623_0026593_942_1196 | 84 |
| 60 | 3300046680 | Ga0495646_0006111 | Ga0495646_0006111_5171_5425 | 84 |
| 61 | 3300046689 | Ga0495613_0018634 | Ga0495613_0018634_2377_2631 | 84 |
| 62 | 3300046690 | Ga0495624_0158686 | Ga0495624_0158686_601_855 | 84 |
| 63 | 3300046809 | Ga0495600_0015518 | Ga0495600_0015518_2782_3036 | 84 |
| 64 | 3300047315 | Ga0495581_0017598 | Ga0495581_0017598_1172_1426 | 84 |
| 65 | 3300047317 | Ga0495604_0075020 | Ga0495604_0075020_788_1042 | 84 |
| 66 | 3300047319 | Ga0495674_0035475 | Ga0495674_0035475_1727_1981 | 84 |
| 67 | 3300047322 | Ga0495680_0050131 | Ga0495680_0050131_493_747 | 84 |
| 68 | 3300047444 | Ga0495675_0003097 | Ga0495675_0003097_3129_3383 | 84 |
| 69 | 3300047471 | Ga0495684_0035539 | Ga0495684_0035539_971_1225 | 84 |
| 70 | 3300047673 | Ga0495593_0020420 | Ga0495593_0020420_3041_3295 | 84 |
| 71 | 3300048088 | Ga0495602_0017114 | Ga0495602_0017114_1848_2102 | 84 |
| 72 | 3300053077 | Ga0495601_0036065 | Ga0495601_0036065_1724_1978 | 84 |
| 73 | 3300053078 | Ga0495612_0087097 | Ga0495612_0087097_314_568 | 84 |
| 74 | 3300053084 | Ga0495595_0059266 | Ga0495595_0059266_548_802 | 84 |
| 75 | iso_pu_bacteria | 2744054611 | 2744956003 | 84 |
| 76 | 3300025901 | Ga0207688_10447529 | Ga0207688_104475291 | 85 |
| 77 | 3300030521 | Ga0307511_10204626 | Ga0307511_102046261 | 85 |
| 78 | 3300031665 | Ga0316575_10107901 | Ga0316575_101079012 | 85 |
| 79 | 3300031995 | Ga0307409_100510306 | Ga0307409_1005103062 | 85 |
| 80 | 3300035171 | Ga0373946_0598720 | Ga0373946_0598720_227_487 | 85 |
| 81 | 3300037418 | Ga0395900_0092294 | Ga0395900_0092294_580_840 | 85 |
| 82 | 3300037466 | Ga0395898_0043522 | Ga0395898_0043522_1447_1707 | 85 |
| 83 | 3300037471 | Ga0395905_0722368 | Ga0395905_0722368_66_326 | 85 |
| 84 | 3300038443 | Ga0395901_0196097 | Ga0395901_0196097_776_1036 | 85 |
| 85 | 3300041997 | Ga0439431_0086436 | Ga0439431_0086436_324_584 | 85 |
| 86 | 3300042002 | Ga0439442_098970 | Ga0439442_098970_142_402 | 85 |
| 87 | 3300042156 | Ga0439446_0048867 | Ga0439446_0048867_178_438 | 85 |
| 88 | 3300042435 | Ga0439434_0076795 | Ga0439434_0076795_345_605 | 85 |
| 89 | 3300046459 | Ga0495629_0169068 | Ga0495629_0169068_1166_1426 | 85 |
| 90 | 3300046461 | Ga0495641_0085904 | Ga0495641_0085904_195_455 | 85 |
| 91 | 3300046475 | Ga0495639_0122506 | Ga0495639_0122506_821_1081 | 85 |
| 92 | 3300046689 | Ga0495613_0567562 | Ga0495613_0567562_157_417 | 85 |
| 93 | 3300048914 | Ga0496111_0604192 | Ga0496111_0604192_137_397 | 85 |
| 94 | 3300048915 | Ga0496112_0225413 | Ga0496112_0225413_457_717 | 85 |
| 95 | 3300048916 | Ga0496113_0041862 | Ga0496113_0041862_525_785 | 85 |
| 96 | 3300049574 | Ga0501038_1100872 | Ga0501038_1100872_45_305 | 85 |
| 97 | 3300049581 | Ga0501047_0949067 | Ga0501047_0949067_46_306 | 85 |
| 98 | 3300049583 | Ga0501067_0007055 | Ga0501067_0007055_5144_5404 | 85 |
| 99 | 3300049584 | Ga0501068_0172460 | Ga0501068_0172460_213_473 | 85 |
| 100 | 3300049586 | Ga0501070_0014548 | Ga0501070_0014548_5524_5784 | 85 |
| 101 | 3300049587 | Ga0501071_0472537 | Ga0501071_0472537_199_459 | 85 |
| 102 | 3300049589 | Ga0501073_0009592 | Ga0501073_0009592_599_859 | 85 |
| 103 | 3300049590 | Ga0501074_0014245 | Ga0501074_0014245_457_717 | 85 |
| 104 | 3300049593 | Ga0501077_0074425 | Ga0501077_0074425_576_836 | 85 |
| 105 | 3300049741 | Ga0501079_0357708 | Ga0501079_0357708_303_563 | 85 |
| 106 | 3300049742 | Ga0501080_0059848 | Ga0501080_0059848_2565_2825 | 85 |
| 107 | 3300049744 | Ga0501083_0019481 | Ga0501083_0019481_3895_4155 | 85 |
| 108 | 3300053092 | Ga0500583_0543451 | Ga0500583_0543451_169_429 | 85 |
| 109 | 3300054114 | Ga0501084_0738796 | Ga0501084_0738796_203_463 | 85 |
| 110 | 3300060353 | Ga0501082_0008404 | Ga0501082_0008404_7914_8174 | 85 |
| 111 | iso_pu_bacteria | 2547132424 | 2548697074 | 85 |
| 112 | iso_pu_bacteria | 2565956761 | 2566996110 | 85 |
| 113 | iso_pu_bacteria | 2643221692 | 2644511782 | 85 |
| 114 | iso_pu_bacteria | 2738541264 | 2738667572 | 85 |
| 115 | iso_pu_bacteria | 2738541274 | 2738705510 | 85 |
| 116 | iso_pu_bacteria | 2738541308 | 2738892320 | 85 |
| 117 | iso_pu_bacteria | 2738541356 | 2739146642 | 85 |
| 118 | iso_pu_bacteria | 2738543011 | 2739236423 | 85 |
| 119 | iso_pu_bacteria | 2738543028 | 2739332299 | 85 |
| 120 | iso_pu_bacteria | 2842134933 | 2842135855 | 85 |
| 121 | iso_pu_bacteria | 2889300758 | 2889305904 | 85 |
| 122 | iso_pu_bacteria | 2902792274 | 2902793586 | 85 |
| 123 | iso_pu_bacteria | 2902792274 | 2902796805 | 85 |
| 124 | iso_pu_bacteria | 2902810491 | 2902813634 | 85 |
| 125 | iso_pu_bacteria | 2902810491 | 2902816746 | 85 |
| 126 | iso_pu_bacteria | 2902837492 | 2902843592 | 85 |
| 127 | iso_pu_bacteria | 2904535858 | 2904540745 | 85 |
| 128 | iso_pu_bacteria | 2904765812 | 2904766266 | 85 |
| 129 | iso_pu_bacteria | 2904770941 | 2904772331 | 85 |
| 130 | iso_pu_bacteria | 2908811453 | 2908812460 | 85 |
| 131 | iso_pu_bacteria | 2919420072 | 2919421308 | 85 |
| 132 | iso_pu_bacteria | 2919432681 | 2919432934 | 85 |
| 133 | iso_pu_bacteria | 2919713450 | 2919713567 | 85 |
| 134 | iso_pu_bacteria | 2922554459 | 2922554834 | 85 |
| 135 | iso_pu_bacteria | 2939743619 | 2939744039 | 85 |
| 136 | iso_pu_bacteria | 2974315732 | 2974318889 | 85 |
| 137 | iso_pu_bacteria | 2984523437 | 2984527159 | 85 |
| 138 | 3300003320 | rootH2_10014701 | rootH2_100147011 | 86 |
| 139 | 3300005329 | Ga0070683_100785096 | Ga0070683_1007850962 | 86 |
| 140 | 3300005336 | Ga0070680_101475501 | Ga0070680_1014755012 | 86 |
| 141 | 3300005467 | Ga0070706_101941089 | Ga0070706_1019410891 | 86 |
| 142 | 3300005530 | Ga0070679_100205942 | Ga0070679_1002059421 | 86 |
| 143 | 3300009551 | Ga0105238_11577667 | Ga0105238_115776672 | 86 |
| 144 | 3300013105 | Ga0157369_11159480 | Ga0157369_111594802 | 86 |
| 145 | 3300013307 | Ga0157372_10495502 | Ga0157372_104955023 | 86 |
| 146 | 3300020078 | Ga0206352_10194983 | Ga0206352_101949832 | 86 |
| 147 | 3300020610 | Ga0154015_1673388 | Ga0154015_16733882 | 86 |
| 148 | 3300022467 | Ga0224712_10096383 | Ga0224712_100963832 | 86 |
| 149 | 3300025904 | Ga0207647_10295835 | Ga0207647_102958353 | 86 |
| 150 | 3300025917 | Ga0207660_10339002 | Ga0207660_103390022 | 86 |
| 151 | 3300031730 | Ga0307516_10388557 | Ga0307516_103885572 | 86 |
| 152 | 3300031731 | Ga0307405_10452489 | Ga0307405_104524892 | 86 |
| 153 | 3300031731 | Ga0307405_11705939 | Ga0307405_117059391 | 86 |
| 154 | 3300031824 | Ga0307413_10151373 | Ga0307413_101513733 | 86 |
| 155 | 3300031838 | Ga0307518_10217378 | Ga0307518_102173782 | 86 |
| 156 | 3300031852 | Ga0307410_10064909 | Ga0307410_100649093 | 86 |
| 157 | 3300031852 | Ga0307410_10221531 | Ga0307410_102215312 | 86 |
| 158 | 3300031852 | Ga0307410_11655704 | Ga0307410_116557042 | 86 |
| 159 | 3300031901 | Ga0307406_10832805 | Ga0307406_108328051 | 86 |
| 160 | 3300031901 | Ga0307406_10993005 | Ga0307406_109930052 | 86 |
| 161 | 3300031903 | Ga0307407_11033082 | Ga0307407_110330821 | 86 |
| 162 | 3300031911 | Ga0307412_12263855 | Ga0307412_122638551 | 86 |
| 163 | 3300031995 | Ga0307409_100057515 | Ga0307409_1000575153 | 86 |
| 164 | 3300031995 | Ga0307409_100077870 | Ga0307409_1000778702 | 86 |
| 165 | 3300031995 | Ga0307409_100303772 | Ga0307409_1003037721 | 86 |
| 166 | 3300032004 | Ga0307414_10144368 | Ga0307414_101443683 | 86 |
| 167 | 3300032005 | Ga0307411_11164077 | Ga0307411_111640771 | 86 |
| 168 | 3300032126 | Ga0307415_100231938 | Ga0307415_1002319381 | 86 |
| 169 | 3300042007 | Ga0439449_0408523 | Ga0439449_0408523_47_313 | 86 |
| 170 | 3300044694 | Ga0466963_0627570 | Ga0466963_0627570_457_729 | 86 |
| 171 | 3300046455 | Ga0495603_0642203 | Ga0495603_0642203_36_302 | 86 |
| 172 | 3300046473 | Ga0495582_0131685 | Ga0495582_0131685_527_793 | 86 |
| 173 | 3300049568 | Ga0501031_0030529 | Ga0501031_0030529_1031_1294 | 86 |
| 174 | 3300049569 | Ga0501032_0349463 | Ga0501032_0349463_545_838 | 86 |
| 175 | 3300049571 | Ga0501034_0468555 | Ga0501034_0468555_157_450 | 86 |
| 176 | 3300049572 | Ga0501036_0230377 | Ga0501036_0230377_212_478 | 86 |
| 177 | 3300049572 | Ga0501036_0421975 | Ga0501036_0421975_242_505 | 86 |
| 178 | 3300049572 | Ga0501036_0854244 | Ga0501036_0854244_340_603 | 86 |
| 179 | 3300049574 | Ga0501038_0012468 | Ga0501038_0012468_3774_4067 | 86 |
| 180 | 3300049574 | Ga0501038_1344011 | Ga0501038_1344011_22_285 | 86 |
| 181 | 3300049575 | Ga0501039_0230430 | Ga0501039_0230430_330_623 | 86 |
| 182 | 3300049575 | Ga0501039_0754001 | Ga0501039_0754001_380_643 | 86 |
| 183 | 3300049581 | Ga0501047_0660208 | Ga0501047_0660208_368_661 | 86 |
| 184 | 3300049582 | Ga0501048_0412578 | Ga0501048_0412578_113_379 | 86 |
| 185 | 3300049585 | Ga0501069_0074776 | Ga0501069_0074776_857_1150 | 86 |
| 186 | 3300049586 | Ga0501070_0508200 | Ga0501070_0508200_498_761 | 86 |
| 187 | 3300049587 | Ga0501071_0080362 | Ga0501071_0080362_201_464 | 86 |
| 188 | 3300049587 | Ga0501071_0380886 | Ga0501071_0380886_333_596 | 86 |
| 189 | 3300049587 | Ga0501071_0990720 | Ga0501071_0990720_264_527 | 86 |
| 190 | 3300049588 | Ga0501072_0475249 | Ga0501072_0475249_635_898 | 86 |
| 191 | 3300049588 | Ga0501072_0697267 | Ga0501072_0697267_120_383 | 86 |
| 192 | 3300049589 | Ga0501073_0973500 | Ga0501073_0973500_230_523 | 86 |
| 193 | 3300049590 | Ga0501074_0180325 | Ga0501074_0180325_884_1177 | 86 |
| 194 | 3300049590 | Ga0501074_0498355 | Ga0501074_0498355_139_405 | 86 |
| 195 | 3300049591 | Ga0501075_0682249 | Ga0501075_0682249_379_645 | 86 |
| 196 | 3300049592 | Ga0501076_0603012 | Ga0501076_0603012_193_456 | 86 |
| 197 | 3300049741 | Ga0501079_0504897 | Ga0501079_0504897_166_429 | 86 |
| 198 | 3300049742 | Ga0501080_0626100 | Ga0501080_0626100_41_334 | 86 |
| 199 | 3300049743 | Ga0501081_0351748 | Ga0501081_0351748_559_825 | 86 |
| 200 | 3300049822 | Ga0501035_0342772 | Ga0501035_0342772_216_479 | 86 |
| 201 | 3300050492 | nmdc:mga0yw44_236511_c1 | nmdc:mga0yw44_236511_c1_766_1032 | 86 |
| 202 | 3300054114 | Ga0501084_0986903 | Ga0501084_0986903_360_653 | 86 |
| 203 | 3300061734 | Ga0530510_0153763 | Ga0530510_0153763_734_997 | 86 |
| 204 | 3300061734 | Ga0530510_0648581 | Ga0530510_0648581_447_710 | 86 |
| 205 | 3300009545 | Ga0105237_12451415 | Ga0105237_124514151 | 87 |
| 206 | 3300009553 | Ga0105249_10000893 | Ga0105249_100008937 | 87 |
| 207 | 3300013308 | Ga0157375_12069732 | Ga0157375_120697321 | 87 |
| 208 | 3300014968 | Ga0157379_11833539 | Ga0157379_118335392 | 87 |
| 209 | 3300014969 | Ga0157376_12071362 | Ga0157376_120713622 | 87 |
| 210 | 3300025961 | Ga0207712_10394382 | Ga0207712_103943821 | 87 |
| 211 | 3300028786 | Ga0307517_10017918 | Ga0307517_100179182 | 87 |
| 212 | 3300031507 | Ga0307509_10047201 | Ga0307509_100472015 | 87 |
| 213 | 3300031507 | Ga0307509_10454459 | Ga0307509_104544592 | 87 |
| 214 | 3300031649 | Ga0307514_10169161 | Ga0307514_101691611 | 87 |
| 215 | 3300031730 | Ga0307516_10447551 | Ga0307516_104475512 | 87 |
| 216 | 3300033179 | Ga0307507_10284885 | Ga0307507_102848852 | 87 |
| 217 | 3300033180 | Ga0307510_10241242 | Ga0307510_102412422 | 87 |
| 218 | 3300044656 | Ga0466969_0010944 | Ga0466969_0010944_3817_4083 | 87 |
| 219 | 3300044684 | Ga0466966_0007607 | Ga0466966_0007607_4010_4276 | 87 |
| 220 | 3300044693 | Ga0466961_0117841 | Ga0466961_0117841_358_624 | 87 |
| 221 | 3300044693 | Ga0466961_0758272 | Ga0466961_0758272_100_366 | 87 |
| 222 | 3300044842 | Ga0466957_0675201 | Ga0466957_0675201_399_665 | 87 |
| 223 | 3300045049 | Ga0466959_0038359 | Ga0466959_0038359_382_648 | 87 |
| 224 | 3300046454 | Ga0495592_0016686 | Ga0495592_0016686_4191_4496 | 87 |
| 225 | 3300046454 | Ga0495592_0061579 | Ga0495592_0061579_2010_2276 | 87 |
| 226 | 3300046454 | Ga0495592_0099107 | Ga0495592_0099107_1741_2013 | 87 |
| 227 | 3300046459 | Ga0495629_0144108 | Ga0495629_0144108_346_612 | 87 |
| 228 | 3300046462 | Ga0495651_0006062 | Ga0495651_0006062_1883_2149 | 87 |
| 229 | 3300046462 | Ga0495651_0025606 | Ga0495651_0025606_3875_4141 | 87 |
| 230 | 3300046472 | Ga0495580_0350017 | Ga0495580_0350017_202_468 | 87 |
| 231 | 3300046476 | Ga0495662_0048716 | Ga0495662_0048716_1392_1658 | 87 |
| 232 | 3300046477 | Ga0495664_0138212 | Ga0495664_0138212_162_428 | 87 |
| 233 | 3300046477 | Ga0495664_0272753 | Ga0495664_0272753_352_618 | 87 |
| 234 | 3300046492 | Ga0495585_0131476 | Ga0495585_0131476_1011_1277 | 87 |
| 235 | 3300046499 | Ga0495594_0158154 | Ga0495594_0158154_74_340 | 87 |
| 236 | 3300046499 | Ga0495594_0814536 | Ga0495594_0814536_123_389 | 87 |
| 237 | 3300046514 | Ga0495618_0186191 | Ga0495618_0186191_827_1093 | 87 |
| 238 | 3300046515 | Ga0495620_0341627 | Ga0495620_0341627_26_292 | 87 |
| 239 | 3300046516 | Ga0495628_0019029 | Ga0495628_0019029_4660_4932 | 87 |
| 240 | 3300046516 | Ga0495628_0125953 | Ga0495628_0125953_1111_1377 | 87 |
| 241 | 3300046517 | Ga0495630_0472146 | Ga0495630_0472146_357_623 | 87 |
| 242 | 3300046522 | Ga0495643_0017059 | Ga0495643_0017059_310_576 | 87 |
| 243 | 3300046526 | Ga0495666_0011433 | Ga0495666_0011433_4013_4279 | 87 |
| 244 | 3300046526 | Ga0495666_0065617 | Ga0495666_0065617_1070_1336 | 87 |
| 245 | 3300046529 | Ga0495652_0003268 | Ga0495652_0003268_2201_2473 | 87 |
| 246 | 3300046529 | Ga0495652_0488655 | Ga0495652_0488655_145_411 | 87 |
| 247 | 3300046531 | Ga0495665_0047488 | Ga0495665_0047488_1281_1547 | 87 |
| 248 | 3300046533 | Ga0495640_0098956 | Ga0495640_0098956_684_950 | 87 |
| 249 | 3300046535 | Ga0495586_0014326 | Ga0495586_0014326_2226_2492 | 87 |
| 250 | 3300046535 | Ga0495586_0244879 | Ga0495586_0244879_680_946 | 87 |
| 251 | 3300046536 | Ga0495587_0071684 | Ga0495587_0071684_445_711 | 87 |
| 252 | 3300046543 | Ga0495645_0045123 | Ga0495645_0045123_1812_2084 | 87 |
| 253 | 3300046543 | Ga0495645_0054818 | Ga0495645_0054818_1577_1843 | 87 |
| 254 | 3300046543 | Ga0495645_0859928 | Ga0495645_0859928_198_464 | 87 |
| 255 | 3300046616 | Ga0495668_0538471 | Ga0495668_0538471_227_493 | 87 |
| 256 | 3300046642 | Ga0495634_0061064 | Ga0495634_0061064_19_291 | 87 |
| 257 | 3300046642 | Ga0495634_0189984 | Ga0495634_0189984_842_1108 | 87 |
| 258 | 3300046663 | Ga0495635_0033891 | Ga0495635_0033891_1571_1843 | 87 |
| 259 | 3300046663 | Ga0495635_0066171 | Ga0495635_0066171_810_1076 | 87 |
| 260 | 3300046674 | Ga0495588_0266904 | Ga0495588_0266904_203_469 | 87 |
| 261 | 3300046674 | Ga0495588_0581562 | Ga0495588_0581562_144_443 | 87 |
| 262 | 3300046679 | Ga0495623_0026491 | Ga0495623_0026491_2903_3169 | 87 |
| 263 | 3300046680 | Ga0495646_0018729 | Ga0495646_0018729_1290_1562 | 87 |
| 264 | 3300046680 | Ga0495646_0191874 | Ga0495646_0191874_384_650 | 87 |
| 265 | 3300046683 | Ga0495658_0807805 | Ga0495658_0807805_245_511 | 87 |
| 266 | 3300046689 | Ga0495613_0205198 | Ga0495613_0205198_666_932 | 87 |
| 267 | 3300046690 | Ga0495624_0180502 | Ga0495624_0180502_496_771 | 87 |
| 268 | 3300046691 | Ga0495670_0021740 | Ga0495670_0021740_605_871 | 87 |
| 269 | 3300046692 | Ga0495671_0569688 | Ga0495671_0569688_182_448 | 87 |
| 270 | 3300046794 | Ga0495589_0392610 | Ga0495589_0392610_125_391 | 87 |
| 271 | 3300047315 | Ga0495581_0083003 | Ga0495581_0083003_641_907 | 87 |
| 272 | 3300047315 | Ga0495581_0360709 | Ga0495581_0360709_273_539 | 87 |
| 273 | 3300047317 | Ga0495604_0041494 | Ga0495604_0041494_2500_2766 | 87 |
| 274 | 3300047317 | Ga0495604_0089960 | Ga0495604_0089960_445_711 | 87 |
| 275 | 3300047317 | Ga0495604_0136128 | Ga0495604_0136128_989_1255 | 87 |
| 276 | 3300047443 | Ga0495687_050886 | Ga0495687_050886_401_667 | 87 |
| 277 | 3300047444 | Ga0495675_0504692 | Ga0495675_0504692_319_585 | 87 |
| 278 | 3300047444 | Ga0495675_0596861 | Ga0495675_0596861_117_383 | 87 |
| 279 | 3300047446 | Ga0495679_110918 | Ga0495679_110918_78_344 | 87 |
| 280 | 3300047447 | Ga0495685_000496 | Ga0495685_000496_8756_9022 | 87 |
| 281 | 3300047470 | Ga0495681_0014914 | Ga0495681_0014914_3573_3839 | 87 |
| 282 | 3300047471 | Ga0495684_0850398 | Ga0495684_0850398_103_375 | 87 |
| 283 | 3300047472 | Ga0495686_0155781 | Ga0495686_0155781_970_1236 | 87 |
| 284 | 3300047673 | Ga0495593_0083003 | Ga0495593_0083003_1146_1412 | 87 |
| 285 | 3300047673 | Ga0495593_0192803 | Ga0495593_0192803_233_508 | 87 |
| 286 | 3300047673 | Ga0495593_0712888 | Ga0495593_0712888_128_394 | 87 |
| 287 | 3300048091 | Ga0495626_0263777 | Ga0495626_0263777_385_651 | 87 |
| 288 | 3300048905 | Ga0496102_0067957 | Ga0496102_0067957_1669_1935 | 87 |
| 289 | 3300048919 | Ga0496116_0000224 | Ga0496116_0000224_101584_101850 | 87 |
| 290 | 3300048920 | Ga0496117_0074800 | Ga0496117_0074800_980_1246 | 87 |
| 291 | 3300048921 | Ga0496118_0028149 | Ga0496118_0028149_4260_4526 | 87 |
| 292 | 3300048922 | Ga0496119_0010949 | Ga0496119_0010949_2905_3171 | 87 |
| 293 | 3300048923 | Ga0496120_0054158 | Ga0496120_0054158_1787_2053 | 87 |
| 294 | 3300049569 | Ga0501032_0180754 | Ga0501032_0180754_753_1019 | 87 |
| 295 | 3300049822 | Ga0501035_0023964 | Ga0501035_0023964_3665_3931 | 87 |
| 296 | 3300049823 | Ga0501044_0526391 | Ga0501044_0526391_239_505 | 87 |
| 297 | 3300053077 | Ga0495601_0054952 | Ga0495601_0054952_2168_2434 | 87 |
| 298 | 3300053078 | Ga0495612_0008332 | Ga0495612_0008332_3865_4137 | 87 |
| 299 | 3300053079 | Ga0500610_0386853 | Ga0500610_0386853_293_559 | 87 |
| 300 | 3300053085 | Ga0495619_0027478 | Ga0495619_0027478_1384_1650 | 87 |
| 301 | 3300053086 | Ga0500578_0300672 | Ga0500578_0300672_192_458 | 87 |
| 302 | 3300053094 | Ga0500566_0118491 | Ga0500566_0118491_1038_1304 | 87 |
| 303 | 3300053099 | Ga0500654_033475 | Ga0500654_033475_1119_1385 | 87 |
| 304 | 3300053101 | Ga0500553_065288 | Ga0500553_065288_1278_1544 | 87 |
| 305 | 3300053105 | Ga0500557_282067 | Ga0500557_282067_14_280 | 87 |
| 306 | 3300053107 | Ga0500560_003175 | Ga0500560_003175_788_1063 | 87 |
| 307 | 3300053109 | Ga0500569_300851 | Ga0500569_300851_162_428 | 87 |
| 308 | 3300053123 | Ga0500614_004621 | Ga0500614_004621_90_356 | 87 |
| 309 | 3300053129 | Ga0500628_001538 | Ga0500628_001538_2293_2559 | 87 |
| 310 | 3300053131 | Ga0500652_016845 | Ga0500652_016845_2338_2604 | 87 |
| 311 | 3300053134 | Ga0500658_0200313 | Ga0500658_0200313_69_335 | 87 |
| 312 | 3300053137 | Ga0500561_0236589 | Ga0500561_0236589_32_298 | 87 |
| 313 | 3300053140 | Ga0500573_0068501 | Ga0500573_0068501_530_805 | 87 |
| 314 | 3300053140 | Ga0500573_0553024 | Ga0500573_0553024_16_282 | 87 |
| 315 | 3300053142 | Ga0500577_0207329 | Ga0500577_0207329_549_815 | 87 |
| 316 | 3300053143 | Ga0500579_081841 | Ga0500579_081841_853_1119 | 87 |
| 317 | 3300053146 | Ga0500588_0287378 | Ga0500588_0287378_244_510 | 87 |
| 318 | 3300053149 | Ga0500600_0132375 | Ga0500600_0132375_638_904 | 87 |
| 319 | 3300053150 | Ga0500603_172460 | Ga0500603_172460_308_574 | 87 |
| 320 | 3300053153 | Ga0500616_0007990 | Ga0500616_0007990_553_819 | 87 |
| 321 | 3300053160 | Ga0500633_0044639 | Ga0500633_0044639_1195_1461 | 87 |
| 322 | 3300053161 | Ga0500634_0106343 | Ga0500634_0106343_162_428 | 87 |
| 323 | 3300053177 | Ga0500636_0080281 | Ga0500636_0080281_525_800 | 87 |
| 324 | 3300053739 | Ga0500587_069614 | Ga0500587_069614_80_346 | 87 |
| 325 | iso_pu_bacteria | 2902799365 | 2902800310 | 87 |
| 326 | 3300030521 | Ga0307511_10407805 | Ga0307511_104078051 | 88 |
| 327 | 3300031507 | Ga0307509_10005545 | Ga0307509_100055459 | 88 |
| 328 | 3300031507 | Ga0307509_10030807 | Ga0307509_100308074 | 88 |
| 329 | 3300031838 | Ga0307518_10184284 | Ga0307518_101842842 | 88 |
| 330 | 3300033179 | Ga0307507_10648236 | Ga0307507_106482361 | 88 |
| 331 | 3300033180 | Ga0307510_10552553 | Ga0307510_105525532 | 88 |
| 332 | 3300046459 | Ga0495629_1146408 | Ga0495629_1146408_216_485 | 88 |
| 333 | 3300046499 | Ga0495594_0136541 | Ga0495594_0136541_772_1077 | 88 |
| 334 | 3300046533 | Ga0495640_0209947 | Ga0495640_0209947_360_629 | 88 |
| 335 | 3300046663 | Ga0495635_0006391 | Ga0495635_0006391_7483_7752 | 88 |
| 336 | 3300046674 | Ga0495588_0079881 | Ga0495588_0079881_978_1247 | 88 |
| 337 | 3300046674 | Ga0495588_0203676 | Ga0495588_0203676_480_749 | 88 |
| 338 | 3300046683 | Ga0495658_0598078 | Ga0495658_0598078_132_401 | 88 |
| 339 | 3300046690 | Ga0495624_0079456 | Ga0495624_0079456_54_359 | 88 |
| 340 | 3300047315 | Ga0495581_0108630 | Ga0495581_0108630_461_730 | 88 |
| 341 | 3300049742 | Ga0501080_0176297 | Ga0501080_0176297_684_950 | 88 |
| 342 | 3300053085 | Ga0495619_0033191 | Ga0495619_0033191_2533_2802 | 88 |
| 343 | 3300053094 | Ga0500566_0037844 | Ga0500566_0037844_1347_1652 | 88 |
| 344 | 3300053094 | Ga0500566_0201144 | Ga0500566_0201144_438_707 | 88 |
| 345 | 3300053095 | Ga0500640_039268 | Ga0500640_039268_1350_1619 | 88 |
| 346 | 3300053101 | Ga0500553_024427 | Ga0500553_024427_1685_1954 | 88 |
| 347 | 3300053107 | Ga0500560_026695 | Ga0500560_026695_238_543 | 88 |
| 348 | 3300053107 | Ga0500560_141531 | Ga0500560_141531_38_307 | 88 |
| 349 | 3300053145 | Ga0500586_175224 | Ga0500586_175224_192_497 | 88 |
| 350 | 3300053150 | Ga0500603_105942 | Ga0500603_105942_35_304 | 88 |
| 351 | 3300002067 | JGI24735J21928_10262872 | JGI24735J21928_102628722 | 89 |
| 352 | 3300003792 | Ga0055540_1000151 | Ga0055540_100015117 | 89 |
| 353 | 3300003792 | Ga0055540_1002619 | Ga0055540_10026193 | 89 |
| 354 | 3300005327 | Ga0070658_11209786 | Ga0070658_112097862 | 89 |
| 355 | 3300005329 | Ga0070683_100410732 | Ga0070683_1004107322 | 89 |
| 356 | 3300005335 | Ga0070666_10190121 | Ga0070666_101901212 | 89 |
| 357 | 3300005337 | Ga0070682_100028453 | Ga0070682_1000284532 | 89 |
| 358 | 3300005338 | Ga0068868_100572660 | Ga0068868_1005726602 | 89 |
| 359 | 3300005344 | Ga0070661_100338371 | Ga0070661_1003383712 | 89 |
| 360 | 3300005345 | Ga0070692_10435347 | Ga0070692_104353472 | 89 |
| 361 | 3300005347 | Ga0070668_100000135 | Ga0070668_10000013543 | 89 |
| 362 | 3300005347 | Ga0070668_100246617 | Ga0070668_1002466172 | 89 |
| 363 | 3300005347 | Ga0070668_101066142 | Ga0070668_1010661421 | 89 |
| 364 | 3300005347 | Ga0070668_101545761 | Ga0070668_1015457611 | 89 |
| 365 | 3300005347 | Ga0070668_101641947 | Ga0070668_1016419471 | 89 |
| 366 | 3300005356 | Ga0070674_100402110 | Ga0070674_1004021102 | 89 |
| 367 | 3300005366 | Ga0070659_100469314 | Ga0070659_1004693141 | 89 |
| 368 | 3300005367 | Ga0070667_100000042 | Ga0070667_10000004219 | 89 |
| 369 | 3300005367 | Ga0070667_100000274 | Ga0070667_10000027434 | 89 |
| 370 | 3300005435 | Ga0070714_100045388 | Ga0070714_1000453884 | 89 |
| 371 | 3300005435 | Ga0070714_101393875 | Ga0070714_1013938752 | 89 |
| 372 | 3300005435 | Ga0070714_101619788 | Ga0070714_1016197882 | 89 |
| 373 | 3300005436 | Ga0070713_100595319 | Ga0070713_1005953192 | 89 |
| 374 | 3300005439 | Ga0070711_101204552 | Ga0070711_1012045521 | 89 |
| 375 | 3300005440 | Ga0070705_101435470 | Ga0070705_1014354701 | 89 |
| 376 | 3300005441 | Ga0070700_100107259 | Ga0070700_1001072592 | 89 |
| 377 | 3300005445 | Ga0070708_100584824 | Ga0070708_1005848242 | 89 |
| 378 | 3300005455 | Ga0070663_100102737 | Ga0070663_1001027372 | 89 |
| 379 | 3300005455 | Ga0070663_101587118 | Ga0070663_1015871181 | 89 |
| 380 | 3300005457 | Ga0070662_101879226 | Ga0070662_1018792262 | 89 |
| 381 | 3300005466 | Ga0070685_11553285 | Ga0070685_115532852 | 89 |
| 382 | 3300005535 | Ga0070684_100065536 | Ga0070684_1000655363 | 89 |
| 383 | 3300005544 | Ga0070686_101938923 | Ga0070686_1019389231 | 89 |
| 384 | 3300005546 | Ga0070696_101361153 | Ga0070696_1013611531 | 89 |
| 385 | 3300005547 | Ga0070693_101080182 | Ga0070693_1010801821 | 89 |
| 386 | 3300005548 | Ga0070665_100004204 | Ga0070665_10000420414 | 89 |
| 387 | 3300005548 | Ga0070665_100311437 | Ga0070665_1003114372 | 89 |
| 388 | 3300005548 | Ga0070665_100821694 | Ga0070665_1008216942 | 89 |
| 389 | 3300005548 | Ga0070665_101369684 | Ga0070665_1013696842 | 89 |
| 390 | 3300005548 | Ga0070665_101429280 | Ga0070665_1014292801 | 89 |
| 391 | 3300005549 | Ga0070704_102237836 | Ga0070704_1022378361 | 89 |
| 392 | 3300005578 | Ga0068854_102050603 | Ga0068854_1020506031 | 89 |
| 393 | 3300005615 | Ga0070702_100945331 | Ga0070702_1009453312 | 89 |
| 394 | 3300005617 | Ga0068859_100000471 | Ga0068859_1000004718 | 89 |
| 395 | 3300005617 | Ga0068859_100889849 | Ga0068859_1008898492 | 89 |
| 396 | 3300005617 | Ga0068859_102292451 | Ga0068859_1022924511 | 89 |
| 397 | 3300005618 | Ga0068864_100588681 | Ga0068864_1005886811 | 89 |
| 398 | 3300005618 | Ga0068864_100698018 | Ga0068864_1006980182 | 89 |
| 399 | 3300005719 | Ga0068861_101103979 | Ga0068861_1011039792 | 89 |
| 400 | 3300005840 | Ga0068870_10521725 | Ga0068870_105217252 | 89 |
| 401 | 3300005841 | Ga0068863_100000461 | Ga0068863_10000046125 | 89 |
| 402 | 3300005842 | Ga0068858_100500442 | Ga0068858_1005004422 | 89 |
| 403 | 3300005842 | Ga0068858_100560696 | Ga0068858_1005606962 | 89 |
| 404 | 3300005842 | Ga0068858_101078361 | Ga0068858_1010783612 | 89 |
| 405 | 3300005842 | Ga0068858_101503276 | Ga0068858_1015032761 | 89 |
| 406 | 3300005843 | Ga0068860_100000020 | Ga0068860_100000020139 | 89 |
| 407 | 3300005843 | Ga0068860_100779242 | Ga0068860_1007792422 | 89 |
| 408 | 3300005844 | Ga0068862_100000013 | Ga0068862_100000013121 | 89 |
| 409 | 3300005844 | Ga0068862_101297974 | Ga0068862_1012979742 | 89 |
| 410 | 3300005937 | Ga0081455_10024225 | Ga0081455_100242251 | 89 |
| 411 | 3300006038 | Ga0075365_10074626 | Ga0075365_100746263 | 89 |
| 412 | 3300006038 | Ga0075365_10391308 | Ga0075365_103913082 | 89 |
| 413 | 3300006042 | Ga0075368_10503722 | Ga0075368_105037222 | 89 |
| 414 | 3300006048 | Ga0075363_100005406 | Ga0075363_1000054063 | 89 |
| 415 | 3300006048 | Ga0075363_100005932 | Ga0075363_1000059323 | 89 |
| 416 | 3300006048 | Ga0075363_100019867 | Ga0075363_1000198674 | 89 |
| 417 | 3300006048 | Ga0075363_100200463 | Ga0075363_1002004633 | 89 |
| 418 | 3300006048 | Ga0075363_100297706 | Ga0075363_1002977061 | 89 |
| 419 | 3300006048 | Ga0075363_100597962 | Ga0075363_1005979622 | 89 |
| 420 | 3300006048 | Ga0075363_100621748 | Ga0075363_1006217482 | 89 |
| 421 | 3300006048 | Ga0075363_100673127 | Ga0075363_1006731272 | 89 |
| 422 | 3300006051 | Ga0075364_10003432 | Ga0075364_100034329 | 89 |
| 423 | 3300006051 | Ga0075364_10014156 | Ga0075364_100141565 | 89 |
| 424 | 3300006051 | Ga0075364_10034551 | Ga0075364_100345513 | 89 |
| 425 | 3300006051 | Ga0075364_10086192 | Ga0075364_100861923 | 89 |
| 426 | 3300006173 | Ga0070716_100963608 | Ga0070716_1009636082 | 89 |
| 427 | 3300006177 | Ga0075362_10019106 | Ga0075362_100191062 | 89 |
| 428 | 3300006177 | Ga0075362_10157816 | Ga0075362_101578162 | 89 |
| 429 | 3300006177 | Ga0075362_10306135 | Ga0075362_103061352 | 89 |
| 430 | 3300006177 | Ga0075362_10337011 | Ga0075362_103370112 | 89 |
| 431 | 3300006177 | Ga0075362_10584410 | Ga0075362_105844101 | 89 |
| 432 | 3300006177 | Ga0075362_10617066 | Ga0075362_106170661 | 89 |
| 433 | 3300006178 | Ga0075367_10103437 | Ga0075367_101034373 | 89 |
| 434 | 3300006178 | Ga0075367_10438805 | Ga0075367_104388051 | 89 |
| 435 | 3300006178 | Ga0075367_10888451 | Ga0075367_108884511 | 89 |
| 436 | 3300006178 | Ga0075367_10952805 | Ga0075367_109528052 | 89 |
| 437 | 3300006186 | Ga0075369_10000373 | Ga0075369_100003733 | 89 |
| 438 | 3300006186 | Ga0075369_10022073 | Ga0075369_100220735 | 89 |
| 439 | 3300006186 | Ga0075369_10028716 | Ga0075369_100287162 | 89 |
| 440 | 3300006186 | Ga0075369_10035046 | Ga0075369_100350462 | 89 |
| 441 | 3300006186 | Ga0075369_10045729 | Ga0075369_100457293 | 89 |
| 442 | 3300006186 | Ga0075369_10046326 | Ga0075369_100463262 | 89 |
| 443 | 3300006186 | Ga0075369_10168304 | Ga0075369_101683041 | 89 |
| 444 | 3300006353 | Ga0075370_10003259 | Ga0075370_100032592 | 89 |
| 445 | 3300006353 | Ga0075370_10022515 | Ga0075370_100225152 | 89 |
| 446 | 3300006353 | Ga0075370_10080322 | Ga0075370_100803221 | 89 |
| 447 | 3300006353 | Ga0075370_10233640 | Ga0075370_102336403 | 89 |
| 448 | 3300006353 | Ga0075370_10405396 | Ga0075370_104053962 | 89 |
| 449 | 3300006353 | Ga0075370_10731034 | Ga0075370_107310342 | 89 |
| 450 | 3300006353 | Ga0075370_10823286 | Ga0075370_108232862 | 89 |
| 451 | 3300006358 | Ga0068871_101646764 | Ga0068871_1016467642 | 89 |
| 452 | 3300006846 | Ga0075430_100200493 | Ga0075430_1002004932 | 89 |
| 453 | 3300006881 | Ga0068865_100993388 | Ga0068865_1009933882 | 89 |
| 454 | 3300006931 | Ga0097620_100000471 | Ga0097620_10000047128 | 89 |
| 455 | 3300006931 | Ga0097620_100889643 | Ga0097620_1008896432 | 89 |
| 456 | 3300006931 | Ga0097620_102293156 | Ga0097620_1022931561 | 89 |
| 457 | 3300009036 | Ga0105244_10150940 | Ga0105244_101509402 | 89 |
| 458 | 3300009092 | Ga0105250_10023932 | Ga0105250_100239324 | 89 |
| 459 | 3300009092 | Ga0105250_10562437 | Ga0105250_105624371 | 89 |
| 460 | 3300009094 | Ga0111539_11999102 | Ga0111539_119991022 | 89 |
| 461 | 3300009098 | Ga0105245_10085834 | Ga0105245_100858341 | 89 |
| 462 | 3300009098 | Ga0105245_10712316 | Ga0105245_107123162 | 89 |
| 463 | 3300009098 | Ga0105245_13252537 | Ga0105245_132525372 | 89 |
| 464 | 3300009101 | Ga0105247_10000009 | Ga0105247_10000009238 | 89 |
| 465 | 3300009101 | Ga0105247_10118015 | Ga0105247_101180152 | 89 |
| 466 | 3300009148 | Ga0105243_10000598 | Ga0105243_1000059826 | 89 |
| 467 | 3300009148 | Ga0105243_10561769 | Ga0105243_105617692 | 89 |
| 468 | 3300009148 | Ga0105243_11656363 | Ga0105243_116563632 | 89 |
| 469 | 3300009174 | Ga0105241_10275985 | Ga0105241_102759852 | 89 |
| 470 | 3300009177 | Ga0105248_10000197 | Ga0105248_1000019763 | 89 |
| 471 | 3300009545 | Ga0105237_10061716 | Ga0105237_100617163 | 89 |
| 472 | 3300009553 | Ga0105249_10000057 | Ga0105249_1000005724 | 89 |
| 473 | 3300009553 | Ga0105249_11914622 | Ga0105249_119146222 | 89 |
| 474 | 3300010159 | Ga0099796_10006106 | Ga0099796_100061063 | 89 |
| 475 | 3300010375 | Ga0105239_10026275 | Ga0105239_100262752 | 89 |
| 476 | 3300010375 | Ga0105239_10087947 | Ga0105239_100879471 | 89 |
| 477 | 3300010375 | Ga0105239_10118860 | Ga0105239_101188601 | 89 |
| 478 | 3300010375 | Ga0105239_10394938 | Ga0105239_103949382 | 89 |
| 479 | 3300010375 | Ga0105239_11951386 | Ga0105239_119513862 | 89 |
| 480 | 3300011119 | Ga0105246_11109711 | Ga0105246_111097112 | 89 |
| 481 | 3300011119 | Ga0105246_11170302 | Ga0105246_111703022 | 89 |
| 482 | 3300012491 | Ga0157329_1026181 | Ga0157329_10261811 | 89 |
| 483 | 3300013296 | Ga0157374_11586542 | Ga0157374_115865421 | 89 |
| 484 | 3300013306 | Ga0163162_10671561 | Ga0163162_106715612 | 89 |
| 485 | 3300013307 | Ga0157372_11540065 | Ga0157372_115400652 | 89 |
| 486 | 3300013308 | Ga0157375_10225070 | Ga0157375_102250702 | 89 |
| 487 | 3300013308 | Ga0157375_11736707 | Ga0157375_117367071 | 89 |
| 488 | 3300014325 | Ga0163163_10010646 | Ga0163163_100106467 | 89 |
| 489 | 3300014326 | Ga0157380_11136872 | Ga0157380_111368722 | 89 |
| 490 | 3300014326 | Ga0157380_11284015 | Ga0157380_112840151 | 89 |
| 491 | 3300014745 | Ga0157377_10283700 | Ga0157377_102837002 | 89 |
| 492 | 3300014968 | Ga0157379_10716254 | Ga0157379_107162542 | 89 |
| 493 | 3300014968 | Ga0157379_11527198 | Ga0157379_115271981 | 89 |
| 494 | 3300014969 | Ga0157376_11908841 | Ga0157376_119088412 | 89 |
| 495 | 3300017792 | Ga0163161_11716767 | Ga0163161_117167671 | 89 |
| 496 | 3300025303 | Ga0209051_1003563 | Ga0209051_10035634 | 89 |
| 497 | 3300025711 | Ga0207696_1101006 | Ga0207696_11010062 | 89 |
| 498 | 3300025900 | Ga0207710_10000014 | Ga0207710_10000014254 | 89 |
| 499 | 3300025900 | Ga0207710_10320176 | Ga0207710_103201762 | 89 |
| 500 | 3300025901 | Ga0207688_10163062 | Ga0207688_101630622 | 89 |
| 501 | 3300025903 | Ga0207680_10091100 | Ga0207680_100911001 | 89 |
| 502 | 3300025904 | Ga0207647_10404704 | Ga0207647_104047042 | 89 |
| 503 | 3300025906 | Ga0207699_10633728 | Ga0207699_106337282 | 89 |
| 504 | 3300025908 | Ga0207643_10200708 | Ga0207643_102007081 | 89 |
| 505 | 3300025909 | Ga0207705_10778383 | Ga0207705_107783831 | 89 |
| 506 | 3300025911 | Ga0207654_10539073 | Ga0207654_105390732 | 89 |
| 507 | 3300025914 | Ga0207671_10040113 | Ga0207671_100401133 | 89 |
| 508 | 3300025920 | Ga0207649_10627625 | Ga0207649_106276252 | 89 |
| 509 | 3300025923 | Ga0207681_10005666 | Ga0207681_100056669 | 89 |
| 510 | 3300025929 | Ga0207664_10025334 | Ga0207664_100253346 | 89 |
| 511 | 3300025929 | Ga0207664_10075031 | Ga0207664_100750312 | 89 |
| 512 | 3300025932 | Ga0207690_11199894 | Ga0207690_111998942 | 89 |
| 513 | 3300025933 | Ga0207706_11295728 | Ga0207706_112957282 | 89 |
| 514 | 3300025935 | Ga0207709_10002071 | Ga0207709_100020719 | 89 |
| 515 | 3300025935 | Ga0207709_11014946 | Ga0207709_110149461 | 89 |
| 516 | 3300025937 | Ga0207669_10412504 | Ga0207669_104125042 | 89 |
| 517 | 3300025938 | Ga0207704_10381250 | Ga0207704_103812501 | 89 |
| 518 | 3300025939 | Ga0207665_10706556 | Ga0207665_107065562 | 89 |
| 519 | 3300025941 | Ga0207711_10000146 | Ga0207711_100001468 | 89 |
| 520 | 3300025961 | Ga0207712_10000050 | Ga0207712_10000050132 | 89 |
| 521 | 3300025961 | Ga0207712_11139535 | Ga0207712_111395351 | 89 |
| 522 | 3300025972 | Ga0207668_10000867 | Ga0207668_100008677 | 89 |
| 523 | 3300025972 | Ga0207668_10581840 | Ga0207668_105818402 | 89 |
| 524 | 3300025972 | Ga0207668_11008683 | Ga0207668_110086832 | 89 |
| 525 | 3300025986 | Ga0207658_10000423 | Ga0207658_1000042311 | 89 |
| 526 | 3300025986 | Ga0207658_10000540 | Ga0207658_1000054016 | 89 |
| 527 | 3300026023 | Ga0207677_10319257 | Ga0207677_103192572 | 89 |
| 528 | 3300026035 | Ga0207703_10125009 | Ga0207703_101250093 | 89 |
| 529 | 3300026035 | Ga0207703_10299081 | Ga0207703_102990812 | 89 |
| 530 | 3300026035 | Ga0207703_11027484 | Ga0207703_110274842 | 89 |
| 531 | 3300026035 | Ga0207703_12218416 | Ga0207703_122184161 | 89 |
| 532 | 3300026041 | Ga0207639_10962036 | Ga0207639_109620361 | 89 |
| 533 | 3300026067 | Ga0207678_10068893 | Ga0207678_100688933 | 89 |
| 534 | 3300026067 | Ga0207678_10767648 | Ga0207678_107676481 | 89 |
| 535 | 3300026075 | Ga0207708_10560550 | Ga0207708_105605502 | 89 |
| 536 | 3300026088 | Ga0207641_10000613 | Ga0207641_1000061324 | 89 |
| 537 | 3300026095 | Ga0207676_10409403 | Ga0207676_104094032 | 89 |
| 538 | 3300026095 | Ga0207676_11956270 | Ga0207676_119562701 | 89 |
| 539 | 3300026118 | Ga0207675_101813949 | Ga0207675_1018139492 | 89 |
| 540 | 3300026121 | Ga0207683_10893913 | Ga0207683_108939132 | 89 |
| 541 | 3300028379 | Ga0268266_10018590 | Ga0268266_100185902 | 89 |
| 542 | 3300028379 | Ga0268266_10374901 | Ga0268266_103749012 | 89 |
| 543 | 3300028379 | Ga0268266_10958213 | Ga0268266_109582132 | 89 |
| 544 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004132 | 89 |
| 545 | 3300028380 | Ga0268265_12327120 | Ga0268265_123271201 | 89 |
| 546 | 3300028381 | Ga0268264_10000024 | Ga0268264_10000024131 | 89 |
| 547 | 3300028381 | Ga0268264_10844471 | Ga0268264_108444712 | 89 |
| 548 | 3300031251 | Ga0265327_10000069 | Ga0265327_1000006956 | 89 |
| 549 | 3300031251 | Ga0265327_10001438 | Ga0265327_100014386 | 89 |
| 550 | 3300031251 | Ga0265327_10019782 | Ga0265327_100197825 | 89 |
| 551 | 3300031251 | Ga0265327_10327421 | Ga0265327_103274211 | 89 |
| 552 | 3300031824 | Ga0307413_11888227 | Ga0307413_118882272 | 89 |
| 553 | 3300031824 | Ga0307413_11981530 | Ga0307413_119815301 | 89 |
| 554 | 3300031852 | Ga0307410_10306619 | Ga0307410_103066192 | 89 |
| 555 | 3300031901 | Ga0307406_11228063 | Ga0307406_112280631 | 89 |
| 556 | 3300031901 | Ga0307406_11860367 | Ga0307406_118603671 | 89 |
| 557 | 3300031995 | Ga0307409_100379638 | Ga0307409_1003796382 | 89 |
| 558 | 3300031995 | Ga0307409_101765499 | Ga0307409_1017654991 | 89 |
| 559 | 3300032002 | Ga0307416_102453787 | Ga0307416_1024537872 | 89 |
| 560 | 3300032004 | Ga0307414_11100675 | Ga0307414_111006752 | 89 |
| 561 | 3300032005 | Ga0307411_10820447 | Ga0307411_108204472 | 89 |
| 562 | 3300032126 | Ga0307415_100388882 | Ga0307415_1003888823 | 89 |
| 563 | 3300032126 | Ga0307415_100559446 | Ga0307415_1005594461 | 89 |
| 564 | 3300035121 | Ga0373960_0161396 | Ga0373960_0161396_207_476 | 89 |
| 565 | 3300039447 | Ga0436361_0252756 | Ga0436361_0252756_45_314 | 89 |
| 566 | 3300041410 | Ga0439461_0000249 | Ga0439461_0000249_1364_1633 | 89 |
| 567 | 3300041410 | Ga0439461_0052714 | Ga0439461_0052714_225_494 | 89 |
| 568 | 3300041410 | Ga0439461_0083337 | Ga0439461_0083337_19_288 | 89 |
| 569 | 3300041411 | Ga0439466_0000731 | Ga0439466_0000731_969_1238 | 89 |
| 570 | 3300041411 | Ga0439466_0034022 | Ga0439466_0034022_1312_1581 | 89 |
| 571 | 3300041411 | Ga0439466_0159818 | Ga0439466_0159818_27_296 | 89 |
| 572 | 3300041413 | Ga0439465_0006081 | Ga0439465_0006081_1310_1579 | 89 |
| 573 | 3300041413 | Ga0439465_0007513 | Ga0439465_0007513_1192_1461 | 89 |
| 574 | 3300041413 | Ga0439465_0093910 | Ga0439465_0093910_670_939 | 89 |
| 575 | 3300041443 | Ga0451789_0123174 | Ga0451789_0123174_115_387 | 89 |
| 576 | 3300041453 | Ga0451797_0476086 | Ga0451797_0476086_213_482 | 89 |
| 577 | 3300041458 | Ga0451798_1141269 | Ga0451798_1141269_318_587 | 89 |
| 578 | 3300041459 | Ga0451800_0113281 | Ga0451800_0113281_60_335 | 89 |
| 579 | 3300041460 | Ga0451802_0131784 | Ga0451802_0131784_91_360 | 89 |
| 580 | 3300041460 | Ga0451802_1390458 | Ga0451802_1390458_50_319 | 89 |
| 581 | 3300041491 | Ga0451833_1288190 | Ga0451833_1288190_349_618 | 89 |
| 582 | 3300041494 | Ga0451837_1558681 | Ga0451837_1558681_162_431 | 89 |
| 583 | 3300041498 | Ga0451841_0221605 | Ga0451841_0221605_85_354 | 89 |
| 584 | 3300041503 | Ga0451847_0332780 | Ga0451847_0332780_152_421 | 89 |
| 585 | 3300041512 | Ga0451853_0580394 | Ga0451853_0580394_867_1136 | 89 |
| 586 | 3300041997 | Ga0439431_0132154 | Ga0439431_0132154_230_499 | 89 |
| 587 | 3300042004 | Ga0439445_0001278 | Ga0439445_0001278_260_529 | 89 |
| 588 | 3300042004 | Ga0439445_0062953 | Ga0439445_0062953_185_454 | 89 |
| 589 | 3300042435 | Ga0439434_0014178 | Ga0439434_0014178_1027_1296 | 89 |
| 590 | 3300042435 | Ga0439434_0082490 | Ga0439434_0082490_309_578 | 89 |
| 591 | 3300042438 | Ga0439459_0019225 | Ga0439459_0019225_338_607 | 89 |
| 592 | 3300044658 | Ga0466972_0331971 | Ga0466972_0331971_15_284 | 89 |
| 593 | 3300044658 | Ga0466972_0551732 | Ga0466972_0551732_49_318 | 89 |
| 594 | 3300044683 | Ga0466965_0117270 | Ga0466965_0117270_75_344 | 89 |
| 595 | 3300044706 | Ga0466964_0574706 | Ga0466964_0574706_221_490 | 89 |
| 596 | 3300044735 | Ga0466968_0001212 | Ga0466968_0001212_2350_2619 | 89 |
| 597 | 3300044765 | Ga0466970_0182169 | Ga0466970_0182169_376_645 | 89 |
| 598 | 3300044842 | Ga0466957_0594013 | Ga0466957_0594013_57_326 | 89 |
| 599 | 3300044901 | Ga0466960_0040240 | Ga0466960_0040240_1906_2175 | 89 |
| 600 | 3300045049 | Ga0466959_0146553 | Ga0466959_0146553_699_968 | 89 |
| 601 | 3300045976 | Ga0466967_0129620 | Ga0466967_0129620_1001_1270 | 89 |
| 602 | 3300045976 | Ga0466967_0989430 | Ga0466967_0989430_189_458 | 89 |
| 603 | 3300045976 | Ga0466967_1341909 | Ga0466967_1341909_282_551 | 89 |
| 604 | 3300046455 | Ga0495603_0066746 | Ga0495603_0066746_1421_1690 | 89 |
| 605 | 3300046455 | Ga0495603_0890677 | Ga0495603_0890677_168_437 | 89 |
| 606 | 3300046459 | Ga0495629_0339864 | Ga0495629_0339864_153_422 | 89 |
| 607 | 3300046460 | Ga0495638_0000703 | Ga0495638_0000703_25218_25487 | 89 |
| 608 | 3300046460 | Ga0495638_0021521 | Ga0495638_0021521_2088_2357 | 89 |
| 609 | 3300046460 | Ga0495638_0094292 | Ga0495638_0094292_1370_1639 | 89 |
| 610 | 3300046460 | Ga0495638_0170814 | Ga0495638_0170814_35_304 | 89 |
| 611 | 3300046461 | Ga0495641_0059507 | Ga0495641_0059507_726_995 | 89 |
| 612 | 3300046472 | Ga0495580_0415094 | Ga0495580_0415094_372_641 | 89 |
| 613 | 3300046472 | Ga0495580_0483604 | Ga0495580_0483604_188_457 | 89 |
| 614 | 3300046473 | Ga0495582_0250240 | Ga0495582_0250240_100_369 | 89 |
| 615 | 3300046475 | Ga0495639_0110399 | Ga0495639_0110399_582_851 | 89 |
| 616 | 3300046506 | Ga0495583_0318590 | Ga0495583_0318590_325_594 | 89 |
| 617 | 3300046506 | Ga0495583_0334764 | Ga0495583_0334764_238_513 | 89 |
| 618 | 3300046517 | Ga0495630_1170586 | Ga0495630_1170586_124_393 | 89 |
| 619 | 3300046524 | Ga0495648_0008525 | Ga0495648_0008525_3190_3465 | 89 |
| 620 | 3300046524 | Ga0495648_0019522 | Ga0495648_0019522_61_330 | 89 |
| 621 | 3300046524 | Ga0495648_0288433 | Ga0495648_0288433_333_602 | 89 |
| 622 | 3300046530 | Ga0495654_0015950 | Ga0495654_0015950_3113_3382 | 89 |
| 623 | 3300046530 | Ga0495654_0058658 | Ga0495654_0058658_11_280 | 89 |
| 624 | 3300046530 | Ga0495654_0064436 | Ga0495654_0064436_996_1271 | 89 |
| 625 | 3300046531 | Ga0495665_0027770 | Ga0495665_0027770_984_1253 | 89 |
| 626 | 3300046531 | Ga0495665_0120258 | Ga0495665_0120258_149_418 | 89 |
| 627 | 3300046533 | Ga0495640_0377725 | Ga0495640_0377725_51_320 | 89 |
| 628 | 3300046535 | Ga0495586_0796234 | Ga0495586_0796234_251_520 | 89 |
| 629 | 3300046557 | Ga0495622_0320885 | Ga0495622_0320885_72_341 | 89 |
| 630 | 3300046616 | Ga0495668_0012128 | Ga0495668_0012128_3823_4092 | 89 |
| 631 | 3300046616 | Ga0495668_0082396 | Ga0495668_0082396_1142_1411 | 89 |
| 632 | 3300046642 | Ga0495634_0384440 | Ga0495634_0384440_540_809 | 89 |
| 633 | 3300046648 | Ga0495611_0054878 | Ga0495611_0054878_837_1106 | 89 |
| 634 | 3300046648 | Ga0495611_0082247 | Ga0495611_0082247_589_864 | 89 |
| 635 | 3300046674 | Ga0495588_0096591 | Ga0495588_0096591_1176_1445 | 89 |
| 636 | 3300046674 | Ga0495588_0366651 | Ga0495588_0366651_161_430 | 89 |
| 637 | 3300046683 | Ga0495658_0158081 | Ga0495658_0158081_256_525 | 89 |
| 638 | 3300046690 | Ga0495624_0115614 | Ga0495624_0115614_390_659 | 89 |
| 639 | 3300046690 | Ga0495624_0243802 | Ga0495624_0243802_233_502 | 89 |
| 640 | 3300046692 | Ga0495671_0278343 | Ga0495671_0278343_154_429 | 89 |
| 641 | 3300046694 | Ga0495649_0085277 | Ga0495649_0085277_1016_1285 | 89 |
| 642 | 3300046694 | Ga0495649_0481648 | Ga0495649_0481648_148_417 | 89 |
| 643 | 3300047315 | Ga0495581_0121613 | Ga0495581_0121613_1137_1406 | 89 |
| 644 | 3300047315 | Ga0495581_0129659 | Ga0495581_0129659_679_948 | 89 |
| 645 | 3300047319 | Ga0495674_0490042 | Ga0495674_0490042_257_526 | 89 |
| 646 | 3300047320 | Ga0495672_0001616 | Ga0495672_0001616_18522_18797 | 89 |
| 647 | 3300047320 | Ga0495672_0006905 | Ga0495672_0006905_3473_3742 | 89 |
| 648 | 3300047320 | Ga0495672_0006953 | Ga0495672_0006953_3593_3862 | 89 |
| 649 | 3300047320 | Ga0495672_0034185 | Ga0495672_0034185_588_857 | 89 |
| 650 | 3300047320 | Ga0495672_0425406 | Ga0495672_0425406_92_361 | 89 |
| 651 | 3300047321 | Ga0495676_0436429 | Ga0495676_0436429_263_532 | 89 |
| 652 | 3300047469 | Ga0495673_0000243 | Ga0495673_0000243_74009_74278 | 89 |
| 653 | 3300047469 | Ga0495673_0036202 | Ga0495673_0036202_1112_1381 | 89 |
| 654 | 3300047469 | Ga0495673_0043455 | Ga0495673_0043455_403_678 | 89 |
| 655 | 3300047472 | Ga0495686_0008407 | Ga0495686_0008407_4059_4328 | 89 |
| 656 | 3300047673 | Ga0495593_0656649 | Ga0495593_0656649_48_317 | 89 |
| 657 | 3300048903 | Ga0496100_0000092 | Ga0496100_0000092_46219_46488 | 89 |
| 658 | 3300048903 | Ga0496100_0034053 | Ga0496100_0034053_183_452 | 89 |
| 659 | 3300048903 | Ga0496100_0044602 | Ga0496100_0044602_47_316 | 89 |
| 660 | 3300048903 | Ga0496100_0072521 | Ga0496100_0072521_835_1104 | 89 |
| 661 | 3300048904 | Ga0496101_0000018 | Ga0496101_0000018_46093_46362 | 89 |
| 662 | 3300048904 | Ga0496101_0000247 | Ga0496101_0000247_34212_34481 | 89 |
| 663 | 3300048904 | Ga0496101_0013241 | Ga0496101_0013241_4556_4825 | 89 |
| 664 | 3300048904 | Ga0496101_1002349 | Ga0496101_1002349_231_500 | 89 |
| 665 | 3300048904 | Ga0496101_1047407 | Ga0496101_1047407_64_333 | 89 |
| 666 | 3300048905 | Ga0496102_0000239 | Ga0496102_0000239_33133_33402 | 89 |
| 667 | 3300048905 | Ga0496102_0000417 | Ga0496102_0000417_45877_46146 | 89 |
| 668 | 3300048905 | Ga0496102_0064190 | Ga0496102_0064190_583_852 | 89 |
| 669 | 3300048905 | Ga0496102_0148879 | Ga0496102_0148879_535_804 | 89 |
| 670 | 3300048905 | Ga0496102_0200133 | Ga0496102_0200133_430_699 | 89 |
| 671 | 3300048905 | Ga0496102_0745557 | Ga0496102_0745557_338_607 | 89 |
| 672 | 3300048906 | Ga0496103_0000148 | Ga0496103_0000148_33676_33945 | 89 |
| 673 | 3300048906 | Ga0496103_0000727 | Ga0496103_0000727_2284_2553 | 89 |
| 674 | 3300048906 | Ga0496103_0000795 | Ga0496103_0000795_15536_15805 | 89 |
| 675 | 3300048906 | Ga0496103_0415652 | Ga0496103_0415652_224_493 | 89 |
| 676 | 3300048906 | Ga0496103_0423891 | Ga0496103_0423891_94_363 | 89 |
| 677 | 3300048907 | Ga0496104_0900185 | Ga0496104_0900185_346_615 | 89 |
| 678 | 3300048907 | Ga0496104_1032431 | Ga0496104_1032431_431_700 | 89 |
| 679 | 3300048907 | Ga0496104_1354495 | Ga0496104_1354495_309_578 | 89 |
| 680 | 3300048909 | Ga0496106_0020980 | Ga0496106_0020980_4297_4566 | 89 |
| 681 | 3300048909 | Ga0496106_0099680 | Ga0496106_0099680_636_905 | 89 |
| 682 | 3300048909 | Ga0496106_0177922 | Ga0496106_0177922_27_296 | 89 |
| 683 | 3300048910 | Ga0496107_0000367 | Ga0496107_0000367_19682_19951 | 89 |
| 684 | 3300048910 | Ga0496107_0009963 | Ga0496107_0009963_4934_5203 | 89 |
| 685 | 3300048910 | Ga0496107_0156006 | Ga0496107_0156006_692_961 | 89 |
| 686 | 3300048911 | Ga0496108_0001617 | Ga0496108_0001617_5527_5796 | 89 |
| 687 | 3300048911 | Ga0496108_0071966 | Ga0496108_0071966_500_769 | 89 |
| 688 | 3300048911 | Ga0496108_0413260 | Ga0496108_0413260_165_434 | 89 |
| 689 | 3300048911 | Ga0496108_0470473 | Ga0496108_0470473_464_733 | 89 |
| 690 | 3300048912 | Ga0496109_0000688 | Ga0496109_0000688_23434_23703 | 89 |
| 691 | 3300048912 | Ga0496109_0012643 | Ga0496109_0012643_5404_5673 | 89 |
| 692 | 3300048912 | Ga0496109_0127838 | Ga0496109_0127838_637_906 | 89 |
| 693 | 3300048912 | Ga0496109_0306795 | Ga0496109_0306795_18_287 | 89 |
| 694 | 3300048913 | Ga0496110_0000316 | Ga0496110_0000316_11118_11387 | 89 |
| 695 | 3300048913 | Ga0496110_0366965 | Ga0496110_0366965_1008_1277 | 89 |
| 696 | 3300048913 | Ga0496110_1076514 | Ga0496110_1076514_389_658 | 89 |
| 697 | 3300048914 | Ga0496111_0820465 | Ga0496111_0820465_305_574 | 89 |
| 698 | 3300048914 | Ga0496111_0909230 | Ga0496111_0909230_188_457 | 89 |
| 699 | 3300048915 | Ga0496112_0011082 | Ga0496112_0011082_2975_3244 | 89 |
| 700 | 3300048915 | Ga0496112_0120571 | Ga0496112_0120571_846_1115 | 89 |
| 701 | 3300048916 | Ga0496113_1061851 | Ga0496113_1061851_54_323 | 89 |
| 702 | 3300048916 | Ga0496113_1145636 | Ga0496113_1145636_109_378 | 89 |
| 703 | 3300048916 | Ga0496113_1297639 | Ga0496113_1297639_194_463 | 89 |
| 704 | 3300048916 | Ga0496113_1462638 | Ga0496113_1462638_26_295 | 89 |
| 705 | 3300048917 | Ga0496114_0000353 | Ga0496114_0000353_6199_6468 | 89 |
| 706 | 3300048918 | Ga0496115_0236643 | Ga0496115_0236643_715_984 | 89 |
| 707 | 3300048918 | Ga0496115_0813994 | Ga0496115_0813994_352_621 | 89 |
| 708 | 3300048919 | Ga0496116_0000355 | Ga0496116_0000355_38566_38835 | 89 |
| 709 | 3300048919 | Ga0496116_0005548 | Ga0496116_0005548_9523_9792 | 89 |
| 710 | 3300048919 | Ga0496116_0014633 | Ga0496116_0014633_2464_2733 | 89 |
| 711 | 3300048920 | Ga0496117_0000051 | Ga0496117_0000051_252299_252568 | 89 |
| 712 | 3300048920 | Ga0496117_0000909 | Ga0496117_0000909_16612_16881 | 89 |
| 713 | 3300048920 | Ga0496117_0012107 | Ga0496117_0012107_5673_5942 | 89 |
| 714 | 3300048920 | Ga0496117_0099125 | Ga0496117_0099125_1306_1575 | 89 |
| 715 | 3300048920 | Ga0496117_0265821 | Ga0496117_0265821_185_454 | 89 |
| 716 | 3300048921 | Ga0496118_0000043 | Ga0496118_0000043_252299_252568 | 89 |
| 717 | 3300048921 | Ga0496118_0000324 | Ga0496118_0000324_44646_44915 | 89 |
| 718 | 3300048921 | Ga0496118_0002530 | Ga0496118_0002530_10398_10667 | 89 |
| 719 | 3300048921 | Ga0496118_0046458 | Ga0496118_0046458_2198_2467 | 89 |
| 720 | 3300048921 | Ga0496118_0404747 | Ga0496118_0404747_293_562 | 89 |
| 721 | 3300048922 | Ga0496119_0000990 | Ga0496119_0000990_23246_23515 | 89 |
| 722 | 3300048922 | Ga0496119_0003073 | Ga0496119_0003073_9191_9460 | 89 |
| 723 | 3300048922 | Ga0496119_0029615 | Ga0496119_0029615_1975_2244 | 89 |
| 724 | 3300048922 | Ga0496119_0130880 | Ga0496119_0130880_396_665 | 89 |
| 725 | 3300048923 | Ga0496120_0009746 | Ga0496120_0009746_4832_5101 | 89 |
| 726 | 3300048923 | Ga0496120_0014292 | Ga0496120_0014292_1141_1410 | 89 |
| 727 | 3300048923 | Ga0496120_0192780 | Ga0496120_0192780_57_326 | 89 |
| 728 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_407143_407412 | 89 |
| 729 | 3300048924 | Ga0496121_0000924 | Ga0496121_0000924_29651_29920 | 89 |
| 730 | 3300048924 | Ga0496121_0002322 | Ga0496121_0002322_9657_9926 | 89 |
| 731 | 3300048924 | Ga0496121_0555430 | Ga0496121_0555430_150_419 | 89 |
| 732 | 3300048925 | Ga0496122_0000164 | Ga0496122_0000164_111480_111749 | 89 |
| 733 | 3300048925 | Ga0496122_0246220 | Ga0496122_0246220_643_912 | 89 |
| 734 | 3300048926 | Ga0496123_0003496 | Ga0496123_0003496_15978_16247 | 89 |
| 735 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_407143_407412 | 89 |
| 736 | 3300048927 | Ga0496124_0523991 | Ga0496124_0523991_404_673 | 89 |
| 737 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_56037_56306 | 89 |
| 738 | 3300048928 | Ga0496125_0079216 | Ga0496125_0079216_969_1238 | 89 |
| 739 | 3300048928 | Ga0496125_0081795 | Ga0496125_0081795_1352_1621 | 89 |
| 740 | 3300048928 | Ga0496125_0116487 | Ga0496125_0116487_370_639 | 89 |
| 741 | 3300048928 | Ga0496125_0327620 | Ga0496125_0327620_328_597 | 89 |
| 742 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_407143_407412 | 89 |
| 743 | 3300048929 | Ga0496126_0002171 | Ga0496126_0002171_1333_1602 | 89 |
| 744 | 3300048929 | Ga0496126_0521685 | Ga0496126_0521685_524_793 | 89 |
| 745 | 3300048929 | Ga0496126_0521688 | Ga0496126_0521688_154_423 | 89 |
| 746 | 3300049569 | Ga0501032_0001214 | Ga0501032_0001214_12334_12603 | 89 |
| 747 | 3300049569 | Ga0501032_0001214 | Ga0501032_0001214_7543_7812 | 89 |
| 748 | 3300049569 | Ga0501032_0002928 | Ga0501032_0002928_4340_4609 | 89 |
| 749 | 3300049571 | Ga0501034_0001356 | Ga0501034_0001356_20002_20271 | 89 |
| 750 | 3300049571 | Ga0501034_0002853 | Ga0501034_0002853_11835_12104 | 89 |
| 751 | 3300049571 | Ga0501034_0002853 | Ga0501034_0002853_7044_7313 | 89 |
| 752 | 3300049572 | Ga0501036_0002465 | Ga0501036_0002465_4804_5073 | 89 |
| 753 | 3300049572 | Ga0501036_0002465 | Ga0501036_0002465_9595_9864 | 89 |
| 754 | 3300049572 | Ga0501036_0054599 | Ga0501036_0054599_2011_2280 | 89 |
| 755 | 3300049573 | Ga0501037_0000220 | Ga0501037_0000220_8540_8809 | 89 |
| 756 | 3300049573 | Ga0501037_0001017 | Ga0501037_0001017_12851_13120 | 89 |
| 757 | 3300049573 | Ga0501037_0001017 | Ga0501037_0001017_8060_8329 | 89 |
| 758 | 3300049574 | Ga0501038_0000980 | Ga0501038_0000980_11861_12130 | 89 |
| 759 | 3300049574 | Ga0501038_0001589 | Ga0501038_0001589_14262_14531 | 89 |
| 760 | 3300049574 | Ga0501038_0001589 | Ga0501038_0001589_9471_9740 | 89 |
| 761 | 3300049575 | Ga0501039_0000976 | Ga0501039_0000976_12873_13142 | 89 |
| 762 | 3300049575 | Ga0501039_0000976 | Ga0501039_0000976_8082_8351 | 89 |
| 763 | 3300049575 | Ga0501039_0001608 | Ga0501039_0001608_643_912 | 89 |
| 764 | 3300049577 | Ga0501041_0795914 | Ga0501041_0795914_127_396 | 89 |
| 765 | 3300049579 | Ga0501043_0001421 | Ga0501043_0001421_12873_13142 | 89 |
| 766 | 3300049579 | Ga0501043_0001421 | Ga0501043_0001421_8082_8351 | 89 |
| 767 | 3300049579 | Ga0501043_0008835 | Ga0501043_0008835_1722_1991 | 89 |
| 768 | 3300049580 | Ga0501046_0139616 | Ga0501046_0139616_1287_1556 | 89 |
| 769 | 3300049581 | Ga0501047_0260279 | Ga0501047_0260279_584_853 | 89 |
| 770 | 3300049581 | Ga0501047_1115258 | Ga0501047_1115258_73_342 | 89 |
| 771 | 3300049581 | Ga0501047_1216277 | Ga0501047_1216277_152_421 | 89 |
| 772 | 3300049583 | Ga0501067_0059179 | Ga0501067_0059179_307_576 | 89 |
| 773 | 3300049584 | Ga0501068_0872432 | Ga0501068_0872432_196_465 | 89 |
| 774 | 3300049585 | Ga0501069_0732925 | Ga0501069_0732925_312_581 | 89 |
| 775 | 3300049586 | Ga0501070_0001619 | Ga0501070_0001619_11880_12149 | 89 |
| 776 | 3300049586 | Ga0501070_0001619 | Ga0501070_0001619_7089_7358 | 89 |
| 777 | 3300049586 | Ga0501070_0064844 | Ga0501070_0064844_1105_1374 | 89 |
| 778 | 3300049587 | Ga0501071_0019804 | Ga0501071_0019804_1923_2192 | 89 |
| 779 | 3300049589 | Ga0501073_0008348 | Ga0501073_0008348_7203_7472 | 89 |
| 780 | 3300049589 | Ga0501073_0012643 | Ga0501073_0012643_2628_2897 | 89 |
| 781 | 3300049593 | Ga0501077_0058401 | Ga0501077_0058401_248_517 | 89 |
| 782 | 3300049741 | Ga0501079_0226620 | Ga0501079_0226620_1014_1283 | 89 |
| 783 | 3300049823 | Ga0501044_0003636 | Ga0501044_0003636_11623_11892 | 89 |
| 784 | 3300049823 | Ga0501044_0003636 | Ga0501044_0003636_6832_7101 | 89 |
| 785 | 3300049823 | Ga0501044_0007721 | Ga0501044_0007721_9465_9734 | 89 |
| 786 | 3300049823 | Ga0501044_0041282 | Ga0501044_0041282_2876_3145 | 89 |
| 787 | 3300049824 | Ga0501045_1431833 | Ga0501045_1431833_11_280 | 89 |
| 788 | 3300050489 | nmdc:mga03683_122053_c1 | nmdc:mga03683_122053_c1_208_477 | 89 |
| 789 | 3300050489 | nmdc:mga03683_296190_c1 | nmdc:mga03683_296190_c1_107_376 | 89 |
| 790 | 3300050489 | nmdc:mga03683_322237_c1 | nmdc:mga03683_322237_c1_131_400 | 89 |
| 791 | 3300050489 | nmdc:mga03683_517832_c1 | nmdc:mga03683_517832_c1_277_546 | 89 |
| 792 | 3300050489 | nmdc:mga03683_57907_c1 | nmdc:mga03683_57907_c1_731_1000 | 89 |
| 793 | 3300050490 | nmdc:mga03n38_126437_c1 | nmdc:mga03n38_126437_c1_446_715 | 89 |
| 794 | 3300050490 | nmdc:mga03n38_20349_c1 | nmdc:mga03n38_20349_c1_1025_1294 | 89 |
| 795 | 3300050490 | nmdc:mga03n38_233450_c1 | nmdc:mga03n38_233450_c1_64_333 | 89 |
| 796 | 3300050490 | nmdc:mga03n38_38933_c1 | nmdc:mga03n38_38933_c1_1082_1351 | 89 |
| 797 | 3300050490 | nmdc:mga03n38_49574_c1 | nmdc:mga03n38_49574_c1_967_1236 | 89 |
| 798 | 3300050490 | nmdc:mga03n38_765_c2 | nmdc:mga03n38_765_c2_6008_6277 | 89 |
| 799 | 3300050490 | nmdc:mga03n38_822836_c1 | nmdc:mga03n38_822836_c1_69_338 | 89 |
| 800 | 3300050490 | nmdc:mga03n38_86562_c1 | nmdc:mga03n38_86562_c1_638_907 | 89 |
| 801 | 3300050491 | nmdc:mga00v17_143978_c1 | nmdc:mga00v17_143978_c1_734_1003 | 89 |
| 802 | 3300050491 | nmdc:mga00v17_267515_c1 | nmdc:mga00v17_267515_c1_732_1001 | 89 |
| 803 | 3300050491 | nmdc:mga00v17_2753_c1 | nmdc:mga00v17_2753_c1_5398_5667 | 89 |
| 804 | 3300050491 | nmdc:mga00v17_2964_c1 | nmdc:mga00v17_2964_c1_7744_8013 | 89 |
| 805 | 3300050491 | nmdc:mga00v17_428857_c1 | nmdc:mga00v17_428857_c1_58_327 | 89 |
| 806 | 3300050491 | nmdc:mga00v17_664666_c1 | nmdc:mga00v17_664666_c1_349_618 | 89 |
| 807 | 3300050491 | nmdc:mga00v17_991052_c1 | nmdc:mga00v17_991052_c1_232_501 | 89 |
| 808 | 3300050492 | nmdc:mga0yw44_141077_c1 | nmdc:mga0yw44_141077_c1_39_308 | 89 |
| 809 | 3300050492 | nmdc:mga0yw44_314841_c1 | nmdc:mga0yw44_314841_c1_233_502 | 89 |
| 810 | 3300050492 | nmdc:mga0yw44_901224_c1 | nmdc:mga0yw44_901224_c1_219_488 | 89 |
| 811 | 3300050494 | nmdc:mga06z11_212214_c1 | nmdc:mga06z11_212214_c1_460_729 | 89 |
| 812 | 3300050494 | nmdc:mga06z11_359481_c1 | nmdc:mga06z11_359481_c1_583_852 | 89 |
| 813 | 3300050496 | nmdc:mga07m45_17718_c1 | nmdc:mga07m45_17718_c1_3213_3482 | 89 |
| 814 | 3300050496 | nmdc:mga07m45_259506_c1 | nmdc:mga07m45_259506_c1_178_450 | 89 |
| 815 | 3300050496 | nmdc:mga07m45_265485_c1 | nmdc:mga07m45_265485_c1_457_726 | 89 |
| 816 | 3300050496 | nmdc:mga07m45_297351_c1 | nmdc:mga07m45_297351_c1_106_375 | 89 |
| 817 | 3300050496 | nmdc:mga07m45_54135_c1 | nmdc:mga07m45_54135_c1_544_813 | 89 |
| 818 | 3300050496 | nmdc:mga07m45_73289_c1 | nmdc:mga07m45_73289_c1_511_780 | 89 |
| 819 | 3300050496 | nmdc:mga07m45_76649_c1 | nmdc:mga07m45_76649_c1_905_1174 | 89 |
| 820 | 3300050509 | nmdc:mga0qj67_191131_c1 | nmdc:mga0qj67_191131_c1_1048_1317 | 89 |
| 821 | 3300050511 | nmdc:mga08y16_1255093_c1 | nmdc:mga08y16_1255093_c1_141_410 | 89 |
| 822 | 3300050516 | nmdc:mga0sz30_1570_c3 | nmdc:mga0sz30_1570_c3_423_692 | 89 |
| 823 | 3300050516 | nmdc:mga0sz30_184738_c1 | nmdc:mga0sz30_184738_c1_146_415 | 89 |
| 824 | 3300050516 | nmdc:mga0sz30_185756_c1 | nmdc:mga0sz30_185756_c1_239_508 | 89 |
| 825 | 3300050516 | nmdc:mga0sz30_196062_c2 | nmdc:mga0sz30_196062_c2_248_517 | 89 |
| 826 | 3300050516 | nmdc:mga0sz30_3198_c1 | nmdc:mga0sz30_3198_c1_3959_4228 | 89 |
| 827 | 3300050516 | nmdc:mga0sz30_3903_c2 | nmdc:mga0sz30_3903_c2_1212_1487 | 89 |
| 828 | 3300050516 | nmdc:mga0sz30_44034_c1 | nmdc:mga0sz30_44034_c1_749_1018 | 89 |
| 829 | 3300050516 | nmdc:mga0sz30_49002_c1 | nmdc:mga0sz30_49002_c1_417_686 | 89 |
| 830 | 3300050516 | nmdc:mga0sz30_593234_c1 | nmdc:mga0sz30_593234_c1_114_383 | 89 |
| 831 | 3300050516 | nmdc:mga0sz30_79124_c1 | nmdc:mga0sz30_79124_c1_353_622 | 89 |
| 832 | 3300053080 | Ga0500635_0010410 | Ga0500635_0010410_805_1074 | 89 |
| 833 | 3300053087 | Ga0500643_015487 | Ga0500643_015487_1294_1563 | 89 |
| 834 | 3300053089 | Ga0500581_158927 | Ga0500581_158927_268_537 | 89 |
| 835 | 3300053096 | Ga0500641_0095792 | Ga0500641_0095792_134_403 | 89 |
| 836 | 3300053096 | Ga0500641_0108825 | Ga0500641_0108825_611_880 | 89 |
| 837 | 3300053098 | Ga0500650_0239772 | Ga0500650_0239772_157_432 | 89 |
| 838 | 3300053104 | Ga0500556_0004758 | Ga0500556_0004758_2447_2716 | 89 |
| 839 | 3300053108 | Ga0500562_029104 | Ga0500562_029104_232_501 | 89 |
| 840 | 3300053119 | Ga0500595_022551 | Ga0500595_022551_180_449 | 89 |
| 841 | 3300053122 | Ga0500608_145397 | Ga0500608_145397_550_819 | 89 |
| 842 | 3300053123 | Ga0500614_003215 | Ga0500614_003215_3065_3346 | 89 |
| 843 | 3300053129 | Ga0500628_130111 | Ga0500628_130111_396_665 | 89 |
| 844 | 3300053131 | Ga0500652_000813 | Ga0500652_000813_5948_6217 | 89 |
| 845 | 3300053131 | Ga0500652_083240 | Ga0500652_083240_298_567 | 89 |
| 846 | 3300053134 | Ga0500658_0031952 | Ga0500658_0031952_1609_1878 | 89 |
| 847 | 3300053136 | Ga0500559_0075300 | Ga0500559_0075300_197_466 | 89 |
| 848 | 3300053138 | Ga0500564_250523 | Ga0500564_250523_65_334 | 89 |
| 849 | 3300053146 | Ga0500588_0171020 | Ga0500588_0171020_447_716 | 89 |
| 850 | 3300053178 | Ga0500637_0534790 | Ga0500637_0534790_150_419 | 89 |
| 851 | 3300053730 | Ga0500645_000004 | Ga0500645_000004_291448_291717 | 89 |
| 852 | 3300053730 | Ga0500645_000057 | Ga0500645_000057_49594_49863 | 89 |
| 853 | 3300053730 | Ga0500645_000988 | Ga0500645_000988_9780_10049 | 89 |
| 854 | 3300061719 | Ga0466962_0357367 | Ga0466962_0357367_134_403 | 89 |
| 855 | iso_pu_bacteria | 2939582691 | 2939587606 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b87-assembly1.cif.gz_A-2 | crystal structure of transmembrane protein tmhc2_e | 0.8904 | 8 | 58 |
| 6b87-assembly2.cif.gz_B-3 | crystal structure of transmembrane protein tmhc2_e | 0.8748 | 8 | 58 |
| 6ahx-assembly1.cif.gz_A-2 | copper-sensing operon regulator protein (csorgz) | 0.8724 | 10 | 64 |
| 6wa9-assembly1.cif.gz_T | structure of the chlamydia pneumoniae cdsv and cdso protein complex | 0.8702 | 6 | 63 |
| 8cws-assembly1.cif.gz_B | accurate computational design of genetically encoded 3d protein crystals | 0.8225 | 8 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dkqA02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.889 | 2 | 51 | 4.10.860.20 |
| 3dkqC02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.8856 | 2 | 51 | 4.10.860.20 |
| af_Q0IZV2_506_799_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.8453 | 6 | 60 | 1.20.1270.60 |
| af_A0A1D6M4L8_452_775_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.8287 | 6 | 61 | 1.20.1270.60 |
| af_I1MM63_213_618_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8204 | 11 | 70 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356JXN1-F1-model_v4 | Metal-sensitive transcriptional repressor | 0.914 | 1 | 62 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
| AF-A0A399EMS7-F1-model_v4 | Metal-sensitive transcriptional repressor | 0.9083 | 1 | 59 |
GO:0003677
GO:0045892 GO:0046872 |
| AF-A0A350TLH5-F1-model_v4 | CsoR family transcriptional regulator | 0.9054 | 1 | 62 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
| AF-A0A4U9CZE0-F1-model_v4 | Transcriptional repressor FrmR | 0.892 | 1 | 63 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
| AF-A0A522VW15-F1-model_v4 | Transcriptional regulator | 0.8677 | 1 | 62 |
GO:0003677
GO:0045892 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar