F483607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 855 | 341 | 844 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10101200|Ga0070666_101012002 |
| Length | 190 |
| Sequence | MATPDWKWRSGRPVSRVDLSGCSRAGLVPSLAMSGAVCPGSFDPITLGHLDVFERAAAQFDEVVVAVLVNPNKKGMFTAEERIAMITEATSHLPNLRAEAGSGLVVDFARARGLTAIVKGLRTGTDFEYELQMAQMNRHVAGVDTFFVATKPQFSFVSSSLAKEVATLGGDVTDLLPAVVNKRLQAKLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 3 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 4 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 5 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 6 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 7 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 8 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 9 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 10 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 11 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 12 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 13 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 213 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 216 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 222 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 223 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 224 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 227 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 228 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 281 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 284 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 285 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 286 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 287 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 325 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 329 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 330 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 331 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 332 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 0 |
| Isolates | 1.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.29 |
| Nodule | 0 |
| Rhizoplane | 10.64 |
| Rhizosphere | 60.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1008764 | 3300000546 | Bacteria | 1084 |
| 2 | JGI24746J21847_1006471 | 3300001977 | Bacteria | 1815 |
| 3 | JGI24737J22298_10051930 | 3300001990 | Bacteria | 1244 |
| 4 | JGI24737J22298_10110059 | 3300001990 | Bacteria | 815 |
| 5 | JGI24743J22301_10036835 | 3300001991 | Bacteria | 974 |
| 6 | JGI24743J22301_10146340 | 3300001991 | Bacteria | 528 |
| 7 | JGI24735J21928_10135299 | 3300002067 | Bacteria | 711 |
| 8 | JGI24738J21930_10010345 | 3300002075 | Bacteria | 2078 |
| 9 | JGI24738J21930_10117783 | 3300002075 | Bacteria | 575 |
| 10 | JGI24744J21845_10000451 | 3300002077 | Bacteria | 7254 |
| 11 | JGI24744J21845_10001995 | 3300002077 | Bacteria | 4126 |
| 12 | JGI24034J26672_10003538 | 3300002239 | Bacteria | 2182 |
| 13 | JGI24034J26672_10059429 | 3300002239 | Bacteria | 669 |
| 14 | JGI24742J22300_10004585 | 3300002244 | Bacteria | 2266 |
| 15 | JGI24742J22300_10004702 | 3300002244 | Bacteria | 2239 |
| 16 | JGI24751J29686_10007519 | 3300002459 | Bacteria | 2227 |
| 17 | Ga0055540_1000057 | 3300003792 | Bacteria | 136356 |
| 18 | Ga0055540_1009975 | 3300003792 | Bacteria | 3207 |
| 19 | Ga0055540_1012396 | 3300003792 | Bacteria | 2678 |
| 20 | Ga0070676_10027558 | 3300005328 | Bacteria | 3223 |
| 21 | Ga0070683_100409140 | 3300005329 | Bacteria | 1294 |
| 22 | Ga0070690_100010167 | 3300005330 | Bacteria | 5466 |
| 23 | Ga0070677_10101975 | 3300005333 | Bacteria | 1267 |
| 24 | Ga0070666_10085397 | 3300005335 | Bacteria | 2162 |
| 25 | Ga0070666_10101200 | 3300005335 | Bacteria | 1986 |
| 26 | Ga0070666_10734241 | 3300005335 | Bacteria | 725 |
| 27 | Ga0070680_100357171 | 3300005336 | Bacteria | 1243 |
| 28 | Ga0070680_100751093 | 3300005336 | Bacteria | 840 |
| 29 | Ga0070682_100022831 | 3300005337 | Bacteria | 3711 |
| 30 | Ga0070682_100043680 | 3300005337 | Bacteria | 2772 |
| 31 | Ga0070682_100554184 | 3300005337 | Bacteria | 900 |
| 32 | Ga0070682_100927341 | 3300005337 | Bacteria | 717 |
| 33 | Ga0068868_100000294 | 3300005338 | Bacteria | 33573 |
| 34 | Ga0068868_100132081 | 3300005338 | Bacteria | 2044 |
| 35 | Ga0068868_100480884 | 3300005338 | Bacteria | 1085 |
| 36 | Ga0068868_100501203 | 3300005338 | Bacteria | 1063 |
| 37 | Ga0068868_100548991 | 3300005338 | Bacteria | 1018 |
| 38 | Ga0070660_100555623 | 3300005339 | Bacteria | 958 |
| 39 | Ga0070689_100040180 | 3300005340 | Bacteria | 3585 |
| 40 | Ga0070691_10016547 | 3300005341 | Bacteria | 3388 |
| 41 | Ga0070661_100553276 | 3300005344 | Bacteria | 926 |
| 42 | Ga0070692_10166620 | 3300005345 | Bacteria | 1267 |
| 43 | Ga0070668_100001698 | 3300005347 | Bacteria | 15974 |
| 44 | Ga0070668_100231823 | 3300005347 | Bacteria | 1527 |
| 45 | Ga0070669_100005178 | 3300005353 | Bacteria | 9434 |
| 46 | Ga0070669_100137614 | 3300005353 | Bacteria | 1880 |
| 47 | Ga0070671_100063135 | 3300005355 | Bacteria | 3084 |
| 48 | Ga0070674_100041075 | 3300005356 | Bacteria | 3132 |
| 49 | Ga0070688_100027089 | 3300005365 | Bacteria | 3412 |
| 50 | Ga0070659_100165779 | 3300005366 | Bacteria | 1808 |
| 51 | Ga0070667_100000063 | 3300005367 | Bacteria | 138777 |
| 52 | Ga0070667_100000727 | 3300005367 | Bacteria | 31611 |
| 53 | Ga0070667_100011532 | 3300005367 | Bacteria | 7306 |
| 54 | Ga0070667_100015369 | 3300005367 | Bacteria | 6328 |
| 55 | Ga0070667_100195731 | 3300005367 | Bacteria | 1792 |
| 56 | Ga0070667_101214548 | 3300005367 | Bacteria | 706 |
| 57 | Ga0070703_10012339 | 3300005406 | Bacteria | 2421 |
| 58 | Ga0070709_10140768 | 3300005434 | Bacteria | 1657 |
| 59 | Ga0070714_100097251 | 3300005435 | Bacteria | 2587 |
| 60 | Ga0070713_100566240 | 3300005436 | Bacteria | 1077 |
| 61 | Ga0070710_10005017 | 3300005437 | Bacteria | 6264 |
| 62 | Ga0070711_100001192 | 3300005439 | Bacteria | 14041 |
| 63 | Ga0070711_100158578 | 3300005439 | Bacteria | 1713 |
| 64 | Ga0070711_100421292 | 3300005439 | Bacteria | 1088 |
| 65 | Ga0070705_100704170 | 3300005440 | Bacteria | 794 |
| 66 | Ga0070700_100000463 | 3300005441 | Bacteria | 20347 |
| 67 | Ga0070694_100020285 | 3300005444 | Bacteria | 4235 |
| 68 | Ga0070663_100019917 | 3300005455 | Bacteria | 4431 |
| 69 | Ga0070663_100043359 | 3300005455 | Bacteria | 3166 |
| 70 | Ga0070663_100097225 | 3300005455 | Bacteria | 2192 |
| 71 | Ga0070678_100000347 | 3300005456 | Bacteria | 21660 |
| 72 | Ga0070678_100416041 | 3300005456 | Bacteria | 1171 |
| 73 | Ga0070662_100003014 | 3300005457 | Bacteria | 10479 |
| 74 | Ga0068867_100020639 | 3300005459 | Bacteria | 4694 |
| 75 | Ga0070685_10033819 | 3300005466 | Bacteria | 2876 |
| 76 | Ga0068853_100006576 | 3300005539 | Bacteria | 9256 |
| 77 | Ga0068853_100132561 | 3300005539 | Bacteria | 2232 |
| 78 | Ga0070672_100346062 | 3300005543 | Bacteria | 1266 |
| 79 | Ga0070686_100066142 | 3300005544 | Bacteria | 2350 |
| 80 | Ga0070686_100284527 | 3300005544 | Bacteria | 1221 |
| 81 | Ga0070696_100146040 | 3300005546 | Bacteria | 1733 |
| 82 | Ga0070665_100005170 | 3300005548 | Bacteria | 13500 |
| 83 | Ga0070665_100009871 | 3300005548 | Bacteria | 9651 |
| 84 | Ga0070665_100030285 | 3300005548 | Bacteria | 5447 |
| 85 | Ga0070665_100297289 | 3300005548 | Bacteria | 1617 |
| 86 | Ga0070665_100344355 | 3300005548 | Bacteria | 1496 |
| 87 | Ga0070704_100000118 | 3300005549 | Bacteria | 28378 |
| 88 | Ga0070704_101203667 | 3300005549 | Bacteria | 691 |
| 89 | Ga0068855_100094813 | 3300005563 | Bacteria | 3441 |
| 90 | Ga0068855_100540967 | 3300005563 | Bacteria | 1262 |
| 91 | Ga0068854_100000777 | 3300005578 | Bacteria | 18943 |
| 92 | Ga0070702_100000798 | 3300005615 | Bacteria | 12021 |
| 93 | Ga0070702_100120907 | 3300005615 | Bacteria | 1639 |
| 94 | Ga0070702_100289450 | 3300005615 | Bacteria | 1128 |
| 95 | Ga0068859_100015872 | 3300005617 | Bacteria | 7568 |
| 96 | Ga0068859_100484346 | 3300005617 | Bacteria | 1332 |
| 97 | Ga0068864_100198700 | 3300005618 | Bacteria | 1841 |
| 98 | Ga0068866_10000197 | 3300005718 | Bacteria | 28297 |
| 99 | Ga0068866_10220397 | 3300005718 | Bacteria | 1144 |
| 100 | Ga0068866_10261167 | 3300005718 | Bacteria | 1064 |
| 101 | Ga0068861_100000102 | 3300005719 | Bacteria | 42240 |
| 102 | Ga0068861_100036577 | 3300005719 | Bacteria | 3645 |
| 103 | Ga0068861_100074511 | 3300005719 | Bacteria | 2639 |
| 104 | Ga0068861_101621210 | 3300005719 | Bacteria | 638 |
| 105 | Ga0068870_10211854 | 3300005840 | Bacteria | 1181 |
| 106 | Ga0068863_100000159 | 3300005841 | Bacteria | 71831 |
| 107 | Ga0068863_100155729 | 3300005841 | Bacteria | 2188 |
| 108 | Ga0068858_100146419 | 3300005842 | Bacteria | 2218 |
| 109 | Ga0068858_100691988 | 3300005842 | Bacteria | 992 |
| 110 | Ga0068860_100000065 | 3300005843 | Bacteria | 186634 |
| 111 | Ga0068860_100079612 | 3300005843 | Bacteria | 3115 |
| 112 | Ga0068860_100199937 | 3300005843 | Bacteria | 1936 |
| 113 | Ga0068860_100466172 | 3300005843 | Bacteria | 1257 |
| 114 | Ga0068862_100000028 | 3300005844 | Bacteria | 184197 |
| 115 | Ga0068862_100013056 | 3300005844 | Bacteria | 6871 |
| 116 | Ga0068862_100101838 | 3300005844 | Bacteria | 2513 |
| 117 | Ga0068862_100490976 | 3300005844 | Bacteria | 1164 |
| 118 | Ga0081455_10014375 | 3300005937 | Bacteria | 7766 |
| 119 | Ga0081538_10255051 | 3300005981 | Bacteria | 666 |
| 120 | Ga0075365_10003536 | 3300006038 | Bacteria | 8081 |
| 121 | Ga0075365_10008557 | 3300006038 | Bacteria | 5822 |
| 122 | Ga0075365_10010928 | 3300006038 | Bacteria | 5317 |
| 123 | Ga0075365_10026131 | 3300006038 | Bacteria | 3703 |
| 124 | Ga0075365_10100605 | 3300006038 | Bacteria | 1979 |
| 125 | Ga0075365_10105792 | 3300006038 | Bacteria | 1930 |
| 126 | Ga0075365_10126464 | 3300006038 | Bacteria | 1766 |
| 127 | Ga0075365_10129945 | 3300006038 | Bacteria | 1743 |
| 128 | Ga0075365_10166525 | 3300006038 | Bacteria | 1537 |
| 129 | Ga0075365_10363502 | 3300006038 | Bacteria | 1020 |
| 130 | Ga0075363_100002212 | 3300006048 | Bacteria | 7851 |
| 131 | Ga0075363_100004832 | 3300006048 | Bacteria | 5948 |
| 132 | Ga0075363_100005085 | 3300006048 | Bacteria | 5815 |
| 133 | Ga0075363_100005618 | 3300006048 | Bacteria | 5604 |
| 134 | Ga0075363_100010328 | 3300006048 | Bacteria | 4428 |
| 135 | Ga0075363_100019344 | 3300006048 | Bacteria | 3404 |
| 136 | Ga0075363_100021791 | 3300006048 | Bacteria | 3233 |
| 137 | Ga0075363_100032964 | 3300006048 | Bacteria | 2694 |
| 138 | Ga0075363_100044705 | 3300006048 | Bacteria | 2347 |
| 139 | Ga0075363_100091181 | 3300006048 | Bacteria | 1678 |
| 140 | Ga0075363_100159307 | 3300006048 | Bacteria | 1277 |
| 141 | Ga0075363_100204817 | 3300006048 | Bacteria | 1128 |
| 142 | Ga0075363_100210075 | 3300006048 | Bacteria | 1114 |
| 143 | Ga0075363_100233587 | 3300006048 | Bacteria | 1056 |
| 144 | Ga0075364_10002550 | 3300006051 | Bacteria | 10206 |
| 145 | Ga0075364_10004805 | 3300006051 | Bacteria | 7818 |
| 146 | Ga0075364_10006029 | 3300006051 | Bacteria | 7090 |
| 147 | Ga0075364_10013034 | 3300006051 | Bacteria | 5101 |
| 148 | Ga0075364_10014518 | 3300006051 | Bacteria | 4869 |
| 149 | Ga0075364_10014806 | 3300006051 | Bacteria | 4825 |
| 150 | Ga0075364_10015034 | 3300006051 | Bacteria | 4791 |
| 151 | Ga0075364_10016870 | 3300006051 | Bacteria | 4550 |
| 152 | Ga0075364_10145845 | 3300006051 | Bacteria | 1593 |
| 153 | Ga0075364_10163663 | 3300006051 | Bacteria | 1502 |
| 154 | Ga0075364_10181004 | 3300006051 | Bacteria | 1426 |
| 155 | Ga0075364_10329545 | 3300006051 | Bacteria | 1040 |
| 156 | Ga0075364_10685275 | 3300006051 | Bacteria | 699 |
| 157 | Ga0070716_100000479 | 3300006173 | Bacteria | 16547 |
| 158 | Ga0070716_100002564 | 3300006173 | Bacteria | 8405 |
| 159 | Ga0070712_100000901 | 3300006175 | Bacteria | 17767 |
| 160 | Ga0070712_100181949 | 3300006175 | Bacteria | 1638 |
| 161 | Ga0070712_100376545 | 3300006175 | Bacteria | 1168 |
| 162 | Ga0070712_100936741 | 3300006175 | Bacteria | 748 |
| 163 | Ga0075362_10003956 | 3300006177 | Bacteria | 5266 |
| 164 | Ga0075362_10004236 | 3300006177 | Bacteria | 5126 |
| 165 | Ga0075362_10010735 | 3300006177 | Bacteria | 3586 |
| 166 | Ga0075362_10047877 | 3300006177 | Bacteria | 1905 |
| 167 | Ga0075362_10090150 | 3300006177 | Bacteria | 1422 |
| 168 | Ga0075362_10166239 | 3300006177 | Bacteria | 1064 |
| 169 | Ga0075362_10305725 | 3300006177 | Bacteria | 790 |
| 170 | Ga0075362_10366515 | 3300006177 | Bacteria | 723 |
| 171 | Ga0075367_10003365 | 3300006178 | Bacteria | 7607 |
| 172 | Ga0075367_10034443 | 3300006178 | Bacteria | 2926 |
| 173 | Ga0075367_10128092 | 3300006178 | Bacteria | 1568 |
| 174 | Ga0075367_10151412 | 3300006178 | Bacteria | 1439 |
| 175 | Ga0075367_10152586 | 3300006178 | Bacteria | 1434 |
| 176 | Ga0075367_10165823 | 3300006178 | Bacteria | 1375 |
| 177 | Ga0075367_10177686 | 3300006178 | Bacteria | 1327 |
| 178 | Ga0075369_10004972 | 3300006186 | Bacteria | 4946 |
| 179 | Ga0075369_10006708 | 3300006186 | Bacteria | 4364 |
| 180 | Ga0075369_10012781 | 3300006186 | Bacteria | 3319 |
| 181 | Ga0075369_10015455 | 3300006186 | Bacteria | 3064 |
| 182 | Ga0075369_10032363 | 3300006186 | Bacteria | 2212 |
| 183 | Ga0075369_10042231 | 3300006186 | Bacteria | 1954 |
| 184 | Ga0075369_10056562 | 3300006186 | Bacteria | 1705 |
| 185 | Ga0075369_10065208 | 3300006186 | Bacteria | 1596 |
| 186 | Ga0075369_10065449 | 3300006186 | Bacteria | 1593 |
| 187 | Ga0075369_10123960 | 3300006186 | Bacteria | 1171 |
| 188 | Ga0075366_10199966 | 3300006195 | Bacteria | 1215 |
| 189 | Ga0097621_100931576 | 3300006237 | Bacteria | 810 |
| 190 | Ga0075370_10011857 | 3300006353 | Bacteria | 4590 |
| 191 | Ga0075370_10026183 | 3300006353 | Bacteria | 3230 |
| 192 | Ga0075370_10026467 | 3300006353 | Bacteria | 3214 |
| 193 | Ga0075370_10094051 | 3300006353 | Bacteria | 1730 |
| 194 | Ga0075370_10105139 | 3300006353 | Bacteria | 1636 |
| 195 | Ga0075370_10130388 | 3300006353 | Bacteria | 1467 |
| 196 | Ga0075370_10130744 | 3300006353 | Bacteria | 1465 |
| 197 | Ga0075370_10149202 | 3300006353 | Bacteria | 1370 |
| 198 | Ga0075370_10188879 | 3300006353 | Bacteria | 1213 |
| 199 | Ga0068871_100009689 | 3300006358 | Bacteria | 6994 |
| 200 | Ga0068871_100092764 | 3300006358 | Bacteria | 2519 |
| 201 | Ga0075428_100005745 | 3300006844 | Bacteria | 13782 |
| 202 | Ga0075430_100013678 | 3300006846 | Bacteria | 6918 |
| 203 | Ga0075431_100034823 | 3300006847 | Bacteria | 5186 |
| 204 | Ga0068865_100000554 | 3300006881 | Bacteria | 20777 |
| 205 | Ga0068865_100646743 | 3300006881 | Bacteria | 898 |
| 206 | Ga0097620_100015873 | 3300006931 | Bacteria | 7568 |
| 207 | Ga0097620_100484339 | 3300006931 | Bacteria | 1332 |
| 208 | Ga0105250_10072232 | 3300009092 | Bacteria | 1395 |
| 209 | Ga0111539_10911721 | 3300009094 | Bacteria | 1022 |
| 210 | Ga0105245_10002148 | 3300009098 | Bacteria | 17862 |
| 211 | Ga0105247_10000910 | 3300009101 | Bacteria | 22259 |
| 212 | Ga0105247_10002035 | 3300009101 | Bacteria | 14006 |
| 213 | Ga0105247_10063859 | 3300009101 | Bacteria | 2287 |
| 214 | Ga0105247_10386931 | 3300009101 | Bacteria | 993 |
| 215 | Ga0114129_12644484 | 3300009147 | Bacteria | 598 |
| 216 | Ga0105243_10001698 | 3300009148 | Bacteria | 18980 |
| 217 | Ga0105243_10035777 | 3300009148 | Bacteria | 3851 |
| 218 | Ga0105243_10175523 | 3300009148 | Bacteria | 1859 |
| 219 | Ga0105241_10421973 | 3300009174 | Bacteria | 1174 |
| 220 | Ga0105242_10001106 | 3300009176 | Bacteria | 21246 |
| 221 | Ga0105242_10264733 | 3300009176 | Bacteria | 1554 |
| 222 | Ga0105248_10000074 | 3300009177 | Bacteria | 114554 |
| 223 | Ga0105248_10002067 | 3300009177 | Bacteria | 22238 |
| 224 | Ga0105248_10509809 | 3300009177 | Bacteria | 1356 |
| 225 | Ga0105248_11170510 | 3300009177 | Bacteria | 869 |
| 226 | Ga0105237_10005869 | 3300009545 | Bacteria | 13768 |
| 227 | Ga0105237_10011639 | 3300009545 | Bacteria | 9311 |
| 228 | Ga0105237_10015011 | 3300009545 | Bacteria | 8072 |
| 229 | Ga0105237_10035962 | 3300009545 | Bacteria | 5010 |
| 230 | Ga0105237_10320139 | 3300009545 | Bacteria | 1554 |
| 231 | Ga0105237_11622532 | 3300009545 | Bacteria | 654 |
| 232 | Ga0105238_10127847 | 3300009551 | Bacteria | 2519 |
| 233 | Ga0105238_10202962 | 3300009551 | Bacteria | 1959 |
| 234 | Ga0105238_10270412 | 3300009551 | Bacteria | 1680 |
| 235 | Ga0105249_10000011 | 3300009553 | Bacteria | 292812 |
| 236 | Ga0105249_10000817 | 3300009553 | Bacteria | 28085 |
| 237 | Ga0105249_10111193 | 3300009553 | Bacteria | 2590 |
| 238 | Ga0105249_10627160 | 3300009553 | Bacteria | 1131 |
| 239 | Ga0099796_10311501 | 3300010159 | Bacteria | 669 |
| 240 | Ga0105239_10019349 | 3300010375 | Bacteria | 7520 |
| 241 | Ga0105239_10027950 | 3300010375 | Bacteria | 6206 |
| 242 | Ga0105239_10201628 | 3300010375 | Bacteria | 2229 |
| 243 | Ga0105239_10325781 | 3300010375 | Bacteria | 1733 |
| 244 | Ga0105239_11150032 | 3300010375 | Bacteria | 894 |
| 245 | Ga0105246_10079065 | 3300011119 | Bacteria | 2337 |
| 246 | Ga0105246_10244608 | 3300011119 | Bacteria | 1420 |
| 247 | Ga0105246_11072455 | 3300011119 | Bacteria | 734 |
| 248 | Ga0105246_11603379 | 3300011119 | Bacteria | 615 |
| 249 | Ga0157321_1022979 | 3300012487 | Bacteria | 586 |
| 250 | Ga0157373_10970106 | 3300013100 | Bacteria | 633 |
| 251 | Ga0157371_10208418 | 3300013102 | Bacteria | 1402 |
| 252 | Ga0157370_10483171 | 3300013104 | Bacteria | 1138 |
| 253 | Ga0157369_10210083 | 3300013105 | Bacteria | 2040 |
| 254 | Ga0157369_10290187 | 3300013105 | Bacteria | 1703 |
| 255 | Ga0157369_10423540 | 3300013105 | Bacteria | 1380 |
| 256 | Ga0157374_10111242 | 3300013296 | Bacteria | 2635 |
| 257 | Ga0157374_10123065 | 3300013296 | Bacteria | 2505 |
| 258 | Ga0157378_10069631 | 3300013297 | Bacteria | 3156 |
| 259 | Ga0163162_10002629 | 3300013306 | Bacteria | 17028 |
| 260 | Ga0163162_10100449 | 3300013306 | Bacteria | 2984 |
| 261 | Ga0163162_10324604 | 3300013306 | Bacteria | 1672 |
| 262 | Ga0163162_10821137 | 3300013306 | Bacteria | 1046 |
| 263 | Ga0157372_10005992 | 3300013307 | Bacteria | 12914 |
| 264 | Ga0157372_10136515 | 3300013307 | Bacteria | 2825 |
| 265 | Ga0157375_10029335 | 3300013308 | Bacteria | 5172 |
| 266 | Ga0157375_10626295 | 3300013308 | Bacteria | 1233 |
| 267 | Ga0157375_11311887 | 3300013308 | Bacteria | 851 |
| 268 | Ga0163163_10010435 | 3300014325 | Bacteria | 8357 |
| 269 | Ga0163163_10058920 | 3300014325 | Bacteria | 3797 |
| 270 | Ga0163163_10133054 | 3300014325 | Bacteria | 2527 |
| 271 | Ga0163163_10227342 | 3300014325 | Bacteria | 1915 |
| 272 | Ga0157380_10000237 | 3300014326 | Bacteria | 33183 |
| 273 | Ga0182008_10149930 | 3300014497 | Bacteria | 1169 |
| 274 | Ga0157377_10131869 | 3300014745 | Bacteria | 1527 |
| 275 | Ga0157377_10200053 | 3300014745 | Bacteria | 1268 |
| 276 | Ga0157377_10776403 | 3300014745 | Bacteria | 704 |
| 277 | Ga0157379_10003146 | 3300014968 | Bacteria | 13969 |
| 278 | Ga0157379_10205600 | 3300014968 | Bacteria | 1781 |
| 279 | Ga0157379_10219258 | 3300014968 | Bacteria | 1723 |
| 280 | Ga0157379_10666057 | 3300014968 | Bacteria | 975 |
| 281 | Ga0157379_11300996 | 3300014968 | Bacteria | 702 |
| 282 | Ga0157376_10283778 | 3300014969 | Bacteria | 1560 |
| 283 | Ga0163161_10012503 | 3300017792 | Bacteria | 5893 |
| 284 | Ga0163161_10102152 | 3300017792 | Bacteria | 2135 |
| 285 | Ga0213874_10049667 | 3300021377 | Bacteria | 1283 |
| 286 | Ga0213876_10006163 | 3300021384 | Bacteria | 6543 |
| 287 | Ga0213876_10016750 | 3300021384 | Bacteria | 3872 |
| 288 | Ga0213875_10027324 | 3300021388 | Bacteria | 2715 |
| 289 | Ga0213875_10107486 | 3300021388 | Bacteria | 1302 |
| 290 | Ga0209233_1019362 | 3300025261 | Bacteria | 1811 |
| 291 | Ga0209673_1050254 | 3300025273 | Bacteria | 1108 |
| 292 | Ga0209051_1000075 | 3300025303 | Bacteria | 205011 |
| 293 | Ga0209051_1002890 | 3300025303 | Bacteria | 11797 |
| 294 | Ga0209051_1004789 | 3300025303 | Bacteria | 8164 |
| 295 | Ga0209051_1004816 | 3300025303 | Bacteria | 8134 |
| 296 | Ga0207697_10225906 | 3300025315 | Bacteria | 826 |
| 297 | Ga0207692_10000823 | 3300025898 | Bacteria | 11109 |
| 298 | Ga0207642_10001812 | 3300025899 | Bacteria | 6604 |
| 299 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 300 | Ga0207710_10012315 | 3300025900 | Bacteria | 3599 |
| 301 | Ga0207710_10073146 | 3300025900 | Bacteria | 1576 |
| 302 | Ga0207710_10116201 | 3300025900 | Bacteria | 1274 |
| 303 | Ga0207688_10000631 | 3300025901 | Bacteria | 17344 |
| 304 | Ga0207688_10001555 | 3300025901 | Bacteria | 12077 |
| 305 | Ga0207680_10003254 | 3300025903 | Bacteria | 7649 |
| 306 | Ga0207680_10104517 | 3300025903 | Bacteria | 1826 |
| 307 | Ga0207647_10102565 | 3300025904 | Bacteria | 1696 |
| 308 | Ga0207647_10309263 | 3300025904 | Bacteria | 899 |
| 309 | Ga0207685_10010762 | 3300025905 | Bacteria | 2719 |
| 310 | Ga0207699_10288214 | 3300025906 | Bacteria | 1143 |
| 311 | Ga0207645_10028955 | 3300025907 | Bacteria | 3571 |
| 312 | Ga0207643_10254038 | 3300025908 | Bacteria | 1083 |
| 313 | Ga0207684_10565264 | 3300025910 | Bacteria | 972 |
| 314 | Ga0207707_10572499 | 3300025912 | Bacteria | 958 |
| 315 | Ga0207671_10007376 | 3300025914 | Bacteria | 9550 |
| 316 | Ga0207671_10010966 | 3300025914 | Bacteria | 7425 |
| 317 | Ga0207671_10023781 | 3300025914 | Bacteria | 4617 |
| 318 | Ga0207671_10088863 | 3300025914 | Bacteria | 2325 |
| 319 | Ga0207693_10000049 | 3300025915 | Bacteria | 100347 |
| 320 | Ga0207693_10016572 | 3300025915 | Bacteria | 5886 |
| 321 | Ga0207693_10508662 | 3300025915 | Bacteria | 940 |
| 322 | Ga0207693_10734168 | 3300025915 | Bacteria | 763 |
| 323 | Ga0207663_10675056 | 3300025916 | Bacteria | 817 |
| 324 | Ga0207660_10392660 | 3300025917 | Bacteria | 1116 |
| 325 | Ga0207662_10173268 | 3300025918 | Bacteria | 1385 |
| 326 | Ga0207657_10392050 | 3300025919 | Bacteria | 1093 |
| 327 | Ga0207681_10015809 | 3300025923 | Bacteria | 4711 |
| 328 | Ga0207694_10147254 | 3300025924 | Bacteria | 1896 |
| 329 | Ga0207694_10333884 | 3300025924 | Bacteria | 1253 |
| 330 | Ga0207650_10322380 | 3300025925 | Bacteria | 1266 |
| 331 | Ga0207687_10001708 | 3300025927 | Bacteria | 15148 |
| 332 | Ga0207687_10029129 | 3300025927 | Bacteria | 3713 |
| 333 | Ga0207700_10262229 | 3300025928 | Bacteria | 1480 |
| 334 | Ga0207664_10338994 | 3300025929 | Bacteria | 1329 |
| 335 | Ga0207664_11011005 | 3300025929 | Bacteria | 745 |
| 336 | Ga0207644_10078843 | 3300025931 | Bacteria | 2428 |
| 337 | Ga0207690_10046133 | 3300025932 | Bacteria | 2884 |
| 338 | Ga0207706_10017197 | 3300025933 | Bacteria | 6518 |
| 339 | Ga0207706_10089745 | 3300025933 | Bacteria | 2702 |
| 340 | Ga0207686_10006782 | 3300025934 | Bacteria | 6168 |
| 341 | Ga0207709_10005064 | 3300025935 | Bacteria | 7524 |
| 342 | Ga0207670_10007646 | 3300025936 | Bacteria | 6049 |
| 343 | Ga0207670_11003663 | 3300025936 | Bacteria | 702 |
| 344 | Ga0207669_10060278 | 3300025937 | Bacteria | 2325 |
| 345 | Ga0207669_10075584 | 3300025937 | Bacteria | 2135 |
| 346 | Ga0207669_10226851 | 3300025937 | Bacteria | 1375 |
| 347 | Ga0207704_10002646 | 3300025938 | Bacteria | 8086 |
| 348 | Ga0207704_10589610 | 3300025938 | Bacteria | 908 |
| 349 | Ga0207665_10003396 | 3300025939 | Bacteria | 10656 |
| 350 | Ga0207665_10006174 | 3300025939 | Bacteria | 7956 |
| 351 | Ga0207665_10410131 | 3300025939 | Bacteria | 1033 |
| 352 | Ga0207691_10429306 | 3300025940 | Bacteria | 1126 |
| 353 | Ga0207711_10000149 | 3300025941 | Bacteria | 74062 |
| 354 | Ga0207711_11038140 | 3300025941 | Bacteria | 760 |
| 355 | Ga0207689_10011059 | 3300025942 | Bacteria | 7755 |
| 356 | Ga0207689_10149660 | 3300025942 | Bacteria | 1924 |
| 357 | Ga0207661_10454513 | 3300025944 | Bacteria | 1167 |
| 358 | Ga0207667_10110240 | 3300025949 | Bacteria | 2839 |
| 359 | Ga0207667_10520202 | 3300025949 | Bacteria | 1205 |
| 360 | Ga0207651_10729817 | 3300025960 | Bacteria | 874 |
| 361 | Ga0207712_10000020 | 3300025961 | Bacteria | 292796 |
| 362 | Ga0207712_10001309 | 3300025961 | Bacteria | 17057 |
| 363 | Ga0207712_10048105 | 3300025961 | Bacteria | 2965 |
| 364 | Ga0207712_10661849 | 3300025961 | Bacteria | 908 |
| 365 | Ga0207668_10004346 | 3300025972 | Bacteria | 8322 |
| 366 | Ga0207668_10064977 | 3300025972 | Bacteria | 2581 |
| 367 | Ga0207668_10485406 | 3300025972 | Bacteria | 1060 |
| 368 | Ga0207668_10623516 | 3300025972 | Bacteria | 941 |
| 369 | Ga0207640_10035693 | 3300025981 | Bacteria | 3113 |
| 370 | Ga0207658_10001359 | 3300025986 | Bacteria | 19133 |
| 371 | Ga0207658_10099915 | 3300025986 | Bacteria | 2270 |
| 372 | Ga0207658_10279949 | 3300025986 | Bacteria | 1429 |
| 373 | Ga0207658_10845125 | 3300025986 | Bacteria | 832 |
| 374 | Ga0207677_10002239 | 3300026023 | Bacteria | 10159 |
| 375 | Ga0207677_10039731 | 3300026023 | Bacteria | 3096 |
| 376 | Ga0207677_10179216 | 3300026023 | Bacteria | 1665 |
| 377 | Ga0207703_10220293 | 3300026035 | Bacteria | 1696 |
| 378 | Ga0207703_10608927 | 3300026035 | Bacteria | 1034 |
| 379 | Ga0207639_10005576 | 3300026041 | Bacteria | 8513 |
| 380 | Ga0207639_10105934 | 3300026041 | Bacteria | 2282 |
| 381 | Ga0207639_10134443 | 3300026041 | Bacteria | 2051 |
| 382 | Ga0207678_10006306 | 3300026067 | Bacteria | 10532 |
| 383 | Ga0207678_10032076 | 3300026067 | Bacteria | 4579 |
| 384 | Ga0207708_10000411 | 3300026075 | Bacteria | 33673 |
| 385 | Ga0207708_10011584 | 3300026075 | Bacteria | 6572 |
| 386 | Ga0207708_10646042 | 3300026075 | Bacteria | 900 |
| 387 | Ga0207702_10600534 | 3300026078 | Bacteria | 1080 |
| 388 | Ga0207641_10000156 | 3300026088 | Bacteria | 97171 |
| 389 | Ga0207641_10188820 | 3300026088 | Bacteria | 1892 |
| 390 | Ga0207641_10450075 | 3300026088 | Bacteria | 1244 |
| 391 | Ga0207641_11664913 | 3300026088 | Bacteria | 640 |
| 392 | Ga0207648_10000187 | 3300026089 | Bacteria | 65094 |
| 393 | Ga0207648_10104857 | 3300026089 | Bacteria | 2480 |
| 394 | Ga0207675_100000220 | 3300026118 | Bacteria | 53425 |
| 395 | Ga0207675_100208575 | 3300026118 | Bacteria | 1878 |
| 396 | Ga0207683_10000197 | 3300026121 | Bacteria | 52074 |
| 397 | Ga0207683_10016831 | 3300026121 | Bacteria | 6221 |
| 398 | Ga0207683_10272058 | 3300026121 | Bacteria | 1547 |
| 399 | Ga0207683_11630363 | 3300026121 | Bacteria | 594 |
| 400 | Ga0207698_10037259 | 3300026142 | Bacteria | 3580 |
| 401 | Ga0207698_11525706 | 3300026142 | Bacteria | 683 |
| 402 | Ga0209813_10005913 | 3300027866 | Bacteria | 3001 |
| 403 | Ga0209813_10150119 | 3300027866 | Bacteria | 834 |
| 404 | Ga0268266_10004901 | 3300028379 | Bacteria | 12694 |
| 405 | Ga0268266_10007692 | 3300028379 | Bacteria | 9676 |
| 406 | Ga0268266_10018751 | 3300028379 | Bacteria | 5895 |
| 407 | Ga0268266_10049310 | 3300028379 | Bacteria | 3611 |
| 408 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 409 | Ga0268265_10026403 | 3300028380 | Bacteria | 4132 |
| 410 | Ga0268265_10319787 | 3300028380 | Bacteria | 1405 |
| 411 | Ga0268265_10589825 | 3300028380 | Bacteria | 1060 |
| 412 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 413 | Ga0268264_10012485 | 3300028381 | Bacteria | 6994 |
| 414 | Ga0268264_10111091 | 3300028381 | Bacteria | 2401 |
| 415 | Ga0268264_11174025 | 3300028381 | Bacteria | 777 |
| 416 | Ga0265327_10002454 | 3300031251 | Bacteria | 19559 |
| 417 | Ga0307408_100615059 | 3300031548 | Bacteria | 967 |
| 418 | Ga0307413_10040624 | 3300031824 | Bacteria | 2716 |
| 419 | Ga0307413_10061299 | 3300031824 | Bacteria | 2320 |
| 420 | Ga0307410_11430315 | 3300031852 | Bacteria | 608 |
| 421 | Ga0307406_10756649 | 3300031901 | Bacteria | 816 |
| 422 | Ga0307407_10042758 | 3300031903 | Bacteria | 2543 |
| 423 | Ga0307409_100292982 | 3300031995 | Bacteria | 1510 |
| 424 | Ga0307416_100098500 | 3300032002 | Bacteria | 2536 |
| 425 | Ga0307416_100645439 | 3300032002 | Bacteria | 1143 |
| 426 | Ga0307414_11061717 | 3300032004 | Bacteria | 747 |
| 427 | Ga0307411_10526675 | 3300032005 | Bacteria | 1004 |
| 428 | Ga0307415_100016173 | 3300032126 | Bacteria | 4439 |
| 429 | Ga0307415_101229370 | 3300032126 | Bacteria | 707 |
| 430 | Ga0373941_0024802 | 3300035115 | Bacteria | 1726 |
| 431 | Ga0373960_0022712 | 3300035121 | Bacteria | 1683 |
| 432 | Ga0373942_0200302 | 3300035207 | Bacteria | 662 |
| 433 | Ga0373962_0086001 | 3300035242 | Bacteria | 962 |
| 434 | Ga0373931_0037789 | 3300035691 | Bacteria | 2522 |
| 435 | Ga0373931_0078237 | 3300035691 | Bacteria | 1819 |
| 436 | Ga0373937_1240750 | 3300036401 | Bacteria | 694 |
| 437 | Ga0316584_0454039 | 3300036712 | Bacteria | 906 |
| 438 | Ga0395900_0576256 | 3300037418 | Bacteria | 1068 |
| 439 | Ga0395900_0856793 | 3300037418 | Bacteria | 834 |
| 440 | Ga0395900_1285241 | 3300037418 | Bacteria | 646 |
| 441 | Ga0436364_0126449 | 3300037853 | Bacteria | 4577 |
| 442 | Ga0436364_0603886 | 3300037853 | Bacteria | 667 |
| 443 | Ga0436364_0950685 | 3300037853 | Bacteria | 10867 |
| 444 | Ga0436365_0059246 | 3300039437 | Bacteria | 4077 |
| 445 | Ga0436365_0627008 | 3300039437 | Bacteria | 4243 |
| 446 | Ga0436365_1276831 | 3300039437 | Bacteria | 12153 |
| 447 | Ga0436365_1413714 | 3300039437 | Bacteria | 699 |
| 448 | Ga0436360_0562690 | 3300039438 | Bacteria | 2233 |
| 449 | Ga0436361_0363522 | 3300039447 | Bacteria | 829 |
| 450 | Ga0436363_0082189 | 3300039450 | Bacteria | 844 |
| 451 | Ga0436363_0160340 | 3300039450 | Bacteria | 802 |
| 452 | Ga0436363_0198696 | 3300039450 | Bacteria | 4028 |
| 453 | Ga0436363_0598107 | 3300039450 | Bacteria | 1717 |
| 454 | Ga0436363_1183203 | 3300039450 | Bacteria | 1677 |
| 455 | Ga0439461_0003064 | 3300041410 | Bacteria | 2724 |
| 456 | Ga0439461_0012317 | 3300041410 | Bacteria | 1598 |
| 457 | Ga0439466_0001598 | 3300041411 | Bacteria | 8850 |
| 458 | Ga0439466_0005159 | 3300041411 | Bacteria | 5005 |
| 459 | Ga0439465_0002492 | 3300041413 | Bacteria | 6011 |
| 460 | Ga0439465_0003273 | 3300041413 | Bacteria | 5294 |
| 461 | Ga0439465_0010180 | 3300041413 | Bacteria | 2955 |
| 462 | Ga0439465_0018576 | 3300041413 | Bacteria | 2172 |
| 463 | Ga0439465_0133700 | 3300041413 | Bacteria | 877 |
| 464 | Ga0451787_735807 | 3300041441 | Bacteria | 1069 |
| 465 | Ga0451789_0771824 | 3300041443 | Bacteria | 604 |
| 466 | Ga0451793_0034594 | 3300041452 | Bacteria | 618 |
| 467 | Ga0451841_0612220 | 3300041498 | Bacteria | 1606 |
| 468 | Ga0451847_0137655 | 3300041503 | Bacteria | 824 |
| 469 | Ga0439431_0005723 | 3300041997 | Bacteria | 2742 |
| 470 | Ga0439431_0035028 | 3300041997 | Bacteria | 1260 |
| 471 | Ga0439442_041566 | 3300042002 | Bacteria | 966 |
| 472 | Ga0439445_0008931 | 3300042004 | Bacteria | 2354 |
| 473 | Ga0439445_0019377 | 3300042004 | Bacteria | 1695 |
| 474 | Ga0439448_0149902 | 3300042005 | Bacteria | 809 |
| 475 | Ga0439434_0002444 | 3300042435 | Bacteria | 5402 |
| 476 | Ga0439434_0027631 | 3300042435 | Bacteria | 1716 |
| 477 | Ga0439434_0086834 | 3300042435 | Bacteria | 997 |
| 478 | Ga0439435_0130772 | 3300042436 | Bacteria | 793 |
| 479 | Ga0466969_0003541 | 3300044656 | Bacteria | 8306 |
| 480 | Ga0466969_0110240 | 3300044656 | Bacteria | 1289 |
| 481 | Ga0466972_0007528 | 3300044658 | Bacteria | 5463 |
| 482 | Ga0466972_0008245 | 3300044658 | Bacteria | 5221 |
| 483 | Ga0466972_0026588 | 3300044658 | Bacteria | 2868 |
| 484 | Ga0466972_0055758 | 3300044658 | Bacteria | 1900 |
| 485 | Ga0466972_0101894 | 3300044658 | Bacteria | 1358 |
| 486 | Ga0466972_0237777 | 3300044658 | Bacteria | 852 |
| 487 | Ga0466965_0001448 | 3300044683 | Bacteria | 9581 |
| 488 | Ga0466965_0003649 | 3300044683 | Bacteria | 6786 |
| 489 | Ga0466965_0060406 | 3300044683 | Bacteria | 1893 |
| 490 | Ga0466965_0109211 | 3300044683 | Bacteria | 1420 |
| 491 | Ga0466965_0381991 | 3300044683 | Bacteria | 776 |
| 492 | Ga0466966_0004633 | 3300044684 | Bacteria | 9052 |
| 493 | Ga0466966_0009501 | 3300044684 | Bacteria | 6440 |
| 494 | Ga0466966_0180851 | 3300044684 | Bacteria | 1279 |
| 495 | Ga0466966_0445789 | 3300044684 | Bacteria | 778 |
| 496 | Ga0466961_0009146 | 3300044693 | Bacteria | 6309 |
| 497 | Ga0466961_0180376 | 3300044693 | Bacteria | 1311 |
| 498 | Ga0466964_0001519 | 3300044706 | Bacteria | 7975 |
| 499 | Ga0466964_0084611 | 3300044706 | Bacteria | 1368 |
| 500 | Ga0466971_0002606 | 3300044719 | Bacteria | 7629 |
| 501 | Ga0466971_0012348 | 3300044719 | Bacteria | 3742 |
| 502 | Ga0466968_0001533 | 3300044735 | Bacteria | 8300 |
| 503 | Ga0466968_0001712 | 3300044735 | Bacteria | 7907 |
| 504 | Ga0466968_0002050 | 3300044735 | Bacteria | 7331 |
| 505 | Ga0466968_0028015 | 3300044735 | Bacteria | 2321 |
| 506 | Ga0466968_0538556 | 3300044735 | Bacteria | 585 |
| 507 | Ga0466970_0002905 | 3300044765 | Bacteria | 8298 |
| 508 | Ga0466970_0011881 | 3300044765 | Bacteria | 4441 |
| 509 | Ga0466970_0019593 | 3300044765 | Bacteria | 3508 |
| 510 | Ga0466970_0055259 | 3300044765 | Bacteria | 2120 |
| 511 | Ga0466970_0280708 | 3300044765 | Bacteria | 937 |
| 512 | Ga0466957_0001674 | 3300044842 | Bacteria | 11647 |
| 513 | Ga0466957_0011226 | 3300044842 | Bacteria | 5160 |
| 514 | Ga0466957_0020925 | 3300044842 | Bacteria | 3849 |
| 515 | Ga0466957_0056145 | 3300044842 | Bacteria | 2407 |
| 516 | Ga0466957_0458622 | 3300044842 | Bacteria | 879 |
| 517 | Ga0466957_0539263 | 3300044842 | Bacteria | 812 |
| 518 | Ga0466960_0000116 | 3300044901 | Bacteria | 26505 |
| 519 | Ga0466960_0000837 | 3300044901 | Bacteria | 10857 |
| 520 | Ga0466960_0143415 | 3300044901 | Bacteria | 1270 |
| 521 | Ga0466959_0006180 | 3300045049 | Bacteria | 8275 |
| 522 | Ga0466959_0007885 | 3300045049 | Bacteria | 7496 |
| 523 | Ga0466959_0050309 | 3300045049 | Bacteria | 3059 |
| 524 | Ga0466959_0053451 | 3300045049 | Bacteria | 2952 |
| 525 | Ga0466958_0002368 | 3300045836 | Bacteria | 9439 |
| 526 | Ga0466958_0017360 | 3300045836 | Bacteria | 4158 |
| 527 | Ga0466958_0021510 | 3300045836 | Bacteria | 3771 |
| 528 | Ga0466958_0112916 | 3300045836 | Bacteria | 1697 |
| 529 | Ga0466958_0657361 | 3300045836 | Bacteria | 682 |
| 530 | Ga0466958_0765419 | 3300045836 | Bacteria | 629 |
| 531 | Ga0466958_0847942 | 3300045836 | Bacteria | 596 |
| 532 | Ga0466967_0002885 | 3300045976 | Bacteria | 10936 |
| 533 | Ga0466967_0003298 | 3300045976 | Bacteria | 10478 |
| 534 | Ga0466967_0021171 | 3300045976 | Bacteria | 5274 |
| 535 | Ga0466967_0030203 | 3300045976 | Bacteria | 4545 |
| 536 | Ga0466967_0044271 | 3300045976 | Bacteria | 3860 |
| 537 | Ga0466967_0473321 | 3300045976 | Bacteria | 1226 |
| 538 | Ga0466967_0841830 | 3300045976 | Bacteria | 911 |
| 539 | Ga0495629_0015508 | 3300046459 | Bacteria | 5471 |
| 540 | Ga0495638_0037001 | 3300046460 | Bacteria | 3106 |
| 541 | Ga0495641_0005534 | 3300046461 | Bacteria | 8485 |
| 542 | Ga0495650_0193701 | 3300046471 | Bacteria | 709 |
| 543 | Ga0495582_0059652 | 3300046473 | Bacteria | 2105 |
| 544 | Ga0495639_0031878 | 3300046475 | Bacteria | 2349 |
| 545 | Ga0495584_0318994 | 3300046491 | Bacteria | 789 |
| 546 | Ga0495606_0010471 | 3300046507 | Bacteria | 7689 |
| 547 | Ga0495608_0361087 | 3300046511 | Bacteria | 893 |
| 548 | Ga0495648_0001720 | 3300046524 | Bacteria | 21134 |
| 549 | Ga0495640_0122927 | 3300046533 | Bacteria | 1685 |
| 550 | Ga0495635_0878669 | 3300046663 | Bacteria | 575 |
| 551 | Ga0495671_0106388 | 3300046692 | Bacteria | 1370 |
| 552 | Ga0495674_0723527 | 3300047319 | Bacteria | 779 |
| 553 | Ga0495672_0006563 | 3300047320 | Bacteria | 8962 |
| 554 | Ga0495672_0055873 | 3300047320 | Bacteria | 2301 |
| 555 | Ga0495677_0317379 | 3300047445 | Bacteria | 614 |
| 556 | Ga0495673_0000355 | 3300047469 | Bacteria | 57060 |
| 557 | Ga0495686_0002522 | 3300047472 | Bacteria | 17141 |
| 558 | Ga0495686_0011027 | 3300047472 | Bacteria | 6393 |
| 559 | Ga0495686_0034814 | 3300047472 | Bacteria | 3240 |
| 560 | Ga0495686_0365391 | 3300047472 | Bacteria | 781 |
| 561 | Ga0495686_0472982 | 3300047472 | Unclassified | 663 |
| 562 | Ga0496100_0000009 | 3300048903 | Bacteria | 225785 |
| 563 | Ga0496100_0000531 | 3300048903 | Bacteria | 18147 |
| 564 | Ga0496100_0006888 | 3300048903 | Bacteria | 6224 |
| 565 | Ga0496100_0013488 | 3300048903 | Bacteria | 4715 |
| 566 | Ga0496100_0033050 | 3300048903 | Bacteria | 3233 |
| 567 | Ga0496100_0280561 | 3300048903 | Bacteria | 1242 |
| 568 | Ga0496100_0539637 | 3300048903 | Bacteria | 901 |
| 569 | Ga0496101_0000018 | 3300048904 | Bacteria | 236102 |
| 570 | Ga0496101_0000102 | 3300048904 | Bacteria | 88779 |
| 571 | Ga0496101_0000432 | 3300048904 | Bacteria | 26783 |
| 572 | Ga0496101_0002584 | 3300048904 | Bacteria | 11123 |
| 573 | Ga0496101_0048871 | 3300048904 | Bacteria | 3041 |
| 574 | Ga0496101_0257671 | 3300048904 | Bacteria | 1360 |
| 575 | Ga0496101_0458739 | 3300048904 | Bacteria | 1005 |
| 576 | Ga0496101_0478661 | 3300048904 | Bacteria | 983 |
| 577 | Ga0496102_0000037 | 3300048905 | Bacteria | 199368 |
| 578 | Ga0496102_0000780 | 3300048905 | Bacteria | 31010 |
| 579 | Ga0496102_0001336 | 3300048905 | Bacteria | 22132 |
| 580 | Ga0496102_0035693 | 3300048905 | Bacteria | 4476 |
| 581 | Ga0496102_0116111 | 3300048905 | Bacteria | 2498 |
| 582 | Ga0496102_0127375 | 3300048905 | Bacteria | 2381 |
| 583 | Ga0496102_0142321 | 3300048905 | Bacteria | 2249 |
| 584 | Ga0496102_0801092 | 3300048905 | Bacteria | 864 |
| 585 | Ga0496102_1233731 | 3300048905 | Bacteria | 667 |
| 586 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 587 | Ga0496103_0001409 | 3300048906 | Bacteria | 16139 |
| 588 | Ga0496103_0001995 | 3300048906 | Bacteria | 13156 |
| 589 | Ga0496103_0018136 | 3300048906 | Bacteria | 4220 |
| 590 | Ga0496103_0264594 | 3300048906 | Bacteria | 1106 |
| 591 | Ga0496103_0397004 | 3300048906 | Bacteria | 886 |
| 592 | Ga0496104_0019767 | 3300048907 | Bacteria | 6166 |
| 593 | Ga0496104_0022028 | 3300048907 | Bacteria | 5855 |
| 594 | Ga0496105_0117376 | 3300048908 | Bacteria | 2195 |
| 595 | Ga0496105_0153063 | 3300048908 | Bacteria | 1895 |
| 596 | Ga0496105_0188632 | 3300048908 | Bacteria | 1687 |
| 597 | Ga0496105_0300130 | 3300048908 | Bacteria | 1291 |
| 598 | Ga0496106_0004574 | 3300048909 | Bacteria | 10261 |
| 599 | Ga0496106_0004861 | 3300048909 | Bacteria | 9945 |
| 600 | Ga0496106_0005826 | 3300048909 | Bacteria | 9113 |
| 601 | Ga0496106_0012852 | 3300048909 | Bacteria | 6180 |
| 602 | Ga0496106_0052159 | 3300048909 | Bacteria | 3085 |
| 603 | Ga0496106_0197032 | 3300048909 | Bacteria | 1602 |
| 604 | Ga0496106_0621694 | 3300048909 | Bacteria | 864 |
| 605 | Ga0496106_0634410 | 3300048909 | Bacteria | 854 |
| 606 | Ga0496106_1339127 | 3300048909 | Bacteria | 555 |
| 607 | Ga0496107_0000511 | 3300048910 | Bacteria | 21543 |
| 608 | Ga0496107_0004059 | 3300048910 | Bacteria | 9857 |
| 609 | Ga0496107_0011387 | 3300048910 | Bacteria | 6193 |
| 610 | Ga0496107_0014747 | 3300048910 | Bacteria | 5473 |
| 611 | Ga0496107_0319733 | 3300048910 | Bacteria | 1155 |
| 612 | Ga0496107_0824527 | 3300048910 | Bacteria | 678 |
| 613 | Ga0496108_0001088 | 3300048911 | Bacteria | 21204 |
| 614 | Ga0496108_0002904 | 3300048911 | Bacteria | 13767 |
| 615 | Ga0496108_0188733 | 3300048911 | Bacteria | 1786 |
| 616 | Ga0496108_0337249 | 3300048911 | Bacteria | 1315 |
| 617 | Ga0496108_0929573 | 3300048911 | Bacteria | 745 |
| 618 | Ga0496109_0000136 | 3300048912 | Bacteria | 73612 |
| 619 | Ga0496109_0011714 | 3300048912 | Bacteria | 7543 |
| 620 | Ga0496109_0012517 | 3300048912 | Bacteria | 7325 |
| 621 | Ga0496109_0199615 | 3300048912 | Bacteria | 1880 |
| 622 | Ga0496109_1353856 | 3300048912 | Bacteria | 647 |
| 623 | Ga0496110_0001780 | 3300048913 | Bacteria | 15871 |
| 624 | Ga0496110_0012200 | 3300048913 | Bacteria | 7060 |
| 625 | Ga0496110_0150718 | 3300048913 | Bacteria | 2106 |
| 626 | Ga0496110_0245040 | 3300048913 | Bacteria | 1631 |
| 627 | Ga0496111_0004530 | 3300048914 | Bacteria | 8793 |
| 628 | Ga0496111_0421597 | 3300048914 | Bacteria | 986 |
| 629 | Ga0496112_0006921 | 3300048915 | Bacteria | 10007 |
| 630 | Ga0496112_0021424 | 3300048915 | Bacteria | 6147 |
| 631 | Ga0496112_0067479 | 3300048915 | Bacteria | 3531 |
| 632 | Ga0496112_0201511 | 3300048915 | Bacteria | 1949 |
| 633 | Ga0496113_0002072 | 3300048916 | Bacteria | 11538 |
| 634 | Ga0496113_0014387 | 3300048916 | Bacteria | 5397 |
| 635 | Ga0496113_0060141 | 3300048916 | Bacteria | 2863 |
| 636 | Ga0496113_0547449 | 3300048916 | Bacteria | 928 |
| 637 | Ga0496113_1048555 | 3300048916 | Bacteria | 641 |
| 638 | Ga0496114_0000108 | 3300048917 | Bacteria | 59737 |
| 639 | Ga0496114_0015915 | 3300048917 | Bacteria | 6053 |
| 640 | Ga0496114_0018416 | 3300048917 | Bacteria | 5645 |
| 641 | Ga0496114_0024842 | 3300048917 | Bacteria | 4892 |
| 642 | Ga0496114_0341192 | 3300048917 | Bacteria | 1325 |
| 643 | Ga0496114_0650347 | 3300048917 | Bacteria | 927 |
| 644 | Ga0496114_0856495 | 3300048917 | Bacteria | 789 |
| 645 | Ga0496115_0003184 | 3300048918 | Bacteria | 11793 |
| 646 | Ga0496115_0043674 | 3300048918 | Bacteria | 3575 |
| 647 | Ga0496115_0081580 | 3300048918 | Bacteria | 2634 |
| 648 | Ga0496115_0185350 | 3300048918 | Bacteria | 1720 |
| 649 | Ga0496115_0898779 | 3300048918 | Bacteria | 683 |
| 650 | Ga0496116_0000276 | 3300048919 | Bacteria | 89506 |
| 651 | Ga0496116_0002633 | 3300048919 | Bacteria | 18626 |
| 652 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 653 | Ga0496117_0001267 | 3300048920 | Bacteria | 37488 |
| 654 | Ga0496117_0054979 | 3300048920 | Bacteria | 2785 |
| 655 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 656 | Ga0496118_0000275 | 3300048921 | Bacteria | 90451 |
| 657 | Ga0496118_0000292 | 3300048921 | Bacteria | 87325 |
| 658 | Ga0496118_0011629 | 3300048921 | Bacteria | 8560 |
| 659 | Ga0496118_0328393 | 3300048921 | Bacteria | 826 |
| 660 | Ga0496119_0005085 | 3300048922 | Bacteria | 12770 |
| 661 | Ga0496119_0006894 | 3300048922 | Bacteria | 10369 |
| 662 | Ga0496119_0011468 | 3300048922 | Bacteria | 7331 |
| 663 | Ga0496119_0197251 | 3300048922 | Bacteria | 1044 |
| 664 | Ga0496120_0017069 | 3300048923 | Bacteria | 4718 |
| 665 | Ga0496120_0030665 | 3300048923 | Bacteria | 3264 |
| 666 | Ga0496120_0098986 | 3300048923 | Bacteria | 1544 |
| 667 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 668 | Ga0496121_0000338 | 3300048924 | Bacteria | 97703 |
| 669 | Ga0496121_0016981 | 3300048924 | Bacteria | 7472 |
| 670 | Ga0496121_0135536 | 3300048924 | Bacteria | 1835 |
| 671 | Ga0496121_0247368 | 3300048924 | Bacteria | 1238 |
| 672 | Ga0496121_0350796 | 3300048924 | Bacteria | 983 |
| 673 | Ga0496122_0000164 | 3300048925 | Bacteria | 158055 |
| 674 | Ga0496122_0024719 | 3300048925 | Bacteria | 5247 |
| 675 | Ga0496123_0004915 | 3300048926 | Bacteria | 13718 |
| 676 | Ga0496123_0024513 | 3300048926 | Bacteria | 4582 |
| 677 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 678 | Ga0496124_0086213 | 3300048927 | Bacteria | 2570 |
| 679 | Ga0496124_0673315 | 3300048927 | Bacteria | 660 |
| 680 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 681 | Ga0496125_0006797 | 3300048928 | Bacteria | 12284 |
| 682 | Ga0496125_0225606 | 3300048928 | Bacteria | 1203 |
| 683 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 684 | Ga0496126_0000551 | 3300048929 | Bacteria | 72093 |
| 685 | Ga0496126_0009407 | 3300048929 | Bacteria | 10380 |
| 686 | Ga0496126_0048638 | 3300048929 | Bacteria | 3873 |
| 687 | Ga0496126_0336025 | 3300048929 | Bacteria | 1238 |
| 688 | Ga0496126_0470687 | 3300048929 | Bacteria | 1008 |
| 689 | Ga0501032_0002086 | 3300049569 | Bacteria | 15782 |
| 690 | Ga0501033_0011021 | 3300049570 | Bacteria | 6924 |
| 691 | Ga0501033_0024106 | 3300049570 | Bacteria | 4592 |
| 692 | Ga0501034_0001139 | 3300049571 | Bacteria | 37012 |
| 693 | Ga0501034_0001642 | 3300049571 | Bacteria | 28889 |
| 694 | Ga0501034_0064818 | 3300049571 | Bacteria | 3667 |
| 695 | Ga0501034_0351996 | 3300049571 | Bacteria | 1401 |
| 696 | Ga0501034_0527795 | 3300049571 | Bacteria | 1092 |
| 697 | Ga0501036_0016199 | 3300049572 | Bacteria | 6225 |
| 698 | Ga0501036_0037773 | 3300049572 | Bacteria | 4085 |
| 699 | Ga0501037_0003861 | 3300049573 | Bacteria | 10869 |
| 700 | Ga0501037_0007268 | 3300049573 | Bacteria | 8094 |
| 701 | Ga0501038_0001528 | 3300049574 | Bacteria | 21344 |
| 702 | Ga0501039_0000288 | 3300049575 | Bacteria | 35904 |
| 703 | Ga0501040_0888284 | 3300049576 | Bacteria | 645 |
| 704 | Ga0501043_0000411 | 3300049579 | Bacteria | 38553 |
| 705 | Ga0501043_0102514 | 3300049579 | Bacteria | 2249 |
| 706 | Ga0501046_0000379 | 3300049580 | Bacteria | 44584 |
| 707 | Ga0501047_0000372 | 3300049581 | Bacteria | 50660 |
| 708 | Ga0501047_0065052 | 3300049581 | Bacteria | 3516 |
| 709 | Ga0501047_0291716 | 3300049581 | Bacteria | 1475 |
| 710 | Ga0501047_0352859 | 3300049581 | Bacteria | 1307 |
| 711 | Ga0501048_0001876 | 3300049582 | Bacteria | 15956 |
| 712 | Ga0501069_0031324 | 3300049585 | Bacteria | 2924 |
| 713 | Ga0501069_0260500 | 3300049585 | Bacteria | 1012 |
| 714 | Ga0501070_0000614 | 3300049586 | Bacteria | 32686 |
| 715 | Ga0501070_0003863 | 3300049586 | Bacteria | 12920 |
| 716 | Ga0501070_0081466 | 3300049586 | Bacteria | 2678 |
| 717 | Ga0501070_0364218 | 3300049586 | Bacteria | 1172 |
| 718 | Ga0501073_0031355 | 3300049589 | Bacteria | 3793 |
| 719 | Ga0501073_0209524 | 3300049589 | Bacteria | 1347 |
| 720 | Ga0501073_0548404 | 3300049589 | Bacteria | 799 |
| 721 | Ga0501074_0692854 | 3300049590 | Bacteria | 719 |
| 722 | Ga0501077_0193961 | 3300049593 | Bacteria | 1290 |
| 723 | Ga0501077_0418646 | 3300049593 | Bacteria | 857 |
| 724 | Ga0501080_0190895 | 3300049742 | Bacteria | 1882 |
| 725 | Ga0501080_0805797 | 3300049742 | Bacteria | 823 |
| 726 | Ga0501083_0110676 | 3300049744 | Bacteria | 1806 |
| 727 | Ga0501035_0000344 | 3300049822 | Bacteria | 53753 |
| 728 | Ga0501035_0002980 | 3300049822 | Bacteria | 16277 |
| 729 | Ga0501044_0011255 | 3300049823 | Bacteria | 9699 |
| 730 | Ga0501044_0017131 | 3300049823 | Bacteria | 7776 |
| 731 | Ga0501044_0037385 | 3300049823 | Bacteria | 5075 |
| 732 | Ga0501044_0088632 | 3300049823 | Bacteria | 3123 |
| 733 | nmdc:mga03683_119849_c1 | 3300050489 | Bacteria | 1169 |
| 734 | nmdc:mga03683_192912_c1 | 3300050489 | Bacteria | 933 |
| 735 | nmdc:mga03683_41848_c1 | 3300050489 | Bacteria | 1883 |
| 736 | nmdc:mga03683_5371_c1 | 3300050489 | Bacteria | 4324 |
| 737 | nmdc:mga03683_9801_c1 | 3300050489 | Bacteria | 3418 |
| 738 | nmdc:mga03n38_10185_c1 | 3300050490 | Bacteria | 3450 |
| 739 | nmdc:mga03n38_1341_c1 | 3300050490 | Bacteria | 6962 |
| 740 | nmdc:mga03n38_1868_c1 | 3300050490 | Bacteria | 6296 |
| 741 | nmdc:mga03n38_230170_c1 | 3300050490 | Bacteria | 971 |
| 742 | nmdc:mga03n38_25775_c1 | 3300050490 | Bacteria | 2420 |
| 743 | nmdc:mga03n38_27304_c1 | 3300050490 | Bacteria | 2367 |
| 744 | nmdc:mga03n38_355751_c1 | 3300050490 | Bacteria | 798 |
| 745 | nmdc:mga03n38_373627_c1 | 3300050490 | Bacteria | 780 |
| 746 | nmdc:mga03n38_39244_c1 | 3300050490 | Bacteria | 2053 |
| 747 | nmdc:mga03n38_408364_c1 | 3300050490 | Bacteria | 749 |
| 748 | nmdc:mga03n38_66281_c1 | 3300050490 | Bacteria | 1658 |
| 749 | nmdc:mga00v17_10660_c1 | 3300050491 | Bacteria | 5027 |
| 750 | nmdc:mga00v17_10941_c1 | 3300050491 | Bacteria | 4972 |
| 751 | nmdc:mga00v17_117922_c1 | 3300050491 | Bacteria | 1688 |
| 752 | nmdc:mga00v17_16207_c1 | 3300050491 | Bacteria | 4200 |
| 753 | nmdc:mga00v17_207732_c1 | 3300050491 | Bacteria | 1267 |
| 754 | nmdc:mga00v17_21421_c1 | 3300050491 | Bacteria | 3716 |
| 755 | nmdc:mga00v17_2499_c1 | 3300050491 | Bacteria | 9411 |
| 756 | nmdc:mga00v17_278811_c1 | 3300050491 | Bacteria | 1085 |
| 757 | nmdc:mga00v17_297599_c1 | 3300050491 | Bacteria | 1048 |
| 758 | nmdc:mga00v17_309560_c1 | 3300050491 | Bacteria | 1026 |
| 759 | nmdc:mga00v17_38824_c1 | 3300050491 | Bacteria | 2849 |
| 760 | nmdc:mga00v17_480685_c1 | 3300050491 | Bacteria | 806 |
| 761 | nmdc:mga00v17_533178_c1 | 3300050491 | Bacteria | 760 |
| 762 | nmdc:mga00v17_58638_c1 | 3300050491 | Bacteria | 2359 |
| 763 | nmdc:mga00v17_60308_c1 | 3300050491 | Bacteria | 2329 |
| 764 | nmdc:mga00v17_7042_c1 | 3300050491 | Bacteria | 5989 |
| 765 | nmdc:mga00v17_7501_c1 | 3300050491 | Bacteria | 5823 |
| 766 | nmdc:mga0yw44_183462_c1 | 3300050492 | Bacteria | 1378 |
| 767 | nmdc:mga0yw44_1866_c1 | 3300050492 | Bacteria | 8658 |
| 768 | nmdc:mga0yw44_19090_c1 | 3300050492 | Bacteria | 3773 |
| 769 | nmdc:mga0yw44_218593_c1 | 3300050492 | Bacteria | 1262 |
| 770 | nmdc:mga0yw44_248080_c1 | 3300050492 | Bacteria | 1184 |
| 771 | nmdc:mga0yw44_257710_c1 | 3300050492 | Bacteria | 1162 |
| 772 | nmdc:mga0yw44_372035_c1 | 3300050492 | Bacteria | 964 |
| 773 | nmdc:mga0yw44_481397_c1 | 3300050492 | Bacteria | 842 |
| 774 | nmdc:mga0yw44_73890_c1 | 3300050492 | Bacteria | 2122 |
| 775 | nmdc:mga0yw44_74875_c1 | 3300050492 | Bacteria | 2109 |
| 776 | nmdc:mga0yw44_7852_c1 | 3300050492 | Bacteria | 5282 |
| 777 | nmdc:mga0k408_69490_c1 | 3300050493 | Bacteria | 2055 |
| 778 | nmdc:mga06z11_113785_c1 | 3300050494 | Bacteria | 1501 |
| 779 | nmdc:mga06z11_119025_c1 | 3300050494 | Bacteria | 1471 |
| 780 | nmdc:mga06z11_14437_c1 | 3300050494 | Bacteria | 3499 |
| 781 | nmdc:mga06z11_153243_c1 | 3300050494 | Bacteria | 1312 |
| 782 | nmdc:mga06z11_154550_c1 | 3300050494 | Bacteria | 1307 |
| 783 | nmdc:mga06z11_234929_c1 | 3300050494 | Bacteria | 1075 |
| 784 | nmdc:mga06z11_266431_c1 | 3300050494 | Bacteria | 1012 |
| 785 | nmdc:mga06z11_401601_c1 | 3300050494 | Bacteria | 825 |
| 786 | nmdc:mga06z11_5301_c1 | 3300050494 | Bacteria | 5164 |
| 787 | nmdc:mga04h51_107771_c1 | 3300050495 | Bacteria | 1023 |
| 788 | nmdc:mga04h51_184483_c1 | 3300050495 | Bacteria | 813 |
| 789 | nmdc:mga07m45_10931_c1 | 3300050496 | Bacteria | 3054 |
| 790 | nmdc:mga07m45_110902_c1 | 3300050496 | Bacteria | 1580 |
| 791 | nmdc:mga07m45_112251_c1 | 3300050496 | Bacteria | 1571 |
| 792 | nmdc:mga07m45_128771_c1 | 3300050496 | Bacteria | 1464 |
| 793 | nmdc:mga07m45_146232_c1 | 3300050496 | Bacteria | 1370 |
| 794 | nmdc:mga07m45_204901_c1 | 3300050496 | Bacteria | 1147 |
| 795 | nmdc:mga07m45_25465_c1 | 3300050496 | Bacteria | 3244 |
| 796 | nmdc:mga07m45_43584_c1 | 3300050496 | Bacteria | 1252 |
| 797 | nmdc:mga07m45_517462_c1 | 3300050496 | Bacteria | 691 |
| 798 | nmdc:mga07m45_68888_c1 | 3300050496 | Bacteria | 2011 |
| 799 | nmdc:mga07m45_7339_c1 | 3300050496 | Bacteria | 5626 |
| 800 | nmdc:mga07m45_7354_c1 | 3300050496 | Bacteria | 5623 |
| 801 | nmdc:mga05p37_27189_c1 | 3300050507 | Bacteria | 6964 |
| 802 | nmdc:mga09592_288422_c1 | 3300050508 | Bacteria | 1423 |
| 803 | nmdc:mga0qj67_66076_c1 | 3300050509 | Bacteria | 2880 |
| 804 | nmdc:mga0qj67_7908_c1 | 3300050509 | Bacteria | 7858 |
| 805 | nmdc:mga06r32_18218_c1 | 3300050510 | Bacteria | 6425 |
| 806 | nmdc:mga08y16_826498_c1 | 3300050511 | Bacteria | 917 |
| 807 | nmdc:mga0n895_854997_c1 | 3300050512 | Bacteria | 897 |
| 808 | nmdc:mga0sz30_100127_c1 | 3300050516 | Bacteria | 1266 |
| 809 | nmdc:mga0sz30_105251_c1 | 3300050516 | Bacteria | 1234 |
| 810 | nmdc:mga0sz30_124159_c1 | 3300050516 | Bacteria | 1135 |
| 811 | nmdc:mga0sz30_152805_c1 | 3300050516 | Bacteria | 1021 |
| 812 | nmdc:mga0sz30_15412_c1 | 3300050516 | Bacteria | 3021 |
| 813 | nmdc:mga0sz30_16148_c1 | 3300050516 | Bacteria | 2959 |
| 814 | nmdc:mga0sz30_164083_c1 | 3300050516 | Bacteria | 984 |
| 815 | nmdc:mga0sz30_252954_c1 | 3300050516 | Bacteria | 784 |
| 816 | nmdc:mga0sz30_67219_c1 | 3300050516 | Bacteria | 1539 |
| 817 | nmdc:mga0sz30_673_c1 | 3300050516 | Bacteria | 12605 |
| 818 | nmdc:mga0sz30_9230_c1 | 3300050516 | Bacteria | 2679 |
| 819 | Ga0500635_0002503 | 3300053080 | Bacteria | 4563 |
| 820 | Ga0495655_0005032 | 3300053083 | Bacteria | 2307 |
| 821 | Ga0500643_003428 | 3300053087 | Bacteria | 7642 |
| 822 | Ga0500643_020257 | 3300053087 | Bacteria | 2178 |
| 823 | Ga0500650_0068408 | 3300053098 | Bacteria | 1660 |
| 824 | Ga0500562_005573 | 3300053108 | Bacteria | 3164 |
| 825 | Ga0500608_095073 | 3300053122 | Bacteria | 1387 |
| 826 | Ga0500642_0256270 | 3300053130 | Bacteria | 802 |
| 827 | Ga0500652_009718 | 3300053131 | Bacteria | 3266 |
| 828 | Ga0500652_038573 | 3300053131 | Bacteria | 1911 |
| 829 | Ga0500559_0017606 | 3300053136 | Bacteria | 3018 |
| 830 | Ga0500564_089895 | 3300053138 | Bacteria | 1368 |
| 831 | Ga0500568_0055573 | 3300053139 | Bacteria | 1545 |
| 832 | Ga0500579_239452 | 3300053143 | Bacteria | 604 |
| 833 | Ga0500616_0000812 | 3300053153 | Bacteria | 35580 |
| 834 | Ga0500616_0056503 | 3300053153 | Bacteria | 2048 |
| 835 | Ga0500627_0028790 | 3300053158 | Bacteria | 2311 |
| 836 | Ga0500636_0234518 | 3300053177 | Unclassified | 947 |
| 837 | Ga0500637_0035224 | 3300053178 | Bacteria | 2805 |
| 838 | Ga0500645_000075 | 3300053730 | Bacteria | 78736 |
| 839 | Ga0500645_022555 | 3300053730 | Bacteria | 1935 |
| 840 | Ga0466962_0004965 | 3300061719 | Bacteria | 6398 |
| 841 | Ga0466962_0010269 | 3300061719 | Bacteria | 4496 |
| 842 | Ga0466962_0094889 | 3300061719 | Bacteria | 1430 |
| 843 | Ga0466962_0106556 | 3300061719 | Bacteria | 1348 |
| 844 | Ga0466962_0275481 | 3300061719 | Bacteria | 830 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048928 | Ga0496125_0225606 | Ga0496125_0225606_761_1168 | 130 |
| 2 | 3300041503 | Ga0451847_0137655 | Ga0451847_0137655_289_738 | 148 |
| 3 | iso_pu_bacteria | 2929212328 | 2929214787 | 153 |
| 4 | iso_pu_bacteria | 2643221715 | 2644634964 | 154 |
| 5 | iso_pu_bacteria | 2738541264 | 2738667483 | 154 |
| 6 | iso_pu_bacteria | 2738541356 | 2739146553 | 154 |
| 7 | iso_pu_bacteria | 2902792274 | 2902798383 | 154 |
| 8 | iso_pu_bacteria | 2902810491 | 2902816980 | 154 |
| 9 | 3300050489 | nmdc:mga03683_41848_c1 | nmdc:mga03683_41848_c1_355_822 | 155 |
| 10 | iso_pu_bacteria | 2643221687 | 2644486481 | 155 |
| 11 | iso_pu_bacteria | 2902837492 | 2902840102 | 155 |
| 12 | 3300006038 | Ga0075365_10026131 | Ga0075365_100261313 | 156 |
| 13 | 3300006048 | Ga0075363_100021791 | Ga0075363_1000217913 | 156 |
| 14 | 3300006051 | Ga0075364_10013034 | Ga0075364_100130343 | 156 |
| 15 | 3300006177 | Ga0075362_10090150 | Ga0075362_100901503 | 156 |
| 16 | 3300006353 | Ga0075370_10011857 | Ga0075370_100118576 | 156 |
| 17 | 3300032126 | Ga0307415_101229370 | Ga0307415_1012293702 | 156 |
| 18 | 3300048903 | Ga0496100_0539637 | Ga0496100_0539637_225_698 | 156 |
| 19 | 3300048904 | Ga0496101_0458739 | Ga0496101_0458739_308_781 | 156 |
| 20 | 3300048910 | Ga0496107_0319733 | Ga0496107_0319733_224_697 | 156 |
| 21 | 3300048924 | Ga0496121_0247368 | Ga0496121_0247368_541_1014 | 156 |
| 22 | 3300050489 | nmdc:mga03683_9801_c1 | nmdc:mga03683_9801_c1_1896_2369 | 156 |
| 23 | 3300050492 | nmdc:mga0yw44_19090_c1 | nmdc:mga0yw44_19090_c1_2546_3019 | 156 |
| 24 | 3300050496 | nmdc:mga07m45_10931_c1 | nmdc:mga07m45_10931_c1_917_1390 | 156 |
| 25 | iso_pu_bacteria | 2523231044 | 2523385878 | 156 |
| 26 | iso_pu_bacteria | 2902799365 | 2902801644 | 156 |
| 27 | iso_pu_bacteria | 2939582691 | 2939587226 | 156 |
| 28 | 3300006186 | Ga0075369_10004972 | Ga0075369_100049723 | 157 |
| 29 | 3300047472 | Ga0495686_0002522 | Ga0495686_0002522_15842_16327 | 157 |
| 30 | 3300047472 | Ga0495686_0034814 | Ga0495686_0034814_1459_1944 | 157 |
| 31 | 3300047472 | Ga0495686_0472982 | Ga0495686_0472982_68_553 | 157 |
| 32 | 3300048914 | Ga0496111_0004530 | Ga0496111_0004530_564_1037 | 157 |
| 33 | 3300050516 | nmdc:mga0sz30_15412_c1 | nmdc:mga0sz30_15412_c1_1356_1829 | 157 |
| 34 | 3300053136 | Ga0500559_0017606 | Ga0500559_0017606_2033_2518 | 157 |
| 35 | 3300001977 | JGI24746J21847_1006471 | JGI24746J21847_10064713 | 158 |
| 36 | 3300001990 | JGI24737J22298_10051930 | JGI24737J22298_100519302 | 158 |
| 37 | 3300001990 | JGI24737J22298_10110059 | JGI24737J22298_101100591 | 158 |
| 38 | 3300001991 | JGI24743J22301_10036835 | JGI24743J22301_100368352 | 158 |
| 39 | 3300001991 | JGI24743J22301_10146340 | JGI24743J22301_101463401 | 158 |
| 40 | 3300002067 | JGI24735J21928_10135299 | JGI24735J21928_101352991 | 158 |
| 41 | 3300002075 | JGI24738J21930_10010345 | JGI24738J21930_100103451 | 158 |
| 42 | 3300002075 | JGI24738J21930_10117783 | JGI24738J21930_101177831 | 158 |
| 43 | 3300002077 | JGI24744J21845_10000451 | JGI24744J21845_100004519 | 158 |
| 44 | 3300002077 | JGI24744J21845_10001995 | JGI24744J21845_100019951 | 158 |
| 45 | 3300002239 | JGI24034J26672_10003538 | JGI24034J26672_100035383 | 158 |
| 46 | 3300002239 | JGI24034J26672_10059429 | JGI24034J26672_100594291 | 158 |
| 47 | 3300002244 | JGI24742J22300_10004585 | JGI24742J22300_100045852 | 158 |
| 48 | 3300002244 | JGI24742J22300_10004702 | JGI24742J22300_100047022 | 158 |
| 49 | 3300002459 | JGI24751J29686_10007519 | JGI24751J29686_100075192 | 158 |
| 50 | 3300003792 | Ga0055540_1000057 | Ga0055540_100005767 | 158 |
| 51 | 3300005328 | Ga0070676_10027558 | Ga0070676_100275582 | 158 |
| 52 | 3300005329 | Ga0070683_100409140 | Ga0070683_1004091402 | 158 |
| 53 | 3300005330 | Ga0070690_100010167 | Ga0070690_1000101675 | 158 |
| 54 | 3300005333 | Ga0070677_10101975 | Ga0070677_101019752 | 158 |
| 55 | 3300005335 | Ga0070666_10085397 | Ga0070666_100853973 | 158 |
| 56 | 3300005335 | Ga0070666_10101200 | Ga0070666_101012002 | 158 |
| 57 | 3300005336 | Ga0070680_100357171 | Ga0070680_1003571712 | 158 |
| 58 | 3300005337 | Ga0070682_100022831 | Ga0070682_1000228315 | 158 |
| 59 | 3300005337 | Ga0070682_100043680 | Ga0070682_1000436802 | 158 |
| 60 | 3300005337 | Ga0070682_100927341 | Ga0070682_1009273411 | 158 |
| 61 | 3300005338 | Ga0068868_100000294 | Ga0068868_10000029416 | 158 |
| 62 | 3300005338 | Ga0068868_100132081 | Ga0068868_1001320812 | 158 |
| 63 | 3300005338 | Ga0068868_100480884 | Ga0068868_1004808842 | 158 |
| 64 | 3300005338 | Ga0068868_100501203 | Ga0068868_1005012031 | 158 |
| 65 | 3300005338 | Ga0068868_100548991 | Ga0068868_1005489912 | 158 |
| 66 | 3300005339 | Ga0070660_100555623 | Ga0070660_1005556232 | 158 |
| 67 | 3300005340 | Ga0070689_100040180 | Ga0070689_1000401805 | 158 |
| 68 | 3300005341 | Ga0070691_10016547 | Ga0070691_100165475 | 158 |
| 69 | 3300005344 | Ga0070661_100553276 | Ga0070661_1005532762 | 158 |
| 70 | 3300005345 | Ga0070692_10166620 | Ga0070692_101666202 | 158 |
| 71 | 3300005347 | Ga0070668_100001698 | Ga0070668_1000016982 | 158 |
| 72 | 3300005347 | Ga0070668_100231823 | Ga0070668_1002318232 | 158 |
| 73 | 3300005353 | Ga0070669_100005178 | Ga0070669_1000051789 | 158 |
| 74 | 3300005353 | Ga0070669_100137614 | Ga0070669_1001376142 | 158 |
| 75 | 3300005355 | Ga0070671_100063135 | Ga0070671_1000631353 | 158 |
| 76 | 3300005365 | Ga0070688_100027089 | Ga0070688_1000270893 | 158 |
| 77 | 3300005366 | Ga0070659_100165779 | Ga0070659_1001657792 | 158 |
| 78 | 3300005367 | Ga0070667_100000063 | Ga0070667_100000063102 | 158 |
| 79 | 3300005367 | Ga0070667_100000727 | Ga0070667_10000072714 | 158 |
| 80 | 3300005367 | Ga0070667_100011532 | Ga0070667_1000115329 | 158 |
| 81 | 3300005367 | Ga0070667_100015369 | Ga0070667_1000153699 | 158 |
| 82 | 3300005367 | Ga0070667_100195731 | Ga0070667_1001957312 | 158 |
| 83 | 3300005406 | Ga0070703_10012339 | Ga0070703_100123393 | 158 |
| 84 | 3300005434 | Ga0070709_10140768 | Ga0070709_101407682 | 158 |
| 85 | 3300005437 | Ga0070710_10005017 | Ga0070710_100050176 | 158 |
| 86 | 3300005439 | Ga0070711_100001192 | Ga0070711_1000011922 | 158 |
| 87 | 3300005439 | Ga0070711_100158578 | Ga0070711_1001585782 | 158 |
| 88 | 3300005440 | Ga0070705_100704170 | Ga0070705_1007041702 | 158 |
| 89 | 3300005441 | Ga0070700_100000463 | Ga0070700_10000046311 | 158 |
| 90 | 3300005444 | Ga0070694_100020285 | Ga0070694_1000202854 | 158 |
| 91 | 3300005455 | Ga0070663_100019917 | Ga0070663_1000199172 | 158 |
| 92 | 3300005455 | Ga0070663_100043359 | Ga0070663_1000433593 | 158 |
| 93 | 3300005456 | Ga0070678_100000347 | Ga0070678_10000034717 | 158 |
| 94 | 3300005456 | Ga0070678_100416041 | Ga0070678_1004160411 | 158 |
| 95 | 3300005457 | Ga0070662_100003014 | Ga0070662_10000301410 | 158 |
| 96 | 3300005459 | Ga0068867_100020639 | Ga0068867_1000206392 | 158 |
| 97 | 3300005466 | Ga0070685_10033819 | Ga0070685_100338193 | 158 |
| 98 | 3300005539 | Ga0068853_100006576 | Ga0068853_1000065769 | 158 |
| 99 | 3300005543 | Ga0070672_100346062 | Ga0070672_1003460622 | 158 |
| 100 | 3300005544 | Ga0070686_100066142 | Ga0070686_1000661423 | 158 |
| 101 | 3300005544 | Ga0070686_100284527 | Ga0070686_1002845272 | 158 |
| 102 | 3300005546 | Ga0070696_100146040 | Ga0070696_1001460403 | 158 |
| 103 | 3300005548 | Ga0070665_100005170 | Ga0070665_1000051709 | 158 |
| 104 | 3300005548 | Ga0070665_100009871 | Ga0070665_1000098717 | 158 |
| 105 | 3300005548 | Ga0070665_100030285 | Ga0070665_1000302853 | 158 |
| 106 | 3300005548 | Ga0070665_100344355 | Ga0070665_1003443551 | 158 |
| 107 | 3300005549 | Ga0070704_100000118 | Ga0070704_10000011813 | 158 |
| 108 | 3300005563 | Ga0068855_100094813 | Ga0068855_1000948133 | 158 |
| 109 | 3300005563 | Ga0068855_100540967 | Ga0068855_1005409672 | 158 |
| 110 | 3300005578 | Ga0068854_100000777 | Ga0068854_1000007776 | 158 |
| 111 | 3300005615 | Ga0070702_100000798 | Ga0070702_1000007985 | 158 |
| 112 | 3300005615 | Ga0070702_100120907 | Ga0070702_1001209073 | 158 |
| 113 | 3300005617 | Ga0068859_100015872 | Ga0068859_1000158723 | 158 |
| 114 | 3300005617 | Ga0068859_100484346 | Ga0068859_1004843462 | 158 |
| 115 | 3300005618 | Ga0068864_100198700 | Ga0068864_1001987002 | 158 |
| 116 | 3300005718 | Ga0068866_10000197 | Ga0068866_1000019720 | 158 |
| 117 | 3300005718 | Ga0068866_10220397 | Ga0068866_102203972 | 158 |
| 118 | 3300005719 | Ga0068861_100000102 | Ga0068861_10000010221 | 158 |
| 119 | 3300005719 | Ga0068861_100036577 | Ga0068861_1000365773 | 158 |
| 120 | 3300005719 | Ga0068861_100074511 | Ga0068861_1000745113 | 158 |
| 121 | 3300005719 | Ga0068861_101621210 | Ga0068861_1016212102 | 158 |
| 122 | 3300005840 | Ga0068870_10211854 | Ga0068870_102118542 | 158 |
| 123 | 3300005841 | Ga0068863_100000159 | Ga0068863_10000015943 | 158 |
| 124 | 3300005841 | Ga0068863_100155729 | Ga0068863_1001557293 | 158 |
| 125 | 3300005842 | Ga0068858_100146419 | Ga0068858_1001464193 | 158 |
| 126 | 3300005842 | Ga0068858_100691988 | Ga0068858_1006919881 | 158 |
| 127 | 3300005843 | Ga0068860_100000065 | Ga0068860_100000065102 | 158 |
| 128 | 3300005843 | Ga0068860_100079612 | Ga0068860_1000796125 | 158 |
| 129 | 3300005843 | Ga0068860_100199937 | Ga0068860_1001999373 | 158 |
| 130 | 3300005843 | Ga0068860_100466172 | Ga0068860_1004661722 | 158 |
| 131 | 3300005844 | Ga0068862_100000028 | Ga0068862_100000028121 | 158 |
| 132 | 3300005844 | Ga0068862_100013056 | Ga0068862_1000130563 | 158 |
| 133 | 3300005844 | Ga0068862_100101838 | Ga0068862_1001018381 | 158 |
| 134 | 3300005844 | Ga0068862_100490976 | Ga0068862_1004909762 | 158 |
| 135 | 3300005981 | Ga0081538_10255051 | Ga0081538_102550511 | 158 |
| 136 | 3300006038 | Ga0075365_10003536 | Ga0075365_1000353611 | 158 |
| 137 | 3300006038 | Ga0075365_10008557 | Ga0075365_100085579 | 158 |
| 138 | 3300006038 | Ga0075365_10100605 | Ga0075365_101006053 | 158 |
| 139 | 3300006038 | Ga0075365_10129945 | Ga0075365_101299452 | 158 |
| 140 | 3300006048 | Ga0075363_100002212 | Ga0075363_1000022124 | 158 |
| 141 | 3300006048 | Ga0075363_100004832 | Ga0075363_1000048323 | 158 |
| 142 | 3300006048 | Ga0075363_100005085 | Ga0075363_1000050853 | 158 |
| 143 | 3300006048 | Ga0075363_100019344 | Ga0075363_1000193444 | 158 |
| 144 | 3300006048 | Ga0075363_100032964 | Ga0075363_1000329642 | 158 |
| 145 | 3300006048 | Ga0075363_100044705 | Ga0075363_1000447052 | 158 |
| 146 | 3300006048 | Ga0075363_100091181 | Ga0075363_1000911811 | 158 |
| 147 | 3300006048 | Ga0075363_100204817 | Ga0075363_1002048172 | 158 |
| 148 | 3300006048 | Ga0075363_100210075 | Ga0075363_1002100752 | 158 |
| 149 | 3300006048 | Ga0075363_100233587 | Ga0075363_1002335872 | 158 |
| 150 | 3300006051 | Ga0075364_10002550 | Ga0075364_1000255010 | 158 |
| 151 | 3300006051 | Ga0075364_10004805 | Ga0075364_100048058 | 158 |
| 152 | 3300006051 | Ga0075364_10006029 | Ga0075364_100060293 | 158 |
| 153 | 3300006051 | Ga0075364_10014518 | Ga0075364_100145186 | 158 |
| 154 | 3300006051 | Ga0075364_10015034 | Ga0075364_100150342 | 158 |
| 155 | 3300006051 | Ga0075364_10016870 | Ga0075364_100168703 | 158 |
| 156 | 3300006051 | Ga0075364_10145845 | Ga0075364_101458452 | 158 |
| 157 | 3300006051 | Ga0075364_10181004 | Ga0075364_101810043 | 158 |
| 158 | 3300006051 | Ga0075364_10329545 | Ga0075364_103295452 | 158 |
| 159 | 3300006173 | Ga0070716_100000479 | Ga0070716_1000004796 | 158 |
| 160 | 3300006173 | Ga0070716_100002564 | Ga0070716_1000025647 | 158 |
| 161 | 3300006175 | Ga0070712_100000901 | Ga0070712_10000090111 | 158 |
| 162 | 3300006175 | Ga0070712_100181949 | Ga0070712_1001819492 | 158 |
| 163 | 3300006177 | Ga0075362_10003956 | Ga0075362_100039566 | 158 |
| 164 | 3300006177 | Ga0075362_10004236 | Ga0075362_100042362 | 158 |
| 165 | 3300006177 | Ga0075362_10166239 | Ga0075362_101662392 | 158 |
| 166 | 3300006177 | Ga0075362_10305725 | Ga0075362_103057252 | 158 |
| 167 | 3300006177 | Ga0075362_10366515 | Ga0075362_103665151 | 158 |
| 168 | 3300006178 | Ga0075367_10003365 | Ga0075367_100033653 | 158 |
| 169 | 3300006178 | Ga0075367_10034443 | Ga0075367_100344432 | 158 |
| 170 | 3300006178 | Ga0075367_10128092 | Ga0075367_101280922 | 158 |
| 171 | 3300006178 | Ga0075367_10151412 | Ga0075367_101514122 | 158 |
| 172 | 3300006178 | Ga0075367_10165823 | Ga0075367_101658232 | 158 |
| 173 | 3300006178 | Ga0075367_10177686 | Ga0075367_101776862 | 158 |
| 174 | 3300006186 | Ga0075369_10006708 | Ga0075369_100067083 | 158 |
| 175 | 3300006186 | Ga0075369_10015455 | Ga0075369_100154553 | 158 |
| 176 | 3300006186 | Ga0075369_10032363 | Ga0075369_100323633 | 158 |
| 177 | 3300006186 | Ga0075369_10065208 | Ga0075369_100652082 | 158 |
| 178 | 3300006186 | Ga0075369_10065449 | Ga0075369_100654492 | 158 |
| 179 | 3300006186 | Ga0075369_10123960 | Ga0075369_101239602 | 158 |
| 180 | 3300006195 | Ga0075366_10199966 | Ga0075366_101999661 | 158 |
| 181 | 3300006353 | Ga0075370_10026183 | Ga0075370_100261834 | 158 |
| 182 | 3300006353 | Ga0075370_10026467 | Ga0075370_100264673 | 158 |
| 183 | 3300006353 | Ga0075370_10094051 | Ga0075370_100940512 | 158 |
| 184 | 3300006353 | Ga0075370_10130388 | Ga0075370_101303882 | 158 |
| 185 | 3300006353 | Ga0075370_10130744 | Ga0075370_101307442 | 158 |
| 186 | 3300006353 | Ga0075370_10149202 | Ga0075370_101492022 | 158 |
| 187 | 3300006353 | Ga0075370_10188879 | Ga0075370_101888792 | 158 |
| 188 | 3300006358 | Ga0068871_100009689 | Ga0068871_1000096893 | 158 |
| 189 | 3300006358 | Ga0068871_100092764 | Ga0068871_1000927642 | 158 |
| 190 | 3300006844 | Ga0075428_100005745 | Ga0075428_10000574510 | 158 |
| 191 | 3300006846 | Ga0075430_100013678 | Ga0075430_1000136786 | 158 |
| 192 | 3300006847 | Ga0075431_100034823 | Ga0075431_1000348233 | 158 |
| 193 | 3300006881 | Ga0068865_100000554 | Ga0068865_10000055411 | 158 |
| 194 | 3300006931 | Ga0097620_100015873 | Ga0097620_1000158733 | 158 |
| 195 | 3300006931 | Ga0097620_100484339 | Ga0097620_1004843392 | 158 |
| 196 | 3300009092 | Ga0105250_10072232 | Ga0105250_100722322 | 158 |
| 197 | 3300009094 | Ga0111539_10911721 | Ga0111539_109117211 | 158 |
| 198 | 3300009098 | Ga0105245_10002148 | Ga0105245_100021483 | 158 |
| 199 | 3300009101 | Ga0105247_10000910 | Ga0105247_100009105 | 158 |
| 200 | 3300009101 | Ga0105247_10002035 | Ga0105247_100020359 | 158 |
| 201 | 3300009101 | Ga0105247_10063859 | Ga0105247_100638592 | 158 |
| 202 | 3300009101 | Ga0105247_10386931 | Ga0105247_103869312 | 158 |
| 203 | 3300009147 | Ga0114129_12644484 | Ga0114129_126444841 | 158 |
| 204 | 3300009148 | Ga0105243_10001698 | Ga0105243_1000169814 | 158 |
| 205 | 3300009148 | Ga0105243_10035777 | Ga0105243_100357775 | 158 |
| 206 | 3300009148 | Ga0105243_10175523 | Ga0105243_101755231 | 158 |
| 207 | 3300009174 | Ga0105241_10421973 | Ga0105241_104219732 | 158 |
| 208 | 3300009176 | Ga0105242_10001106 | Ga0105242_100011063 | 158 |
| 209 | 3300009177 | Ga0105248_10000074 | Ga0105248_1000007493 | 158 |
| 210 | 3300009177 | Ga0105248_10002067 | Ga0105248_100020676 | 158 |
| 211 | 3300009177 | Ga0105248_10509809 | Ga0105248_105098092 | 158 |
| 212 | 3300009545 | Ga0105237_10005869 | Ga0105237_1000586912 | 158 |
| 213 | 3300009545 | Ga0105237_10011639 | Ga0105237_100116393 | 158 |
| 214 | 3300009545 | Ga0105237_10015011 | Ga0105237_100150118 | 158 |
| 215 | 3300009545 | Ga0105237_10035962 | Ga0105237_100359626 | 158 |
| 216 | 3300009545 | Ga0105237_10320139 | Ga0105237_103201392 | 158 |
| 217 | 3300009545 | Ga0105237_11622532 | Ga0105237_116225321 | 158 |
| 218 | 3300009551 | Ga0105238_10127847 | Ga0105238_101278473 | 158 |
| 219 | 3300009551 | Ga0105238_10202962 | Ga0105238_102029622 | 158 |
| 220 | 3300009551 | Ga0105238_10270412 | Ga0105238_102704123 | 158 |
| 221 | 3300009553 | Ga0105249_10000011 | Ga0105249_10000011212 | 158 |
| 222 | 3300009553 | Ga0105249_10000817 | Ga0105249_1000081726 | 158 |
| 223 | 3300009553 | Ga0105249_10111193 | Ga0105249_101111932 | 158 |
| 224 | 3300009553 | Ga0105249_10627160 | Ga0105249_106271602 | 158 |
| 225 | 3300010159 | Ga0099796_10311501 | Ga0099796_103115011 | 158 |
| 226 | 3300010375 | Ga0105239_10019349 | Ga0105239_100193499 | 158 |
| 227 | 3300010375 | Ga0105239_10027950 | Ga0105239_100279506 | 158 |
| 228 | 3300010375 | Ga0105239_10201628 | Ga0105239_102016282 | 158 |
| 229 | 3300010375 | Ga0105239_10325781 | Ga0105239_103257812 | 158 |
| 230 | 3300010375 | Ga0105239_11150032 | Ga0105239_111500321 | 158 |
| 231 | 3300011119 | Ga0105246_10079065 | Ga0105246_100790653 | 158 |
| 232 | 3300011119 | Ga0105246_10244608 | Ga0105246_102446082 | 158 |
| 233 | 3300011119 | Ga0105246_11603379 | Ga0105246_116033791 | 158 |
| 234 | 3300013100 | Ga0157373_10970106 | Ga0157373_109701061 | 158 |
| 235 | 3300013102 | Ga0157371_10208418 | Ga0157371_102084182 | 158 |
| 236 | 3300013104 | Ga0157370_10483171 | Ga0157370_104831712 | 158 |
| 237 | 3300013105 | Ga0157369_10210083 | Ga0157369_102100832 | 158 |
| 238 | 3300013296 | Ga0157374_10111242 | Ga0157374_101112422 | 158 |
| 239 | 3300013296 | Ga0157374_10123065 | Ga0157374_101230653 | 158 |
| 240 | 3300013297 | Ga0157378_10069631 | Ga0157378_100696315 | 158 |
| 241 | 3300013306 | Ga0163162_10002629 | Ga0163162_100026293 | 158 |
| 242 | 3300013306 | Ga0163162_10100449 | Ga0163162_101004493 | 158 |
| 243 | 3300013306 | Ga0163162_10324604 | Ga0163162_103246042 | 158 |
| 244 | 3300013306 | Ga0163162_10821137 | Ga0163162_108211372 | 158 |
| 245 | 3300013307 | Ga0157372_10005992 | Ga0157372_100059924 | 158 |
| 246 | 3300013307 | Ga0157372_10136515 | Ga0157372_101365154 | 158 |
| 247 | 3300013308 | Ga0157375_10029335 | Ga0157375_100293354 | 158 |
| 248 | 3300013308 | Ga0157375_10626295 | Ga0157375_106262952 | 158 |
| 249 | 3300014325 | Ga0163163_10010435 | Ga0163163_100104355 | 158 |
| 250 | 3300014325 | Ga0163163_10058920 | Ga0163163_100589202 | 158 |
| 251 | 3300014325 | Ga0163163_10133054 | Ga0163163_101330542 | 158 |
| 252 | 3300014325 | Ga0163163_10227342 | Ga0163163_102273423 | 158 |
| 253 | 3300014326 | Ga0157380_10000237 | Ga0157380_1000023719 | 158 |
| 254 | 3300014497 | Ga0182008_10149930 | Ga0182008_101499302 | 158 |
| 255 | 3300014745 | Ga0157377_10131869 | Ga0157377_101318693 | 158 |
| 256 | 3300014745 | Ga0157377_10200053 | Ga0157377_102000531 | 158 |
| 257 | 3300014745 | Ga0157377_10776403 | Ga0157377_107764031 | 158 |
| 258 | 3300014968 | Ga0157379_10003146 | Ga0157379_100031468 | 158 |
| 259 | 3300014968 | Ga0157379_10219258 | Ga0157379_102192582 | 158 |
| 260 | 3300014968 | Ga0157379_10666057 | Ga0157379_106660571 | 158 |
| 261 | 3300017792 | Ga0163161_10012503 | Ga0163161_100125032 | 158 |
| 262 | 3300017792 | Ga0163161_10102152 | Ga0163161_101021523 | 158 |
| 263 | 3300025303 | Ga0209051_1000075 | Ga0209051_100007573 | 158 |
| 264 | 3300025315 | Ga0207697_10225906 | Ga0207697_102259061 | 158 |
| 265 | 3300025898 | Ga0207692_10000823 | Ga0207692_100008236 | 158 |
| 266 | 3300025899 | Ga0207642_10001812 | Ga0207642_100018124 | 158 |
| 267 | 3300025900 | Ga0207710_10000014 | Ga0207710_1000001414 | 158 |
| 268 | 3300025900 | Ga0207710_10012315 | Ga0207710_100123154 | 158 |
| 269 | 3300025900 | Ga0207710_10073146 | Ga0207710_100731462 | 158 |
| 270 | 3300025900 | Ga0207710_10116201 | Ga0207710_101162012 | 158 |
| 271 | 3300025901 | Ga0207688_10000631 | Ga0207688_100006315 | 158 |
| 272 | 3300025901 | Ga0207688_10001555 | Ga0207688_1000155512 | 158 |
| 273 | 3300025903 | Ga0207680_10003254 | Ga0207680_100032549 | 158 |
| 274 | 3300025903 | Ga0207680_10104517 | Ga0207680_101045172 | 158 |
| 275 | 3300025904 | Ga0207647_10102565 | Ga0207647_101025652 | 158 |
| 276 | 3300025905 | Ga0207685_10010762 | Ga0207685_100107623 | 158 |
| 277 | 3300025906 | Ga0207699_10288214 | Ga0207699_102882142 | 158 |
| 278 | 3300025907 | Ga0207645_10028955 | Ga0207645_100289553 | 158 |
| 279 | 3300025908 | Ga0207643_10254038 | Ga0207643_102540382 | 158 |
| 280 | 3300025910 | Ga0207684_10565264 | Ga0207684_105652642 | 158 |
| 281 | 3300025912 | Ga0207707_10572499 | Ga0207707_105724992 | 158 |
| 282 | 3300025914 | Ga0207671_10007376 | Ga0207671_1000737610 | 158 |
| 283 | 3300025914 | Ga0207671_10010966 | Ga0207671_100109665 | 158 |
| 284 | 3300025914 | Ga0207671_10023781 | Ga0207671_100237813 | 158 |
| 285 | 3300025914 | Ga0207671_10088863 | Ga0207671_100888632 | 158 |
| 286 | 3300025915 | Ga0207693_10000049 | Ga0207693_1000004984 | 158 |
| 287 | 3300025915 | Ga0207693_10016572 | Ga0207693_100165725 | 158 |
| 288 | 3300025917 | Ga0207660_10392660 | Ga0207660_103926602 | 158 |
| 289 | 3300025918 | Ga0207662_10173268 | Ga0207662_101732682 | 158 |
| 290 | 3300025919 | Ga0207657_10392050 | Ga0207657_103920502 | 158 |
| 291 | 3300025923 | Ga0207681_10015809 | Ga0207681_100158096 | 158 |
| 292 | 3300025924 | Ga0207694_10147254 | Ga0207694_101472542 | 158 |
| 293 | 3300025924 | Ga0207694_10333884 | Ga0207694_103338842 | 158 |
| 294 | 3300025925 | Ga0207650_10322380 | Ga0207650_103223802 | 158 |
| 295 | 3300025927 | Ga0207687_10001708 | Ga0207687_1000170814 | 158 |
| 296 | 3300025927 | Ga0207687_10029129 | Ga0207687_100291293 | 158 |
| 297 | 3300025929 | Ga0207664_10338994 | Ga0207664_103389942 | 158 |
| 298 | 3300025931 | Ga0207644_10078843 | Ga0207644_100788434 | 158 |
| 299 | 3300025932 | Ga0207690_10046133 | Ga0207690_100461332 | 158 |
| 300 | 3300025933 | Ga0207706_10017197 | Ga0207706_100171973 | 158 |
| 301 | 3300025933 | Ga0207706_10089745 | Ga0207706_100897453 | 158 |
| 302 | 3300025934 | Ga0207686_10006782 | Ga0207686_100067823 | 158 |
| 303 | 3300025935 | Ga0207709_10005064 | Ga0207709_100050643 | 158 |
| 304 | 3300025936 | Ga0207670_10007646 | Ga0207670_100076469 | 158 |
| 305 | 3300025936 | Ga0207670_11003663 | Ga0207670_110036632 | 158 |
| 306 | 3300025937 | Ga0207669_10060278 | Ga0207669_100602782 | 158 |
| 307 | 3300025937 | Ga0207669_10226851 | Ga0207669_102268512 | 158 |
| 308 | 3300025938 | Ga0207704_10002646 | Ga0207704_100026463 | 158 |
| 309 | 3300025939 | Ga0207665_10003396 | Ga0207665_100033967 | 158 |
| 310 | 3300025939 | Ga0207665_10006174 | Ga0207665_100061743 | 158 |
| 311 | 3300025940 | Ga0207691_10429306 | Ga0207691_104293062 | 158 |
| 312 | 3300025941 | Ga0207711_10000149 | Ga0207711_1000014959 | 158 |
| 313 | 3300025941 | Ga0207711_11038140 | Ga0207711_110381402 | 158 |
| 314 | 3300025942 | Ga0207689_10011059 | Ga0207689_100110599 | 158 |
| 315 | 3300025942 | Ga0207689_10149660 | Ga0207689_101496602 | 158 |
| 316 | 3300025944 | Ga0207661_10454513 | Ga0207661_104545131 | 158 |
| 317 | 3300025949 | Ga0207667_10110240 | Ga0207667_101102403 | 158 |
| 318 | 3300025949 | Ga0207667_10520202 | Ga0207667_105202022 | 158 |
| 319 | 3300025960 | Ga0207651_10729817 | Ga0207651_107298171 | 158 |
| 320 | 3300025961 | Ga0207712_10000020 | Ga0207712_1000002068 | 158 |
| 321 | 3300025961 | Ga0207712_10001309 | Ga0207712_100013099 | 158 |
| 322 | 3300025961 | Ga0207712_10048105 | Ga0207712_100481055 | 158 |
| 323 | 3300025961 | Ga0207712_10661849 | Ga0207712_106618492 | 158 |
| 324 | 3300025972 | Ga0207668_10004346 | Ga0207668_100043466 | 158 |
| 325 | 3300025972 | Ga0207668_10064977 | Ga0207668_100649773 | 158 |
| 326 | 3300025972 | Ga0207668_10485406 | Ga0207668_104854061 | 158 |
| 327 | 3300025972 | Ga0207668_10623516 | Ga0207668_106235162 | 158 |
| 328 | 3300025981 | Ga0207640_10035693 | Ga0207640_100356933 | 158 |
| 329 | 3300025986 | Ga0207658_10001359 | Ga0207658_1000135911 | 158 |
| 330 | 3300025986 | Ga0207658_10099915 | Ga0207658_100999152 | 158 |
| 331 | 3300025986 | Ga0207658_10279949 | Ga0207658_102799492 | 158 |
| 332 | 3300025986 | Ga0207658_10845125 | Ga0207658_108451251 | 158 |
| 333 | 3300026023 | Ga0207677_10002239 | Ga0207677_100022396 | 158 |
| 334 | 3300026023 | Ga0207677_10039731 | Ga0207677_100397312 | 158 |
| 335 | 3300026023 | Ga0207677_10179216 | Ga0207677_101792162 | 158 |
| 336 | 3300026035 | Ga0207703_10220293 | Ga0207703_102202932 | 158 |
| 337 | 3300026035 | Ga0207703_10608927 | Ga0207703_106089272 | 158 |
| 338 | 3300026041 | Ga0207639_10005576 | Ga0207639_100055763 | 158 |
| 339 | 3300026041 | Ga0207639_10134443 | Ga0207639_101344432 | 158 |
| 340 | 3300026067 | Ga0207678_10006306 | Ga0207678_1000630611 | 158 |
| 341 | 3300026067 | Ga0207678_10032076 | Ga0207678_100320761 | 158 |
| 342 | 3300026075 | Ga0207708_10000411 | Ga0207708_1000041118 | 158 |
| 343 | 3300026075 | Ga0207708_10011584 | Ga0207708_100115845 | 158 |
| 344 | 3300026078 | Ga0207702_10600534 | Ga0207702_106005341 | 158 |
| 345 | 3300026088 | Ga0207641_10000156 | Ga0207641_1000015656 | 158 |
| 346 | 3300026088 | Ga0207641_10188820 | Ga0207641_101888202 | 158 |
| 347 | 3300026088 | Ga0207641_10450075 | Ga0207641_104500751 | 158 |
| 348 | 3300026088 | Ga0207641_11664913 | Ga0207641_116649131 | 158 |
| 349 | 3300026089 | Ga0207648_10000187 | Ga0207648_1000018746 | 158 |
| 350 | 3300026089 | Ga0207648_10104857 | Ga0207648_101048573 | 158 |
| 351 | 3300026118 | Ga0207675_100000220 | Ga0207675_10000022045 | 158 |
| 352 | 3300026118 | Ga0207675_100208575 | Ga0207675_1002085753 | 158 |
| 353 | 3300026121 | Ga0207683_10000197 | Ga0207683_1000019726 | 158 |
| 354 | 3300026121 | Ga0207683_10016831 | Ga0207683_100168313 | 158 |
| 355 | 3300026121 | Ga0207683_10272058 | Ga0207683_102720582 | 158 |
| 356 | 3300026142 | Ga0207698_10037259 | Ga0207698_100372593 | 158 |
| 357 | 3300026142 | Ga0207698_11525706 | Ga0207698_115257061 | 158 |
| 358 | 3300027866 | Ga0209813_10150119 | Ga0209813_101501192 | 158 |
| 359 | 3300028379 | Ga0268266_10004901 | Ga0268266_100049015 | 158 |
| 360 | 3300028379 | Ga0268266_10007692 | Ga0268266_100076927 | 158 |
| 361 | 3300028379 | Ga0268266_10018751 | Ga0268266_100187513 | 158 |
| 362 | 3300028379 | Ga0268266_10049310 | Ga0268266_100493105 | 158 |
| 363 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004387 | 158 |
| 364 | 3300028380 | Ga0268265_10026403 | Ga0268265_100264032 | 158 |
| 365 | 3300028380 | Ga0268265_10319787 | Ga0268265_103197872 | 158 |
| 366 | 3300028380 | Ga0268265_10589825 | Ga0268265_105898252 | 158 |
| 367 | 3300028381 | Ga0268264_10000024 | Ga0268264_10000024372 | 158 |
| 368 | 3300028381 | Ga0268264_10012485 | Ga0268264_100124859 | 158 |
| 369 | 3300028381 | Ga0268264_10111091 | Ga0268264_101110912 | 158 |
| 370 | 3300031251 | Ga0265327_10002454 | Ga0265327_100024543 | 158 |
| 371 | 3300031548 | Ga0307408_100615059 | Ga0307408_1006150592 | 158 |
| 372 | 3300031824 | Ga0307413_10040624 | Ga0307413_100406244 | 158 |
| 373 | 3300031824 | Ga0307413_10061299 | Ga0307413_100612992 | 158 |
| 374 | 3300031852 | Ga0307410_11430315 | Ga0307410_114303151 | 158 |
| 375 | 3300031901 | Ga0307406_10756649 | Ga0307406_107566492 | 158 |
| 376 | 3300031903 | Ga0307407_10042758 | Ga0307407_100427582 | 158 |
| 377 | 3300032002 | Ga0307416_100098500 | Ga0307416_1000985001 | 158 |
| 378 | 3300032002 | Ga0307416_100645439 | Ga0307416_1006454392 | 158 |
| 379 | 3300032004 | Ga0307414_11061717 | Ga0307414_110617171 | 158 |
| 380 | 3300032005 | Ga0307411_10526675 | Ga0307411_105266752 | 158 |
| 381 | 3300032126 | Ga0307415_100016173 | Ga0307415_1000161732 | 158 |
| 382 | 3300035115 | Ga0373941_0024802 | Ga0373941_0024802_359_835 | 158 |
| 383 | 3300035207 | Ga0373942_0200302 | Ga0373942_0200302_22_498 | 158 |
| 384 | 3300035242 | Ga0373962_0086001 | Ga0373962_0086001_89_565 | 158 |
| 385 | 3300035691 | Ga0373931_0037789 | Ga0373931_0037789_923_1399 | 158 |
| 386 | 3300035691 | Ga0373931_0078237 | Ga0373931_0078237_1200_1676 | 158 |
| 387 | 3300036401 | Ga0373937_1240750 | Ga0373937_1240750_175_672 | 158 |
| 388 | 3300037418 | Ga0395900_0576256 | Ga0395900_0576256_339_815 | 158 |
| 389 | 3300037418 | Ga0395900_0856793 | Ga0395900_0856793_237_713 | 158 |
| 390 | 3300037418 | Ga0395900_1285241 | Ga0395900_1285241_19_540 | 158 |
| 391 | 3300037853 | Ga0436364_0603886 | Ga0436364_0603886_11_487 | 158 |
| 392 | 3300039437 | Ga0436365_0627008 | Ga0436365_0627008_1328_1804 | 158 |
| 393 | 3300039450 | Ga0436363_1183203 | Ga0436363_1183203_706_1191 | 158 |
| 394 | 3300041410 | Ga0439461_0003064 | Ga0439461_0003064_1670_2146 | 158 |
| 395 | 3300041410 | Ga0439461_0012317 | Ga0439461_0012317_34_510 | 158 |
| 396 | 3300041411 | Ga0439466_0001598 | Ga0439466_0001598_3649_4125 | 158 |
| 397 | 3300041411 | Ga0439466_0005159 | Ga0439466_0005159_2034_2510 | 158 |
| 398 | 3300041413 | Ga0439465_0002492 | Ga0439465_0002492_3896_4372 | 158 |
| 399 | 3300041413 | Ga0439465_0003273 | Ga0439465_0003273_271_747 | 158 |
| 400 | 3300041413 | Ga0439465_0010180 | Ga0439465_0010180_335_811 | 158 |
| 401 | 3300041413 | Ga0439465_0018576 | Ga0439465_0018576_254_730 | 158 |
| 402 | 3300041413 | Ga0439465_0133700 | Ga0439465_0133700_254_730 | 158 |
| 403 | 3300041443 | Ga0451789_0771824 | Ga0451789_0771824_54_530 | 158 |
| 404 | 3300041452 | Ga0451793_0034594 | Ga0451793_0034594_32_508 | 158 |
| 405 | 3300041997 | Ga0439431_0005723 | Ga0439431_0005723_1845_2321 | 158 |
| 406 | 3300041997 | Ga0439431_0035028 | Ga0439431_0035028_247_723 | 158 |
| 407 | 3300042002 | Ga0439442_041566 | Ga0439442_041566_274_750 | 158 |
| 408 | 3300042004 | Ga0439445_0008931 | Ga0439445_0008931_1563_2039 | 158 |
| 409 | 3300042004 | Ga0439445_0019377 | Ga0439445_0019377_481_957 | 158 |
| 410 | 3300042005 | Ga0439448_0149902 | Ga0439448_0149902_219_695 | 158 |
| 411 | 3300042435 | Ga0439434_0002444 | Ga0439434_0002444_2312_2788 | 158 |
| 412 | 3300042435 | Ga0439434_0027631 | Ga0439434_0027631_915_1391 | 158 |
| 413 | 3300042435 | Ga0439434_0086834 | Ga0439434_0086834_114_590 | 158 |
| 414 | 3300042436 | Ga0439435_0130772 | Ga0439435_0130772_137_613 | 158 |
| 415 | 3300044656 | Ga0466969_0003541 | Ga0466969_0003541_198_704 | 158 |
| 416 | 3300044658 | Ga0466972_0007528 | Ga0466972_0007528_3937_4443 | 158 |
| 417 | 3300044658 | Ga0466972_0008245 | Ga0466972_0008245_1552_2028 | 158 |
| 418 | 3300044658 | Ga0466972_0026588 | Ga0466972_0026588_256_732 | 158 |
| 419 | 3300044658 | Ga0466972_0055758 | Ga0466972_0055758_1059_1535 | 158 |
| 420 | 3300044658 | Ga0466972_0101894 | Ga0466972_0101894_850_1326 | 158 |
| 421 | 3300044658 | Ga0466972_0237777 | Ga0466972_0237777_92_568 | 158 |
| 422 | 3300044683 | Ga0466965_0001448 | Ga0466965_0001448_8612_9088 | 158 |
| 423 | 3300044683 | Ga0466965_0003649 | Ga0466965_0003649_2137_2613 | 158 |
| 424 | 3300044683 | Ga0466965_0109211 | Ga0466965_0109211_755_1231 | 158 |
| 425 | 3300044684 | Ga0466966_0004633 | Ga0466966_0004633_7022_7528 | 158 |
| 426 | 3300044684 | Ga0466966_0180851 | Ga0466966_0180851_77_553 | 158 |
| 427 | 3300044693 | Ga0466961_0009146 | Ga0466961_0009146_2592_3068 | 158 |
| 428 | 3300044706 | Ga0466964_0001519 | Ga0466964_0001519_7055_7561 | 158 |
| 429 | 3300044706 | Ga0466964_0084611 | Ga0466964_0084611_127_603 | 158 |
| 430 | 3300044719 | Ga0466971_0002606 | Ga0466971_0002606_2037_2513 | 158 |
| 431 | 3300044735 | Ga0466968_0001533 | Ga0466968_0001533_7657_8163 | 158 |
| 432 | 3300044735 | Ga0466968_0001712 | Ga0466968_0001712_5841_6317 | 158 |
| 433 | 3300044735 | Ga0466968_0028015 | Ga0466968_0028015_27_503 | 158 |
| 434 | 3300044735 | Ga0466968_0538556 | Ga0466968_0538556_91_567 | 158 |
| 435 | 3300044765 | Ga0466970_0002905 | Ga0466970_0002905_138_644 | 158 |
| 436 | 3300044765 | Ga0466970_0011881 | Ga0466970_0011881_1598_2074 | 158 |
| 437 | 3300044765 | Ga0466970_0019593 | Ga0466970_0019593_984_1460 | 158 |
| 438 | 3300044765 | Ga0466970_0280708 | Ga0466970_0280708_435_911 | 158 |
| 439 | 3300044842 | Ga0466957_0011226 | Ga0466957_0011226_830_1306 | 158 |
| 440 | 3300044842 | Ga0466957_0020925 | Ga0466957_0020925_1614_2090 | 158 |
| 441 | 3300044901 | Ga0466960_0000116 | Ga0466960_0000116_19978_20454 | 158 |
| 442 | 3300044901 | Ga0466960_0000837 | Ga0466960_0000837_8256_8732 | 158 |
| 443 | 3300045049 | Ga0466959_0006180 | Ga0466959_0006180_138_644 | 158 |
| 444 | 3300045049 | Ga0466959_0050309 | Ga0466959_0050309_2521_2997 | 158 |
| 445 | 3300045049 | Ga0466959_0053451 | Ga0466959_0053451_2100_2576 | 158 |
| 446 | 3300045836 | Ga0466958_0021510 | Ga0466958_0021510_631_1107 | 158 |
| 447 | 3300045836 | Ga0466958_0657361 | Ga0466958_0657361_81_557 | 158 |
| 448 | 3300045976 | Ga0466967_0002885 | Ga0466967_0002885_7890_8366 | 158 |
| 449 | 3300045976 | Ga0466967_0003298 | Ga0466967_0003298_4399_4875 | 158 |
| 450 | 3300045976 | Ga0466967_0044271 | Ga0466967_0044271_119_595 | 158 |
| 451 | 3300045976 | Ga0466967_0841830 | Ga0466967_0841830_56_532 | 158 |
| 452 | 3300046507 | Ga0495606_0010471 | Ga0495606_0010471_4572_5048 | 158 |
| 453 | 3300046524 | Ga0495648_0001720 | Ga0495648_0001720_4606_5082 | 158 |
| 454 | 3300046663 | Ga0495635_0878669 | Ga0495635_0878669_58_534 | 158 |
| 455 | 3300046692 | Ga0495671_0106388 | Ga0495671_0106388_754_1230 | 158 |
| 456 | 3300047319 | Ga0495674_0723527 | Ga0495674_0723527_104_580 | 158 |
| 457 | 3300047320 | Ga0495672_0006563 | Ga0495672_0006563_1868_2344 | 158 |
| 458 | 3300047445 | Ga0495677_0317379 | Ga0495677_0317379_26_502 | 158 |
| 459 | 3300047469 | Ga0495673_0000355 | Ga0495673_0000355_570_1046 | 158 |
| 460 | 3300048903 | Ga0496100_0000009 | Ga0496100_0000009_78577_79053 | 158 |
| 461 | 3300048903 | Ga0496100_0000531 | Ga0496100_0000531_10846_11322 | 158 |
| 462 | 3300048903 | Ga0496100_0013488 | Ga0496100_0013488_1926_2402 | 158 |
| 463 | 3300048903 | Ga0496100_0033050 | Ga0496100_0033050_2566_3042 | 158 |
| 464 | 3300048904 | Ga0496101_0000018 | Ga0496101_0000018_140318_140794 | 158 |
| 465 | 3300048904 | Ga0496101_0000102 | Ga0496101_0000102_70469_70945 | 158 |
| 466 | 3300048904 | Ga0496101_0002584 | Ga0496101_0002584_6744_7220 | 158 |
| 467 | 3300048904 | Ga0496101_0048871 | Ga0496101_0048871_530_1006 | 158 |
| 468 | 3300048904 | Ga0496101_0478661 | Ga0496101_0478661_331_807 | 158 |
| 469 | 3300048905 | Ga0496102_0000037 | Ga0496102_0000037_17875_18351 | 158 |
| 470 | 3300048905 | Ga0496102_0000780 | Ga0496102_0000780_12900_13376 | 158 |
| 471 | 3300048905 | Ga0496102_0001336 | Ga0496102_0001336_16782_17258 | 158 |
| 472 | 3300048905 | Ga0496102_0116111 | Ga0496102_0116111_267_743 | 158 |
| 473 | 3300048905 | Ga0496102_0142321 | Ga0496102_0142321_1643_2119 | 158 |
| 474 | 3300048905 | Ga0496102_0801092 | Ga0496102_0801092_94_573 | 158 |
| 475 | 3300048905 | Ga0496102_1233731 | Ga0496102_1233731_115_591 | 158 |
| 476 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_328587_329063 | 158 |
| 477 | 3300048906 | Ga0496103_0001409 | Ga0496103_0001409_12116_12592 | 158 |
| 478 | 3300048906 | Ga0496103_0001995 | Ga0496103_0001995_3843_4319 | 158 |
| 479 | 3300048906 | Ga0496103_0018136 | Ga0496103_0018136_680_1156 | 158 |
| 480 | 3300048906 | Ga0496103_0397004 | Ga0496103_0397004_176_652 | 158 |
| 481 | 3300048907 | Ga0496104_0019767 | Ga0496104_0019767_653_1129 | 158 |
| 482 | 3300048908 | Ga0496105_0117376 | Ga0496105_0117376_1125_1601 | 158 |
| 483 | 3300048908 | Ga0496105_0153063 | Ga0496105_0153063_1046_1522 | 158 |
| 484 | 3300048908 | Ga0496105_0188632 | Ga0496105_0188632_423_899 | 158 |
| 485 | 3300048909 | Ga0496106_0004574 | Ga0496106_0004574_5926_6402 | 158 |
| 486 | 3300048909 | Ga0496106_0005826 | Ga0496106_0005826_3990_4466 | 158 |
| 487 | 3300048909 | Ga0496106_0012852 | Ga0496106_0012852_584_1060 | 158 |
| 488 | 3300048909 | Ga0496106_0052159 | Ga0496106_0052159_2376_2852 | 158 |
| 489 | 3300048909 | Ga0496106_0197032 | Ga0496106_0197032_257_733 | 158 |
| 490 | 3300048910 | Ga0496107_0000511 | Ga0496107_0000511_8983_9459 | 158 |
| 491 | 3300048910 | Ga0496107_0004059 | Ga0496107_0004059_4013_4489 | 158 |
| 492 | 3300048910 | Ga0496107_0011387 | Ga0496107_0011387_997_1473 | 158 |
| 493 | 3300048911 | Ga0496108_0001088 | Ga0496108_0001088_11651_12127 | 158 |
| 494 | 3300048911 | Ga0496108_0002904 | Ga0496108_0002904_13217_13693 | 158 |
| 495 | 3300048911 | Ga0496108_0337249 | Ga0496108_0337249_257_733 | 158 |
| 496 | 3300048911 | Ga0496108_0929573 | Ga0496108_0929573_46_522 | 158 |
| 497 | 3300048912 | Ga0496109_0000136 | Ga0496109_0000136_17297_17773 | 158 |
| 498 | 3300048912 | Ga0496109_0011714 | Ga0496109_0011714_6231_6707 | 158 |
| 499 | 3300048912 | Ga0496109_0012517 | Ga0496109_0012517_4982_5458 | 158 |
| 500 | 3300048912 | Ga0496109_0199615 | Ga0496109_0199615_530_1006 | 158 |
| 501 | 3300048912 | Ga0496109_1353856 | Ga0496109_1353856_51_527 | 158 |
| 502 | 3300048913 | Ga0496110_0001780 | Ga0496110_0001780_7942_8418 | 158 |
| 503 | 3300048913 | Ga0496110_0012200 | Ga0496110_0012200_6033_6509 | 158 |
| 504 | 3300048913 | Ga0496110_0150718 | Ga0496110_0150718_74_550 | 158 |
| 505 | 3300048913 | Ga0496110_0245040 | Ga0496110_0245040_1109_1585 | 158 |
| 506 | 3300048914 | Ga0496111_0421597 | Ga0496111_0421597_252_728 | 158 |
| 507 | 3300048915 | Ga0496112_0006921 | Ga0496112_0006921_598_1074 | 158 |
| 508 | 3300048915 | Ga0496112_0021424 | Ga0496112_0021424_4154_4630 | 158 |
| 509 | 3300048915 | Ga0496112_0067479 | Ga0496112_0067479_2005_2481 | 158 |
| 510 | 3300048915 | Ga0496112_0201511 | Ga0496112_0201511_1432_1908 | 158 |
| 511 | 3300048916 | Ga0496113_0002072 | Ga0496113_0002072_321_797 | 158 |
| 512 | 3300048916 | Ga0496113_0014387 | Ga0496113_0014387_4841_5317 | 158 |
| 513 | 3300048916 | Ga0496113_0060141 | Ga0496113_0060141_99_575 | 158 |
| 514 | 3300048916 | Ga0496113_0547449 | Ga0496113_0547449_266_742 | 158 |
| 515 | 3300048916 | Ga0496113_1048555 | Ga0496113_1048555_46_522 | 158 |
| 516 | 3300048917 | Ga0496114_0000108 | Ga0496114_0000108_25680_26156 | 158 |
| 517 | 3300048917 | Ga0496114_0018416 | Ga0496114_0018416_596_1072 | 158 |
| 518 | 3300048917 | Ga0496114_0650347 | Ga0496114_0650347_277_753 | 158 |
| 519 | 3300048917 | Ga0496114_0856495 | Ga0496114_0856495_79_558 | 158 |
| 520 | 3300048918 | Ga0496115_0003184 | Ga0496115_0003184_3510_3986 | 158 |
| 521 | 3300048918 | Ga0496115_0043674 | Ga0496115_0043674_2538_3014 | 158 |
| 522 | 3300048918 | Ga0496115_0898779 | Ga0496115_0898779_77_553 | 158 |
| 523 | 3300048919 | Ga0496116_0000276 | Ga0496116_0000276_17849_18325 | 158 |
| 524 | 3300048919 | Ga0496116_0002633 | Ga0496116_0002633_4496_4972 | 158 |
| 525 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1526990_1527466 | 158 |
| 526 | 3300048920 | Ga0496117_0001267 | Ga0496117_0001267_1897_2373 | 158 |
| 527 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1526993_1527469 | 158 |
| 528 | 3300048921 | Ga0496118_0000275 | Ga0496118_0000275_84821_85297 | 158 |
| 529 | 3300048921 | Ga0496118_0011629 | Ga0496118_0011629_6645_7121 | 158 |
| 530 | 3300048921 | Ga0496118_0328393 | Ga0496118_0328393_31_507 | 158 |
| 531 | 3300048922 | Ga0496119_0005085 | Ga0496119_0005085_10609_11085 | 158 |
| 532 | 3300048922 | Ga0496119_0006894 | Ga0496119_0006894_5250_5726 | 158 |
| 533 | 3300048922 | Ga0496119_0011468 | Ga0496119_0011468_5525_6001 | 158 |
| 534 | 3300048922 | Ga0496119_0197251 | Ga0496119_0197251_414_890 | 158 |
| 535 | 3300048923 | Ga0496120_0017069 | Ga0496120_0017069_567_1043 | 158 |
| 536 | 3300048923 | Ga0496120_0030665 | Ga0496120_0030665_218_694 | 158 |
| 537 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_312711_313187 | 158 |
| 538 | 3300048924 | Ga0496121_0000338 | Ga0496121_0000338_26759_27235 | 158 |
| 539 | 3300048924 | Ga0496121_0016981 | Ga0496121_0016981_592_1068 | 158 |
| 540 | 3300048925 | Ga0496122_0000164 | Ga0496122_0000164_17048_17524 | 158 |
| 541 | 3300048925 | Ga0496122_0024719 | Ga0496122_0024719_2236_2712 | 158 |
| 542 | 3300048926 | Ga0496123_0004915 | Ga0496123_0004915_1791_2267 | 158 |
| 543 | 3300048926 | Ga0496123_0024513 | Ga0496123_0024513_1677_2153 | 158 |
| 544 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_312711_313187 | 158 |
| 545 | 3300048927 | Ga0496124_0086213 | Ga0496124_0086213_1712_2188 | 158 |
| 546 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_150262_150738 | 158 |
| 547 | 3300048928 | Ga0496125_0006797 | Ga0496125_0006797_3830_4306 | 158 |
| 548 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_312711_313187 | 158 |
| 549 | 3300048929 | Ga0496126_0000551 | Ga0496126_0000551_403_879 | 158 |
| 550 | 3300048929 | Ga0496126_0009407 | Ga0496126_0009407_6225_6701 | 158 |
| 551 | 3300048929 | Ga0496126_0470687 | Ga0496126_0470687_298_774 | 158 |
| 552 | 3300049571 | Ga0501034_0064818 | Ga0501034_0064818_2417_2893 | 158 |
| 553 | 3300049571 | Ga0501034_0351996 | Ga0501034_0351996_173_649 | 158 |
| 554 | 3300049571 | Ga0501034_0527795 | Ga0501034_0527795_438_914 | 158 |
| 555 | 3300049581 | Ga0501047_0065052 | Ga0501047_0065052_2618_3094 | 158 |
| 556 | 3300049581 | Ga0501047_0291716 | Ga0501047_0291716_327_803 | 158 |
| 557 | 3300049586 | Ga0501070_0081466 | Ga0501070_0081466_1438_1914 | 158 |
| 558 | 3300049586 | Ga0501070_0364218 | Ga0501070_0364218_110_586 | 158 |
| 559 | 3300049742 | Ga0501080_0190895 | Ga0501080_0190895_699_1175 | 158 |
| 560 | 3300050489 | nmdc:mga03683_192912_c1 | nmdc:mga03683_192912_c1_265_774 | 158 |
| 561 | 3300050489 | nmdc:mga03683_5371_c1 | nmdc:mga03683_5371_c1_3533_4009 | 158 |
| 562 | 3300050490 | nmdc:mga03n38_1868_c1 | nmdc:mga03n38_1868_c1_2120_2596 | 158 |
| 563 | 3300050490 | nmdc:mga03n38_230170_c1 | nmdc:mga03n38_230170_c1_269_745 | 158 |
| 564 | 3300050490 | nmdc:mga03n38_25775_c1 | nmdc:mga03n38_25775_c1_247_723 | 158 |
| 565 | 3300050490 | nmdc:mga03n38_27304_c1 | nmdc:mga03n38_27304_c1_781_1257 | 158 |
| 566 | 3300050490 | nmdc:mga03n38_355751_c1 | nmdc:mga03n38_355751_c1_292_768 | 158 |
| 567 | 3300050490 | nmdc:mga03n38_373627_c1 | nmdc:mga03n38_373627_c1_247_723 | 158 |
| 568 | 3300050490 | nmdc:mga03n38_39244_c1 | nmdc:mga03n38_39244_c1_1114_1590 | 158 |
| 569 | 3300050490 | nmdc:mga03n38_408364_c1 | nmdc:mga03n38_408364_c1_243_719 | 158 |
| 570 | 3300050490 | nmdc:mga03n38_66281_c1 | nmdc:mga03n38_66281_c1_1163_1639 | 158 |
| 571 | 3300050491 | nmdc:mga00v17_10660_c1 | nmdc:mga00v17_10660_c1_4452_4961 | 158 |
| 572 | 3300050491 | nmdc:mga00v17_10941_c1 | nmdc:mga00v17_10941_c1_902_1378 | 158 |
| 573 | 3300050491 | nmdc:mga00v17_16207_c1 | nmdc:mga00v17_16207_c1_3492_3968 | 158 |
| 574 | 3300050491 | nmdc:mga00v17_207732_c1 | nmdc:mga00v17_207732_c1_613_1089 | 158 |
| 575 | 3300050491 | nmdc:mga00v17_2499_c1 | nmdc:mga00v17_2499_c1_3297_3773 | 158 |
| 576 | 3300050491 | nmdc:mga00v17_278811_c1 | nmdc:mga00v17_278811_c1_167_643 | 158 |
| 577 | 3300050491 | nmdc:mga00v17_309560_c1 | nmdc:mga00v17_309560_c1_69_545 | 158 |
| 578 | 3300050491 | nmdc:mga00v17_38824_c1 | nmdc:mga00v17_38824_c1_1478_1954 | 158 |
| 579 | 3300050491 | nmdc:mga00v17_480685_c1 | nmdc:mga00v17_480685_c1_67_543 | 158 |
| 580 | 3300050491 | nmdc:mga00v17_58638_c1 | nmdc:mga00v17_58638_c1_1100_1576 | 158 |
| 581 | 3300050491 | nmdc:mga00v17_60308_c1 | nmdc:mga00v17_60308_c1_867_1343 | 158 |
| 582 | 3300050491 | nmdc:mga00v17_7042_c1 | nmdc:mga00v17_7042_c1_1570_2046 | 158 |
| 583 | 3300050492 | nmdc:mga0yw44_1866_c1 | nmdc:mga0yw44_1866_c1_6335_6811 | 158 |
| 584 | 3300050492 | nmdc:mga0yw44_248080_c1 | nmdc:mga0yw44_248080_c1_21_497 | 158 |
| 585 | 3300050492 | nmdc:mga0yw44_257710_c1 | nmdc:mga0yw44_257710_c1_96_572 | 158 |
| 586 | 3300050492 | nmdc:mga0yw44_7852_c1 | nmdc:mga0yw44_7852_c1_2088_2564 | 158 |
| 587 | 3300050493 | nmdc:mga0k408_69490_c1 | nmdc:mga0k408_69490_c1_415_891 | 158 |
| 588 | 3300050494 | nmdc:mga06z11_113785_c1 | nmdc:mga06z11_113785_c1_854_1330 | 158 |
| 589 | 3300050494 | nmdc:mga06z11_119025_c1 | nmdc:mga06z11_119025_c1_93_569 | 158 |
| 590 | 3300050494 | nmdc:mga06z11_14437_c1 | nmdc:mga06z11_14437_c1_2668_3144 | 158 |
| 591 | 3300050494 | nmdc:mga06z11_154550_c1 | nmdc:mga06z11_154550_c1_615_1124 | 158 |
| 592 | 3300050494 | nmdc:mga06z11_234929_c1 | nmdc:mga06z11_234929_c1_449_925 | 158 |
| 593 | 3300050494 | nmdc:mga06z11_266431_c1 | nmdc:mga06z11_266431_c1_520_996 | 158 |
| 594 | 3300050494 | nmdc:mga06z11_401601_c1 | nmdc:mga06z11_401601_c1_56_532 | 158 |
| 595 | 3300050495 | nmdc:mga04h51_184483_c1 | nmdc:mga04h51_184483_c1_241_717 | 158 |
| 596 | 3300050496 | nmdc:mga07m45_110902_c1 | nmdc:mga07m45_110902_c1_854_1330 | 158 |
| 597 | 3300050496 | nmdc:mga07m45_112251_c1 | nmdc:mga07m45_112251_c1_356_832 | 158 |
| 598 | 3300050496 | nmdc:mga07m45_146232_c1 | nmdc:mga07m45_146232_c1_266_742 | 158 |
| 599 | 3300050496 | nmdc:mga07m45_204901_c1 | nmdc:mga07m45_204901_c1_612_1088 | 158 |
| 600 | 3300050496 | nmdc:mga07m45_25465_c1 | nmdc:mga07m45_25465_c1_1762_2238 | 158 |
| 601 | 3300050496 | nmdc:mga07m45_43584_c1 | nmdc:mga07m45_43584_c1_302_778 | 158 |
| 602 | 3300050496 | nmdc:mga07m45_68888_c1 | nmdc:mga07m45_68888_c1_1146_1622 | 158 |
| 603 | 3300050496 | nmdc:mga07m45_7339_c1 | nmdc:mga07m45_7339_c1_4359_4835 | 158 |
| 604 | 3300050507 | nmdc:mga05p37_27189_c1 | nmdc:mga05p37_27189_c1_1555_2031 | 158 |
| 605 | 3300050508 | nmdc:mga09592_288422_c1 | nmdc:mga09592_288422_c1_649_1125 | 158 |
| 606 | 3300050509 | nmdc:mga0qj67_66076_c1 | nmdc:mga0qj67_66076_c1_1420_1896 | 158 |
| 607 | 3300050509 | nmdc:mga0qj67_7908_c1 | nmdc:mga0qj67_7908_c1_6419_6895 | 158 |
| 608 | 3300050510 | nmdc:mga06r32_18218_c1 | nmdc:mga06r32_18218_c1_3860_4336 | 158 |
| 609 | 3300050511 | nmdc:mga08y16_826498_c1 | nmdc:mga08y16_826498_c1_400_876 | 158 |
| 610 | 3300050512 | nmdc:mga0n895_854997_c1 | nmdc:mga0n895_854997_c1_405_881 | 158 |
| 611 | 3300050516 | nmdc:mga0sz30_105251_c1 | nmdc:mga0sz30_105251_c1_490_966 | 158 |
| 612 | 3300050516 | nmdc:mga0sz30_124159_c1 | nmdc:mga0sz30_124159_c1_212_688 | 158 |
| 613 | 3300050516 | nmdc:mga0sz30_152805_c1 | nmdc:mga0sz30_152805_c1_458_934 | 158 |
| 614 | 3300050516 | nmdc:mga0sz30_164083_c1 | nmdc:mga0sz30_164083_c1_187_663 | 158 |
| 615 | 3300050516 | nmdc:mga0sz30_252954_c1 | nmdc:mga0sz30_252954_c1_222_698 | 158 |
| 616 | 3300050516 | nmdc:mga0sz30_673_c1 | nmdc:mga0sz30_673_c1_3991_4467 | 158 |
| 617 | 3300050516 | nmdc:mga0sz30_9230_c1 | nmdc:mga0sz30_9230_c1_881_1357 | 158 |
| 618 | 3300053083 | Ga0495655_0005032 | Ga0495655_0005032_1366_1842 | 158 |
| 619 | 3300053087 | Ga0500643_003428 | Ga0500643_003428_2365_2841 | 158 |
| 620 | 3300053130 | Ga0500642_0256270 | Ga0500642_0256270_110_586 | 158 |
| 621 | 3300053138 | Ga0500564_089895 | Ga0500564_089895_340_816 | 158 |
| 622 | 3300053153 | Ga0500616_0056503 | Ga0500616_0056503_122_598 | 158 |
| 623 | 3300053177 | Ga0500636_0234518 | Ga0500636_0234518_339_845 | 158 |
| 624 | 3300053178 | Ga0500637_0035224 | Ga0500637_0035224_1143_1649 | 158 |
| 625 | 3300061719 | Ga0466962_0010269 | Ga0466962_0010269_114_590 | 158 |
| 626 | 3300061719 | Ga0466962_0094889 | Ga0466962_0094889_803_1309 | 158 |
| 627 | 3300003792 | Ga0055540_1009975 | Ga0055540_10099753 | 159 |
| 628 | 3300003792 | Ga0055540_1012396 | Ga0055540_10123963 | 159 |
| 629 | 3300005335 | Ga0070666_10734241 | Ga0070666_107342411 | 159 |
| 630 | 3300005455 | Ga0070663_100097225 | Ga0070663_1000972253 | 159 |
| 631 | 3300005539 | Ga0068853_100132561 | Ga0068853_1001325612 | 159 |
| 632 | 3300005548 | Ga0070665_100297289 | Ga0070665_1002972892 | 159 |
| 633 | 3300006177 | Ga0075362_10010735 | Ga0075362_100107352 | 159 |
| 634 | 3300006186 | Ga0075369_10012781 | Ga0075369_100127813 | 159 |
| 635 | 3300006186 | Ga0075369_10042231 | Ga0075369_100422312 | 159 |
| 636 | 3300021377 | Ga0213874_10049667 | Ga0213874_100496671 | 159 |
| 637 | 3300021384 | Ga0213876_10006163 | Ga0213876_100061633 | 159 |
| 638 | 3300021384 | Ga0213876_10016750 | Ga0213876_100167503 | 159 |
| 639 | 3300021388 | Ga0213875_10027324 | Ga0213875_100273243 | 159 |
| 640 | 3300021388 | Ga0213875_10107486 | Ga0213875_101074862 | 159 |
| 641 | 3300025273 | Ga0209673_1050254 | Ga0209673_10502542 | 159 |
| 642 | 3300025303 | Ga0209051_1002890 | Ga0209051_10028907 | 159 |
| 643 | 3300025303 | Ga0209051_1004789 | Ga0209051_10047898 | 159 |
| 644 | 3300025303 | Ga0209051_1004816 | Ga0209051_10048167 | 159 |
| 645 | 3300025929 | Ga0207664_11011005 | Ga0207664_110110051 | 159 |
| 646 | 3300026041 | Ga0207639_10105934 | Ga0207639_101059344 | 159 |
| 647 | 3300026075 | Ga0207708_10646042 | Ga0207708_106460422 | 159 |
| 648 | 3300026121 | Ga0207683_11630363 | Ga0207683_116303631 | 159 |
| 649 | 3300037853 | Ga0436364_0126449 | Ga0436364_0126449_3133_3612 | 159 |
| 650 | 3300037853 | Ga0436364_0950685 | Ga0436364_0950685_8189_8668 | 159 |
| 651 | 3300039437 | Ga0436365_0059246 | Ga0436365_0059246_922_1401 | 159 |
| 652 | 3300039437 | Ga0436365_1276831 | Ga0436365_1276831_11299_11778 | 159 |
| 653 | 3300039447 | Ga0436361_0363522 | Ga0436361_0363522_77_556 | 159 |
| 654 | 3300039450 | Ga0436363_0198696 | Ga0436363_0198696_815_1294 | 159 |
| 655 | 3300039450 | Ga0436363_0598107 | Ga0436363_0598107_623_1102 | 159 |
| 656 | 3300041441 | Ga0451787_735807 | Ga0451787_735807_481_960 | 159 |
| 657 | 3300044719 | Ga0466971_0012348 | Ga0466971_0012348_1400_1879 | 159 |
| 658 | 3300044842 | Ga0466957_0458622 | Ga0466957_0458622_68_547 | 159 |
| 659 | 3300045836 | Ga0466958_0112916 | Ga0466958_0112916_105_584 | 159 |
| 660 | 3300046460 | Ga0495638_0037001 | Ga0495638_0037001_2179_2658 | 159 |
| 661 | 3300046471 | Ga0495650_0193701 | Ga0495650_0193701_197_676 | 159 |
| 662 | 3300046491 | Ga0495584_0318994 | Ga0495584_0318994_248_745 | 159 |
| 663 | 3300047320 | Ga0495672_0055873 | Ga0495672_0055873_1170_1649 | 159 |
| 664 | 3300047472 | Ga0495686_0011027 | Ga0495686_0011027_3142_3621 | 159 |
| 665 | 3300048903 | Ga0496100_0280561 | Ga0496100_0280561_729_1208 | 159 |
| 666 | 3300048904 | Ga0496101_0257671 | Ga0496101_0257671_576_1055 | 159 |
| 667 | 3300048905 | Ga0496102_0127375 | Ga0496102_0127375_93_572 | 159 |
| 668 | 3300048910 | Ga0496107_0824527 | Ga0496107_0824527_155_634 | 159 |
| 669 | 3300048917 | Ga0496114_0024842 | Ga0496114_0024842_2960_3439 | 159 |
| 670 | 3300048917 | Ga0496114_0341192 | Ga0496114_0341192_552_1031 | 159 |
| 671 | 3300048924 | Ga0496121_0135536 | Ga0496121_0135536_354_833 | 159 |
| 672 | 3300048924 | Ga0496121_0350796 | Ga0496121_0350796_174_653 | 159 |
| 673 | 3300048927 | Ga0496124_0673315 | Ga0496124_0673315_73_552 | 159 |
| 674 | 3300048929 | Ga0496126_0048638 | Ga0496126_0048638_2200_2679 | 159 |
| 675 | 3300049570 | Ga0501033_0024106 | Ga0501033_0024106_270_749 | 159 |
| 676 | 3300049571 | Ga0501034_0001642 | Ga0501034_0001642_8896_9375 | 159 |
| 677 | 3300049572 | Ga0501036_0016199 | Ga0501036_0016199_1765_2244 | 159 |
| 678 | 3300049573 | Ga0501037_0003861 | Ga0501037_0003861_6121_6600 | 159 |
| 679 | 3300049574 | Ga0501038_0001528 | Ga0501038_0001528_14499_14978 | 159 |
| 680 | 3300049575 | Ga0501039_0000288 | Ga0501039_0000288_19612_20091 | 159 |
| 681 | 3300049576 | Ga0501040_0888284 | Ga0501040_0888284_41_520 | 159 |
| 682 | 3300049579 | Ga0501043_0000411 | Ga0501043_0000411_11659_12138 | 159 |
| 683 | 3300049581 | Ga0501047_0352859 | Ga0501047_0352859_660_1139 | 159 |
| 684 | 3300049586 | Ga0501070_0000614 | Ga0501070_0000614_26289_26768 | 159 |
| 685 | 3300049589 | Ga0501073_0209524 | Ga0501073_0209524_858_1337 | 159 |
| 686 | 3300049593 | Ga0501077_0418646 | Ga0501077_0418646_361_840 | 159 |
| 687 | 3300049822 | Ga0501035_0000344 | Ga0501035_0000344_43946_44425 | 159 |
| 688 | 3300049823 | Ga0501044_0011255 | Ga0501044_0011255_5158_5637 | 159 |
| 689 | 3300049823 | Ga0501044_0088632 | Ga0501044_0088632_1268_1747 | 159 |
| 690 | 3300050491 | nmdc:mga00v17_117922_c1 | nmdc:mga00v17_117922_c1_26_505 | 159 |
| 691 | 3300050516 | nmdc:mga0sz30_16148_c1 | nmdc:mga0sz30_16148_c1_1191_1670 | 159 |
| 692 | 3300053087 | Ga0500643_020257 | Ga0500643_020257_1557_2036 | 159 |
| 693 | 3300053098 | Ga0500650_0068408 | Ga0500650_0068408_568_1047 | 159 |
| 694 | 3300053122 | Ga0500608_095073 | Ga0500608_095073_384_863 | 159 |
| 695 | 3300053131 | Ga0500652_038573 | Ga0500652_038573_1104_1583 | 159 |
| 696 | 3300053158 | Ga0500627_0028790 | Ga0500627_0028790_924_1403 | 159 |
| 697 | 3300053730 | Ga0500645_000075 | Ga0500645_000075_71062_71541 | 159 |
| 698 | 3300053730 | Ga0500645_022555 | Ga0500645_022555_1064_1543 | 159 |
| 699 | 3300061719 | Ga0466962_0004965 | Ga0466962_0004965_5587_6066 | 159 |
| 700 | 3300000546 | LJNas_1008764 | LJNas_10087642 | 160 |
| 701 | 3300005336 | Ga0070680_100751093 | Ga0070680_1007510931 | 160 |
| 702 | 3300005337 | Ga0070682_100554184 | Ga0070682_1005541841 | 160 |
| 703 | 3300005356 | Ga0070674_100041075 | Ga0070674_1000410752 | 160 |
| 704 | 3300005367 | Ga0070667_101214548 | Ga0070667_1012145481 | 160 |
| 705 | 3300005435 | Ga0070714_100097251 | Ga0070714_1000972512 | 160 |
| 706 | 3300005436 | Ga0070713_100566240 | Ga0070713_1005662401 | 160 |
| 707 | 3300005439 | Ga0070711_100421292 | Ga0070711_1004212921 | 160 |
| 708 | 3300005549 | Ga0070704_101203667 | Ga0070704_1012036671 | 160 |
| 709 | 3300005615 | Ga0070702_100289450 | Ga0070702_1002894502 | 160 |
| 710 | 3300005718 | Ga0068866_10261167 | Ga0068866_102611672 | 160 |
| 711 | 3300005937 | Ga0081455_10014375 | Ga0081455_100143753 | 160 |
| 712 | 3300006038 | Ga0075365_10010928 | Ga0075365_100109282 | 160 |
| 713 | 3300006038 | Ga0075365_10105792 | Ga0075365_101057922 | 160 |
| 714 | 3300006038 | Ga0075365_10126464 | Ga0075365_101264643 | 160 |
| 715 | 3300006038 | Ga0075365_10166525 | Ga0075365_101665253 | 160 |
| 716 | 3300006038 | Ga0075365_10363502 | Ga0075365_103635022 | 160 |
| 717 | 3300006048 | Ga0075363_100005618 | Ga0075363_1000056183 | 160 |
| 718 | 3300006048 | Ga0075363_100010328 | Ga0075363_1000103284 | 160 |
| 719 | 3300006048 | Ga0075363_100159307 | Ga0075363_1001593072 | 160 |
| 720 | 3300006051 | Ga0075364_10014806 | Ga0075364_100148063 | 160 |
| 721 | 3300006051 | Ga0075364_10163663 | Ga0075364_101636632 | 160 |
| 722 | 3300006051 | Ga0075364_10685275 | Ga0075364_106852751 | 160 |
| 723 | 3300006175 | Ga0070712_100376545 | Ga0070712_1003765452 | 160 |
| 724 | 3300006175 | Ga0070712_100936741 | Ga0070712_1009367411 | 160 |
| 725 | 3300006177 | Ga0075362_10047877 | Ga0075362_100478772 | 160 |
| 726 | 3300006178 | Ga0075367_10152586 | Ga0075367_101525862 | 160 |
| 727 | 3300006186 | Ga0075369_10056562 | Ga0075369_100565623 | 160 |
| 728 | 3300006237 | Ga0097621_100931576 | Ga0097621_1009315762 | 160 |
| 729 | 3300006353 | Ga0075370_10105139 | Ga0075370_101051392 | 160 |
| 730 | 3300006881 | Ga0068865_100646743 | Ga0068865_1006467432 | 160 |
| 731 | 3300009176 | Ga0105242_10264733 | Ga0105242_102647331 | 160 |
| 732 | 3300009177 | Ga0105248_11170510 | Ga0105248_111705102 | 160 |
| 733 | 3300011119 | Ga0105246_11072455 | Ga0105246_110724551 | 160 |
| 734 | 3300012487 | Ga0157321_1022979 | Ga0157321_10229791 | 160 |
| 735 | 3300013105 | Ga0157369_10290187 | Ga0157369_102901872 | 160 |
| 736 | 3300013105 | Ga0157369_10423540 | Ga0157369_104235402 | 160 |
| 737 | 3300013308 | Ga0157375_11311887 | Ga0157375_113118871 | 160 |
| 738 | 3300014968 | Ga0157379_10205600 | Ga0157379_102056002 | 160 |
| 739 | 3300014968 | Ga0157379_11300996 | Ga0157379_113009961 | 160 |
| 740 | 3300014969 | Ga0157376_10283778 | Ga0157376_102837781 | 160 |
| 741 | 3300025261 | Ga0209233_1019362 | Ga0209233_10193622 | 160 |
| 742 | 3300025904 | Ga0207647_10309263 | Ga0207647_103092632 | 160 |
| 743 | 3300025915 | Ga0207693_10508662 | Ga0207693_105086622 | 160 |
| 744 | 3300025915 | Ga0207693_10734168 | Ga0207693_107341681 | 160 |
| 745 | 3300025916 | Ga0207663_10675056 | Ga0207663_106750562 | 160 |
| 746 | 3300025928 | Ga0207700_10262229 | Ga0207700_102622292 | 160 |
| 747 | 3300025937 | Ga0207669_10075584 | Ga0207669_100755842 | 160 |
| 748 | 3300025938 | Ga0207704_10589610 | Ga0207704_105896101 | 160 |
| 749 | 3300025939 | Ga0207665_10410131 | Ga0207665_104101312 | 160 |
| 750 | 3300027866 | Ga0209813_10005913 | Ga0209813_100059134 | 160 |
| 751 | 3300028381 | Ga0268264_11174025 | Ga0268264_111740251 | 160 |
| 752 | 3300031995 | Ga0307409_100292982 | Ga0307409_1002929822 | 160 |
| 753 | 3300035121 | Ga0373960_0022712 | Ga0373960_0022712_450_935 | 160 |
| 754 | 3300036712 | Ga0316584_0454039 | Ga0316584_0454039_178_663 | 160 |
| 755 | 3300039437 | Ga0436365_1413714 | Ga0436365_1413714_24_506 | 160 |
| 756 | 3300039438 | Ga0436360_0562690 | Ga0436360_0562690_266_748 | 160 |
| 757 | 3300039450 | Ga0436363_0082189 | Ga0436363_0082189_274_756 | 160 |
| 758 | 3300039450 | Ga0436363_0160340 | Ga0436363_0160340_32_517 | 160 |
| 759 | 3300041498 | Ga0451841_0612220 | Ga0451841_0612220_1006_1491 | 160 |
| 760 | 3300044656 | Ga0466969_0110240 | Ga0466969_0110240_168_653 | 160 |
| 761 | 3300044683 | Ga0466965_0060406 | Ga0466965_0060406_728_1213 | 160 |
| 762 | 3300044683 | Ga0466965_0381991 | Ga0466965_0381991_191_679 | 160 |
| 763 | 3300044684 | Ga0466966_0009501 | Ga0466966_0009501_800_1285 | 160 |
| 764 | 3300044684 | Ga0466966_0445789 | Ga0466966_0445789_74_562 | 160 |
| 765 | 3300044693 | Ga0466961_0180376 | Ga0466961_0180376_91_579 | 160 |
| 766 | 3300044735 | Ga0466968_0002050 | Ga0466968_0002050_276_764 | 160 |
| 767 | 3300044765 | Ga0466970_0055259 | Ga0466970_0055259_1152_1640 | 160 |
| 768 | 3300044842 | Ga0466957_0001674 | Ga0466957_0001674_5946_6431 | 160 |
| 769 | 3300044842 | Ga0466957_0056145 | Ga0466957_0056145_1583_2143 | 160 |
| 770 | 3300044842 | Ga0466957_0539263 | Ga0466957_0539263_55_537 | 160 |
| 771 | 3300044901 | Ga0466960_0143415 | Ga0466960_0143415_367_927 | 160 |
| 772 | 3300045049 | Ga0466959_0007885 | Ga0466959_0007885_4940_5425 | 160 |
| 773 | 3300045836 | Ga0466958_0002368 | Ga0466958_0002368_6405_6890 | 160 |
| 774 | 3300045836 | Ga0466958_0017360 | Ga0466958_0017360_3419_3901 | 160 |
| 775 | 3300045836 | Ga0466958_0765419 | Ga0466958_0765419_81_563 | 160 |
| 776 | 3300045836 | Ga0466958_0847942 | Ga0466958_0847942_62_544 | 160 |
| 777 | 3300045976 | Ga0466967_0021171 | Ga0466967_0021171_1789_2313 | 160 |
| 778 | 3300045976 | Ga0466967_0030203 | Ga0466967_0030203_3672_4232 | 160 |
| 779 | 3300045976 | Ga0466967_0473321 | Ga0466967_0473321_703_1185 | 160 |
| 780 | 3300046459 | Ga0495629_0015508 | Ga0495629_0015508_1852_2337 | 160 |
| 781 | 3300046461 | Ga0495641_0005534 | Ga0495641_0005534_6835_7320 | 160 |
| 782 | 3300046473 | Ga0495582_0059652 | Ga0495582_0059652_1460_1945 | 160 |
| 783 | 3300046475 | Ga0495639_0031878 | Ga0495639_0031878_586_1071 | 160 |
| 784 | 3300046511 | Ga0495608_0361087 | Ga0495608_0361087_86_571 | 160 |
| 785 | 3300046533 | Ga0495640_0122927 | Ga0495640_0122927_1046_1531 | 160 |
| 786 | 3300047472 | Ga0495686_0365391 | Ga0495686_0365391_79_561 | 160 |
| 787 | 3300048903 | Ga0496100_0006888 | Ga0496100_0006888_3580_4062 | 160 |
| 788 | 3300048904 | Ga0496101_0000432 | Ga0496101_0000432_16522_17004 | 160 |
| 789 | 3300048905 | Ga0496102_0035693 | Ga0496102_0035693_586_1068 | 160 |
| 790 | 3300048906 | Ga0496103_0264594 | Ga0496103_0264594_413_895 | 160 |
| 791 | 3300048907 | Ga0496104_0022028 | Ga0496104_0022028_1306_1788 | 160 |
| 792 | 3300048908 | Ga0496105_0300130 | Ga0496105_0300130_427_909 | 160 |
| 793 | 3300048909 | Ga0496106_0004861 | Ga0496106_0004861_3590_4072 | 160 |
| 794 | 3300048909 | Ga0496106_0621694 | Ga0496106_0621694_268_777 | 160 |
| 795 | 3300048909 | Ga0496106_0634410 | Ga0496106_0634410_193_678 | 160 |
| 796 | 3300048909 | Ga0496106_1339127 | Ga0496106_1339127_50_535 | 160 |
| 797 | 3300048910 | Ga0496107_0014747 | Ga0496107_0014747_2819_3301 | 160 |
| 798 | 3300048911 | Ga0496108_0188733 | Ga0496108_0188733_396_878 | 160 |
| 799 | 3300048917 | Ga0496114_0015915 | Ga0496114_0015915_5233_5715 | 160 |
| 800 | 3300048918 | Ga0496115_0081580 | Ga0496115_0081580_1827_2309 | 160 |
| 801 | 3300048918 | Ga0496115_0185350 | Ga0496115_0185350_1187_1696 | 160 |
| 802 | 3300048920 | Ga0496117_0054979 | Ga0496117_0054979_2004_2486 | 160 |
| 803 | 3300048921 | Ga0496118_0000292 | Ga0496118_0000292_70869_71351 | 160 |
| 804 | 3300048923 | Ga0496120_0098986 | Ga0496120_0098986_847_1332 | 160 |
| 805 | 3300048929 | Ga0496126_0336025 | Ga0496126_0336025_213_698 | 160 |
| 806 | 3300049569 | Ga0501032_0002086 | Ga0501032_0002086_7809_8291 | 160 |
| 807 | 3300049570 | Ga0501033_0011021 | Ga0501033_0011021_3482_3964 | 160 |
| 808 | 3300049571 | Ga0501034_0001139 | Ga0501034_0001139_16304_16786 | 160 |
| 809 | 3300049572 | Ga0501036_0037773 | Ga0501036_0037773_549_1031 | 160 |
| 810 | 3300049573 | Ga0501037_0007268 | Ga0501037_0007268_7321_7803 | 160 |
| 811 | 3300049579 | Ga0501043_0102514 | Ga0501043_0102514_1297_1779 | 160 |
| 812 | 3300049580 | Ga0501046_0000379 | Ga0501046_0000379_12122_12604 | 160 |
| 813 | 3300049581 | Ga0501047_0000372 | Ga0501047_0000372_36215_36697 | 160 |
| 814 | 3300049582 | Ga0501048_0001876 | Ga0501048_0001876_12448_12930 | 160 |
| 815 | 3300049585 | Ga0501069_0031324 | Ga0501069_0031324_2362_2859 | 160 |
| 816 | 3300049585 | Ga0501069_0260500 | Ga0501069_0260500_81_563 | 160 |
| 817 | 3300049586 | Ga0501070_0003863 | Ga0501070_0003863_3244_3726 | 160 |
| 818 | 3300049589 | Ga0501073_0031355 | Ga0501073_0031355_3042_3524 | 160 |
| 819 | 3300049589 | Ga0501073_0548404 | Ga0501073_0548404_152_649 | 160 |
| 820 | 3300049590 | Ga0501074_0692854 | Ga0501074_0692854_156_638 | 160 |
| 821 | 3300049593 | Ga0501077_0193961 | Ga0501077_0193961_133_636 | 160 |
| 822 | 3300049742 | Ga0501080_0805797 | Ga0501080_0805797_59_541 | 160 |
| 823 | 3300049744 | Ga0501083_0110676 | Ga0501083_0110676_981_1463 | 160 |
| 824 | 3300049822 | Ga0501035_0002980 | Ga0501035_0002980_10931_11413 | 160 |
| 825 | 3300049823 | Ga0501044_0017131 | Ga0501044_0017131_3207_3689 | 160 |
| 826 | 3300049823 | Ga0501044_0037385 | Ga0501044_0037385_1559_2044 | 160 |
| 827 | 3300050489 | nmdc:mga03683_119849_c1 | nmdc:mga03683_119849_c1_500_997 | 160 |
| 828 | 3300050490 | nmdc:mga03n38_10185_c1 | nmdc:mga03n38_10185_c1_1665_2147 | 160 |
| 829 | 3300050490 | nmdc:mga03n38_1341_c1 | nmdc:mga03n38_1341_c1_4217_4714 | 160 |
| 830 | 3300050491 | nmdc:mga00v17_21421_c1 | nmdc:mga00v17_21421_c1_2496_2993 | 160 |
| 831 | 3300050491 | nmdc:mga00v17_297599_c1 | nmdc:mga00v17_297599_c1_231_728 | 160 |
| 832 | 3300050491 | nmdc:mga00v17_533178_c1 | nmdc:mga00v17_533178_c1_60_557 | 160 |
| 833 | 3300050491 | nmdc:mga00v17_7501_c1 | nmdc:mga00v17_7501_c1_5025_5507 | 160 |
| 834 | 3300050492 | nmdc:mga0yw44_183462_c1 | nmdc:mga0yw44_183462_c1_580_1074 | 160 |
| 835 | 3300050492 | nmdc:mga0yw44_218593_c1 | nmdc:mga0yw44_218593_c1_255_740 | 160 |
| 836 | 3300050492 | nmdc:mga0yw44_372035_c1 | nmdc:mga0yw44_372035_c1_49_534 | 160 |
| 837 | 3300050492 | nmdc:mga0yw44_481397_c1 | nmdc:mga0yw44_481397_c1_292_777 | 160 |
| 838 | 3300050492 | nmdc:mga0yw44_73890_c1 | nmdc:mga0yw44_73890_c1_1212_1694 | 160 |
| 839 | 3300050492 | nmdc:mga0yw44_74875_c1 | nmdc:mga0yw44_74875_c1_1282_1794 | 160 |
| 840 | 3300050494 | nmdc:mga06z11_153243_c1 | nmdc:mga06z11_153243_c1_469_954 | 160 |
| 841 | 3300050494 | nmdc:mga06z11_5301_c1 | nmdc:mga06z11_5301_c1_3002_3499 | 160 |
| 842 | 3300050495 | nmdc:mga04h51_107771_c1 | nmdc:mga04h51_107771_c1_86_583 | 160 |
| 843 | 3300050496 | nmdc:mga07m45_128771_c1 | nmdc:mga07m45_128771_c1_935_1420 | 160 |
| 844 | 3300050496 | nmdc:mga07m45_517462_c1 | nmdc:mga07m45_517462_c1_143_640 | 160 |
| 845 | 3300050496 | nmdc:mga07m45_7354_c1 | nmdc:mga07m45_7354_c1_4217_4714 | 160 |
| 846 | 3300050516 | nmdc:mga0sz30_100127_c1 | nmdc:mga0sz30_100127_c1_499_981 | 160 |
| 847 | 3300050516 | nmdc:mga0sz30_67219_c1 | nmdc:mga0sz30_67219_c1_201_686 | 160 |
| 848 | 3300053080 | Ga0500635_0002503 | Ga0500635_0002503_682_1164 | 160 |
| 849 | 3300053108 | Ga0500562_005573 | Ga0500562_005573_240_722 | 160 |
| 850 | 3300053131 | Ga0500652_009718 | Ga0500652_009718_1611_2093 | 160 |
| 851 | 3300053139 | Ga0500568_0055573 | Ga0500568_0055573_90_587 | 160 |
| 852 | 3300053143 | Ga0500579_239452 | Ga0500579_239452_30_512 | 160 |
| 853 | 3300053153 | Ga0500616_0000812 | Ga0500616_0000812_32769_33254 | 160 |
| 854 | 3300061719 | Ga0466962_0106556 | Ga0466962_0106556_539_1021 | 160 |
| 855 | 3300061719 | Ga0466962_0275481 | Ga0466962_0275481_26_514 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o0a-assembly1.cif.gz_B | crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) | 0.9922 | 1 | 156 |
| 7yy8-assembly1.cif.gz_B-2 | crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 | 0.9916 | 1 | 156 |
| 6qmi-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. | 0.9908 | 1 | 156 |
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.9903 | 1 | 156 |
| 3nba-assembly2.cif.gz_B | phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp) | 0.982 | 1 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9908 | 1 | 156 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9774 | 1 | 156 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9709 | 1 | 156 | 3.40.50.620 |
| 3nd7D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9476 | 2 | 154 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9414 | 1 | 156 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L0ISV5-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.994 | 1 | 157 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A3S4RQW7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9932 | 1 | 160 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A2V0MYR3-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9923 | 13 | 160 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A1UED2-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9917 | 1 | 157 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A1I4KUK7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9881 | 1 | 159 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar