F483607

General Info

Members Datasets Scaffolds Average Seq Length
855 341 844 159

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10101200|Ga0070666_101012002
Length 190
Sequence MATPDWKWRSGRPVSRVDLSGCSRAGLVPSLAMSGAVCPGSFDPITLGHLDVFERAAAQFDEVVVAVLVNPNKKGMFTAEERIAMITEATSHLPNLRAEAGSGLVVDFARARGLTAIVKGLRTGTDFEYELQMAQMNRHVAGVDTFFVATKPQFSFVSSSLAKEVATLGGDVTDLLPAVVNKRLQAKLAG

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
3 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
4 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
8 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
9 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
10 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
11 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
12 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
219 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
220 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
221 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
222 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
223 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
325 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
328 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
329 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
330 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
331 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
332 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
333 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
338 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
339 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.29
Nodule 0
Rhizoplane 10.64
Rhizosphere 60.23
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1008764 3300000546 Bacteria 1084
2 JGI24746J21847_1006471 3300001977 Bacteria 1815
3 JGI24737J22298_10051930 3300001990 Bacteria 1244
4 JGI24737J22298_10110059 3300001990 Bacteria 815
5 JGI24743J22301_10036835 3300001991 Bacteria 974
6 JGI24743J22301_10146340 3300001991 Bacteria 528
7 JGI24735J21928_10135299 3300002067 Bacteria 711
8 JGI24738J21930_10010345 3300002075 Bacteria 2078
9 JGI24738J21930_10117783 3300002075 Bacteria 575
10 JGI24744J21845_10000451 3300002077 Bacteria 7254
11 JGI24744J21845_10001995 3300002077 Bacteria 4126
12 JGI24034J26672_10003538 3300002239 Bacteria 2182
13 JGI24034J26672_10059429 3300002239 Bacteria 669
14 JGI24742J22300_10004585 3300002244 Bacteria 2266
15 JGI24742J22300_10004702 3300002244 Bacteria 2239
16 JGI24751J29686_10007519 3300002459 Bacteria 2227
17 Ga0055540_1000057 3300003792 Bacteria 136356
18 Ga0055540_1009975 3300003792 Bacteria 3207
19 Ga0055540_1012396 3300003792 Bacteria 2678
20 Ga0070676_10027558 3300005328 Bacteria 3223
21 Ga0070683_100409140 3300005329 Bacteria 1294
22 Ga0070690_100010167 3300005330 Bacteria 5466
23 Ga0070677_10101975 3300005333 Bacteria 1267
24 Ga0070666_10085397 3300005335 Bacteria 2162
25 Ga0070666_10101200 3300005335 Bacteria 1986
26 Ga0070666_10734241 3300005335 Bacteria 725
27 Ga0070680_100357171 3300005336 Bacteria 1243
28 Ga0070680_100751093 3300005336 Bacteria 840
29 Ga0070682_100022831 3300005337 Bacteria 3711
30 Ga0070682_100043680 3300005337 Bacteria 2772
31 Ga0070682_100554184 3300005337 Bacteria 900
32 Ga0070682_100927341 3300005337 Bacteria 717
33 Ga0068868_100000294 3300005338 Bacteria 33573
34 Ga0068868_100132081 3300005338 Bacteria 2044
35 Ga0068868_100480884 3300005338 Bacteria 1085
36 Ga0068868_100501203 3300005338 Bacteria 1063
37 Ga0068868_100548991 3300005338 Bacteria 1018
38 Ga0070660_100555623 3300005339 Bacteria 958
39 Ga0070689_100040180 3300005340 Bacteria 3585
40 Ga0070691_10016547 3300005341 Bacteria 3388
41 Ga0070661_100553276 3300005344 Bacteria 926
42 Ga0070692_10166620 3300005345 Bacteria 1267
43 Ga0070668_100001698 3300005347 Bacteria 15974
44 Ga0070668_100231823 3300005347 Bacteria 1527
45 Ga0070669_100005178 3300005353 Bacteria 9434
46 Ga0070669_100137614 3300005353 Bacteria 1880
47 Ga0070671_100063135 3300005355 Bacteria 3084
48 Ga0070674_100041075 3300005356 Bacteria 3132
49 Ga0070688_100027089 3300005365 Bacteria 3412
50 Ga0070659_100165779 3300005366 Bacteria 1808
51 Ga0070667_100000063 3300005367 Bacteria 138777
52 Ga0070667_100000727 3300005367 Bacteria 31611
53 Ga0070667_100011532 3300005367 Bacteria 7306
54 Ga0070667_100015369 3300005367 Bacteria 6328
55 Ga0070667_100195731 3300005367 Bacteria 1792
56 Ga0070667_101214548 3300005367 Bacteria 706
57 Ga0070703_10012339 3300005406 Bacteria 2421
58 Ga0070709_10140768 3300005434 Bacteria 1657
59 Ga0070714_100097251 3300005435 Bacteria 2587
60 Ga0070713_100566240 3300005436 Bacteria 1077
61 Ga0070710_10005017 3300005437 Bacteria 6264
62 Ga0070711_100001192 3300005439 Bacteria 14041
63 Ga0070711_100158578 3300005439 Bacteria 1713
64 Ga0070711_100421292 3300005439 Bacteria 1088
65 Ga0070705_100704170 3300005440 Bacteria 794
66 Ga0070700_100000463 3300005441 Bacteria 20347
67 Ga0070694_100020285 3300005444 Bacteria 4235
68 Ga0070663_100019917 3300005455 Bacteria 4431
69 Ga0070663_100043359 3300005455 Bacteria 3166
70 Ga0070663_100097225 3300005455 Bacteria 2192
71 Ga0070678_100000347 3300005456 Bacteria 21660
72 Ga0070678_100416041 3300005456 Bacteria 1171
73 Ga0070662_100003014 3300005457 Bacteria 10479
74 Ga0068867_100020639 3300005459 Bacteria 4694
75 Ga0070685_10033819 3300005466 Bacteria 2876
76 Ga0068853_100006576 3300005539 Bacteria 9256
77 Ga0068853_100132561 3300005539 Bacteria 2232
78 Ga0070672_100346062 3300005543 Bacteria 1266
79 Ga0070686_100066142 3300005544 Bacteria 2350
80 Ga0070686_100284527 3300005544 Bacteria 1221
81 Ga0070696_100146040 3300005546 Bacteria 1733
82 Ga0070665_100005170 3300005548 Bacteria 13500
83 Ga0070665_100009871 3300005548 Bacteria 9651
84 Ga0070665_100030285 3300005548 Bacteria 5447
85 Ga0070665_100297289 3300005548 Bacteria 1617
86 Ga0070665_100344355 3300005548 Bacteria 1496
87 Ga0070704_100000118 3300005549 Bacteria 28378
88 Ga0070704_101203667 3300005549 Bacteria 691
89 Ga0068855_100094813 3300005563 Bacteria 3441
90 Ga0068855_100540967 3300005563 Bacteria 1262
91 Ga0068854_100000777 3300005578 Bacteria 18943
92 Ga0070702_100000798 3300005615 Bacteria 12021
93 Ga0070702_100120907 3300005615 Bacteria 1639
94 Ga0070702_100289450 3300005615 Bacteria 1128
95 Ga0068859_100015872 3300005617 Bacteria 7568
96 Ga0068859_100484346 3300005617 Bacteria 1332
97 Ga0068864_100198700 3300005618 Bacteria 1841
98 Ga0068866_10000197 3300005718 Bacteria 28297
99 Ga0068866_10220397 3300005718 Bacteria 1144
100 Ga0068866_10261167 3300005718 Bacteria 1064
101 Ga0068861_100000102 3300005719 Bacteria 42240
102 Ga0068861_100036577 3300005719 Bacteria 3645
103 Ga0068861_100074511 3300005719 Bacteria 2639
104 Ga0068861_101621210 3300005719 Bacteria 638
105 Ga0068870_10211854 3300005840 Bacteria 1181
106 Ga0068863_100000159 3300005841 Bacteria 71831
107 Ga0068863_100155729 3300005841 Bacteria 2188
108 Ga0068858_100146419 3300005842 Bacteria 2218
109 Ga0068858_100691988 3300005842 Bacteria 992
110 Ga0068860_100000065 3300005843 Bacteria 186634
111 Ga0068860_100079612 3300005843 Bacteria 3115
112 Ga0068860_100199937 3300005843 Bacteria 1936
113 Ga0068860_100466172 3300005843 Bacteria 1257
114 Ga0068862_100000028 3300005844 Bacteria 184197
115 Ga0068862_100013056 3300005844 Bacteria 6871
116 Ga0068862_100101838 3300005844 Bacteria 2513
117 Ga0068862_100490976 3300005844 Bacteria 1164
118 Ga0081455_10014375 3300005937 Bacteria 7766
119 Ga0081538_10255051 3300005981 Bacteria 666
120 Ga0075365_10003536 3300006038 Bacteria 8081
121 Ga0075365_10008557 3300006038 Bacteria 5822
122 Ga0075365_10010928 3300006038 Bacteria 5317
123 Ga0075365_10026131 3300006038 Bacteria 3703
124 Ga0075365_10100605 3300006038 Bacteria 1979
125 Ga0075365_10105792 3300006038 Bacteria 1930
126 Ga0075365_10126464 3300006038 Bacteria 1766
127 Ga0075365_10129945 3300006038 Bacteria 1743
128 Ga0075365_10166525 3300006038 Bacteria 1537
129 Ga0075365_10363502 3300006038 Bacteria 1020
130 Ga0075363_100002212 3300006048 Bacteria 7851
131 Ga0075363_100004832 3300006048 Bacteria 5948
132 Ga0075363_100005085 3300006048 Bacteria 5815
133 Ga0075363_100005618 3300006048 Bacteria 5604
134 Ga0075363_100010328 3300006048 Bacteria 4428
135 Ga0075363_100019344 3300006048 Bacteria 3404
136 Ga0075363_100021791 3300006048 Bacteria 3233
137 Ga0075363_100032964 3300006048 Bacteria 2694
138 Ga0075363_100044705 3300006048 Bacteria 2347
139 Ga0075363_100091181 3300006048 Bacteria 1678
140 Ga0075363_100159307 3300006048 Bacteria 1277
141 Ga0075363_100204817 3300006048 Bacteria 1128
142 Ga0075363_100210075 3300006048 Bacteria 1114
143 Ga0075363_100233587 3300006048 Bacteria 1056
144 Ga0075364_10002550 3300006051 Bacteria 10206
145 Ga0075364_10004805 3300006051 Bacteria 7818
146 Ga0075364_10006029 3300006051 Bacteria 7090
147 Ga0075364_10013034 3300006051 Bacteria 5101
148 Ga0075364_10014518 3300006051 Bacteria 4869
149 Ga0075364_10014806 3300006051 Bacteria 4825
150 Ga0075364_10015034 3300006051 Bacteria 4791
151 Ga0075364_10016870 3300006051 Bacteria 4550
152 Ga0075364_10145845 3300006051 Bacteria 1593
153 Ga0075364_10163663 3300006051 Bacteria 1502
154 Ga0075364_10181004 3300006051 Bacteria 1426
155 Ga0075364_10329545 3300006051 Bacteria 1040
156 Ga0075364_10685275 3300006051 Bacteria 699
157 Ga0070716_100000479 3300006173 Bacteria 16547
158 Ga0070716_100002564 3300006173 Bacteria 8405
159 Ga0070712_100000901 3300006175 Bacteria 17767
160 Ga0070712_100181949 3300006175 Bacteria 1638
161 Ga0070712_100376545 3300006175 Bacteria 1168
162 Ga0070712_100936741 3300006175 Bacteria 748
163 Ga0075362_10003956 3300006177 Bacteria 5266
164 Ga0075362_10004236 3300006177 Bacteria 5126
165 Ga0075362_10010735 3300006177 Bacteria 3586
166 Ga0075362_10047877 3300006177 Bacteria 1905
167 Ga0075362_10090150 3300006177 Bacteria 1422
168 Ga0075362_10166239 3300006177 Bacteria 1064
169 Ga0075362_10305725 3300006177 Bacteria 790
170 Ga0075362_10366515 3300006177 Bacteria 723
171 Ga0075367_10003365 3300006178 Bacteria 7607
172 Ga0075367_10034443 3300006178 Bacteria 2926
173 Ga0075367_10128092 3300006178 Bacteria 1568
174 Ga0075367_10151412 3300006178 Bacteria 1439
175 Ga0075367_10152586 3300006178 Bacteria 1434
176 Ga0075367_10165823 3300006178 Bacteria 1375
177 Ga0075367_10177686 3300006178 Bacteria 1327
178 Ga0075369_10004972 3300006186 Bacteria 4946
179 Ga0075369_10006708 3300006186 Bacteria 4364
180 Ga0075369_10012781 3300006186 Bacteria 3319
181 Ga0075369_10015455 3300006186 Bacteria 3064
182 Ga0075369_10032363 3300006186 Bacteria 2212
183 Ga0075369_10042231 3300006186 Bacteria 1954
184 Ga0075369_10056562 3300006186 Bacteria 1705
185 Ga0075369_10065208 3300006186 Bacteria 1596
186 Ga0075369_10065449 3300006186 Bacteria 1593
187 Ga0075369_10123960 3300006186 Bacteria 1171
188 Ga0075366_10199966 3300006195 Bacteria 1215
189 Ga0097621_100931576 3300006237 Bacteria 810
190 Ga0075370_10011857 3300006353 Bacteria 4590
191 Ga0075370_10026183 3300006353 Bacteria 3230
192 Ga0075370_10026467 3300006353 Bacteria 3214
193 Ga0075370_10094051 3300006353 Bacteria 1730
194 Ga0075370_10105139 3300006353 Bacteria 1636
195 Ga0075370_10130388 3300006353 Bacteria 1467
196 Ga0075370_10130744 3300006353 Bacteria 1465
197 Ga0075370_10149202 3300006353 Bacteria 1370
198 Ga0075370_10188879 3300006353 Bacteria 1213
199 Ga0068871_100009689 3300006358 Bacteria 6994
200 Ga0068871_100092764 3300006358 Bacteria 2519
201 Ga0075428_100005745 3300006844 Bacteria 13782
202 Ga0075430_100013678 3300006846 Bacteria 6918
203 Ga0075431_100034823 3300006847 Bacteria 5186
204 Ga0068865_100000554 3300006881 Bacteria 20777
205 Ga0068865_100646743 3300006881 Bacteria 898
206 Ga0097620_100015873 3300006931 Bacteria 7568
207 Ga0097620_100484339 3300006931 Bacteria 1332
208 Ga0105250_10072232 3300009092 Bacteria 1395
209 Ga0111539_10911721 3300009094 Bacteria 1022
210 Ga0105245_10002148 3300009098 Bacteria 17862
211 Ga0105247_10000910 3300009101 Bacteria 22259
212 Ga0105247_10002035 3300009101 Bacteria 14006
213 Ga0105247_10063859 3300009101 Bacteria 2287
214 Ga0105247_10386931 3300009101 Bacteria 993
215 Ga0114129_12644484 3300009147 Bacteria 598
216 Ga0105243_10001698 3300009148 Bacteria 18980
217 Ga0105243_10035777 3300009148 Bacteria 3851
218 Ga0105243_10175523 3300009148 Bacteria 1859
219 Ga0105241_10421973 3300009174 Bacteria 1174
220 Ga0105242_10001106 3300009176 Bacteria 21246
221 Ga0105242_10264733 3300009176 Bacteria 1554
222 Ga0105248_10000074 3300009177 Bacteria 114554
223 Ga0105248_10002067 3300009177 Bacteria 22238
224 Ga0105248_10509809 3300009177 Bacteria 1356
225 Ga0105248_11170510 3300009177 Bacteria 869
226 Ga0105237_10005869 3300009545 Bacteria 13768
227 Ga0105237_10011639 3300009545 Bacteria 9311
228 Ga0105237_10015011 3300009545 Bacteria 8072
229 Ga0105237_10035962 3300009545 Bacteria 5010
230 Ga0105237_10320139 3300009545 Bacteria 1554
231 Ga0105237_11622532 3300009545 Bacteria 654
232 Ga0105238_10127847 3300009551 Bacteria 2519
233 Ga0105238_10202962 3300009551 Bacteria 1959
234 Ga0105238_10270412 3300009551 Bacteria 1680
235 Ga0105249_10000011 3300009553 Bacteria 292812
236 Ga0105249_10000817 3300009553 Bacteria 28085
237 Ga0105249_10111193 3300009553 Bacteria 2590
238 Ga0105249_10627160 3300009553 Bacteria 1131
239 Ga0099796_10311501 3300010159 Bacteria 669
240 Ga0105239_10019349 3300010375 Bacteria 7520
241 Ga0105239_10027950 3300010375 Bacteria 6206
242 Ga0105239_10201628 3300010375 Bacteria 2229
243 Ga0105239_10325781 3300010375 Bacteria 1733
244 Ga0105239_11150032 3300010375 Bacteria 894
245 Ga0105246_10079065 3300011119 Bacteria 2337
246 Ga0105246_10244608 3300011119 Bacteria 1420
247 Ga0105246_11072455 3300011119 Bacteria 734
248 Ga0105246_11603379 3300011119 Bacteria 615
249 Ga0157321_1022979 3300012487 Bacteria 586
250 Ga0157373_10970106 3300013100 Bacteria 633
251 Ga0157371_10208418 3300013102 Bacteria 1402
252 Ga0157370_10483171 3300013104 Bacteria 1138
253 Ga0157369_10210083 3300013105 Bacteria 2040
254 Ga0157369_10290187 3300013105 Bacteria 1703
255 Ga0157369_10423540 3300013105 Bacteria 1380
256 Ga0157374_10111242 3300013296 Bacteria 2635
257 Ga0157374_10123065 3300013296 Bacteria 2505
258 Ga0157378_10069631 3300013297 Bacteria 3156
259 Ga0163162_10002629 3300013306 Bacteria 17028
260 Ga0163162_10100449 3300013306 Bacteria 2984
261 Ga0163162_10324604 3300013306 Bacteria 1672
262 Ga0163162_10821137 3300013306 Bacteria 1046
263 Ga0157372_10005992 3300013307 Bacteria 12914
264 Ga0157372_10136515 3300013307 Bacteria 2825
265 Ga0157375_10029335 3300013308 Bacteria 5172
266 Ga0157375_10626295 3300013308 Bacteria 1233
267 Ga0157375_11311887 3300013308 Bacteria 851
268 Ga0163163_10010435 3300014325 Bacteria 8357
269 Ga0163163_10058920 3300014325 Bacteria 3797
270 Ga0163163_10133054 3300014325 Bacteria 2527
271 Ga0163163_10227342 3300014325 Bacteria 1915
272 Ga0157380_10000237 3300014326 Bacteria 33183
273 Ga0182008_10149930 3300014497 Bacteria 1169
274 Ga0157377_10131869 3300014745 Bacteria 1527
275 Ga0157377_10200053 3300014745 Bacteria 1268
276 Ga0157377_10776403 3300014745 Bacteria 704
277 Ga0157379_10003146 3300014968 Bacteria 13969
278 Ga0157379_10205600 3300014968 Bacteria 1781
279 Ga0157379_10219258 3300014968 Bacteria 1723
280 Ga0157379_10666057 3300014968 Bacteria 975
281 Ga0157379_11300996 3300014968 Bacteria 702
282 Ga0157376_10283778 3300014969 Bacteria 1560
283 Ga0163161_10012503 3300017792 Bacteria 5893
284 Ga0163161_10102152 3300017792 Bacteria 2135
285 Ga0213874_10049667 3300021377 Bacteria 1283
286 Ga0213876_10006163 3300021384 Bacteria 6543
287 Ga0213876_10016750 3300021384 Bacteria 3872
288 Ga0213875_10027324 3300021388 Bacteria 2715
289 Ga0213875_10107486 3300021388 Bacteria 1302
290 Ga0209233_1019362 3300025261 Bacteria 1811
291 Ga0209673_1050254 3300025273 Bacteria 1108
292 Ga0209051_1000075 3300025303 Bacteria 205011
293 Ga0209051_1002890 3300025303 Bacteria 11797
294 Ga0209051_1004789 3300025303 Bacteria 8164
295 Ga0209051_1004816 3300025303 Bacteria 8134
296 Ga0207697_10225906 3300025315 Bacteria 826
297 Ga0207692_10000823 3300025898 Bacteria 11109
298 Ga0207642_10001812 3300025899 Bacteria 6604
299 Ga0207710_10000014 3300025900 Bacteria 408072
300 Ga0207710_10012315 3300025900 Bacteria 3599
301 Ga0207710_10073146 3300025900 Bacteria 1576
302 Ga0207710_10116201 3300025900 Bacteria 1274
303 Ga0207688_10000631 3300025901 Bacteria 17344
304 Ga0207688_10001555 3300025901 Bacteria 12077
305 Ga0207680_10003254 3300025903 Bacteria 7649
306 Ga0207680_10104517 3300025903 Bacteria 1826
307 Ga0207647_10102565 3300025904 Bacteria 1696
308 Ga0207647_10309263 3300025904 Bacteria 899
309 Ga0207685_10010762 3300025905 Bacteria 2719
310 Ga0207699_10288214 3300025906 Bacteria 1143
311 Ga0207645_10028955 3300025907 Bacteria 3571
312 Ga0207643_10254038 3300025908 Bacteria 1083
313 Ga0207684_10565264 3300025910 Bacteria 972
314 Ga0207707_10572499 3300025912 Bacteria 958
315 Ga0207671_10007376 3300025914 Bacteria 9550
316 Ga0207671_10010966 3300025914 Bacteria 7425
317 Ga0207671_10023781 3300025914 Bacteria 4617
318 Ga0207671_10088863 3300025914 Bacteria 2325
319 Ga0207693_10000049 3300025915 Bacteria 100347
320 Ga0207693_10016572 3300025915 Bacteria 5886
321 Ga0207693_10508662 3300025915 Bacteria 940
322 Ga0207693_10734168 3300025915 Bacteria 763
323 Ga0207663_10675056 3300025916 Bacteria 817
324 Ga0207660_10392660 3300025917 Bacteria 1116
325 Ga0207662_10173268 3300025918 Bacteria 1385
326 Ga0207657_10392050 3300025919 Bacteria 1093
327 Ga0207681_10015809 3300025923 Bacteria 4711
328 Ga0207694_10147254 3300025924 Bacteria 1896
329 Ga0207694_10333884 3300025924 Bacteria 1253
330 Ga0207650_10322380 3300025925 Bacteria 1266
331 Ga0207687_10001708 3300025927 Bacteria 15148
332 Ga0207687_10029129 3300025927 Bacteria 3713
333 Ga0207700_10262229 3300025928 Bacteria 1480
334 Ga0207664_10338994 3300025929 Bacteria 1329
335 Ga0207664_11011005 3300025929 Bacteria 745
336 Ga0207644_10078843 3300025931 Bacteria 2428
337 Ga0207690_10046133 3300025932 Bacteria 2884
338 Ga0207706_10017197 3300025933 Bacteria 6518
339 Ga0207706_10089745 3300025933 Bacteria 2702
340 Ga0207686_10006782 3300025934 Bacteria 6168
341 Ga0207709_10005064 3300025935 Bacteria 7524
342 Ga0207670_10007646 3300025936 Bacteria 6049
343 Ga0207670_11003663 3300025936 Bacteria 702
344 Ga0207669_10060278 3300025937 Bacteria 2325
345 Ga0207669_10075584 3300025937 Bacteria 2135
346 Ga0207669_10226851 3300025937 Bacteria 1375
347 Ga0207704_10002646 3300025938 Bacteria 8086
348 Ga0207704_10589610 3300025938 Bacteria 908
349 Ga0207665_10003396 3300025939 Bacteria 10656
350 Ga0207665_10006174 3300025939 Bacteria 7956
351 Ga0207665_10410131 3300025939 Bacteria 1033
352 Ga0207691_10429306 3300025940 Bacteria 1126
353 Ga0207711_10000149 3300025941 Bacteria 74062
354 Ga0207711_11038140 3300025941 Bacteria 760
355 Ga0207689_10011059 3300025942 Bacteria 7755
356 Ga0207689_10149660 3300025942 Bacteria 1924
357 Ga0207661_10454513 3300025944 Bacteria 1167
358 Ga0207667_10110240 3300025949 Bacteria 2839
359 Ga0207667_10520202 3300025949 Bacteria 1205
360 Ga0207651_10729817 3300025960 Bacteria 874
361 Ga0207712_10000020 3300025961 Bacteria 292796
362 Ga0207712_10001309 3300025961 Bacteria 17057
363 Ga0207712_10048105 3300025961 Bacteria 2965
364 Ga0207712_10661849 3300025961 Bacteria 908
365 Ga0207668_10004346 3300025972 Bacteria 8322
366 Ga0207668_10064977 3300025972 Bacteria 2581
367 Ga0207668_10485406 3300025972 Bacteria 1060
368 Ga0207668_10623516 3300025972 Bacteria 941
369 Ga0207640_10035693 3300025981 Bacteria 3113
370 Ga0207658_10001359 3300025986 Bacteria 19133
371 Ga0207658_10099915 3300025986 Bacteria 2270
372 Ga0207658_10279949 3300025986 Bacteria 1429
373 Ga0207658_10845125 3300025986 Bacteria 832
374 Ga0207677_10002239 3300026023 Bacteria 10159
375 Ga0207677_10039731 3300026023 Bacteria 3096
376 Ga0207677_10179216 3300026023 Bacteria 1665
377 Ga0207703_10220293 3300026035 Bacteria 1696
378 Ga0207703_10608927 3300026035 Bacteria 1034
379 Ga0207639_10005576 3300026041 Bacteria 8513
380 Ga0207639_10105934 3300026041 Bacteria 2282
381 Ga0207639_10134443 3300026041 Bacteria 2051
382 Ga0207678_10006306 3300026067 Bacteria 10532
383 Ga0207678_10032076 3300026067 Bacteria 4579
384 Ga0207708_10000411 3300026075 Bacteria 33673
385 Ga0207708_10011584 3300026075 Bacteria 6572
386 Ga0207708_10646042 3300026075 Bacteria 900
387 Ga0207702_10600534 3300026078 Bacteria 1080
388 Ga0207641_10000156 3300026088 Bacteria 97171
389 Ga0207641_10188820 3300026088 Bacteria 1892
390 Ga0207641_10450075 3300026088 Bacteria 1244
391 Ga0207641_11664913 3300026088 Bacteria 640
392 Ga0207648_10000187 3300026089 Bacteria 65094
393 Ga0207648_10104857 3300026089 Bacteria 2480
394 Ga0207675_100000220 3300026118 Bacteria 53425
395 Ga0207675_100208575 3300026118 Bacteria 1878
396 Ga0207683_10000197 3300026121 Bacteria 52074
397 Ga0207683_10016831 3300026121 Bacteria 6221
398 Ga0207683_10272058 3300026121 Bacteria 1547
399 Ga0207683_11630363 3300026121 Bacteria 594
400 Ga0207698_10037259 3300026142 Bacteria 3580
401 Ga0207698_11525706 3300026142 Bacteria 683
402 Ga0209813_10005913 3300027866 Bacteria 3001
403 Ga0209813_10150119 3300027866 Bacteria 834
404 Ga0268266_10004901 3300028379 Bacteria 12694
405 Ga0268266_10007692 3300028379 Bacteria 9676
406 Ga0268266_10018751 3300028379 Bacteria 5895
407 Ga0268266_10049310 3300028379 Bacteria 3611
408 Ga0268265_10000004 3300028380 Bacteria 648376
409 Ga0268265_10026403 3300028380 Bacteria 4132
410 Ga0268265_10319787 3300028380 Bacteria 1405
411 Ga0268265_10589825 3300028380 Bacteria 1060
412 Ga0268264_10000024 3300028381 Bacteria 470081
413 Ga0268264_10012485 3300028381 Bacteria 6994
414 Ga0268264_10111091 3300028381 Bacteria 2401
415 Ga0268264_11174025 3300028381 Bacteria 777
416 Ga0265327_10002454 3300031251 Bacteria 19559
417 Ga0307408_100615059 3300031548 Bacteria 967
418 Ga0307413_10040624 3300031824 Bacteria 2716
419 Ga0307413_10061299 3300031824 Bacteria 2320
420 Ga0307410_11430315 3300031852 Bacteria 608
421 Ga0307406_10756649 3300031901 Bacteria 816
422 Ga0307407_10042758 3300031903 Bacteria 2543
423 Ga0307409_100292982 3300031995 Bacteria 1510
424 Ga0307416_100098500 3300032002 Bacteria 2536
425 Ga0307416_100645439 3300032002 Bacteria 1143
426 Ga0307414_11061717 3300032004 Bacteria 747
427 Ga0307411_10526675 3300032005 Bacteria 1004
428 Ga0307415_100016173 3300032126 Bacteria 4439
429 Ga0307415_101229370 3300032126 Bacteria 707
430 Ga0373941_0024802 3300035115 Bacteria 1726
431 Ga0373960_0022712 3300035121 Bacteria 1683
432 Ga0373942_0200302 3300035207 Bacteria 662
433 Ga0373962_0086001 3300035242 Bacteria 962
434 Ga0373931_0037789 3300035691 Bacteria 2522
435 Ga0373931_0078237 3300035691 Bacteria 1819
436 Ga0373937_1240750 3300036401 Bacteria 694
437 Ga0316584_0454039 3300036712 Bacteria 906
438 Ga0395900_0576256 3300037418 Bacteria 1068
439 Ga0395900_0856793 3300037418 Bacteria 834
440 Ga0395900_1285241 3300037418 Bacteria 646
441 Ga0436364_0126449 3300037853 Bacteria 4577
442 Ga0436364_0603886 3300037853 Bacteria 667
443 Ga0436364_0950685 3300037853 Bacteria 10867
444 Ga0436365_0059246 3300039437 Bacteria 4077
445 Ga0436365_0627008 3300039437 Bacteria 4243
446 Ga0436365_1276831 3300039437 Bacteria 12153
447 Ga0436365_1413714 3300039437 Bacteria 699
448 Ga0436360_0562690 3300039438 Bacteria 2233
449 Ga0436361_0363522 3300039447 Bacteria 829
450 Ga0436363_0082189 3300039450 Bacteria 844
451 Ga0436363_0160340 3300039450 Bacteria 802
452 Ga0436363_0198696 3300039450 Bacteria 4028
453 Ga0436363_0598107 3300039450 Bacteria 1717
454 Ga0436363_1183203 3300039450 Bacteria 1677
455 Ga0439461_0003064 3300041410 Bacteria 2724
456 Ga0439461_0012317 3300041410 Bacteria 1598
457 Ga0439466_0001598 3300041411 Bacteria 8850
458 Ga0439466_0005159 3300041411 Bacteria 5005
459 Ga0439465_0002492 3300041413 Bacteria 6011
460 Ga0439465_0003273 3300041413 Bacteria 5294
461 Ga0439465_0010180 3300041413 Bacteria 2955
462 Ga0439465_0018576 3300041413 Bacteria 2172
463 Ga0439465_0133700 3300041413 Bacteria 877
464 Ga0451787_735807 3300041441 Bacteria 1069
465 Ga0451789_0771824 3300041443 Bacteria 604
466 Ga0451793_0034594 3300041452 Bacteria 618
467 Ga0451841_0612220 3300041498 Bacteria 1606
468 Ga0451847_0137655 3300041503 Bacteria 824
469 Ga0439431_0005723 3300041997 Bacteria 2742
470 Ga0439431_0035028 3300041997 Bacteria 1260
471 Ga0439442_041566 3300042002 Bacteria 966
472 Ga0439445_0008931 3300042004 Bacteria 2354
473 Ga0439445_0019377 3300042004 Bacteria 1695
474 Ga0439448_0149902 3300042005 Bacteria 809
475 Ga0439434_0002444 3300042435 Bacteria 5402
476 Ga0439434_0027631 3300042435 Bacteria 1716
477 Ga0439434_0086834 3300042435 Bacteria 997
478 Ga0439435_0130772 3300042436 Bacteria 793
479 Ga0466969_0003541 3300044656 Bacteria 8306
480 Ga0466969_0110240 3300044656 Bacteria 1289
481 Ga0466972_0007528 3300044658 Bacteria 5463
482 Ga0466972_0008245 3300044658 Bacteria 5221
483 Ga0466972_0026588 3300044658 Bacteria 2868
484 Ga0466972_0055758 3300044658 Bacteria 1900
485 Ga0466972_0101894 3300044658 Bacteria 1358
486 Ga0466972_0237777 3300044658 Bacteria 852
487 Ga0466965_0001448 3300044683 Bacteria 9581
488 Ga0466965_0003649 3300044683 Bacteria 6786
489 Ga0466965_0060406 3300044683 Bacteria 1893
490 Ga0466965_0109211 3300044683 Bacteria 1420
491 Ga0466965_0381991 3300044683 Bacteria 776
492 Ga0466966_0004633 3300044684 Bacteria 9052
493 Ga0466966_0009501 3300044684 Bacteria 6440
494 Ga0466966_0180851 3300044684 Bacteria 1279
495 Ga0466966_0445789 3300044684 Bacteria 778
496 Ga0466961_0009146 3300044693 Bacteria 6309
497 Ga0466961_0180376 3300044693 Bacteria 1311
498 Ga0466964_0001519 3300044706 Bacteria 7975
499 Ga0466964_0084611 3300044706 Bacteria 1368
500 Ga0466971_0002606 3300044719 Bacteria 7629
501 Ga0466971_0012348 3300044719 Bacteria 3742
502 Ga0466968_0001533 3300044735 Bacteria 8300
503 Ga0466968_0001712 3300044735 Bacteria 7907
504 Ga0466968_0002050 3300044735 Bacteria 7331
505 Ga0466968_0028015 3300044735 Bacteria 2321
506 Ga0466968_0538556 3300044735 Bacteria 585
507 Ga0466970_0002905 3300044765 Bacteria 8298
508 Ga0466970_0011881 3300044765 Bacteria 4441
509 Ga0466970_0019593 3300044765 Bacteria 3508
510 Ga0466970_0055259 3300044765 Bacteria 2120
511 Ga0466970_0280708 3300044765 Bacteria 937
512 Ga0466957_0001674 3300044842 Bacteria 11647
513 Ga0466957_0011226 3300044842 Bacteria 5160
514 Ga0466957_0020925 3300044842 Bacteria 3849
515 Ga0466957_0056145 3300044842 Bacteria 2407
516 Ga0466957_0458622 3300044842 Bacteria 879
517 Ga0466957_0539263 3300044842 Bacteria 812
518 Ga0466960_0000116 3300044901 Bacteria 26505
519 Ga0466960_0000837 3300044901 Bacteria 10857
520 Ga0466960_0143415 3300044901 Bacteria 1270
521 Ga0466959_0006180 3300045049 Bacteria 8275
522 Ga0466959_0007885 3300045049 Bacteria 7496
523 Ga0466959_0050309 3300045049 Bacteria 3059
524 Ga0466959_0053451 3300045049 Bacteria 2952
525 Ga0466958_0002368 3300045836 Bacteria 9439
526 Ga0466958_0017360 3300045836 Bacteria 4158
527 Ga0466958_0021510 3300045836 Bacteria 3771
528 Ga0466958_0112916 3300045836 Bacteria 1697
529 Ga0466958_0657361 3300045836 Bacteria 682
530 Ga0466958_0765419 3300045836 Bacteria 629
531 Ga0466958_0847942 3300045836 Bacteria 596
532 Ga0466967_0002885 3300045976 Bacteria 10936
533 Ga0466967_0003298 3300045976 Bacteria 10478
534 Ga0466967_0021171 3300045976 Bacteria 5274
535 Ga0466967_0030203 3300045976 Bacteria 4545
536 Ga0466967_0044271 3300045976 Bacteria 3860
537 Ga0466967_0473321 3300045976 Bacteria 1226
538 Ga0466967_0841830 3300045976 Bacteria 911
539 Ga0495629_0015508 3300046459 Bacteria 5471
540 Ga0495638_0037001 3300046460 Bacteria 3106
541 Ga0495641_0005534 3300046461 Bacteria 8485
542 Ga0495650_0193701 3300046471 Bacteria 709
543 Ga0495582_0059652 3300046473 Bacteria 2105
544 Ga0495639_0031878 3300046475 Bacteria 2349
545 Ga0495584_0318994 3300046491 Bacteria 789
546 Ga0495606_0010471 3300046507 Bacteria 7689
547 Ga0495608_0361087 3300046511 Bacteria 893
548 Ga0495648_0001720 3300046524 Bacteria 21134
549 Ga0495640_0122927 3300046533 Bacteria 1685
550 Ga0495635_0878669 3300046663 Bacteria 575
551 Ga0495671_0106388 3300046692 Bacteria 1370
552 Ga0495674_0723527 3300047319 Bacteria 779
553 Ga0495672_0006563 3300047320 Bacteria 8962
554 Ga0495672_0055873 3300047320 Bacteria 2301
555 Ga0495677_0317379 3300047445 Bacteria 614
556 Ga0495673_0000355 3300047469 Bacteria 57060
557 Ga0495686_0002522 3300047472 Bacteria 17141
558 Ga0495686_0011027 3300047472 Bacteria 6393
559 Ga0495686_0034814 3300047472 Bacteria 3240
560 Ga0495686_0365391 3300047472 Bacteria 781
561 Ga0495686_0472982 3300047472 Unclassified 663
562 Ga0496100_0000009 3300048903 Bacteria 225785
563 Ga0496100_0000531 3300048903 Bacteria 18147
564 Ga0496100_0006888 3300048903 Bacteria 6224
565 Ga0496100_0013488 3300048903 Bacteria 4715
566 Ga0496100_0033050 3300048903 Bacteria 3233
567 Ga0496100_0280561 3300048903 Bacteria 1242
568 Ga0496100_0539637 3300048903 Bacteria 901
569 Ga0496101_0000018 3300048904 Bacteria 236102
570 Ga0496101_0000102 3300048904 Bacteria 88779
571 Ga0496101_0000432 3300048904 Bacteria 26783
572 Ga0496101_0002584 3300048904 Bacteria 11123
573 Ga0496101_0048871 3300048904 Bacteria 3041
574 Ga0496101_0257671 3300048904 Bacteria 1360
575 Ga0496101_0458739 3300048904 Bacteria 1005
576 Ga0496101_0478661 3300048904 Bacteria 983
577 Ga0496102_0000037 3300048905 Bacteria 199368
578 Ga0496102_0000780 3300048905 Bacteria 31010
579 Ga0496102_0001336 3300048905 Bacteria 22132
580 Ga0496102_0035693 3300048905 Bacteria 4476
581 Ga0496102_0116111 3300048905 Bacteria 2498
582 Ga0496102_0127375 3300048905 Bacteria 2381
583 Ga0496102_0142321 3300048905 Bacteria 2249
584 Ga0496102_0801092 3300048905 Bacteria 864
585 Ga0496102_1233731 3300048905 Bacteria 667
586 Ga0496103_0000004 3300048906 Bacteria 510080
587 Ga0496103_0001409 3300048906 Bacteria 16139
588 Ga0496103_0001995 3300048906 Bacteria 13156
589 Ga0496103_0018136 3300048906 Bacteria 4220
590 Ga0496103_0264594 3300048906 Bacteria 1106
591 Ga0496103_0397004 3300048906 Bacteria 886
592 Ga0496104_0019767 3300048907 Bacteria 6166
593 Ga0496104_0022028 3300048907 Bacteria 5855
594 Ga0496105_0117376 3300048908 Bacteria 2195
595 Ga0496105_0153063 3300048908 Bacteria 1895
596 Ga0496105_0188632 3300048908 Bacteria 1687
597 Ga0496105_0300130 3300048908 Bacteria 1291
598 Ga0496106_0004574 3300048909 Bacteria 10261
599 Ga0496106_0004861 3300048909 Bacteria 9945
600 Ga0496106_0005826 3300048909 Bacteria 9113
601 Ga0496106_0012852 3300048909 Bacteria 6180
602 Ga0496106_0052159 3300048909 Bacteria 3085
603 Ga0496106_0197032 3300048909 Bacteria 1602
604 Ga0496106_0621694 3300048909 Bacteria 864
605 Ga0496106_0634410 3300048909 Bacteria 854
606 Ga0496106_1339127 3300048909 Bacteria 555
607 Ga0496107_0000511 3300048910 Bacteria 21543
608 Ga0496107_0004059 3300048910 Bacteria 9857
609 Ga0496107_0011387 3300048910 Bacteria 6193
610 Ga0496107_0014747 3300048910 Bacteria 5473
611 Ga0496107_0319733 3300048910 Bacteria 1155
612 Ga0496107_0824527 3300048910 Bacteria 678
613 Ga0496108_0001088 3300048911 Bacteria 21204
614 Ga0496108_0002904 3300048911 Bacteria 13767
615 Ga0496108_0188733 3300048911 Bacteria 1786
616 Ga0496108_0337249 3300048911 Bacteria 1315
617 Ga0496108_0929573 3300048911 Bacteria 745
618 Ga0496109_0000136 3300048912 Bacteria 73612
619 Ga0496109_0011714 3300048912 Bacteria 7543
620 Ga0496109_0012517 3300048912 Bacteria 7325
621 Ga0496109_0199615 3300048912 Bacteria 1880
622 Ga0496109_1353856 3300048912 Bacteria 647
623 Ga0496110_0001780 3300048913 Bacteria 15871
624 Ga0496110_0012200 3300048913 Bacteria 7060
625 Ga0496110_0150718 3300048913 Bacteria 2106
626 Ga0496110_0245040 3300048913 Bacteria 1631
627 Ga0496111_0004530 3300048914 Bacteria 8793
628 Ga0496111_0421597 3300048914 Bacteria 986
629 Ga0496112_0006921 3300048915 Bacteria 10007
630 Ga0496112_0021424 3300048915 Bacteria 6147
631 Ga0496112_0067479 3300048915 Bacteria 3531
632 Ga0496112_0201511 3300048915 Bacteria 1949
633 Ga0496113_0002072 3300048916 Bacteria 11538
634 Ga0496113_0014387 3300048916 Bacteria 5397
635 Ga0496113_0060141 3300048916 Bacteria 2863
636 Ga0496113_0547449 3300048916 Bacteria 928
637 Ga0496113_1048555 3300048916 Bacteria 641
638 Ga0496114_0000108 3300048917 Bacteria 59737
639 Ga0496114_0015915 3300048917 Bacteria 6053
640 Ga0496114_0018416 3300048917 Bacteria 5645
641 Ga0496114_0024842 3300048917 Bacteria 4892
642 Ga0496114_0341192 3300048917 Bacteria 1325
643 Ga0496114_0650347 3300048917 Bacteria 927
644 Ga0496114_0856495 3300048917 Bacteria 789
645 Ga0496115_0003184 3300048918 Bacteria 11793
646 Ga0496115_0043674 3300048918 Bacteria 3575
647 Ga0496115_0081580 3300048918 Bacteria 2634
648 Ga0496115_0185350 3300048918 Bacteria 1720
649 Ga0496115_0898779 3300048918 Bacteria 683
650 Ga0496116_0000276 3300048919 Bacteria 89506
651 Ga0496116_0002633 3300048919 Bacteria 18626
652 Ga0496117_0000003 3300048920 Bacteria 1881097
653 Ga0496117_0001267 3300048920 Bacteria 37488
654 Ga0496117_0054979 3300048920 Bacteria 2785
655 Ga0496118_0000001 3300048921 Bacteria 1881100
656 Ga0496118_0000275 3300048921 Bacteria 90451
657 Ga0496118_0000292 3300048921 Bacteria 87325
658 Ga0496118_0011629 3300048921 Bacteria 8560
659 Ga0496118_0328393 3300048921 Bacteria 826
660 Ga0496119_0005085 3300048922 Bacteria 12770
661 Ga0496119_0006894 3300048922 Bacteria 10369
662 Ga0496119_0011468 3300048922 Bacteria 7331
663 Ga0496119_0197251 3300048922 Bacteria 1044
664 Ga0496120_0017069 3300048923 Bacteria 4718
665 Ga0496120_0030665 3300048923 Bacteria 3264
666 Ga0496120_0098986 3300048923 Bacteria 1544
667 Ga0496121_0000023 3300048924 Bacteria 463448
668 Ga0496121_0000338 3300048924 Bacteria 97703
669 Ga0496121_0016981 3300048924 Bacteria 7472
670 Ga0496121_0135536 3300048924 Bacteria 1835
671 Ga0496121_0247368 3300048924 Bacteria 1238
672 Ga0496121_0350796 3300048924 Bacteria 983
673 Ga0496122_0000164 3300048925 Bacteria 158055
674 Ga0496122_0024719 3300048925 Bacteria 5247
675 Ga0496123_0004915 3300048926 Bacteria 13718
676 Ga0496123_0024513 3300048926 Bacteria 4582
677 Ga0496124_0000014 3300048927 Bacteria 463448
678 Ga0496124_0086213 3300048927 Bacteria 2570
679 Ga0496124_0673315 3300048927 Bacteria 660
680 Ga0496125_0000020 3300048928 Bacteria 463448
681 Ga0496125_0006797 3300048928 Bacteria 12284
682 Ga0496125_0225606 3300048928 Bacteria 1203
683 Ga0496126_0000023 3300048929 Bacteria 463448
684 Ga0496126_0000551 3300048929 Bacteria 72093
685 Ga0496126_0009407 3300048929 Bacteria 10380
686 Ga0496126_0048638 3300048929 Bacteria 3873
687 Ga0496126_0336025 3300048929 Bacteria 1238
688 Ga0496126_0470687 3300048929 Bacteria 1008
689 Ga0501032_0002086 3300049569 Bacteria 15782
690 Ga0501033_0011021 3300049570 Bacteria 6924
691 Ga0501033_0024106 3300049570 Bacteria 4592
692 Ga0501034_0001139 3300049571 Bacteria 37012
693 Ga0501034_0001642 3300049571 Bacteria 28889
694 Ga0501034_0064818 3300049571 Bacteria 3667
695 Ga0501034_0351996 3300049571 Bacteria 1401
696 Ga0501034_0527795 3300049571 Bacteria 1092
697 Ga0501036_0016199 3300049572 Bacteria 6225
698 Ga0501036_0037773 3300049572 Bacteria 4085
699 Ga0501037_0003861 3300049573 Bacteria 10869
700 Ga0501037_0007268 3300049573 Bacteria 8094
701 Ga0501038_0001528 3300049574 Bacteria 21344
702 Ga0501039_0000288 3300049575 Bacteria 35904
703 Ga0501040_0888284 3300049576 Bacteria 645
704 Ga0501043_0000411 3300049579 Bacteria 38553
705 Ga0501043_0102514 3300049579 Bacteria 2249
706 Ga0501046_0000379 3300049580 Bacteria 44584
707 Ga0501047_0000372 3300049581 Bacteria 50660
708 Ga0501047_0065052 3300049581 Bacteria 3516
709 Ga0501047_0291716 3300049581 Bacteria 1475
710 Ga0501047_0352859 3300049581 Bacteria 1307
711 Ga0501048_0001876 3300049582 Bacteria 15956
712 Ga0501069_0031324 3300049585 Bacteria 2924
713 Ga0501069_0260500 3300049585 Bacteria 1012
714 Ga0501070_0000614 3300049586 Bacteria 32686
715 Ga0501070_0003863 3300049586 Bacteria 12920
716 Ga0501070_0081466 3300049586 Bacteria 2678
717 Ga0501070_0364218 3300049586 Bacteria 1172
718 Ga0501073_0031355 3300049589 Bacteria 3793
719 Ga0501073_0209524 3300049589 Bacteria 1347
720 Ga0501073_0548404 3300049589 Bacteria 799
721 Ga0501074_0692854 3300049590 Bacteria 719
722 Ga0501077_0193961 3300049593 Bacteria 1290
723 Ga0501077_0418646 3300049593 Bacteria 857
724 Ga0501080_0190895 3300049742 Bacteria 1882
725 Ga0501080_0805797 3300049742 Bacteria 823
726 Ga0501083_0110676 3300049744 Bacteria 1806
727 Ga0501035_0000344 3300049822 Bacteria 53753
728 Ga0501035_0002980 3300049822 Bacteria 16277
729 Ga0501044_0011255 3300049823 Bacteria 9699
730 Ga0501044_0017131 3300049823 Bacteria 7776
731 Ga0501044_0037385 3300049823 Bacteria 5075
732 Ga0501044_0088632 3300049823 Bacteria 3123
733 nmdc:mga03683_119849_c1 3300050489 Bacteria 1169
734 nmdc:mga03683_192912_c1 3300050489 Bacteria 933
735 nmdc:mga03683_41848_c1 3300050489 Bacteria 1883
736 nmdc:mga03683_5371_c1 3300050489 Bacteria 4324
737 nmdc:mga03683_9801_c1 3300050489 Bacteria 3418
738 nmdc:mga03n38_10185_c1 3300050490 Bacteria 3450
739 nmdc:mga03n38_1341_c1 3300050490 Bacteria 6962
740 nmdc:mga03n38_1868_c1 3300050490 Bacteria 6296
741 nmdc:mga03n38_230170_c1 3300050490 Bacteria 971
742 nmdc:mga03n38_25775_c1 3300050490 Bacteria 2420
743 nmdc:mga03n38_27304_c1 3300050490 Bacteria 2367
744 nmdc:mga03n38_355751_c1 3300050490 Bacteria 798
745 nmdc:mga03n38_373627_c1 3300050490 Bacteria 780
746 nmdc:mga03n38_39244_c1 3300050490 Bacteria 2053
747 nmdc:mga03n38_408364_c1 3300050490 Bacteria 749
748 nmdc:mga03n38_66281_c1 3300050490 Bacteria 1658
749 nmdc:mga00v17_10660_c1 3300050491 Bacteria 5027
750 nmdc:mga00v17_10941_c1 3300050491 Bacteria 4972
751 nmdc:mga00v17_117922_c1 3300050491 Bacteria 1688
752 nmdc:mga00v17_16207_c1 3300050491 Bacteria 4200
753 nmdc:mga00v17_207732_c1 3300050491 Bacteria 1267
754 nmdc:mga00v17_21421_c1 3300050491 Bacteria 3716
755 nmdc:mga00v17_2499_c1 3300050491 Bacteria 9411
756 nmdc:mga00v17_278811_c1 3300050491 Bacteria 1085
757 nmdc:mga00v17_297599_c1 3300050491 Bacteria 1048
758 nmdc:mga00v17_309560_c1 3300050491 Bacteria 1026
759 nmdc:mga00v17_38824_c1 3300050491 Bacteria 2849
760 nmdc:mga00v17_480685_c1 3300050491 Bacteria 806
761 nmdc:mga00v17_533178_c1 3300050491 Bacteria 760
762 nmdc:mga00v17_58638_c1 3300050491 Bacteria 2359
763 nmdc:mga00v17_60308_c1 3300050491 Bacteria 2329
764 nmdc:mga00v17_7042_c1 3300050491 Bacteria 5989
765 nmdc:mga00v17_7501_c1 3300050491 Bacteria 5823
766 nmdc:mga0yw44_183462_c1 3300050492 Bacteria 1378
767 nmdc:mga0yw44_1866_c1 3300050492 Bacteria 8658
768 nmdc:mga0yw44_19090_c1 3300050492 Bacteria 3773
769 nmdc:mga0yw44_218593_c1 3300050492 Bacteria 1262
770 nmdc:mga0yw44_248080_c1 3300050492 Bacteria 1184
771 nmdc:mga0yw44_257710_c1 3300050492 Bacteria 1162
772 nmdc:mga0yw44_372035_c1 3300050492 Bacteria 964
773 nmdc:mga0yw44_481397_c1 3300050492 Bacteria 842
774 nmdc:mga0yw44_73890_c1 3300050492 Bacteria 2122
775 nmdc:mga0yw44_74875_c1 3300050492 Bacteria 2109
776 nmdc:mga0yw44_7852_c1 3300050492 Bacteria 5282
777 nmdc:mga0k408_69490_c1 3300050493 Bacteria 2055
778 nmdc:mga06z11_113785_c1 3300050494 Bacteria 1501
779 nmdc:mga06z11_119025_c1 3300050494 Bacteria 1471
780 nmdc:mga06z11_14437_c1 3300050494 Bacteria 3499
781 nmdc:mga06z11_153243_c1 3300050494 Bacteria 1312
782 nmdc:mga06z11_154550_c1 3300050494 Bacteria 1307
783 nmdc:mga06z11_234929_c1 3300050494 Bacteria 1075
784 nmdc:mga06z11_266431_c1 3300050494 Bacteria 1012
785 nmdc:mga06z11_401601_c1 3300050494 Bacteria 825
786 nmdc:mga06z11_5301_c1 3300050494 Bacteria 5164
787 nmdc:mga04h51_107771_c1 3300050495 Bacteria 1023
788 nmdc:mga04h51_184483_c1 3300050495 Bacteria 813
789 nmdc:mga07m45_10931_c1 3300050496 Bacteria 3054
790 nmdc:mga07m45_110902_c1 3300050496 Bacteria 1580
791 nmdc:mga07m45_112251_c1 3300050496 Bacteria 1571
792 nmdc:mga07m45_128771_c1 3300050496 Bacteria 1464
793 nmdc:mga07m45_146232_c1 3300050496 Bacteria 1370
794 nmdc:mga07m45_204901_c1 3300050496 Bacteria 1147
795 nmdc:mga07m45_25465_c1 3300050496 Bacteria 3244
796 nmdc:mga07m45_43584_c1 3300050496 Bacteria 1252
797 nmdc:mga07m45_517462_c1 3300050496 Bacteria 691
798 nmdc:mga07m45_68888_c1 3300050496 Bacteria 2011
799 nmdc:mga07m45_7339_c1 3300050496 Bacteria 5626
800 nmdc:mga07m45_7354_c1 3300050496 Bacteria 5623
801 nmdc:mga05p37_27189_c1 3300050507 Bacteria 6964
802 nmdc:mga09592_288422_c1 3300050508 Bacteria 1423
803 nmdc:mga0qj67_66076_c1 3300050509 Bacteria 2880
804 nmdc:mga0qj67_7908_c1 3300050509 Bacteria 7858
805 nmdc:mga06r32_18218_c1 3300050510 Bacteria 6425
806 nmdc:mga08y16_826498_c1 3300050511 Bacteria 917
807 nmdc:mga0n895_854997_c1 3300050512 Bacteria 897
808 nmdc:mga0sz30_100127_c1 3300050516 Bacteria 1266
809 nmdc:mga0sz30_105251_c1 3300050516 Bacteria 1234
810 nmdc:mga0sz30_124159_c1 3300050516 Bacteria 1135
811 nmdc:mga0sz30_152805_c1 3300050516 Bacteria 1021
812 nmdc:mga0sz30_15412_c1 3300050516 Bacteria 3021
813 nmdc:mga0sz30_16148_c1 3300050516 Bacteria 2959
814 nmdc:mga0sz30_164083_c1 3300050516 Bacteria 984
815 nmdc:mga0sz30_252954_c1 3300050516 Bacteria 784
816 nmdc:mga0sz30_67219_c1 3300050516 Bacteria 1539
817 nmdc:mga0sz30_673_c1 3300050516 Bacteria 12605
818 nmdc:mga0sz30_9230_c1 3300050516 Bacteria 2679
819 Ga0500635_0002503 3300053080 Bacteria 4563
820 Ga0495655_0005032 3300053083 Bacteria 2307
821 Ga0500643_003428 3300053087 Bacteria 7642
822 Ga0500643_020257 3300053087 Bacteria 2178
823 Ga0500650_0068408 3300053098 Bacteria 1660
824 Ga0500562_005573 3300053108 Bacteria 3164
825 Ga0500608_095073 3300053122 Bacteria 1387
826 Ga0500642_0256270 3300053130 Bacteria 802
827 Ga0500652_009718 3300053131 Bacteria 3266
828 Ga0500652_038573 3300053131 Bacteria 1911
829 Ga0500559_0017606 3300053136 Bacteria 3018
830 Ga0500564_089895 3300053138 Bacteria 1368
831 Ga0500568_0055573 3300053139 Bacteria 1545
832 Ga0500579_239452 3300053143 Bacteria 604
833 Ga0500616_0000812 3300053153 Bacteria 35580
834 Ga0500616_0056503 3300053153 Bacteria 2048
835 Ga0500627_0028790 3300053158 Bacteria 2311
836 Ga0500636_0234518 3300053177 Unclassified 947
837 Ga0500637_0035224 3300053178 Bacteria 2805
838 Ga0500645_000075 3300053730 Bacteria 78736
839 Ga0500645_022555 3300053730 Bacteria 1935
840 Ga0466962_0004965 3300061719 Bacteria 6398
841 Ga0466962_0010269 3300061719 Bacteria 4496
842 Ga0466962_0094889 3300061719 Bacteria 1430
843 Ga0466962_0106556 3300061719 Bacteria 1348
844 Ga0466962_0275481 3300061719 Bacteria 830

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0225606 Ga0496125_0225606_761_1168 130
2 3300041503 Ga0451847_0137655 Ga0451847_0137655_289_738 148
3 iso_pu_bacteria 2929212328 2929214787 153
4 iso_pu_bacteria 2643221715 2644634964 154
5 iso_pu_bacteria 2738541264 2738667483 154
6 iso_pu_bacteria 2738541356 2739146553 154
7 iso_pu_bacteria 2902792274 2902798383 154
8 iso_pu_bacteria 2902810491 2902816980 154
9 3300050489 nmdc:mga03683_41848_c1 nmdc:mga03683_41848_c1_355_822 155
10 iso_pu_bacteria 2643221687 2644486481 155
11 iso_pu_bacteria 2902837492 2902840102 155
12 3300006038 Ga0075365_10026131 Ga0075365_100261313 156
13 3300006048 Ga0075363_100021791 Ga0075363_1000217913 156
14 3300006051 Ga0075364_10013034 Ga0075364_100130343 156
15 3300006177 Ga0075362_10090150 Ga0075362_100901503 156
16 3300006353 Ga0075370_10011857 Ga0075370_100118576 156
17 3300032126 Ga0307415_101229370 Ga0307415_1012293702 156
18 3300048903 Ga0496100_0539637 Ga0496100_0539637_225_698 156
19 3300048904 Ga0496101_0458739 Ga0496101_0458739_308_781 156
20 3300048910 Ga0496107_0319733 Ga0496107_0319733_224_697 156
21 3300048924 Ga0496121_0247368 Ga0496121_0247368_541_1014 156
22 3300050489 nmdc:mga03683_9801_c1 nmdc:mga03683_9801_c1_1896_2369 156
23 3300050492 nmdc:mga0yw44_19090_c1 nmdc:mga0yw44_19090_c1_2546_3019 156
24 3300050496 nmdc:mga07m45_10931_c1 nmdc:mga07m45_10931_c1_917_1390 156
25 iso_pu_bacteria 2523231044 2523385878 156
26 iso_pu_bacteria 2902799365 2902801644 156
27 iso_pu_bacteria 2939582691 2939587226 156
28 3300006186 Ga0075369_10004972 Ga0075369_100049723 157
29 3300047472 Ga0495686_0002522 Ga0495686_0002522_15842_16327 157
30 3300047472 Ga0495686_0034814 Ga0495686_0034814_1459_1944 157
31 3300047472 Ga0495686_0472982 Ga0495686_0472982_68_553 157
32 3300048914 Ga0496111_0004530 Ga0496111_0004530_564_1037 157
33 3300050516 nmdc:mga0sz30_15412_c1 nmdc:mga0sz30_15412_c1_1356_1829 157
34 3300053136 Ga0500559_0017606 Ga0500559_0017606_2033_2518 157
35 3300001977 JGI24746J21847_1006471 JGI24746J21847_10064713 158
36 3300001990 JGI24737J22298_10051930 JGI24737J22298_100519302 158
37 3300001990 JGI24737J22298_10110059 JGI24737J22298_101100591 158
38 3300001991 JGI24743J22301_10036835 JGI24743J22301_100368352 158
39 3300001991 JGI24743J22301_10146340 JGI24743J22301_101463401 158
40 3300002067 JGI24735J21928_10135299 JGI24735J21928_101352991 158
41 3300002075 JGI24738J21930_10010345 JGI24738J21930_100103451 158
42 3300002075 JGI24738J21930_10117783 JGI24738J21930_101177831 158
43 3300002077 JGI24744J21845_10000451 JGI24744J21845_100004519 158
44 3300002077 JGI24744J21845_10001995 JGI24744J21845_100019951 158
45 3300002239 JGI24034J26672_10003538 JGI24034J26672_100035383 158
46 3300002239 JGI24034J26672_10059429 JGI24034J26672_100594291 158
47 3300002244 JGI24742J22300_10004585 JGI24742J22300_100045852 158
48 3300002244 JGI24742J22300_10004702 JGI24742J22300_100047022 158
49 3300002459 JGI24751J29686_10007519 JGI24751J29686_100075192 158
50 3300003792 Ga0055540_1000057 Ga0055540_100005767 158
51 3300005328 Ga0070676_10027558 Ga0070676_100275582 158
52 3300005329 Ga0070683_100409140 Ga0070683_1004091402 158
53 3300005330 Ga0070690_100010167 Ga0070690_1000101675 158
54 3300005333 Ga0070677_10101975 Ga0070677_101019752 158
55 3300005335 Ga0070666_10085397 Ga0070666_100853973 158
56 3300005335 Ga0070666_10101200 Ga0070666_101012002 158
57 3300005336 Ga0070680_100357171 Ga0070680_1003571712 158
58 3300005337 Ga0070682_100022831 Ga0070682_1000228315 158
59 3300005337 Ga0070682_100043680 Ga0070682_1000436802 158
60 3300005337 Ga0070682_100927341 Ga0070682_1009273411 158
61 3300005338 Ga0068868_100000294 Ga0068868_10000029416 158
62 3300005338 Ga0068868_100132081 Ga0068868_1001320812 158
63 3300005338 Ga0068868_100480884 Ga0068868_1004808842 158
64 3300005338 Ga0068868_100501203 Ga0068868_1005012031 158
65 3300005338 Ga0068868_100548991 Ga0068868_1005489912 158
66 3300005339 Ga0070660_100555623 Ga0070660_1005556232 158
67 3300005340 Ga0070689_100040180 Ga0070689_1000401805 158
68 3300005341 Ga0070691_10016547 Ga0070691_100165475 158
69 3300005344 Ga0070661_100553276 Ga0070661_1005532762 158
70 3300005345 Ga0070692_10166620 Ga0070692_101666202 158
71 3300005347 Ga0070668_100001698 Ga0070668_1000016982 158
72 3300005347 Ga0070668_100231823 Ga0070668_1002318232 158
73 3300005353 Ga0070669_100005178 Ga0070669_1000051789 158
74 3300005353 Ga0070669_100137614 Ga0070669_1001376142 158
75 3300005355 Ga0070671_100063135 Ga0070671_1000631353 158
76 3300005365 Ga0070688_100027089 Ga0070688_1000270893 158
77 3300005366 Ga0070659_100165779 Ga0070659_1001657792 158
78 3300005367 Ga0070667_100000063 Ga0070667_100000063102 158
79 3300005367 Ga0070667_100000727 Ga0070667_10000072714 158
80 3300005367 Ga0070667_100011532 Ga0070667_1000115329 158
81 3300005367 Ga0070667_100015369 Ga0070667_1000153699 158
82 3300005367 Ga0070667_100195731 Ga0070667_1001957312 158
83 3300005406 Ga0070703_10012339 Ga0070703_100123393 158
84 3300005434 Ga0070709_10140768 Ga0070709_101407682 158
85 3300005437 Ga0070710_10005017 Ga0070710_100050176 158
86 3300005439 Ga0070711_100001192 Ga0070711_1000011922 158
87 3300005439 Ga0070711_100158578 Ga0070711_1001585782 158
88 3300005440 Ga0070705_100704170 Ga0070705_1007041702 158
89 3300005441 Ga0070700_100000463 Ga0070700_10000046311 158
90 3300005444 Ga0070694_100020285 Ga0070694_1000202854 158
91 3300005455 Ga0070663_100019917 Ga0070663_1000199172 158
92 3300005455 Ga0070663_100043359 Ga0070663_1000433593 158
93 3300005456 Ga0070678_100000347 Ga0070678_10000034717 158
94 3300005456 Ga0070678_100416041 Ga0070678_1004160411 158
95 3300005457 Ga0070662_100003014 Ga0070662_10000301410 158
96 3300005459 Ga0068867_100020639 Ga0068867_1000206392 158
97 3300005466 Ga0070685_10033819 Ga0070685_100338193 158
98 3300005539 Ga0068853_100006576 Ga0068853_1000065769 158
99 3300005543 Ga0070672_100346062 Ga0070672_1003460622 158
100 3300005544 Ga0070686_100066142 Ga0070686_1000661423 158
101 3300005544 Ga0070686_100284527 Ga0070686_1002845272 158
102 3300005546 Ga0070696_100146040 Ga0070696_1001460403 158
103 3300005548 Ga0070665_100005170 Ga0070665_1000051709 158
104 3300005548 Ga0070665_100009871 Ga0070665_1000098717 158
105 3300005548 Ga0070665_100030285 Ga0070665_1000302853 158
106 3300005548 Ga0070665_100344355 Ga0070665_1003443551 158
107 3300005549 Ga0070704_100000118 Ga0070704_10000011813 158
108 3300005563 Ga0068855_100094813 Ga0068855_1000948133 158
109 3300005563 Ga0068855_100540967 Ga0068855_1005409672 158
110 3300005578 Ga0068854_100000777 Ga0068854_1000007776 158
111 3300005615 Ga0070702_100000798 Ga0070702_1000007985 158
112 3300005615 Ga0070702_100120907 Ga0070702_1001209073 158
113 3300005617 Ga0068859_100015872 Ga0068859_1000158723 158
114 3300005617 Ga0068859_100484346 Ga0068859_1004843462 158
115 3300005618 Ga0068864_100198700 Ga0068864_1001987002 158
116 3300005718 Ga0068866_10000197 Ga0068866_1000019720 158
117 3300005718 Ga0068866_10220397 Ga0068866_102203972 158
118 3300005719 Ga0068861_100000102 Ga0068861_10000010221 158
119 3300005719 Ga0068861_100036577 Ga0068861_1000365773 158
120 3300005719 Ga0068861_100074511 Ga0068861_1000745113 158
121 3300005719 Ga0068861_101621210 Ga0068861_1016212102 158
122 3300005840 Ga0068870_10211854 Ga0068870_102118542 158
123 3300005841 Ga0068863_100000159 Ga0068863_10000015943 158
124 3300005841 Ga0068863_100155729 Ga0068863_1001557293 158
125 3300005842 Ga0068858_100146419 Ga0068858_1001464193 158
126 3300005842 Ga0068858_100691988 Ga0068858_1006919881 158
127 3300005843 Ga0068860_100000065 Ga0068860_100000065102 158
128 3300005843 Ga0068860_100079612 Ga0068860_1000796125 158
129 3300005843 Ga0068860_100199937 Ga0068860_1001999373 158
130 3300005843 Ga0068860_100466172 Ga0068860_1004661722 158
131 3300005844 Ga0068862_100000028 Ga0068862_100000028121 158
132 3300005844 Ga0068862_100013056 Ga0068862_1000130563 158
133 3300005844 Ga0068862_100101838 Ga0068862_1001018381 158
134 3300005844 Ga0068862_100490976 Ga0068862_1004909762 158
135 3300005981 Ga0081538_10255051 Ga0081538_102550511 158
136 3300006038 Ga0075365_10003536 Ga0075365_1000353611 158
137 3300006038 Ga0075365_10008557 Ga0075365_100085579 158
138 3300006038 Ga0075365_10100605 Ga0075365_101006053 158
139 3300006038 Ga0075365_10129945 Ga0075365_101299452 158
140 3300006048 Ga0075363_100002212 Ga0075363_1000022124 158
141 3300006048 Ga0075363_100004832 Ga0075363_1000048323 158
142 3300006048 Ga0075363_100005085 Ga0075363_1000050853 158
143 3300006048 Ga0075363_100019344 Ga0075363_1000193444 158
144 3300006048 Ga0075363_100032964 Ga0075363_1000329642 158
145 3300006048 Ga0075363_100044705 Ga0075363_1000447052 158
146 3300006048 Ga0075363_100091181 Ga0075363_1000911811 158
147 3300006048 Ga0075363_100204817 Ga0075363_1002048172 158
148 3300006048 Ga0075363_100210075 Ga0075363_1002100752 158
149 3300006048 Ga0075363_100233587 Ga0075363_1002335872 158
150 3300006051 Ga0075364_10002550 Ga0075364_1000255010 158
151 3300006051 Ga0075364_10004805 Ga0075364_100048058 158
152 3300006051 Ga0075364_10006029 Ga0075364_100060293 158
153 3300006051 Ga0075364_10014518 Ga0075364_100145186 158
154 3300006051 Ga0075364_10015034 Ga0075364_100150342 158
155 3300006051 Ga0075364_10016870 Ga0075364_100168703 158
156 3300006051 Ga0075364_10145845 Ga0075364_101458452 158
157 3300006051 Ga0075364_10181004 Ga0075364_101810043 158
158 3300006051 Ga0075364_10329545 Ga0075364_103295452 158
159 3300006173 Ga0070716_100000479 Ga0070716_1000004796 158
160 3300006173 Ga0070716_100002564 Ga0070716_1000025647 158
161 3300006175 Ga0070712_100000901 Ga0070712_10000090111 158
162 3300006175 Ga0070712_100181949 Ga0070712_1001819492 158
163 3300006177 Ga0075362_10003956 Ga0075362_100039566 158
164 3300006177 Ga0075362_10004236 Ga0075362_100042362 158
165 3300006177 Ga0075362_10166239 Ga0075362_101662392 158
166 3300006177 Ga0075362_10305725 Ga0075362_103057252 158
167 3300006177 Ga0075362_10366515 Ga0075362_103665151 158
168 3300006178 Ga0075367_10003365 Ga0075367_100033653 158
169 3300006178 Ga0075367_10034443 Ga0075367_100344432 158
170 3300006178 Ga0075367_10128092 Ga0075367_101280922 158
171 3300006178 Ga0075367_10151412 Ga0075367_101514122 158
172 3300006178 Ga0075367_10165823 Ga0075367_101658232 158
173 3300006178 Ga0075367_10177686 Ga0075367_101776862 158
174 3300006186 Ga0075369_10006708 Ga0075369_100067083 158
175 3300006186 Ga0075369_10015455 Ga0075369_100154553 158
176 3300006186 Ga0075369_10032363 Ga0075369_100323633 158
177 3300006186 Ga0075369_10065208 Ga0075369_100652082 158
178 3300006186 Ga0075369_10065449 Ga0075369_100654492 158
179 3300006186 Ga0075369_10123960 Ga0075369_101239602 158
180 3300006195 Ga0075366_10199966 Ga0075366_101999661 158
181 3300006353 Ga0075370_10026183 Ga0075370_100261834 158
182 3300006353 Ga0075370_10026467 Ga0075370_100264673 158
183 3300006353 Ga0075370_10094051 Ga0075370_100940512 158
184 3300006353 Ga0075370_10130388 Ga0075370_101303882 158
185 3300006353 Ga0075370_10130744 Ga0075370_101307442 158
186 3300006353 Ga0075370_10149202 Ga0075370_101492022 158
187 3300006353 Ga0075370_10188879 Ga0075370_101888792 158
188 3300006358 Ga0068871_100009689 Ga0068871_1000096893 158
189 3300006358 Ga0068871_100092764 Ga0068871_1000927642 158
190 3300006844 Ga0075428_100005745 Ga0075428_10000574510 158
191 3300006846 Ga0075430_100013678 Ga0075430_1000136786 158
192 3300006847 Ga0075431_100034823 Ga0075431_1000348233 158
193 3300006881 Ga0068865_100000554 Ga0068865_10000055411 158
194 3300006931 Ga0097620_100015873 Ga0097620_1000158733 158
195 3300006931 Ga0097620_100484339 Ga0097620_1004843392 158
196 3300009092 Ga0105250_10072232 Ga0105250_100722322 158
197 3300009094 Ga0111539_10911721 Ga0111539_109117211 158
198 3300009098 Ga0105245_10002148 Ga0105245_100021483 158
199 3300009101 Ga0105247_10000910 Ga0105247_100009105 158
200 3300009101 Ga0105247_10002035 Ga0105247_100020359 158
201 3300009101 Ga0105247_10063859 Ga0105247_100638592 158
202 3300009101 Ga0105247_10386931 Ga0105247_103869312 158
203 3300009147 Ga0114129_12644484 Ga0114129_126444841 158
204 3300009148 Ga0105243_10001698 Ga0105243_1000169814 158
205 3300009148 Ga0105243_10035777 Ga0105243_100357775 158
206 3300009148 Ga0105243_10175523 Ga0105243_101755231 158
207 3300009174 Ga0105241_10421973 Ga0105241_104219732 158
208 3300009176 Ga0105242_10001106 Ga0105242_100011063 158
209 3300009177 Ga0105248_10000074 Ga0105248_1000007493 158
210 3300009177 Ga0105248_10002067 Ga0105248_100020676 158
211 3300009177 Ga0105248_10509809 Ga0105248_105098092 158
212 3300009545 Ga0105237_10005869 Ga0105237_1000586912 158
213 3300009545 Ga0105237_10011639 Ga0105237_100116393 158
214 3300009545 Ga0105237_10015011 Ga0105237_100150118 158
215 3300009545 Ga0105237_10035962 Ga0105237_100359626 158
216 3300009545 Ga0105237_10320139 Ga0105237_103201392 158
217 3300009545 Ga0105237_11622532 Ga0105237_116225321 158
218 3300009551 Ga0105238_10127847 Ga0105238_101278473 158
219 3300009551 Ga0105238_10202962 Ga0105238_102029622 158
220 3300009551 Ga0105238_10270412 Ga0105238_102704123 158
221 3300009553 Ga0105249_10000011 Ga0105249_10000011212 158
222 3300009553 Ga0105249_10000817 Ga0105249_1000081726 158
223 3300009553 Ga0105249_10111193 Ga0105249_101111932 158
224 3300009553 Ga0105249_10627160 Ga0105249_106271602 158
225 3300010159 Ga0099796_10311501 Ga0099796_103115011 158
226 3300010375 Ga0105239_10019349 Ga0105239_100193499 158
227 3300010375 Ga0105239_10027950 Ga0105239_100279506 158
228 3300010375 Ga0105239_10201628 Ga0105239_102016282 158
229 3300010375 Ga0105239_10325781 Ga0105239_103257812 158
230 3300010375 Ga0105239_11150032 Ga0105239_111500321 158
231 3300011119 Ga0105246_10079065 Ga0105246_100790653 158
232 3300011119 Ga0105246_10244608 Ga0105246_102446082 158
233 3300011119 Ga0105246_11603379 Ga0105246_116033791 158
234 3300013100 Ga0157373_10970106 Ga0157373_109701061 158
235 3300013102 Ga0157371_10208418 Ga0157371_102084182 158
236 3300013104 Ga0157370_10483171 Ga0157370_104831712 158
237 3300013105 Ga0157369_10210083 Ga0157369_102100832 158
238 3300013296 Ga0157374_10111242 Ga0157374_101112422 158
239 3300013296 Ga0157374_10123065 Ga0157374_101230653 158
240 3300013297 Ga0157378_10069631 Ga0157378_100696315 158
241 3300013306 Ga0163162_10002629 Ga0163162_100026293 158
242 3300013306 Ga0163162_10100449 Ga0163162_101004493 158
243 3300013306 Ga0163162_10324604 Ga0163162_103246042 158
244 3300013306 Ga0163162_10821137 Ga0163162_108211372 158
245 3300013307 Ga0157372_10005992 Ga0157372_100059924 158
246 3300013307 Ga0157372_10136515 Ga0157372_101365154 158
247 3300013308 Ga0157375_10029335 Ga0157375_100293354 158
248 3300013308 Ga0157375_10626295 Ga0157375_106262952 158
249 3300014325 Ga0163163_10010435 Ga0163163_100104355 158
250 3300014325 Ga0163163_10058920 Ga0163163_100589202 158
251 3300014325 Ga0163163_10133054 Ga0163163_101330542 158
252 3300014325 Ga0163163_10227342 Ga0163163_102273423 158
253 3300014326 Ga0157380_10000237 Ga0157380_1000023719 158
254 3300014497 Ga0182008_10149930 Ga0182008_101499302 158
255 3300014745 Ga0157377_10131869 Ga0157377_101318693 158
256 3300014745 Ga0157377_10200053 Ga0157377_102000531 158
257 3300014745 Ga0157377_10776403 Ga0157377_107764031 158
258 3300014968 Ga0157379_10003146 Ga0157379_100031468 158
259 3300014968 Ga0157379_10219258 Ga0157379_102192582 158
260 3300014968 Ga0157379_10666057 Ga0157379_106660571 158
261 3300017792 Ga0163161_10012503 Ga0163161_100125032 158
262 3300017792 Ga0163161_10102152 Ga0163161_101021523 158
263 3300025303 Ga0209051_1000075 Ga0209051_100007573 158
264 3300025315 Ga0207697_10225906 Ga0207697_102259061 158
265 3300025898 Ga0207692_10000823 Ga0207692_100008236 158
266 3300025899 Ga0207642_10001812 Ga0207642_100018124 158
267 3300025900 Ga0207710_10000014 Ga0207710_1000001414 158
268 3300025900 Ga0207710_10012315 Ga0207710_100123154 158
269 3300025900 Ga0207710_10073146 Ga0207710_100731462 158
270 3300025900 Ga0207710_10116201 Ga0207710_101162012 158
271 3300025901 Ga0207688_10000631 Ga0207688_100006315 158
272 3300025901 Ga0207688_10001555 Ga0207688_1000155512 158
273 3300025903 Ga0207680_10003254 Ga0207680_100032549 158
274 3300025903 Ga0207680_10104517 Ga0207680_101045172 158
275 3300025904 Ga0207647_10102565 Ga0207647_101025652 158
276 3300025905 Ga0207685_10010762 Ga0207685_100107623 158
277 3300025906 Ga0207699_10288214 Ga0207699_102882142 158
278 3300025907 Ga0207645_10028955 Ga0207645_100289553 158
279 3300025908 Ga0207643_10254038 Ga0207643_102540382 158
280 3300025910 Ga0207684_10565264 Ga0207684_105652642 158
281 3300025912 Ga0207707_10572499 Ga0207707_105724992 158
282 3300025914 Ga0207671_10007376 Ga0207671_1000737610 158
283 3300025914 Ga0207671_10010966 Ga0207671_100109665 158
284 3300025914 Ga0207671_10023781 Ga0207671_100237813 158
285 3300025914 Ga0207671_10088863 Ga0207671_100888632 158
286 3300025915 Ga0207693_10000049 Ga0207693_1000004984 158
287 3300025915 Ga0207693_10016572 Ga0207693_100165725 158
288 3300025917 Ga0207660_10392660 Ga0207660_103926602 158
289 3300025918 Ga0207662_10173268 Ga0207662_101732682 158
290 3300025919 Ga0207657_10392050 Ga0207657_103920502 158
291 3300025923 Ga0207681_10015809 Ga0207681_100158096 158
292 3300025924 Ga0207694_10147254 Ga0207694_101472542 158
293 3300025924 Ga0207694_10333884 Ga0207694_103338842 158
294 3300025925 Ga0207650_10322380 Ga0207650_103223802 158
295 3300025927 Ga0207687_10001708 Ga0207687_1000170814 158
296 3300025927 Ga0207687_10029129 Ga0207687_100291293 158
297 3300025929 Ga0207664_10338994 Ga0207664_103389942 158
298 3300025931 Ga0207644_10078843 Ga0207644_100788434 158
299 3300025932 Ga0207690_10046133 Ga0207690_100461332 158
300 3300025933 Ga0207706_10017197 Ga0207706_100171973 158
301 3300025933 Ga0207706_10089745 Ga0207706_100897453 158
302 3300025934 Ga0207686_10006782 Ga0207686_100067823 158
303 3300025935 Ga0207709_10005064 Ga0207709_100050643 158
304 3300025936 Ga0207670_10007646 Ga0207670_100076469 158
305 3300025936 Ga0207670_11003663 Ga0207670_110036632 158
306 3300025937 Ga0207669_10060278 Ga0207669_100602782 158
307 3300025937 Ga0207669_10226851 Ga0207669_102268512 158
308 3300025938 Ga0207704_10002646 Ga0207704_100026463 158
309 3300025939 Ga0207665_10003396 Ga0207665_100033967 158
310 3300025939 Ga0207665_10006174 Ga0207665_100061743 158
311 3300025940 Ga0207691_10429306 Ga0207691_104293062 158
312 3300025941 Ga0207711_10000149 Ga0207711_1000014959 158
313 3300025941 Ga0207711_11038140 Ga0207711_110381402 158
314 3300025942 Ga0207689_10011059 Ga0207689_100110599 158
315 3300025942 Ga0207689_10149660 Ga0207689_101496602 158
316 3300025944 Ga0207661_10454513 Ga0207661_104545131 158
317 3300025949 Ga0207667_10110240 Ga0207667_101102403 158
318 3300025949 Ga0207667_10520202 Ga0207667_105202022 158
319 3300025960 Ga0207651_10729817 Ga0207651_107298171 158
320 3300025961 Ga0207712_10000020 Ga0207712_1000002068 158
321 3300025961 Ga0207712_10001309 Ga0207712_100013099 158
322 3300025961 Ga0207712_10048105 Ga0207712_100481055 158
323 3300025961 Ga0207712_10661849 Ga0207712_106618492 158
324 3300025972 Ga0207668_10004346 Ga0207668_100043466 158
325 3300025972 Ga0207668_10064977 Ga0207668_100649773 158
326 3300025972 Ga0207668_10485406 Ga0207668_104854061 158
327 3300025972 Ga0207668_10623516 Ga0207668_106235162 158
328 3300025981 Ga0207640_10035693 Ga0207640_100356933 158
329 3300025986 Ga0207658_10001359 Ga0207658_1000135911 158
330 3300025986 Ga0207658_10099915 Ga0207658_100999152 158
331 3300025986 Ga0207658_10279949 Ga0207658_102799492 158
332 3300025986 Ga0207658_10845125 Ga0207658_108451251 158
333 3300026023 Ga0207677_10002239 Ga0207677_100022396 158
334 3300026023 Ga0207677_10039731 Ga0207677_100397312 158
335 3300026023 Ga0207677_10179216 Ga0207677_101792162 158
336 3300026035 Ga0207703_10220293 Ga0207703_102202932 158
337 3300026035 Ga0207703_10608927 Ga0207703_106089272 158
338 3300026041 Ga0207639_10005576 Ga0207639_100055763 158
339 3300026041 Ga0207639_10134443 Ga0207639_101344432 158
340 3300026067 Ga0207678_10006306 Ga0207678_1000630611 158
341 3300026067 Ga0207678_10032076 Ga0207678_100320761 158
342 3300026075 Ga0207708_10000411 Ga0207708_1000041118 158
343 3300026075 Ga0207708_10011584 Ga0207708_100115845 158
344 3300026078 Ga0207702_10600534 Ga0207702_106005341 158
345 3300026088 Ga0207641_10000156 Ga0207641_1000015656 158
346 3300026088 Ga0207641_10188820 Ga0207641_101888202 158
347 3300026088 Ga0207641_10450075 Ga0207641_104500751 158
348 3300026088 Ga0207641_11664913 Ga0207641_116649131 158
349 3300026089 Ga0207648_10000187 Ga0207648_1000018746 158
350 3300026089 Ga0207648_10104857 Ga0207648_101048573 158
351 3300026118 Ga0207675_100000220 Ga0207675_10000022045 158
352 3300026118 Ga0207675_100208575 Ga0207675_1002085753 158
353 3300026121 Ga0207683_10000197 Ga0207683_1000019726 158
354 3300026121 Ga0207683_10016831 Ga0207683_100168313 158
355 3300026121 Ga0207683_10272058 Ga0207683_102720582 158
356 3300026142 Ga0207698_10037259 Ga0207698_100372593 158
357 3300026142 Ga0207698_11525706 Ga0207698_115257061 158
358 3300027866 Ga0209813_10150119 Ga0209813_101501192 158
359 3300028379 Ga0268266_10004901 Ga0268266_100049015 158
360 3300028379 Ga0268266_10007692 Ga0268266_100076927 158
361 3300028379 Ga0268266_10018751 Ga0268266_100187513 158
362 3300028379 Ga0268266_10049310 Ga0268266_100493105 158
363 3300028380 Ga0268265_10000004 Ga0268265_10000004387 158
364 3300028380 Ga0268265_10026403 Ga0268265_100264032 158
365 3300028380 Ga0268265_10319787 Ga0268265_103197872 158
366 3300028380 Ga0268265_10589825 Ga0268265_105898252 158
367 3300028381 Ga0268264_10000024 Ga0268264_10000024372 158
368 3300028381 Ga0268264_10012485 Ga0268264_100124859 158
369 3300028381 Ga0268264_10111091 Ga0268264_101110912 158
370 3300031251 Ga0265327_10002454 Ga0265327_100024543 158
371 3300031548 Ga0307408_100615059 Ga0307408_1006150592 158
372 3300031824 Ga0307413_10040624 Ga0307413_100406244 158
373 3300031824 Ga0307413_10061299 Ga0307413_100612992 158
374 3300031852 Ga0307410_11430315 Ga0307410_114303151 158
375 3300031901 Ga0307406_10756649 Ga0307406_107566492 158
376 3300031903 Ga0307407_10042758 Ga0307407_100427582 158
377 3300032002 Ga0307416_100098500 Ga0307416_1000985001 158
378 3300032002 Ga0307416_100645439 Ga0307416_1006454392 158
379 3300032004 Ga0307414_11061717 Ga0307414_110617171 158
380 3300032005 Ga0307411_10526675 Ga0307411_105266752 158
381 3300032126 Ga0307415_100016173 Ga0307415_1000161732 158
382 3300035115 Ga0373941_0024802 Ga0373941_0024802_359_835 158
383 3300035207 Ga0373942_0200302 Ga0373942_0200302_22_498 158
384 3300035242 Ga0373962_0086001 Ga0373962_0086001_89_565 158
385 3300035691 Ga0373931_0037789 Ga0373931_0037789_923_1399 158
386 3300035691 Ga0373931_0078237 Ga0373931_0078237_1200_1676 158
387 3300036401 Ga0373937_1240750 Ga0373937_1240750_175_672 158
388 3300037418 Ga0395900_0576256 Ga0395900_0576256_339_815 158
389 3300037418 Ga0395900_0856793 Ga0395900_0856793_237_713 158
390 3300037418 Ga0395900_1285241 Ga0395900_1285241_19_540 158
391 3300037853 Ga0436364_0603886 Ga0436364_0603886_11_487 158
392 3300039437 Ga0436365_0627008 Ga0436365_0627008_1328_1804 158
393 3300039450 Ga0436363_1183203 Ga0436363_1183203_706_1191 158
394 3300041410 Ga0439461_0003064 Ga0439461_0003064_1670_2146 158
395 3300041410 Ga0439461_0012317 Ga0439461_0012317_34_510 158
396 3300041411 Ga0439466_0001598 Ga0439466_0001598_3649_4125 158
397 3300041411 Ga0439466_0005159 Ga0439466_0005159_2034_2510 158
398 3300041413 Ga0439465_0002492 Ga0439465_0002492_3896_4372 158
399 3300041413 Ga0439465_0003273 Ga0439465_0003273_271_747 158
400 3300041413 Ga0439465_0010180 Ga0439465_0010180_335_811 158
401 3300041413 Ga0439465_0018576 Ga0439465_0018576_254_730 158
402 3300041413 Ga0439465_0133700 Ga0439465_0133700_254_730 158
403 3300041443 Ga0451789_0771824 Ga0451789_0771824_54_530 158
404 3300041452 Ga0451793_0034594 Ga0451793_0034594_32_508 158
405 3300041997 Ga0439431_0005723 Ga0439431_0005723_1845_2321 158
406 3300041997 Ga0439431_0035028 Ga0439431_0035028_247_723 158
407 3300042002 Ga0439442_041566 Ga0439442_041566_274_750 158
408 3300042004 Ga0439445_0008931 Ga0439445_0008931_1563_2039 158
409 3300042004 Ga0439445_0019377 Ga0439445_0019377_481_957 158
410 3300042005 Ga0439448_0149902 Ga0439448_0149902_219_695 158
411 3300042435 Ga0439434_0002444 Ga0439434_0002444_2312_2788 158
412 3300042435 Ga0439434_0027631 Ga0439434_0027631_915_1391 158
413 3300042435 Ga0439434_0086834 Ga0439434_0086834_114_590 158
414 3300042436 Ga0439435_0130772 Ga0439435_0130772_137_613 158
415 3300044656 Ga0466969_0003541 Ga0466969_0003541_198_704 158
416 3300044658 Ga0466972_0007528 Ga0466972_0007528_3937_4443 158
417 3300044658 Ga0466972_0008245 Ga0466972_0008245_1552_2028 158
418 3300044658 Ga0466972_0026588 Ga0466972_0026588_256_732 158
419 3300044658 Ga0466972_0055758 Ga0466972_0055758_1059_1535 158
420 3300044658 Ga0466972_0101894 Ga0466972_0101894_850_1326 158
421 3300044658 Ga0466972_0237777 Ga0466972_0237777_92_568 158
422 3300044683 Ga0466965_0001448 Ga0466965_0001448_8612_9088 158
423 3300044683 Ga0466965_0003649 Ga0466965_0003649_2137_2613 158
424 3300044683 Ga0466965_0109211 Ga0466965_0109211_755_1231 158
425 3300044684 Ga0466966_0004633 Ga0466966_0004633_7022_7528 158
426 3300044684 Ga0466966_0180851 Ga0466966_0180851_77_553 158
427 3300044693 Ga0466961_0009146 Ga0466961_0009146_2592_3068 158
428 3300044706 Ga0466964_0001519 Ga0466964_0001519_7055_7561 158
429 3300044706 Ga0466964_0084611 Ga0466964_0084611_127_603 158
430 3300044719 Ga0466971_0002606 Ga0466971_0002606_2037_2513 158
431 3300044735 Ga0466968_0001533 Ga0466968_0001533_7657_8163 158
432 3300044735 Ga0466968_0001712 Ga0466968_0001712_5841_6317 158
433 3300044735 Ga0466968_0028015 Ga0466968_0028015_27_503 158
434 3300044735 Ga0466968_0538556 Ga0466968_0538556_91_567 158
435 3300044765 Ga0466970_0002905 Ga0466970_0002905_138_644 158
436 3300044765 Ga0466970_0011881 Ga0466970_0011881_1598_2074 158
437 3300044765 Ga0466970_0019593 Ga0466970_0019593_984_1460 158
438 3300044765 Ga0466970_0280708 Ga0466970_0280708_435_911 158
439 3300044842 Ga0466957_0011226 Ga0466957_0011226_830_1306 158
440 3300044842 Ga0466957_0020925 Ga0466957_0020925_1614_2090 158
441 3300044901 Ga0466960_0000116 Ga0466960_0000116_19978_20454 158
442 3300044901 Ga0466960_0000837 Ga0466960_0000837_8256_8732 158
443 3300045049 Ga0466959_0006180 Ga0466959_0006180_138_644 158
444 3300045049 Ga0466959_0050309 Ga0466959_0050309_2521_2997 158
445 3300045049 Ga0466959_0053451 Ga0466959_0053451_2100_2576 158
446 3300045836 Ga0466958_0021510 Ga0466958_0021510_631_1107 158
447 3300045836 Ga0466958_0657361 Ga0466958_0657361_81_557 158
448 3300045976 Ga0466967_0002885 Ga0466967_0002885_7890_8366 158
449 3300045976 Ga0466967_0003298 Ga0466967_0003298_4399_4875 158
450 3300045976 Ga0466967_0044271 Ga0466967_0044271_119_595 158
451 3300045976 Ga0466967_0841830 Ga0466967_0841830_56_532 158
452 3300046507 Ga0495606_0010471 Ga0495606_0010471_4572_5048 158
453 3300046524 Ga0495648_0001720 Ga0495648_0001720_4606_5082 158
454 3300046663 Ga0495635_0878669 Ga0495635_0878669_58_534 158
455 3300046692 Ga0495671_0106388 Ga0495671_0106388_754_1230 158
456 3300047319 Ga0495674_0723527 Ga0495674_0723527_104_580 158
457 3300047320 Ga0495672_0006563 Ga0495672_0006563_1868_2344 158
458 3300047445 Ga0495677_0317379 Ga0495677_0317379_26_502 158
459 3300047469 Ga0495673_0000355 Ga0495673_0000355_570_1046 158
460 3300048903 Ga0496100_0000009 Ga0496100_0000009_78577_79053 158
461 3300048903 Ga0496100_0000531 Ga0496100_0000531_10846_11322 158
462 3300048903 Ga0496100_0013488 Ga0496100_0013488_1926_2402 158
463 3300048903 Ga0496100_0033050 Ga0496100_0033050_2566_3042 158
464 3300048904 Ga0496101_0000018 Ga0496101_0000018_140318_140794 158
465 3300048904 Ga0496101_0000102 Ga0496101_0000102_70469_70945 158
466 3300048904 Ga0496101_0002584 Ga0496101_0002584_6744_7220 158
467 3300048904 Ga0496101_0048871 Ga0496101_0048871_530_1006 158
468 3300048904 Ga0496101_0478661 Ga0496101_0478661_331_807 158
469 3300048905 Ga0496102_0000037 Ga0496102_0000037_17875_18351 158
470 3300048905 Ga0496102_0000780 Ga0496102_0000780_12900_13376 158
471 3300048905 Ga0496102_0001336 Ga0496102_0001336_16782_17258 158
472 3300048905 Ga0496102_0116111 Ga0496102_0116111_267_743 158
473 3300048905 Ga0496102_0142321 Ga0496102_0142321_1643_2119 158
474 3300048905 Ga0496102_0801092 Ga0496102_0801092_94_573 158
475 3300048905 Ga0496102_1233731 Ga0496102_1233731_115_591 158
476 3300048906 Ga0496103_0000004 Ga0496103_0000004_328587_329063 158
477 3300048906 Ga0496103_0001409 Ga0496103_0001409_12116_12592 158
478 3300048906 Ga0496103_0001995 Ga0496103_0001995_3843_4319 158
479 3300048906 Ga0496103_0018136 Ga0496103_0018136_680_1156 158
480 3300048906 Ga0496103_0397004 Ga0496103_0397004_176_652 158
481 3300048907 Ga0496104_0019767 Ga0496104_0019767_653_1129 158
482 3300048908 Ga0496105_0117376 Ga0496105_0117376_1125_1601 158
483 3300048908 Ga0496105_0153063 Ga0496105_0153063_1046_1522 158
484 3300048908 Ga0496105_0188632 Ga0496105_0188632_423_899 158
485 3300048909 Ga0496106_0004574 Ga0496106_0004574_5926_6402 158
486 3300048909 Ga0496106_0005826 Ga0496106_0005826_3990_4466 158
487 3300048909 Ga0496106_0012852 Ga0496106_0012852_584_1060 158
488 3300048909 Ga0496106_0052159 Ga0496106_0052159_2376_2852 158
489 3300048909 Ga0496106_0197032 Ga0496106_0197032_257_733 158
490 3300048910 Ga0496107_0000511 Ga0496107_0000511_8983_9459 158
491 3300048910 Ga0496107_0004059 Ga0496107_0004059_4013_4489 158
492 3300048910 Ga0496107_0011387 Ga0496107_0011387_997_1473 158
493 3300048911 Ga0496108_0001088 Ga0496108_0001088_11651_12127 158
494 3300048911 Ga0496108_0002904 Ga0496108_0002904_13217_13693 158
495 3300048911 Ga0496108_0337249 Ga0496108_0337249_257_733 158
496 3300048911 Ga0496108_0929573 Ga0496108_0929573_46_522 158
497 3300048912 Ga0496109_0000136 Ga0496109_0000136_17297_17773 158
498 3300048912 Ga0496109_0011714 Ga0496109_0011714_6231_6707 158
499 3300048912 Ga0496109_0012517 Ga0496109_0012517_4982_5458 158
500 3300048912 Ga0496109_0199615 Ga0496109_0199615_530_1006 158
501 3300048912 Ga0496109_1353856 Ga0496109_1353856_51_527 158
502 3300048913 Ga0496110_0001780 Ga0496110_0001780_7942_8418 158
503 3300048913 Ga0496110_0012200 Ga0496110_0012200_6033_6509 158
504 3300048913 Ga0496110_0150718 Ga0496110_0150718_74_550 158
505 3300048913 Ga0496110_0245040 Ga0496110_0245040_1109_1585 158
506 3300048914 Ga0496111_0421597 Ga0496111_0421597_252_728 158
507 3300048915 Ga0496112_0006921 Ga0496112_0006921_598_1074 158
508 3300048915 Ga0496112_0021424 Ga0496112_0021424_4154_4630 158
509 3300048915 Ga0496112_0067479 Ga0496112_0067479_2005_2481 158
510 3300048915 Ga0496112_0201511 Ga0496112_0201511_1432_1908 158
511 3300048916 Ga0496113_0002072 Ga0496113_0002072_321_797 158
512 3300048916 Ga0496113_0014387 Ga0496113_0014387_4841_5317 158
513 3300048916 Ga0496113_0060141 Ga0496113_0060141_99_575 158
514 3300048916 Ga0496113_0547449 Ga0496113_0547449_266_742 158
515 3300048916 Ga0496113_1048555 Ga0496113_1048555_46_522 158
516 3300048917 Ga0496114_0000108 Ga0496114_0000108_25680_26156 158
517 3300048917 Ga0496114_0018416 Ga0496114_0018416_596_1072 158
518 3300048917 Ga0496114_0650347 Ga0496114_0650347_277_753 158
519 3300048917 Ga0496114_0856495 Ga0496114_0856495_79_558 158
520 3300048918 Ga0496115_0003184 Ga0496115_0003184_3510_3986 158
521 3300048918 Ga0496115_0043674 Ga0496115_0043674_2538_3014 158
522 3300048918 Ga0496115_0898779 Ga0496115_0898779_77_553 158
523 3300048919 Ga0496116_0000276 Ga0496116_0000276_17849_18325 158
524 3300048919 Ga0496116_0002633 Ga0496116_0002633_4496_4972 158
525 3300048920 Ga0496117_0000003 Ga0496117_0000003_1526990_1527466 158
526 3300048920 Ga0496117_0001267 Ga0496117_0001267_1897_2373 158
527 3300048921 Ga0496118_0000001 Ga0496118_0000001_1526993_1527469 158
528 3300048921 Ga0496118_0000275 Ga0496118_0000275_84821_85297 158
529 3300048921 Ga0496118_0011629 Ga0496118_0011629_6645_7121 158
530 3300048921 Ga0496118_0328393 Ga0496118_0328393_31_507 158
531 3300048922 Ga0496119_0005085 Ga0496119_0005085_10609_11085 158
532 3300048922 Ga0496119_0006894 Ga0496119_0006894_5250_5726 158
533 3300048922 Ga0496119_0011468 Ga0496119_0011468_5525_6001 158
534 3300048922 Ga0496119_0197251 Ga0496119_0197251_414_890 158
535 3300048923 Ga0496120_0017069 Ga0496120_0017069_567_1043 158
536 3300048923 Ga0496120_0030665 Ga0496120_0030665_218_694 158
537 3300048924 Ga0496121_0000023 Ga0496121_0000023_312711_313187 158
538 3300048924 Ga0496121_0000338 Ga0496121_0000338_26759_27235 158
539 3300048924 Ga0496121_0016981 Ga0496121_0016981_592_1068 158
540 3300048925 Ga0496122_0000164 Ga0496122_0000164_17048_17524 158
541 3300048925 Ga0496122_0024719 Ga0496122_0024719_2236_2712 158
542 3300048926 Ga0496123_0004915 Ga0496123_0004915_1791_2267 158
543 3300048926 Ga0496123_0024513 Ga0496123_0024513_1677_2153 158
544 3300048927 Ga0496124_0000014 Ga0496124_0000014_312711_313187 158
545 3300048927 Ga0496124_0086213 Ga0496124_0086213_1712_2188 158
546 3300048928 Ga0496125_0000020 Ga0496125_0000020_150262_150738 158
547 3300048928 Ga0496125_0006797 Ga0496125_0006797_3830_4306 158
548 3300048929 Ga0496126_0000023 Ga0496126_0000023_312711_313187 158
549 3300048929 Ga0496126_0000551 Ga0496126_0000551_403_879 158
550 3300048929 Ga0496126_0009407 Ga0496126_0009407_6225_6701 158
551 3300048929 Ga0496126_0470687 Ga0496126_0470687_298_774 158
552 3300049571 Ga0501034_0064818 Ga0501034_0064818_2417_2893 158
553 3300049571 Ga0501034_0351996 Ga0501034_0351996_173_649 158
554 3300049571 Ga0501034_0527795 Ga0501034_0527795_438_914 158
555 3300049581 Ga0501047_0065052 Ga0501047_0065052_2618_3094 158
556 3300049581 Ga0501047_0291716 Ga0501047_0291716_327_803 158
557 3300049586 Ga0501070_0081466 Ga0501070_0081466_1438_1914 158
558 3300049586 Ga0501070_0364218 Ga0501070_0364218_110_586 158
559 3300049742 Ga0501080_0190895 Ga0501080_0190895_699_1175 158
560 3300050489 nmdc:mga03683_192912_c1 nmdc:mga03683_192912_c1_265_774 158
561 3300050489 nmdc:mga03683_5371_c1 nmdc:mga03683_5371_c1_3533_4009 158
562 3300050490 nmdc:mga03n38_1868_c1 nmdc:mga03n38_1868_c1_2120_2596 158
563 3300050490 nmdc:mga03n38_230170_c1 nmdc:mga03n38_230170_c1_269_745 158
564 3300050490 nmdc:mga03n38_25775_c1 nmdc:mga03n38_25775_c1_247_723 158
565 3300050490 nmdc:mga03n38_27304_c1 nmdc:mga03n38_27304_c1_781_1257 158
566 3300050490 nmdc:mga03n38_355751_c1 nmdc:mga03n38_355751_c1_292_768 158
567 3300050490 nmdc:mga03n38_373627_c1 nmdc:mga03n38_373627_c1_247_723 158
568 3300050490 nmdc:mga03n38_39244_c1 nmdc:mga03n38_39244_c1_1114_1590 158
569 3300050490 nmdc:mga03n38_408364_c1 nmdc:mga03n38_408364_c1_243_719 158
570 3300050490 nmdc:mga03n38_66281_c1 nmdc:mga03n38_66281_c1_1163_1639 158
571 3300050491 nmdc:mga00v17_10660_c1 nmdc:mga00v17_10660_c1_4452_4961 158
572 3300050491 nmdc:mga00v17_10941_c1 nmdc:mga00v17_10941_c1_902_1378 158
573 3300050491 nmdc:mga00v17_16207_c1 nmdc:mga00v17_16207_c1_3492_3968 158
574 3300050491 nmdc:mga00v17_207732_c1 nmdc:mga00v17_207732_c1_613_1089 158
575 3300050491 nmdc:mga00v17_2499_c1 nmdc:mga00v17_2499_c1_3297_3773 158
576 3300050491 nmdc:mga00v17_278811_c1 nmdc:mga00v17_278811_c1_167_643 158
577 3300050491 nmdc:mga00v17_309560_c1 nmdc:mga00v17_309560_c1_69_545 158
578 3300050491 nmdc:mga00v17_38824_c1 nmdc:mga00v17_38824_c1_1478_1954 158
579 3300050491 nmdc:mga00v17_480685_c1 nmdc:mga00v17_480685_c1_67_543 158
580 3300050491 nmdc:mga00v17_58638_c1 nmdc:mga00v17_58638_c1_1100_1576 158
581 3300050491 nmdc:mga00v17_60308_c1 nmdc:mga00v17_60308_c1_867_1343 158
582 3300050491 nmdc:mga00v17_7042_c1 nmdc:mga00v17_7042_c1_1570_2046 158
583 3300050492 nmdc:mga0yw44_1866_c1 nmdc:mga0yw44_1866_c1_6335_6811 158
584 3300050492 nmdc:mga0yw44_248080_c1 nmdc:mga0yw44_248080_c1_21_497 158
585 3300050492 nmdc:mga0yw44_257710_c1 nmdc:mga0yw44_257710_c1_96_572 158
586 3300050492 nmdc:mga0yw44_7852_c1 nmdc:mga0yw44_7852_c1_2088_2564 158
587 3300050493 nmdc:mga0k408_69490_c1 nmdc:mga0k408_69490_c1_415_891 158
588 3300050494 nmdc:mga06z11_113785_c1 nmdc:mga06z11_113785_c1_854_1330 158
589 3300050494 nmdc:mga06z11_119025_c1 nmdc:mga06z11_119025_c1_93_569 158
590 3300050494 nmdc:mga06z11_14437_c1 nmdc:mga06z11_14437_c1_2668_3144 158
591 3300050494 nmdc:mga06z11_154550_c1 nmdc:mga06z11_154550_c1_615_1124 158
592 3300050494 nmdc:mga06z11_234929_c1 nmdc:mga06z11_234929_c1_449_925 158
593 3300050494 nmdc:mga06z11_266431_c1 nmdc:mga06z11_266431_c1_520_996 158
594 3300050494 nmdc:mga06z11_401601_c1 nmdc:mga06z11_401601_c1_56_532 158
595 3300050495 nmdc:mga04h51_184483_c1 nmdc:mga04h51_184483_c1_241_717 158
596 3300050496 nmdc:mga07m45_110902_c1 nmdc:mga07m45_110902_c1_854_1330 158
597 3300050496 nmdc:mga07m45_112251_c1 nmdc:mga07m45_112251_c1_356_832 158
598 3300050496 nmdc:mga07m45_146232_c1 nmdc:mga07m45_146232_c1_266_742 158
599 3300050496 nmdc:mga07m45_204901_c1 nmdc:mga07m45_204901_c1_612_1088 158
600 3300050496 nmdc:mga07m45_25465_c1 nmdc:mga07m45_25465_c1_1762_2238 158
601 3300050496 nmdc:mga07m45_43584_c1 nmdc:mga07m45_43584_c1_302_778 158
602 3300050496 nmdc:mga07m45_68888_c1 nmdc:mga07m45_68888_c1_1146_1622 158
603 3300050496 nmdc:mga07m45_7339_c1 nmdc:mga07m45_7339_c1_4359_4835 158
604 3300050507 nmdc:mga05p37_27189_c1 nmdc:mga05p37_27189_c1_1555_2031 158
605 3300050508 nmdc:mga09592_288422_c1 nmdc:mga09592_288422_c1_649_1125 158
606 3300050509 nmdc:mga0qj67_66076_c1 nmdc:mga0qj67_66076_c1_1420_1896 158
607 3300050509 nmdc:mga0qj67_7908_c1 nmdc:mga0qj67_7908_c1_6419_6895 158
608 3300050510 nmdc:mga06r32_18218_c1 nmdc:mga06r32_18218_c1_3860_4336 158
609 3300050511 nmdc:mga08y16_826498_c1 nmdc:mga08y16_826498_c1_400_876 158
610 3300050512 nmdc:mga0n895_854997_c1 nmdc:mga0n895_854997_c1_405_881 158
611 3300050516 nmdc:mga0sz30_105251_c1 nmdc:mga0sz30_105251_c1_490_966 158
612 3300050516 nmdc:mga0sz30_124159_c1 nmdc:mga0sz30_124159_c1_212_688 158
613 3300050516 nmdc:mga0sz30_152805_c1 nmdc:mga0sz30_152805_c1_458_934 158
614 3300050516 nmdc:mga0sz30_164083_c1 nmdc:mga0sz30_164083_c1_187_663 158
615 3300050516 nmdc:mga0sz30_252954_c1 nmdc:mga0sz30_252954_c1_222_698 158
616 3300050516 nmdc:mga0sz30_673_c1 nmdc:mga0sz30_673_c1_3991_4467 158
617 3300050516 nmdc:mga0sz30_9230_c1 nmdc:mga0sz30_9230_c1_881_1357 158
618 3300053083 Ga0495655_0005032 Ga0495655_0005032_1366_1842 158
619 3300053087 Ga0500643_003428 Ga0500643_003428_2365_2841 158
620 3300053130 Ga0500642_0256270 Ga0500642_0256270_110_586 158
621 3300053138 Ga0500564_089895 Ga0500564_089895_340_816 158
622 3300053153 Ga0500616_0056503 Ga0500616_0056503_122_598 158
623 3300053177 Ga0500636_0234518 Ga0500636_0234518_339_845 158
624 3300053178 Ga0500637_0035224 Ga0500637_0035224_1143_1649 158
625 3300061719 Ga0466962_0010269 Ga0466962_0010269_114_590 158
626 3300061719 Ga0466962_0094889 Ga0466962_0094889_803_1309 158
627 3300003792 Ga0055540_1009975 Ga0055540_10099753 159
628 3300003792 Ga0055540_1012396 Ga0055540_10123963 159
629 3300005335 Ga0070666_10734241 Ga0070666_107342411 159
630 3300005455 Ga0070663_100097225 Ga0070663_1000972253 159
631 3300005539 Ga0068853_100132561 Ga0068853_1001325612 159
632 3300005548 Ga0070665_100297289 Ga0070665_1002972892 159
633 3300006177 Ga0075362_10010735 Ga0075362_100107352 159
634 3300006186 Ga0075369_10012781 Ga0075369_100127813 159
635 3300006186 Ga0075369_10042231 Ga0075369_100422312 159
636 3300021377 Ga0213874_10049667 Ga0213874_100496671 159
637 3300021384 Ga0213876_10006163 Ga0213876_100061633 159
638 3300021384 Ga0213876_10016750 Ga0213876_100167503 159
639 3300021388 Ga0213875_10027324 Ga0213875_100273243 159
640 3300021388 Ga0213875_10107486 Ga0213875_101074862 159
641 3300025273 Ga0209673_1050254 Ga0209673_10502542 159
642 3300025303 Ga0209051_1002890 Ga0209051_10028907 159
643 3300025303 Ga0209051_1004789 Ga0209051_10047898 159
644 3300025303 Ga0209051_1004816 Ga0209051_10048167 159
645 3300025929 Ga0207664_11011005 Ga0207664_110110051 159
646 3300026041 Ga0207639_10105934 Ga0207639_101059344 159
647 3300026075 Ga0207708_10646042 Ga0207708_106460422 159
648 3300026121 Ga0207683_11630363 Ga0207683_116303631 159
649 3300037853 Ga0436364_0126449 Ga0436364_0126449_3133_3612 159
650 3300037853 Ga0436364_0950685 Ga0436364_0950685_8189_8668 159
651 3300039437 Ga0436365_0059246 Ga0436365_0059246_922_1401 159
652 3300039437 Ga0436365_1276831 Ga0436365_1276831_11299_11778 159
653 3300039447 Ga0436361_0363522 Ga0436361_0363522_77_556 159
654 3300039450 Ga0436363_0198696 Ga0436363_0198696_815_1294 159
655 3300039450 Ga0436363_0598107 Ga0436363_0598107_623_1102 159
656 3300041441 Ga0451787_735807 Ga0451787_735807_481_960 159
657 3300044719 Ga0466971_0012348 Ga0466971_0012348_1400_1879 159
658 3300044842 Ga0466957_0458622 Ga0466957_0458622_68_547 159
659 3300045836 Ga0466958_0112916 Ga0466958_0112916_105_584 159
660 3300046460 Ga0495638_0037001 Ga0495638_0037001_2179_2658 159
661 3300046471 Ga0495650_0193701 Ga0495650_0193701_197_676 159
662 3300046491 Ga0495584_0318994 Ga0495584_0318994_248_745 159
663 3300047320 Ga0495672_0055873 Ga0495672_0055873_1170_1649 159
664 3300047472 Ga0495686_0011027 Ga0495686_0011027_3142_3621 159
665 3300048903 Ga0496100_0280561 Ga0496100_0280561_729_1208 159
666 3300048904 Ga0496101_0257671 Ga0496101_0257671_576_1055 159
667 3300048905 Ga0496102_0127375 Ga0496102_0127375_93_572 159
668 3300048910 Ga0496107_0824527 Ga0496107_0824527_155_634 159
669 3300048917 Ga0496114_0024842 Ga0496114_0024842_2960_3439 159
670 3300048917 Ga0496114_0341192 Ga0496114_0341192_552_1031 159
671 3300048924 Ga0496121_0135536 Ga0496121_0135536_354_833 159
672 3300048924 Ga0496121_0350796 Ga0496121_0350796_174_653 159
673 3300048927 Ga0496124_0673315 Ga0496124_0673315_73_552 159
674 3300048929 Ga0496126_0048638 Ga0496126_0048638_2200_2679 159
675 3300049570 Ga0501033_0024106 Ga0501033_0024106_270_749 159
676 3300049571 Ga0501034_0001642 Ga0501034_0001642_8896_9375 159
677 3300049572 Ga0501036_0016199 Ga0501036_0016199_1765_2244 159
678 3300049573 Ga0501037_0003861 Ga0501037_0003861_6121_6600 159
679 3300049574 Ga0501038_0001528 Ga0501038_0001528_14499_14978 159
680 3300049575 Ga0501039_0000288 Ga0501039_0000288_19612_20091 159
681 3300049576 Ga0501040_0888284 Ga0501040_0888284_41_520 159
682 3300049579 Ga0501043_0000411 Ga0501043_0000411_11659_12138 159
683 3300049581 Ga0501047_0352859 Ga0501047_0352859_660_1139 159
684 3300049586 Ga0501070_0000614 Ga0501070_0000614_26289_26768 159
685 3300049589 Ga0501073_0209524 Ga0501073_0209524_858_1337 159
686 3300049593 Ga0501077_0418646 Ga0501077_0418646_361_840 159
687 3300049822 Ga0501035_0000344 Ga0501035_0000344_43946_44425 159
688 3300049823 Ga0501044_0011255 Ga0501044_0011255_5158_5637 159
689 3300049823 Ga0501044_0088632 Ga0501044_0088632_1268_1747 159
690 3300050491 nmdc:mga00v17_117922_c1 nmdc:mga00v17_117922_c1_26_505 159
691 3300050516 nmdc:mga0sz30_16148_c1 nmdc:mga0sz30_16148_c1_1191_1670 159
692 3300053087 Ga0500643_020257 Ga0500643_020257_1557_2036 159
693 3300053098 Ga0500650_0068408 Ga0500650_0068408_568_1047 159
694 3300053122 Ga0500608_095073 Ga0500608_095073_384_863 159
695 3300053131 Ga0500652_038573 Ga0500652_038573_1104_1583 159
696 3300053158 Ga0500627_0028790 Ga0500627_0028790_924_1403 159
697 3300053730 Ga0500645_000075 Ga0500645_000075_71062_71541 159
698 3300053730 Ga0500645_022555 Ga0500645_022555_1064_1543 159
699 3300061719 Ga0466962_0004965 Ga0466962_0004965_5587_6066 159
700 3300000546 LJNas_1008764 LJNas_10087642 160
701 3300005336 Ga0070680_100751093 Ga0070680_1007510931 160
702 3300005337 Ga0070682_100554184 Ga0070682_1005541841 160
703 3300005356 Ga0070674_100041075 Ga0070674_1000410752 160
704 3300005367 Ga0070667_101214548 Ga0070667_1012145481 160
705 3300005435 Ga0070714_100097251 Ga0070714_1000972512 160
706 3300005436 Ga0070713_100566240 Ga0070713_1005662401 160
707 3300005439 Ga0070711_100421292 Ga0070711_1004212921 160
708 3300005549 Ga0070704_101203667 Ga0070704_1012036671 160
709 3300005615 Ga0070702_100289450 Ga0070702_1002894502 160
710 3300005718 Ga0068866_10261167 Ga0068866_102611672 160
711 3300005937 Ga0081455_10014375 Ga0081455_100143753 160
712 3300006038 Ga0075365_10010928 Ga0075365_100109282 160
713 3300006038 Ga0075365_10105792 Ga0075365_101057922 160
714 3300006038 Ga0075365_10126464 Ga0075365_101264643 160
715 3300006038 Ga0075365_10166525 Ga0075365_101665253 160
716 3300006038 Ga0075365_10363502 Ga0075365_103635022 160
717 3300006048 Ga0075363_100005618 Ga0075363_1000056183 160
718 3300006048 Ga0075363_100010328 Ga0075363_1000103284 160
719 3300006048 Ga0075363_100159307 Ga0075363_1001593072 160
720 3300006051 Ga0075364_10014806 Ga0075364_100148063 160
721 3300006051 Ga0075364_10163663 Ga0075364_101636632 160
722 3300006051 Ga0075364_10685275 Ga0075364_106852751 160
723 3300006175 Ga0070712_100376545 Ga0070712_1003765452 160
724 3300006175 Ga0070712_100936741 Ga0070712_1009367411 160
725 3300006177 Ga0075362_10047877 Ga0075362_100478772 160
726 3300006178 Ga0075367_10152586 Ga0075367_101525862 160
727 3300006186 Ga0075369_10056562 Ga0075369_100565623 160
728 3300006237 Ga0097621_100931576 Ga0097621_1009315762 160
729 3300006353 Ga0075370_10105139 Ga0075370_101051392 160
730 3300006881 Ga0068865_100646743 Ga0068865_1006467432 160
731 3300009176 Ga0105242_10264733 Ga0105242_102647331 160
732 3300009177 Ga0105248_11170510 Ga0105248_111705102 160
733 3300011119 Ga0105246_11072455 Ga0105246_110724551 160
734 3300012487 Ga0157321_1022979 Ga0157321_10229791 160
735 3300013105 Ga0157369_10290187 Ga0157369_102901872 160
736 3300013105 Ga0157369_10423540 Ga0157369_104235402 160
737 3300013308 Ga0157375_11311887 Ga0157375_113118871 160
738 3300014968 Ga0157379_10205600 Ga0157379_102056002 160
739 3300014968 Ga0157379_11300996 Ga0157379_113009961 160
740 3300014969 Ga0157376_10283778 Ga0157376_102837781 160
741 3300025261 Ga0209233_1019362 Ga0209233_10193622 160
742 3300025904 Ga0207647_10309263 Ga0207647_103092632 160
743 3300025915 Ga0207693_10508662 Ga0207693_105086622 160
744 3300025915 Ga0207693_10734168 Ga0207693_107341681 160
745 3300025916 Ga0207663_10675056 Ga0207663_106750562 160
746 3300025928 Ga0207700_10262229 Ga0207700_102622292 160
747 3300025937 Ga0207669_10075584 Ga0207669_100755842 160
748 3300025938 Ga0207704_10589610 Ga0207704_105896101 160
749 3300025939 Ga0207665_10410131 Ga0207665_104101312 160
750 3300027866 Ga0209813_10005913 Ga0209813_100059134 160
751 3300028381 Ga0268264_11174025 Ga0268264_111740251 160
752 3300031995 Ga0307409_100292982 Ga0307409_1002929822 160
753 3300035121 Ga0373960_0022712 Ga0373960_0022712_450_935 160
754 3300036712 Ga0316584_0454039 Ga0316584_0454039_178_663 160
755 3300039437 Ga0436365_1413714 Ga0436365_1413714_24_506 160
756 3300039438 Ga0436360_0562690 Ga0436360_0562690_266_748 160
757 3300039450 Ga0436363_0082189 Ga0436363_0082189_274_756 160
758 3300039450 Ga0436363_0160340 Ga0436363_0160340_32_517 160
759 3300041498 Ga0451841_0612220 Ga0451841_0612220_1006_1491 160
760 3300044656 Ga0466969_0110240 Ga0466969_0110240_168_653 160
761 3300044683 Ga0466965_0060406 Ga0466965_0060406_728_1213 160
762 3300044683 Ga0466965_0381991 Ga0466965_0381991_191_679 160
763 3300044684 Ga0466966_0009501 Ga0466966_0009501_800_1285 160
764 3300044684 Ga0466966_0445789 Ga0466966_0445789_74_562 160
765 3300044693 Ga0466961_0180376 Ga0466961_0180376_91_579 160
766 3300044735 Ga0466968_0002050 Ga0466968_0002050_276_764 160
767 3300044765 Ga0466970_0055259 Ga0466970_0055259_1152_1640 160
768 3300044842 Ga0466957_0001674 Ga0466957_0001674_5946_6431 160
769 3300044842 Ga0466957_0056145 Ga0466957_0056145_1583_2143 160
770 3300044842 Ga0466957_0539263 Ga0466957_0539263_55_537 160
771 3300044901 Ga0466960_0143415 Ga0466960_0143415_367_927 160
772 3300045049 Ga0466959_0007885 Ga0466959_0007885_4940_5425 160
773 3300045836 Ga0466958_0002368 Ga0466958_0002368_6405_6890 160
774 3300045836 Ga0466958_0017360 Ga0466958_0017360_3419_3901 160
775 3300045836 Ga0466958_0765419 Ga0466958_0765419_81_563 160
776 3300045836 Ga0466958_0847942 Ga0466958_0847942_62_544 160
777 3300045976 Ga0466967_0021171 Ga0466967_0021171_1789_2313 160
778 3300045976 Ga0466967_0030203 Ga0466967_0030203_3672_4232 160
779 3300045976 Ga0466967_0473321 Ga0466967_0473321_703_1185 160
780 3300046459 Ga0495629_0015508 Ga0495629_0015508_1852_2337 160
781 3300046461 Ga0495641_0005534 Ga0495641_0005534_6835_7320 160
782 3300046473 Ga0495582_0059652 Ga0495582_0059652_1460_1945 160
783 3300046475 Ga0495639_0031878 Ga0495639_0031878_586_1071 160
784 3300046511 Ga0495608_0361087 Ga0495608_0361087_86_571 160
785 3300046533 Ga0495640_0122927 Ga0495640_0122927_1046_1531 160
786 3300047472 Ga0495686_0365391 Ga0495686_0365391_79_561 160
787 3300048903 Ga0496100_0006888 Ga0496100_0006888_3580_4062 160
788 3300048904 Ga0496101_0000432 Ga0496101_0000432_16522_17004 160
789 3300048905 Ga0496102_0035693 Ga0496102_0035693_586_1068 160
790 3300048906 Ga0496103_0264594 Ga0496103_0264594_413_895 160
791 3300048907 Ga0496104_0022028 Ga0496104_0022028_1306_1788 160
792 3300048908 Ga0496105_0300130 Ga0496105_0300130_427_909 160
793 3300048909 Ga0496106_0004861 Ga0496106_0004861_3590_4072 160
794 3300048909 Ga0496106_0621694 Ga0496106_0621694_268_777 160
795 3300048909 Ga0496106_0634410 Ga0496106_0634410_193_678 160
796 3300048909 Ga0496106_1339127 Ga0496106_1339127_50_535 160
797 3300048910 Ga0496107_0014747 Ga0496107_0014747_2819_3301 160
798 3300048911 Ga0496108_0188733 Ga0496108_0188733_396_878 160
799 3300048917 Ga0496114_0015915 Ga0496114_0015915_5233_5715 160
800 3300048918 Ga0496115_0081580 Ga0496115_0081580_1827_2309 160
801 3300048918 Ga0496115_0185350 Ga0496115_0185350_1187_1696 160
802 3300048920 Ga0496117_0054979 Ga0496117_0054979_2004_2486 160
803 3300048921 Ga0496118_0000292 Ga0496118_0000292_70869_71351 160
804 3300048923 Ga0496120_0098986 Ga0496120_0098986_847_1332 160
805 3300048929 Ga0496126_0336025 Ga0496126_0336025_213_698 160
806 3300049569 Ga0501032_0002086 Ga0501032_0002086_7809_8291 160
807 3300049570 Ga0501033_0011021 Ga0501033_0011021_3482_3964 160
808 3300049571 Ga0501034_0001139 Ga0501034_0001139_16304_16786 160
809 3300049572 Ga0501036_0037773 Ga0501036_0037773_549_1031 160
810 3300049573 Ga0501037_0007268 Ga0501037_0007268_7321_7803 160
811 3300049579 Ga0501043_0102514 Ga0501043_0102514_1297_1779 160
812 3300049580 Ga0501046_0000379 Ga0501046_0000379_12122_12604 160
813 3300049581 Ga0501047_0000372 Ga0501047_0000372_36215_36697 160
814 3300049582 Ga0501048_0001876 Ga0501048_0001876_12448_12930 160
815 3300049585 Ga0501069_0031324 Ga0501069_0031324_2362_2859 160
816 3300049585 Ga0501069_0260500 Ga0501069_0260500_81_563 160
817 3300049586 Ga0501070_0003863 Ga0501070_0003863_3244_3726 160
818 3300049589 Ga0501073_0031355 Ga0501073_0031355_3042_3524 160
819 3300049589 Ga0501073_0548404 Ga0501073_0548404_152_649 160
820 3300049590 Ga0501074_0692854 Ga0501074_0692854_156_638 160
821 3300049593 Ga0501077_0193961 Ga0501077_0193961_133_636 160
822 3300049742 Ga0501080_0805797 Ga0501080_0805797_59_541 160
823 3300049744 Ga0501083_0110676 Ga0501083_0110676_981_1463 160
824 3300049822 Ga0501035_0002980 Ga0501035_0002980_10931_11413 160
825 3300049823 Ga0501044_0017131 Ga0501044_0017131_3207_3689 160
826 3300049823 Ga0501044_0037385 Ga0501044_0037385_1559_2044 160
827 3300050489 nmdc:mga03683_119849_c1 nmdc:mga03683_119849_c1_500_997 160
828 3300050490 nmdc:mga03n38_10185_c1 nmdc:mga03n38_10185_c1_1665_2147 160
829 3300050490 nmdc:mga03n38_1341_c1 nmdc:mga03n38_1341_c1_4217_4714 160
830 3300050491 nmdc:mga00v17_21421_c1 nmdc:mga00v17_21421_c1_2496_2993 160
831 3300050491 nmdc:mga00v17_297599_c1 nmdc:mga00v17_297599_c1_231_728 160
832 3300050491 nmdc:mga00v17_533178_c1 nmdc:mga00v17_533178_c1_60_557 160
833 3300050491 nmdc:mga00v17_7501_c1 nmdc:mga00v17_7501_c1_5025_5507 160
834 3300050492 nmdc:mga0yw44_183462_c1 nmdc:mga0yw44_183462_c1_580_1074 160
835 3300050492 nmdc:mga0yw44_218593_c1 nmdc:mga0yw44_218593_c1_255_740 160
836 3300050492 nmdc:mga0yw44_372035_c1 nmdc:mga0yw44_372035_c1_49_534 160
837 3300050492 nmdc:mga0yw44_481397_c1 nmdc:mga0yw44_481397_c1_292_777 160
838 3300050492 nmdc:mga0yw44_73890_c1 nmdc:mga0yw44_73890_c1_1212_1694 160
839 3300050492 nmdc:mga0yw44_74875_c1 nmdc:mga0yw44_74875_c1_1282_1794 160
840 3300050494 nmdc:mga06z11_153243_c1 nmdc:mga06z11_153243_c1_469_954 160
841 3300050494 nmdc:mga06z11_5301_c1 nmdc:mga06z11_5301_c1_3002_3499 160
842 3300050495 nmdc:mga04h51_107771_c1 nmdc:mga04h51_107771_c1_86_583 160
843 3300050496 nmdc:mga07m45_128771_c1 nmdc:mga07m45_128771_c1_935_1420 160
844 3300050496 nmdc:mga07m45_517462_c1 nmdc:mga07m45_517462_c1_143_640 160
845 3300050496 nmdc:mga07m45_7354_c1 nmdc:mga07m45_7354_c1_4217_4714 160
846 3300050516 nmdc:mga0sz30_100127_c1 nmdc:mga0sz30_100127_c1_499_981 160
847 3300050516 nmdc:mga0sz30_67219_c1 nmdc:mga0sz30_67219_c1_201_686 160
848 3300053080 Ga0500635_0002503 Ga0500635_0002503_682_1164 160
849 3300053108 Ga0500562_005573 Ga0500562_005573_240_722 160
850 3300053131 Ga0500652_009718 Ga0500652_009718_1611_2093 160
851 3300053139 Ga0500568_0055573 Ga0500568_0055573_90_587 160
852 3300053143 Ga0500579_239452 Ga0500579_239452_30_512 160
853 3300053153 Ga0500616_0000812 Ga0500616_0000812_32769_33254 160
854 3300061719 Ga0466962_0106556 Ga0466962_0106556_539_1021 160
855 3300061719 Ga0466962_0275481 Ga0466962_0275481_26_514 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

37

165

0.96

PF08218

Citrate_ly_lig

Citrate lyase ligase C-terminal domain

40

164

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9922 1 156
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9916 1 156
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9908 1 156
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9903 1 156
3nba-assembly2.cif.gz_B phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp) 0.982 1 155
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9908 1 156 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9774 1 156 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9709 1 156 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9476 2 154 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9414 1 156 3.40.50.620
ID Description Score Start End GO Terms
AF-L0ISV5-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.994 1 157 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3S4RQW7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9932 1 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2V0MYR3-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9923 13 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A1UED2-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9917 1 157 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A1I4KUK7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9881 1 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
95.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map