F483600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 570 | 614 | 569 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0072782|Ga0501073_0072782_855_2381 |
| Length | 501 |
| Sequence | VKKGVAAAGGTPREFCTITVTDGIAMGHAGMYASLPSRDLIADSVELTMRGHGYDALVGLAGCDKSLPGMMMAMVRMNVPSIFIYGGSILPGSFRGQPITVQDMFEAVGKNSVGALSDEDLDEMEQVACPSAGACGAQFTANTMATVSEAIGLALPYSAGAPAPYEIRDRFCMTAGEMVMELVAKNIRPRDIVTRKALENAAAVXXXXGGSTNAALHLPAIAHECGIDFDLFDVAEIFKKTPYVADLKPGGRYVAKDMFEVGGIPLLMKTLLDNGYLHGDCLTVTGRSIAENLKSVKWNDKQDVVHPANKPLTKTGGVVGLKGNLAPDGAIVKVAGMTELKFSGPARCFDAVRNKKYKEGEVLVIRYEGPRGGPGMREMLSTTAALYGQGMGGKVALITDGRFSGATRGFCIGHVGPEAAVGGPIGLLKDGDIITIDAVAGTIDVKLTADELAARKKDWKPREHQFGSGYLWKYAQQVGPAVKGAVTHPGGEGEKECYADG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 11 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 12 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 13 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 14 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 15 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 16 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 17 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 18 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 19 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 20 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 21 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 22 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 23 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 24 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 25 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 26 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 27 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 28 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 29 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 30 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 31 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 32 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 33 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 34 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 35 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 36 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 37 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 38 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 39 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 40 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 41 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 42 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 43 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 44 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 45 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 46 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 47 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 48 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 49 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 50 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 51 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 52 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 53 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 54 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 55 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 56 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 57 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 58 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 59 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 60 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 61 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 62 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 63 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 64 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 65 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 66 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 67 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 68 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 69 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 70 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 71 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 72 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 73 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 74 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 75 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 76 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 77 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 78 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 79 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 80 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 81 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 82 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 83 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 84 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 85 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 86 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 87 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 88 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 89 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 90 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 91 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 92 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 93 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 94 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 95 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 96 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 97 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 98 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 99 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 100 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 101 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 102 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 103 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 104 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 105 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 106 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 107 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 108 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 109 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 110 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 111 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 112 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 113 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 114 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 115 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 116 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 117 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 118 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 119 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 120 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 121 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 122 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 123 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 124 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 125 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 126 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 127 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 128 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 129 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 130 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 131 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 132 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 133 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 134 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 135 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 136 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 137 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 138 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 139 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 140 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 141 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 142 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 143 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 144 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 145 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 146 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 147 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 148 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 149 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 150 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 151 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 152 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 153 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 154 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 155 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 156 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 157 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 158 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 159 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 160 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 161 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 162 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 163 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 164 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 165 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 166 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 167 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 168 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 169 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 170 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 171 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 172 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 173 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 174 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 175 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 176 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 177 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 178 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 179 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 180 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 181 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 182 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 183 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 184 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 185 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 186 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 187 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 188 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 189 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 190 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 191 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 192 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 193 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 194 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 195 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 196 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 197 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 198 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 199 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 200 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 201 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 202 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 203 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 204 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 205 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 206 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 207 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 208 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 209 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 210 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 211 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 212 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 213 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 214 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 215 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 216 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 217 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 218 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 219 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 220 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 221 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 222 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 223 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 224 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 225 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 226 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 227 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 228 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 229 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 230 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 231 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 232 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 233 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 234 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 235 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 236 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 237 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 238 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 239 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 247 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 248 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 250 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 251 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 252 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 253 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 254 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 255 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 256 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 258 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 260 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 261 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 262 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 263 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 264 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 265 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 266 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 267 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 268 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 269 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 271 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 272 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 273 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 274 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 275 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 277 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 278 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 279 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 280 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 281 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 283 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 296 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 307 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 308 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 310 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 312 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 360 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 361 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 362 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 363 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 364 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 365 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 366 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 367 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 368 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 369 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 370 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 371 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 372 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 373 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 374 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 375 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 376 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 377 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 378 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 379 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 380 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 381 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 382 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 383 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 384 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 385 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 386 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 387 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 388 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 389 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 390 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 391 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 392 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 393 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 394 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 395 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 396 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 397 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 398 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 399 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 400 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 401 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 402 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 403 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 404 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 405 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 406 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 407 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 408 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 409 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 410 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 411 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 412 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 463 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 464 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 465 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 466 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 467 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 468 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 469 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 471 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 472 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 473 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 474 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 475 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 476 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 477 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 478 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 479 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 480 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 481 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 482 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 483 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 484 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 485 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 486 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 487 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 488 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 511 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 512 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 517 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 521 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 522 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 523 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 524 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 525 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 531 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 532 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 533 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 534 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 537 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 540 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 541 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 542 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 543 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 544 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 545 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 546 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 547 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 548 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 549 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 550 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 551 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 552 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 553 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 554 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 555 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 556 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 557 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 559 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 560 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 561 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 562 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 563 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 564 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 565 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 566 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 567 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 568 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 569 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 570 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.78 |
| Metatranscriptomes | 0.12 |
| Isolates | 28.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.15 |
| Nodule | 23.54 |
| Rhizoplane | 5.5 |
| Rhizosphere | 59.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1005092 | 3300001977 | Bacteria | 2057 |
| 2 | JGI24740J21852_10002718 | 3300001979 | Bacteria | 7919 |
| 3 | JGI24737J22298_10026704 | 3300001990 | Bacteria | 1823 |
| 4 | JGI24743J22301_10002476 | 3300001991 | Bacteria | 2788 |
| 5 | JGI24750J21931_1001573 | 3300002070 | Bacteria | 2804 |
| 6 | JGI25165J46597_1000209 | 3300003214 | Bacteria | 83865 |
| 7 | Ga0055542_1001237 | 3300003762 | Bacteria | 14181 |
| 8 | Ga0065707_10082036 | 3300005295 | Bacteria | 24003 |
| 9 | Ga0070690_100012694 | 3300005330 | Bacteria | 4961 |
| 10 | Ga0070680_100005001 | 3300005336 | Bacteria | 9989 |
| 11 | Ga0070680_100014421 | 3300005336 | Bacteria | 6177 |
| 12 | Ga0070682_100008648 | 3300005337 | Bacteria | 5748 |
| 13 | Ga0070682_100032430 | 3300005337 | Bacteria | 3168 |
| 14 | Ga0070660_100017179 | 3300005339 | Bacteria | 5270 |
| 15 | Ga0070660_100023476 | 3300005339 | Bacteria | 4568 |
| 16 | Ga0070660_100091886 | 3300005339 | Bacteria | 2395 |
| 17 | Ga0070691_10029192 | 3300005341 | Bacteria | 2580 |
| 18 | Ga0070661_100000136 | 3300005344 | Bacteria | 61339 |
| 19 | Ga0070661_100025422 | 3300005344 | Bacteria | 4255 |
| 20 | Ga0070692_10013099 | 3300005345 | Bacteria | 3859 |
| 21 | Ga0070674_100001589 | 3300005356 | Bacteria | 12172 |
| 22 | Ga0070674_100074541 | 3300005356 | Bacteria | 2408 |
| 23 | Ga0070659_100049347 | 3300005366 | Bacteria | 3309 |
| 24 | Ga0070667_100025110 | 3300005367 | Bacteria | 4953 |
| 25 | Ga0070667_100101319 | 3300005367 | Bacteria | 2487 |
| 26 | Ga0070713_100017657 | 3300005436 | Bacteria | 5403 |
| 27 | Ga0070713_100076504 | 3300005436 | Bacteria | 2843 |
| 28 | Ga0070713_100101050 | 3300005436 | Bacteria | 2498 |
| 29 | Ga0070713_100146200 | 3300005436 | Bacteria | 2099 |
| 30 | Ga0070700_100012459 | 3300005441 | Bacteria | 4748 |
| 31 | Ga0070678_100000645 | 3300005456 | Bacteria | 17064 |
| 32 | Ga0070681_10019339 | 3300005458 | Bacteria | 6816 |
| 33 | Ga0070681_10050201 | 3300005458 | Bacteria | 4163 |
| 34 | Ga0070681_10193215 | 3300005458 | Bacteria | 1955 |
| 35 | Ga0070685_10040776 | 3300005466 | Bacteria | 2643 |
| 36 | Ga0070679_100110957 | 3300005530 | Bacteria | 2729 |
| 37 | Ga0070679_100116519 | 3300005530 | Bacteria | 2656 |
| 38 | Ga0070684_100013746 | 3300005535 | Bacteria | 6534 |
| 39 | Ga0070684_100057270 | 3300005535 | Bacteria | 3402 |
| 40 | Ga0070697_100007631 | 3300005536 | Bacteria | 8420 |
| 41 | Ga0068853_100005539 | 3300005539 | Bacteria | 9904 |
| 42 | Ga0068853_100028539 | 3300005539 | Bacteria | 4694 |
| 43 | Ga0070695_100014007 | 3300005545 | Bacteria | 4829 |
| 44 | Ga0070665_100000458 | 3300005548 | Bacteria | 59389 |
| 45 | Ga0068855_100075277 | 3300005563 | Bacteria | 3920 |
| 46 | Ga0068855_100098438 | 3300005563 | Bacteria | 3369 |
| 47 | Ga0068855_100240249 | 3300005563 | Bacteria | 2024 |
| 48 | Ga0070664_100014739 | 3300005564 | Bacteria | 6384 |
| 49 | Ga0068852_100015727 | 3300005616 | Bacteria | 5880 |
| 50 | Ga0068859_100042742 | 3300005617 | Bacteria | 4553 |
| 51 | Ga0068864_100064771 | 3300005618 | Bacteria | 3170 |
| 52 | Ga0068861_100073921 | 3300005719 | Bacteria | 2649 |
| 53 | Ga0068851_10040828 | 3300005834 | Bacteria | 2332 |
| 54 | Ga0068851_10045496 | 3300005834 | Bacteria | 2218 |
| 55 | Ga0068860_100001757 | 3300005843 | Bacteria | 23123 |
| 56 | Ga0068860_100098874 | 3300005843 | Bacteria | 2783 |
| 57 | Ga0081455_10000444 | 3300005937 | Bacteria | 54433 |
| 58 | Ga0081455_10003034 | 3300005937 | Bacteria | 19573 |
| 59 | Ga0081455_10003870 | 3300005937 | Bacteria | 17056 |
| 60 | Ga0081455_10011629 | 3300005937 | Bacteria | 8830 |
| 61 | Ga0081538_10010773 | 3300005981 | Bacteria | 7474 |
| 62 | Ga0081538_10048046 | 3300005981 | Bacteria | 2609 |
| 63 | Ga0081540_1022231 | 3300005983 | Bacteria | 3747 |
| 64 | Ga0081539_10006551 | 3300005985 | Bacteria | 11109 |
| 65 | Ga0070717_10002040 | 3300006028 | Bacteria | 14141 |
| 66 | Ga0070717_10024422 | 3300006028 | Bacteria | 4800 |
| 67 | Ga0075365_10006310 | 3300006038 | Bacteria | 6511 |
| 68 | Ga0075368_10005599 | 3300006042 | Bacteria | 4332 |
| 69 | Ga0075368_10016104 | 3300006042 | Bacteria | 2782 |
| 70 | Ga0070712_100002437 | 3300006175 | Bacteria | 11465 |
| 71 | Ga0075362_10010086 | 3300006177 | Bacteria | 3676 |
| 72 | Ga0075367_10006314 | 3300006178 | Bacteria | 5977 |
| 73 | Ga0075367_10042352 | 3300006178 | Bacteria | 2664 |
| 74 | Ga0097621_100034819 | 3300006237 | Bacteria | 4019 |
| 75 | Ga0075370_10016647 | 3300006353 | Bacteria | 3957 |
| 76 | Ga0075430_100000060 | 3300006846 | Bacteria | 58237 |
| 77 | Ga0075430_100024195 | 3300006846 | Bacteria | 5170 |
| 78 | Ga0075430_100056454 | 3300006846 | Bacteria | 3302 |
| 79 | Ga0075431_100027666 | 3300006847 | Bacteria | 5819 |
| 80 | Ga0075431_100174308 | 3300006847 | Bacteria | 2209 |
| 81 | Ga0075434_100036752 | 3300006871 | Bacteria | 4845 |
| 82 | Ga0075436_100000396 | 3300006914 | Bacteria | 28016 |
| 83 | Ga0075436_100007214 | 3300006914 | Bacteria | 7604 |
| 84 | Ga0097620_100042742 | 3300006931 | Bacteria | 4553 |
| 85 | Ga0099795_10000411 | 3300007788 | Bacteria | 7838 |
| 86 | Ga0105240_10110067 | 3300009093 | Bacteria | 3335 |
| 87 | Ga0111539_10028731 | 3300009094 | Bacteria | 6782 |
| 88 | Ga0111539_10040542 | 3300009094 | Bacteria | 5604 |
| 89 | Ga0105245_10000398 | 3300009098 | Bacteria | 40337 |
| 90 | Ga0105247_10054002 | 3300009101 | Bacteria | 2479 |
| 91 | Ga0114129_10005706 | 3300009147 | Bacteria | 17633 |
| 92 | Ga0114129_10009088 | 3300009147 | Bacteria | 14162 |
| 93 | Ga0114129_10013011 | 3300009147 | Bacteria | 11851 |
| 94 | Ga0105243_10000202 | 3300009148 | Bacteria | 69670 |
| 95 | Ga0105243_10073548 | 3300009148 | Bacteria | 2770 |
| 96 | Ga0105243_10096966 | 3300009148 | Bacteria | 2440 |
| 97 | Ga0105241_10001829 | 3300009174 | Bacteria | 16143 |
| 98 | Ga0105241_10030299 | 3300009174 | Bacteria | 4042 |
| 99 | Ga0105242_10163785 | 3300009176 | Bacteria | 1949 |
| 100 | Ga0105248_10030240 | 3300009177 | Bacteria | 6046 |
| 101 | Ga0105237_10014904 | 3300009545 | Bacteria | 8107 |
| 102 | Ga0105237_10088033 | 3300009545 | Bacteria | 3095 |
| 103 | Ga0105238_10004648 | 3300009551 | Bacteria | 13589 |
| 104 | Ga0105238_10005879 | 3300009551 | Bacteria | 12154 |
| 105 | Ga0105238_10039698 | 3300009551 | Bacteria | 4773 |
| 106 | Ga0105238_10081246 | 3300009551 | Bacteria | 3230 |
| 107 | Ga0105249_10113755 | 3300009553 | Bacteria | 2561 |
| 108 | Ga0099796_10003534 | 3300010159 | Bacteria | 3644 |
| 109 | Ga0099796_10015336 | 3300010159 | Bacteria | 2238 |
| 110 | Ga0105239_10057788 | 3300010375 | Bacteria | 4256 |
| 111 | Ga0105239_10113265 | 3300010375 | Bacteria | 3008 |
| 112 | Ga0157373_10000586 | 3300013100 | Bacteria | 28347 |
| 113 | Ga0157373_10019996 | 3300013100 | Bacteria | 4870 |
| 114 | Ga0157371_10000024 | 3300013102 | Bacteria | 281202 |
| 115 | Ga0157369_10166917 | 3300013105 | Bacteria | 2321 |
| 116 | Ga0157378_10049148 | 3300013297 | Bacteria | 3752 |
| 117 | Ga0157372_10022517 | 3300013307 | Bacteria | 6819 |
| 118 | Ga0157372_10253969 | 3300013307 | Bacteria | 2041 |
| 119 | Ga0157375_10101613 | 3300013308 | Bacteria | 2959 |
| 120 | Ga0163163_10000006 | 3300014325 | Bacteria | 320401 |
| 121 | Ga0157380_10006819 | 3300014326 | Bacteria | 8072 |
| 122 | Ga0157380_10016504 | 3300014326 | Bacteria | 5447 |
| 123 | Ga0157380_10134840 | 3300014326 | Bacteria | 2112 |
| 124 | Ga0157379_10119859 | 3300014968 | Bacteria | 2366 |
| 125 | Ga0182006_1040534 | 3300015261 | Bacteria | 1833 |
| 126 | Ga0197907_10465604 | 3300020069 | Bacteria | 2395 |
| 127 | Ga0209674_104793 | 3300025226 | Bacteria | 2130 |
| 128 | Ga0209026_1000024 | 3300025250 | Bacteria | 355839 |
| 129 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 130 | Ga0209759_1000389 | 3300025256 | Bacteria | 54772 |
| 131 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 132 | Ga0209233_1000129 | 3300025261 | Bacteria | 206511 |
| 133 | Ga0209455_1000183 | 3300025272 | Bacteria | 99952 |
| 134 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 135 | Ga0207692_10028531 | 3300025898 | Bacteria | 2641 |
| 136 | Ga0207710_10009424 | 3300025900 | Bacteria | 4110 |
| 137 | Ga0207688_10001280 | 3300025901 | Bacteria | 13032 |
| 138 | Ga0207647_10014852 | 3300025904 | Bacteria | 5355 |
| 139 | Ga0207647_10025394 | 3300025904 | Bacteria | 3894 |
| 140 | Ga0207699_10027424 | 3300025906 | Bacteria | 3153 |
| 141 | Ga0207645_10007694 | 3300025907 | Bacteria | 7589 |
| 142 | Ga0207643_10001224 | 3300025908 | Bacteria | 15168 |
| 143 | Ga0207705_10002842 | 3300025909 | Bacteria | 13242 |
| 144 | Ga0207705_10008702 | 3300025909 | Bacteria | 7395 |
| 145 | Ga0207654_10001335 | 3300025911 | Bacteria | 13110 |
| 146 | Ga0207654_10002277 | 3300025911 | Bacteria | 9842 |
| 147 | Ga0207707_10040606 | 3300025912 | Bacteria | 4063 |
| 148 | Ga0207707_10058202 | 3300025912 | Bacteria | 3363 |
| 149 | Ga0207707_10077299 | 3300025912 | Bacteria | 2905 |
| 150 | Ga0207707_10137372 | 3300025912 | Bacteria | 2137 |
| 151 | Ga0207695_10000402 | 3300025913 | Bacteria | 96771 |
| 152 | Ga0207695_10034936 | 3300025913 | Bacteria | 5459 |
| 153 | Ga0207695_10039829 | 3300025913 | Bacteria | 5048 |
| 154 | Ga0207695_10052366 | 3300025913 | Bacteria | 4277 |
| 155 | Ga0207695_10093269 | 3300025913 | Bacteria | 3020 |
| 156 | Ga0207671_10006493 | 3300025914 | Bacteria | 10407 |
| 157 | Ga0207693_10006383 | 3300025915 | Bacteria | 9771 |
| 158 | Ga0207693_10047013 | 3300025915 | Bacteria | 3391 |
| 159 | Ga0207693_10047667 | 3300025915 | Bacteria | 3366 |
| 160 | Ga0207693_10067214 | 3300025915 | Bacteria | 2806 |
| 161 | Ga0207663_10074920 | 3300025916 | Bacteria | 2194 |
| 162 | Ga0207663_10110512 | 3300025916 | Bacteria | 1864 |
| 163 | Ga0207660_10022170 | 3300025917 | Bacteria | 4277 |
| 164 | Ga0207657_10000101 | 3300025919 | Bacteria | 82962 |
| 165 | Ga0207657_10029863 | 3300025919 | Bacteria | 4955 |
| 166 | Ga0207657_10037809 | 3300025919 | Bacteria | 4306 |
| 167 | Ga0207657_10058612 | 3300025919 | Bacteria | 3312 |
| 168 | Ga0207657_10071669 | 3300025919 | Bacteria | 2934 |
| 169 | Ga0207649_10000154 | 3300025920 | Bacteria | 56342 |
| 170 | Ga0207649_10000425 | 3300025920 | Bacteria | 30960 |
| 171 | Ga0207652_10015345 | 3300025921 | Bacteria | 6220 |
| 172 | Ga0207652_10029441 | 3300025921 | Bacteria | 4591 |
| 173 | Ga0207646_10013813 | 3300025922 | Bacteria | 7702 |
| 174 | Ga0207694_10000095 | 3300025924 | Bacteria | 99130 |
| 175 | Ga0207694_10006206 | 3300025924 | Bacteria | 9123 |
| 176 | Ga0207694_10033216 | 3300025924 | Bacteria | 3953 |
| 177 | Ga0207687_10026852 | 3300025927 | Bacteria | 3858 |
| 178 | Ga0207700_10014504 | 3300025928 | Bacteria | 5166 |
| 179 | Ga0207690_10014343 | 3300025932 | Bacteria | 4788 |
| 180 | Ga0207690_10036815 | 3300025932 | Bacteria | 3172 |
| 181 | Ga0207690_10054922 | 3300025932 | Bacteria | 2680 |
| 182 | Ga0207706_10013662 | 3300025933 | Bacteria | 7372 |
| 183 | Ga0207709_10000201 | 3300025935 | Bacteria | 78554 |
| 184 | Ga0207669_10000075 | 3300025937 | Bacteria | 50601 |
| 185 | Ga0207669_10065800 | 3300025937 | Bacteria | 2250 |
| 186 | Ga0207669_10066086 | 3300025937 | Bacteria | 2247 |
| 187 | Ga0207665_10003464 | 3300025939 | Bacteria | 10538 |
| 188 | Ga0207691_10009803 | 3300025940 | Bacteria | 9197 |
| 189 | Ga0207711_10016979 | 3300025941 | Bacteria | 6045 |
| 190 | Ga0207679_10005273 | 3300025945 | Bacteria | 8104 |
| 191 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 192 | Ga0207667_10004211 | 3300025949 | Bacteria | 17659 |
| 193 | Ga0207667_10010528 | 3300025949 | Bacteria | 10808 |
| 194 | Ga0207640_10000829 | 3300025981 | Bacteria | 17600 |
| 195 | Ga0207640_10029840 | 3300025981 | Bacteria | 3352 |
| 196 | Ga0207703_10109549 | 3300026035 | Bacteria | 2354 |
| 197 | Ga0207639_10003097 | 3300026041 | Bacteria | 11175 |
| 198 | Ga0207639_10032248 | 3300026041 | Bacteria | 3855 |
| 199 | Ga0207639_10045222 | 3300026041 | Bacteria | 3314 |
| 200 | Ga0207678_10035216 | 3300026067 | Bacteria | 4359 |
| 201 | Ga0207678_10106267 | 3300026067 | Bacteria | 2395 |
| 202 | Ga0207708_10001181 | 3300026075 | Bacteria | 19661 |
| 203 | Ga0207702_10000025 | 3300026078 | Bacteria | 186312 |
| 204 | Ga0207702_10014651 | 3300026078 | Bacteria | 6506 |
| 205 | Ga0207702_10016315 | 3300026078 | Bacteria | 6148 |
| 206 | Ga0207648_10005697 | 3300026089 | Bacteria | 12493 |
| 207 | Ga0207675_100007911 | 3300026118 | Bacteria | 10021 |
| 208 | Ga0207683_10000067 | 3300026121 | Bacteria | 79552 |
| 209 | Ga0207683_10008737 | 3300026121 | Bacteria | 8649 |
| 210 | Ga0207698_10018802 | 3300026142 | Bacteria | 4718 |
| 211 | Ga0207698_10021195 | 3300026142 | Bacteria | 4489 |
| 212 | Ga0207698_10035023 | 3300026142 | Bacteria | 3668 |
| 213 | Ga0209179_1000852 | 3300027512 | Bacteria | 3388 |
| 214 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 215 | Ga0268266_10022663 | 3300028379 | Bacteria | 5346 |
| 216 | Ga0268266_10085771 | 3300028379 | Bacteria | 2752 |
| 217 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 218 | Ga0265318_10000199 | 3300028577 | Bacteria | 52225 |
| 219 | Ga0265338_10010200 | 3300028800 | Bacteria | 11072 |
| 220 | Ga0265338_10053555 | 3300028800 | Bacteria | 3607 |
| 221 | Ga0307511_10037215 | 3300030521 | Bacteria | 4208 |
| 222 | Ga0265330_10023681 | 3300031235 | Bacteria | 2787 |
| 223 | Ga0265332_10000793 | 3300031238 | Bacteria | 19220 |
| 224 | Ga0265325_10001455 | 3300031241 | Bacteria | 16632 |
| 225 | Ga0265325_10018610 | 3300031241 | Bacteria | 3852 |
| 226 | Ga0265340_10012126 | 3300031247 | Bacteria | 4556 |
| 227 | Ga0265340_10025144 | 3300031247 | Bacteria | 3019 |
| 228 | Ga0265339_10003009 | 3300031249 | Bacteria | 11880 |
| 229 | Ga0265339_10026275 | 3300031249 | Bacteria | 3335 |
| 230 | Ga0265339_10047899 | 3300031249 | Bacteria | 2346 |
| 231 | Ga0265331_10017547 | 3300031250 | Bacteria | 3728 |
| 232 | Ga0265327_10000124 | 3300031251 | Bacteria | 169233 |
| 233 | Ga0265327_10016308 | 3300031251 | Bacteria | 4725 |
| 234 | Ga0265316_10081525 | 3300031344 | Bacteria | 2480 |
| 235 | Ga0265313_10000124 | 3300031595 | Bacteria | 77104 |
| 236 | Ga0265313_10001046 | 3300031595 | Bacteria | 26926 |
| 237 | Ga0265314_10000192 | 3300031711 | Bacteria | 91053 |
| 238 | Ga0265314_10002282 | 3300031711 | Bacteria | 19846 |
| 239 | Ga0265314_10007587 | 3300031711 | Bacteria | 9390 |
| 240 | Ga0265314_10011644 | 3300031711 | Bacteria | 7240 |
| 241 | Ga0265342_10000100 | 3300031712 | Bacteria | 94554 |
| 242 | Ga0265342_10004038 | 3300031712 | Bacteria | 11722 |
| 243 | Ga0265342_10004875 | 3300031712 | Bacteria | 10389 |
| 244 | Ga0265342_10006704 | 3300031712 | Bacteria | 8534 |
| 245 | Ga0265342_10013562 | 3300031712 | Bacteria | 5459 |
| 246 | Ga0265342_10017742 | 3300031712 | Bacteria | 4622 |
| 247 | Ga0316576_10036561 | 3300031727 | Bacteria | 3511 |
| 248 | Ga0307516_10017716 | 3300031730 | Bacteria | 7420 |
| 249 | Ga0307405_10042177 | 3300031731 | Bacteria | 2776 |
| 250 | Ga0307412_10073503 | 3300031911 | Bacteria | 2339 |
| 251 | Ga0316583_10000048 | 3300032133 | Bacteria | 23093 |
| 252 | Ga0373958_0002144 | 3300034819 | Bacteria | 2737 |
| 253 | Ga0373926_0026571 | 3300035083 | Bacteria | 2026 |
| 254 | Ga0373928_0008564 | 3300035084 | Bacteria | 1987 |
| 255 | Ga0373934_0012745 | 3300035086 | Bacteria | 3174 |
| 256 | Ga0373944_0021605 | 3300035089 | Bacteria | 1864 |
| 257 | Ga0373923_0000396 | 3300035111 | Bacteria | 10077 |
| 258 | Ga0373936_0002567 | 3300035113 | Bacteria | 6820 |
| 259 | Ga0373939_0013119 | 3300035114 | Bacteria | 2125 |
| 260 | Ga0373945_0004276 | 3300035116 | Bacteria | 4531 |
| 261 | Ga0373945_0008605 | 3300035116 | Bacteria | 3327 |
| 262 | Ga0373954_0015428 | 3300035118 | Bacteria | 3415 |
| 263 | Ga0373943_0000297 | 3300035170 | Bacteria | 20643 |
| 264 | Ga0373946_0000630 | 3300035171 | Bacteria | 11740 |
| 265 | Ga0373946_0009980 | 3300035171 | Bacteria | 3511 |
| 266 | Ga0373955_0000525 | 3300035172 | Bacteria | 16320 |
| 267 | Ga0373955_0017841 | 3300035172 | Bacteria | 3518 |
| 268 | Ga0373924_0001066 | 3300035410 | Bacteria | 8749 |
| 269 | Ga0373931_0001151 | 3300035691 | Bacteria | 11249 |
| 270 | Ga0373931_0013316 | 3300035691 | Bacteria | 4003 |
| 271 | Ga0373931_0049989 | 3300035691 | Bacteria | 2223 |
| 272 | Ga0373931_0060489 | 3300035691 | Bacteria | 2039 |
| 273 | Ga0373935_0000006 | 3300035692 | Bacteria | 121726 |
| 274 | Ga0373935_0001125 | 3300035692 | Bacteria | 14588 |
| 275 | Ga0373927_0002633 | 3300035695 | Bacteria | 13084 |
| 276 | Ga0373927_0013058 | 3300035695 | Bacteria | 5523 |
| 277 | Ga0373933_0002040 | 3300035724 | Bacteria | 11607 |
| 278 | Ga0373933_0005418 | 3300035724 | Bacteria | 6943 |
| 279 | Ga0373933_0096345 | 3300035724 | Bacteria | 1831 |
| 280 | Ga0373947_0000159 | 3300035725 | Bacteria | 35943 |
| 281 | Ga0373947_0000394 | 3300035725 | Bacteria | 24570 |
| 282 | Ga0373947_0021636 | 3300035725 | Bacteria | 3723 |
| 283 | Ga0373947_0039728 | 3300035725 | Bacteria | 2800 |
| 284 | Ga0373937_0003145 | 3300036401 | Bacteria | 13816 |
| 285 | Ga0373937_0004380 | 3300036401 | Bacteria | 11989 |
| 286 | Ga0373937_0005696 | 3300036401 | Bacteria | 10698 |
| 287 | Ga0373937_0007971 | 3300036401 | Bacteria | 9182 |
| 288 | Ga0373937_0085797 | 3300036401 | Bacteria | 2914 |
| 289 | Ga0373925_0000776 | 3300037068 | Bacteria | 29348 |
| 290 | Ga0373925_0008020 | 3300037068 | Bacteria | 7689 |
| 291 | Ga0373925_0040075 | 3300037068 | Bacteria | 3467 |
| 292 | Ga0373925_0073355 | 3300037068 | Bacteria | 2590 |
| 293 | Ga0373925_0084541 | 3300037068 | Bacteria | 2418 |
| 294 | Ga0395899_0007549 | 3300037312 | Bacteria | 8397 |
| 295 | Ga0395900_0048644 | 3300037418 | Bacteria | 4368 |
| 296 | Ga0395900_0093364 | 3300037418 | Bacteria | 3091 |
| 297 | Ga0395900_0110938 | 3300037418 | Bacteria | 2817 |
| 298 | Ga0395898_0002807 | 3300037466 | Bacteria | 19970 |
| 299 | Ga0395898_0009781 | 3300037466 | Bacteria | 10050 |
| 300 | Ga0395905_0094125 | 3300037471 | Bacteria | 2810 |
| 301 | Ga0395901_0038577 | 3300038443 | Bacteria | 4942 |
| 302 | Ga0395901_0094209 | 3300038443 | Bacteria | 3136 |
| 303 | Ga0395901_0165458 | 3300038443 | Bacteria | 2322 |
| 304 | Ga0395901_0223688 | 3300038443 | Bacteria | 1967 |
| 305 | Ga0395901_0246539 | 3300038443 | Bacteria | 1862 |
| 306 | Ga0436365_0088108 | 3300039437 | Bacteria | 12770 |
| 307 | Ga0436365_1571761 | 3300039437 | Bacteria | 2617 |
| 308 | Ga0436361_0484868 | 3300039447 | Bacteria | 5733 |
| 309 | Ga0436361_0722712 | 3300039447 | Bacteria | 2726 |
| 310 | Ga0436363_1572801 | 3300039450 | Bacteria | 2548 |
| 311 | Ga0439453_0004139 | 3300041408 | Bacteria | 2139 |
| 312 | Ga0466966_0031412 | 3300044684 | Bacteria | 3444 |
| 313 | Ga0466963_0022421 | 3300044694 | Bacteria | 4000 |
| 314 | Ga0466959_0040185 | 3300045049 | Bacteria | 3456 |
| 315 | Ga0466958_0042967 | 3300045836 | Bacteria | 2721 |
| 316 | Ga0495592_0000742 | 3300046454 | Bacteria | 22699 |
| 317 | Ga0495592_0009467 | 3300046454 | Bacteria | 7324 |
| 318 | Ga0495603_0027842 | 3300046455 | Bacteria | 3408 |
| 319 | Ga0495629_0066555 | 3300046459 | Bacteria | 2515 |
| 320 | Ga0495638_0004609 | 3300046460 | Bacteria | 10434 |
| 321 | Ga0495638_0029857 | 3300046460 | Bacteria | 3515 |
| 322 | Ga0495651_0002087 | 3300046462 | Bacteria | 15401 |
| 323 | Ga0495651_0010936 | 3300046462 | Bacteria | 6982 |
| 324 | Ga0495651_0073803 | 3300046462 | Bacteria | 2589 |
| 325 | Ga0495653_0000203 | 3300046463 | Bacteria | 47869 |
| 326 | Ga0495653_0061411 | 3300046463 | Bacteria | 2844 |
| 327 | Ga0495650_0000058 | 3300046471 | Bacteria | 302308 |
| 328 | Ga0495580_0037296 | 3300046472 | Bacteria | 3490 |
| 329 | Ga0495605_0036971 | 3300046474 | Bacteria | 2459 |
| 330 | Ga0495662_0007282 | 3300046476 | Bacteria | 5474 |
| 331 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 332 | Ga0495584_0015596 | 3300046491 | Bacteria | 3874 |
| 333 | Ga0495594_0016216 | 3300046499 | Bacteria | 3923 |
| 334 | Ga0495596_0029424 | 3300046500 | Bacteria | 2202 |
| 335 | Ga0495607_0057266 | 3300046501 | Bacteria | 2234 |
| 336 | Ga0495583_0001172 | 3300046506 | Bacteria | 28294 |
| 337 | Ga0495608_0000058 | 3300046511 | Bacteria | 90246 |
| 338 | Ga0495608_0056757 | 3300046511 | Bacteria | 2585 |
| 339 | Ga0495618_0000049 | 3300046514 | Bacteria | 91727 |
| 340 | Ga0495628_0000022 | 3300046516 | Bacteria | 140362 |
| 341 | Ga0495628_0021240 | 3300046516 | Bacteria | 5344 |
| 342 | Ga0495630_0010063 | 3300046517 | Bacteria | 6813 |
| 343 | Ga0495648_0000166 | 3300046524 | Bacteria | 77879 |
| 344 | Ga0495648_0000895 | 3300046524 | Bacteria | 31207 |
| 345 | Ga0495663_0001212 | 3300046525 | Bacteria | 8286 |
| 346 | Ga0495652_0000008 | 3300046529 | Bacteria | 343637 |
| 347 | Ga0495652_0013568 | 3300046529 | Bacteria | 7333 |
| 348 | Ga0495665_0025630 | 3300046531 | Bacteria | 3167 |
| 349 | Ga0495640_0000727 | 3300046533 | Bacteria | 24699 |
| 350 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 351 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 352 | Ga0495645_0003951 | 3300046543 | Bacteria | 10114 |
| 353 | Ga0495667_0000090 | 3300046559 | Bacteria | 65991 |
| 354 | Ga0495668_0000261 | 3300046616 | Bacteria | 74577 |
| 355 | Ga0495668_0009306 | 3300046616 | Bacteria | 6040 |
| 356 | Ga0495634_0002729 | 3300046642 | Bacteria | 14525 |
| 357 | Ga0495625_0000910 | 3300046660 | Bacteria | 39828 |
| 358 | Ga0495635_0000023 | 3300046663 | Bacteria | 153429 |
| 359 | Ga0495635_0017526 | 3300046663 | Bacteria | 5002 |
| 360 | Ga0495659_0011773 | 3300046664 | Bacteria | 2821 |
| 361 | Ga0495657_0001777 | 3300046675 | Bacteria | 18440 |
| 362 | Ga0495657_0018882 | 3300046675 | Bacteria | 4983 |
| 363 | Ga0495599_0000039 | 3300046678 | Bacteria | 98345 |
| 364 | Ga0495599_0020966 | 3300046678 | Bacteria | 4074 |
| 365 | Ga0495623_0000073 | 3300046679 | Bacteria | 61884 |
| 366 | Ga0495623_0014617 | 3300046679 | Bacteria | 5078 |
| 367 | Ga0495646_0000017 | 3300046680 | Bacteria | 123549 |
| 368 | Ga0495613_0010367 | 3300046689 | Bacteria | 6922 |
| 369 | Ga0495624_0002118 | 3300046690 | Bacteria | 15142 |
| 370 | Ga0495624_0006011 | 3300046690 | Bacteria | 8658 |
| 371 | Ga0495624_0035804 | 3300046690 | Bacteria | 3203 |
| 372 | Ga0495600_0000043 | 3300046809 | Bacteria | 73475 |
| 373 | Ga0495600_0000711 | 3300046809 | Bacteria | 17482 |
| 374 | Ga0495600_0010303 | 3300046809 | Bacteria | 5800 |
| 375 | Ga0495581_0007230 | 3300047315 | Bacteria | 6421 |
| 376 | Ga0495604_0000030 | 3300047317 | Bacteria | 138597 |
| 377 | Ga0495604_0031736 | 3300047317 | Bacteria | 4190 |
| 378 | Ga0495674_0000009 | 3300047319 | Bacteria | 310479 |
| 379 | Ga0495676_0052298 | 3300047321 | Bacteria | 3261 |
| 380 | Ga0495680_0000307 | 3300047322 | Bacteria | 54880 |
| 381 | Ga0495680_0034783 | 3300047322 | Bacteria | 4065 |
| 382 | Ga0495675_0001007 | 3300047444 | Bacteria | 17156 |
| 383 | Ga0495684_0000031 | 3300047471 | Bacteria | 116753 |
| 384 | Ga0495593_0001311 | 3300047673 | Bacteria | 14588 |
| 385 | Ga0495593_0004675 | 3300047673 | Bacteria | 8142 |
| 386 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 387 | Ga0495602_0093924 | 3300048088 | Bacteria | 2480 |
| 388 | Ga0496100_0045603 | 3300048903 | Bacteria | 2814 |
| 389 | Ga0496100_0061810 | 3300048903 | Bacteria | 2469 |
| 390 | Ga0496101_0024952 | 3300048904 | Bacteria | 4144 |
| 391 | Ga0496101_0051971 | 3300048904 | Bacteria | 2953 |
| 392 | Ga0496102_0000120 | 3300048905 | Bacteria | 112432 |
| 393 | Ga0496102_0000758 | 3300048905 | Bacteria | 31549 |
| 394 | Ga0496102_0006681 | 3300048905 | Bacteria | 9851 |
| 395 | Ga0496102_0056461 | 3300048905 | Bacteria | 3582 |
| 396 | Ga0496102_0097769 | 3300048905 | Bacteria | 2723 |
| 397 | Ga0496103_0000154 | 3300048906 | Bacteria | 72239 |
| 398 | Ga0496103_0000186 | 3300048906 | Bacteria | 62771 |
| 399 | Ga0496103_0001330 | 3300048906 | Bacteria | 16750 |
| 400 | Ga0496103_0032806 | 3300048906 | Bacteria | 3170 |
| 401 | Ga0496103_0062570 | 3300048906 | Bacteria | 2317 |
| 402 | Ga0496103_0104915 | 3300048906 | Bacteria | 1792 |
| 403 | Ga0496104_0000116 | 3300048907 | Bacteria | 74423 |
| 404 | Ga0496104_0000935 | 3300048907 | Bacteria | 25059 |
| 405 | Ga0496104_0002021 | 3300048907 | Bacteria | 17617 |
| 406 | Ga0496104_0042159 | 3300048907 | Bacteria | 4282 |
| 407 | Ga0496104_0049921 | 3300048907 | Bacteria | 3946 |
| 408 | Ga0496105_0000364 | 3300048908 | Bacteria | 30030 |
| 409 | Ga0496105_0014298 | 3300048908 | Bacteria | 6316 |
| 410 | Ga0496105_0014705 | 3300048908 | Bacteria | 6231 |
| 411 | Ga0496105_0018042 | 3300048908 | Bacteria | 5664 |
| 412 | Ga0496106_0001709 | 3300048909 | Bacteria | 16390 |
| 413 | Ga0496106_0005524 | 3300048909 | Bacteria | 9356 |
| 414 | Ga0496106_0036071 | 3300048909 | Bacteria | 3699 |
| 415 | Ga0496107_0010874 | 3300048910 | Bacteria | 6333 |
| 416 | Ga0496107_0025281 | 3300048910 | Bacteria | 4203 |
| 417 | Ga0496107_0077651 | 3300048910 | Bacteria | 2419 |
| 418 | Ga0496108_0001344 | 3300048911 | Bacteria | 19333 |
| 419 | Ga0496108_0007516 | 3300048911 | Bacteria | 8837 |
| 420 | Ga0496109_0002147 | 3300048912 | Bacteria | 16399 |
| 421 | Ga0496109_0009622 | 3300048912 | Bacteria | 8243 |
| 422 | Ga0496109_0063593 | 3300048912 | Bacteria | 3375 |
| 423 | Ga0496109_0148649 | 3300048912 | Bacteria | 2193 |
| 424 | Ga0496110_0085005 | 3300048913 | Bacteria | 2824 |
| 425 | Ga0496111_0000807 | 3300048914 | Bacteria | 16805 |
| 426 | Ga0496111_0011323 | 3300048914 | Bacteria | 6003 |
| 427 | Ga0496112_0000646 | 3300048915 | Bacteria | 24167 |
| 428 | Ga0496112_0157356 | 3300048915 | Bacteria | 2239 |
| 429 | Ga0496113_0000048 | 3300048916 | Bacteria | 50958 |
| 430 | Ga0496114_0005133 | 3300048917 | Bacteria | 10211 |
| 431 | Ga0496114_0006528 | 3300048917 | Bacteria | 9192 |
| 432 | Ga0496115_0000423 | 3300048918 | Bacteria | 34595 |
| 433 | Ga0496115_0024951 | 3300048918 | Bacteria | 4651 |
| 434 | Ga0496115_0124463 | 3300048918 | Bacteria | 2123 |
| 435 | Ga0496116_0004809 | 3300048919 | Bacteria | 12742 |
| 436 | Ga0496116_0005657 | 3300048919 | Bacteria | 11507 |
| 437 | Ga0496117_0000317 | 3300048920 | Bacteria | 84472 |
| 438 | Ga0496117_0000977 | 3300048920 | Bacteria | 43773 |
| 439 | Ga0496117_0021552 | 3300048920 | Bacteria | 5207 |
| 440 | Ga0496118_0000144 | 3300048921 | Bacteria | 124411 |
| 441 | Ga0496118_0000303 | 3300048921 | Bacteria | 85332 |
| 442 | Ga0496120_0001824 | 3300048923 | Bacteria | 23801 |
| 443 | Ga0496121_0000697 | 3300048924 | Bacteria | 62465 |
| 444 | Ga0496121_0000780 | 3300048924 | Bacteria | 58378 |
| 445 | Ga0496121_0000977 | 3300048924 | Bacteria | 51197 |
| 446 | Ga0496124_0000177 | 3300048927 | Bacteria | 128355 |
| 447 | Ga0496124_0000214 | 3300048927 | Bacteria | 113007 |
| 448 | Ga0496124_0001377 | 3300048927 | Bacteria | 36428 |
| 449 | Ga0496125_0000850 | 3300048928 | Bacteria | 49000 |
| 450 | Ga0496125_0001995 | 3300048928 | Bacteria | 27692 |
| 451 | Ga0496126_0000505 | 3300048929 | Bacteria | 76567 |
| 452 | Ga0496126_0165650 | 3300048929 | Bacteria | 1886 |
| 453 | Ga0501290_000061 | 3300049513 | Bacteria | 15078 |
| 454 | Ga0501292_000163 | 3300049515 | Bacteria | 10842 |
| 455 | Ga0501300_001891 | 3300049523 | Bacteria | 3123 |
| 456 | Ga0501031_0017275 | 3300049568 | Bacteria | 4688 |
| 457 | Ga0501031_0042832 | 3300049568 | Bacteria | 2955 |
| 458 | Ga0501032_0025126 | 3300049569 | Bacteria | 4107 |
| 459 | Ga0501032_0036933 | 3300049569 | Bacteria | 3333 |
| 460 | Ga0501033_0008987 | 3300049570 | Bacteria | 7714 |
| 461 | Ga0501033_0021051 | 3300049570 | Bacteria | 4923 |
| 462 | Ga0501033_0031944 | 3300049570 | Bacteria | 3952 |
| 463 | Ga0501034_0000247 | 3300049571 | Bacteria | 99828 |
| 464 | Ga0501034_0004140 | 3300049571 | Bacteria | 16237 |
| 465 | Ga0501034_0007071 | 3300049571 | Bacteria | 11968 |
| 466 | Ga0501034_0007660 | 3300049571 | Bacteria | 11490 |
| 467 | Ga0501034_0041050 | 3300049571 | Bacteria | 4681 |
| 468 | Ga0501034_0058090 | 3300049571 | Bacteria | 3888 |
| 469 | Ga0501034_0058266 | 3300049571 | Bacteria | 3881 |
| 470 | Ga0501036_0086031 | 3300049572 | Bacteria | 2658 |
| 471 | Ga0501037_0000753 | 3300049573 | Bacteria | 24482 |
| 472 | Ga0501037_0008277 | 3300049573 | Bacteria | 7624 |
| 473 | Ga0501037_0126663 | 3300049573 | Bacteria | 1833 |
| 474 | Ga0501039_0074875 | 3300049575 | Bacteria | 2632 |
| 475 | Ga0501041_0010481 | 3300049577 | Bacteria | 5462 |
| 476 | Ga0501042_0005477 | 3300049578 | Bacteria | 8177 |
| 477 | Ga0501043_0000031 | 3300049579 | Bacteria | 140707 |
| 478 | Ga0501043_0021229 | 3300049579 | Bacteria | 5090 |
| 479 | Ga0501046_0003147 | 3300049580 | Bacteria | 15238 |
| 480 | Ga0501046_0013927 | 3300049580 | Bacteria | 6792 |
| 481 | Ga0501046_0032485 | 3300049580 | Bacteria | 4226 |
| 482 | Ga0501047_0001238 | 3300049581 | Bacteria | 25278 |
| 483 | Ga0501047_0005504 | 3300049581 | Bacteria | 11918 |
| 484 | Ga0501047_0031114 | 3300049581 | Bacteria | 5147 |
| 485 | Ga0501047_0039175 | 3300049581 | Bacteria | 4585 |
| 486 | Ga0501047_0051713 | 3300049581 | Bacteria | 3970 |
| 487 | Ga0501047_0113988 | 3300049581 | Bacteria | 2585 |
| 488 | Ga0501047_0233092 | 3300049581 | Bacteria | 1694 |
| 489 | Ga0501068_0022282 | 3300049584 | Bacteria | 3703 |
| 490 | Ga0501068_0039213 | 3300049584 | Bacteria | 2840 |
| 491 | Ga0501068_0064517 | 3300049584 | Bacteria | 2229 |
| 492 | Ga0501069_0000362 | 3300049585 | Bacteria | 20433 |
| 493 | Ga0501070_0006517 | 3300049586 | Bacteria | 9928 |
| 494 | Ga0501070_0102857 | 3300049586 | Bacteria | 2362 |
| 495 | Ga0501070_0137367 | 3300049586 | Bacteria | 2018 |
| 496 | Ga0501070_0177650 | 3300049586 | Bacteria | 1752 |
| 497 | Ga0501071_0036454 | 3300049587 | Bacteria | 3508 |
| 498 | Ga0501071_0090456 | 3300049587 | Bacteria | 2247 |
| 499 | Ga0501072_0005871 | 3300049588 | Bacteria | 9351 |
| 500 | Ga0501072_0166725 | 3300049588 | Bacteria | 1757 |
| 501 | Ga0501073_0029473 | 3300049589 | Bacteria | 3921 |
| 502 | Ga0501073_0050501 | 3300049589 | Bacteria | 2914 |
| 503 | Ga0501073_0069905 | 3300049589 | Bacteria | 2446 |
| 504 | Ga0501073_0071284 | 3300049589 | Bacteria | 2421 |
| 505 | Ga0501073_0072782 | 3300049589 | Bacteria | 2393 |
| 506 | Ga0501074_0004186 | 3300049590 | Bacteria | 10310 |
| 507 | Ga0501074_0040878 | 3300049590 | Bacteria | 3357 |
| 508 | Ga0501074_0153203 | 3300049590 | Bacteria | 1647 |
| 509 | Ga0501075_0034007 | 3300049591 | Bacteria | 3794 |
| 510 | Ga0501075_0056774 | 3300049591 | Bacteria | 2948 |
| 511 | Ga0501076_0037460 | 3300049592 | Bacteria | 3803 |
| 512 | Ga0501076_0071397 | 3300049592 | Bacteria | 2777 |
| 513 | Ga0501077_0001516 | 3300049593 | Bacteria | 14004 |
| 514 | Ga0501077_0070310 | 3300049593 | Bacteria | 2218 |
| 515 | Ga0501206_001361 | 3300049653 | Bacteria | 3057 |
| 516 | Ga0501261_000233 | 3300049690 | Bacteria | 7670 |
| 517 | Ga0501079_0057846 | 3300049741 | Bacteria | 2991 |
| 518 | Ga0501079_0084498 | 3300049741 | Bacteria | 2455 |
| 519 | Ga0501079_0116550 | 3300049741 | Bacteria | 2076 |
| 520 | Ga0501080_0016292 | 3300049742 | Bacteria | 6862 |
| 521 | Ga0501080_0035176 | 3300049742 | Bacteria | 4676 |
| 522 | Ga0501080_0043040 | 3300049742 | Bacteria | 4204 |
| 523 | Ga0501080_0065110 | 3300049742 | Bacteria | 3391 |
| 524 | Ga0501080_0070496 | 3300049742 | Bacteria | 3251 |
| 525 | Ga0501080_0112273 | 3300049742 | Bacteria | 2526 |
| 526 | Ga0501081_0002741 | 3300049743 | Bacteria | 11161 |
| 527 | Ga0501081_0011071 | 3300049743 | Bacteria | 5899 |
| 528 | Ga0501081_0020147 | 3300049743 | Bacteria | 4446 |
| 529 | Ga0501081_0024549 | 3300049743 | Bacteria | 4048 |
| 530 | Ga0501083_0001104 | 3300049744 | Bacteria | 18056 |
| 531 | Ga0501083_0068490 | 3300049744 | Bacteria | 2361 |
| 532 | Ga0501279_000070 | 3300049775 | Bacteria | 17566 |
| 533 | Ga0501035_0000036 | 3300049822 | Bacteria | 165008 |
| 534 | Ga0501035_0018367 | 3300049822 | Bacteria | 6444 |
| 535 | Ga0501035_0024745 | 3300049822 | Bacteria | 5504 |
| 536 | Ga0501035_0100874 | 3300049822 | Bacteria | 2534 |
| 537 | Ga0501035_0147909 | 3300049822 | Bacteria | 2040 |
| 538 | Ga0501044_0000011 | 3300049823 | Bacteria | 257385 |
| 539 | Ga0501044_0037901 | 3300049823 | Bacteria | 5037 |
| 540 | Ga0501044_0046332 | 3300049823 | Bacteria | 4502 |
| 541 | Ga0501044_0124848 | 3300049823 | Bacteria | 2572 |
| 542 | Ga0501044_0139308 | 3300049823 | Bacteria | 2415 |
| 543 | Ga0501044_0175169 | 3300049823 | Bacteria | 2114 |
| 544 | Ga0501045_0067200 | 3300049824 | Bacteria | 2632 |
| 545 | nmdc:mga00v17_67988_c1 | 3300050491 | Bacteria | 2202 |
| 546 | nmdc:mga0yw44_3978_c1 | 3300050492 | Bacteria | 6678 |
| 547 | nmdc:mga0yw44_7148_c1 | 3300050492 | Bacteria | 5468 |
| 548 | nmdc:mga0k408_21519_c1 | 3300050493 | Bacteria | 3623 |
| 549 | nmdc:mga06z11_36709_c1 | 3300050494 | Bacteria | 2421 |
| 550 | nmdc:mga07m45_9818_c1 | 3300050496 | Bacteria | 4978 |
| 551 | nmdc:mga05p37_26358_c1 | 3300050507 | Bacteria | 7070 |
| 552 | nmdc:mga05p37_5957_c1 | 3300050507 | Bacteria | 14345 |
| 553 | nmdc:mga05p37_6958_c1 | 3300050507 | Bacteria | 13331 |
| 554 | nmdc:mga05p37_79380_c1 | 3300050507 | Bacteria | 4041 |
| 555 | nmdc:mga09592_43052_c1 | 3300050508 | Bacteria | 3799 |
| 556 | nmdc:mga06r32_102779_c1 | 3300050510 | Bacteria | 2806 |
| 557 | nmdc:mga06r32_140339_c1 | 3300050510 | Bacteria | 2392 |
| 558 | nmdc:mga06r32_32705_c1 | 3300050510 | Bacteria | 4896 |
| 559 | nmdc:mga06r32_78400_c1 | 3300050510 | Bacteria | 3211 |
| 560 | nmdc:mga08y16_32250_c1 | 3300050511 | Bacteria | 5509 |
| 561 | nmdc:mga08y16_67602_c1 | 3300050511 | Bacteria | 3727 |
| 562 | nmdc:mga0n895_15036_c1 | 3300050512 | Bacteria | 7051 |
| 563 | nmdc:mga0n895_42047_c1 | 3300050512 | Bacteria | 4445 |
| 564 | nmdc:mga0rr50_11883_c1 | 3300050513 | Bacteria | 5595 |
| 565 | nmdc:mga08x19_1569_c1 | 3300050514 | Bacteria | 14173 |
| 566 | nmdc:mga08x19_4_c1 | 3300050514 | Bacteria | 335979 |
| 567 | nmdc:mga0a205_125884_c1 | 3300050515 | Bacteria | 2462 |
| 568 | nmdc:mga0sz30_8254_c1 | 3300050516 | Bacteria | 3925 |
| 569 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 570 | Ga0495601_0001378 | 3300053077 | Bacteria | 13376 |
| 571 | Ga0495601_0001923 | 3300053077 | Bacteria | 11622 |
| 572 | Ga0495601_0007958 | 3300053077 | Bacteria | 6242 |
| 573 | Ga0495601_0059481 | 3300053077 | Bacteria | 2423 |
| 574 | Ga0495612_0000055 | 3300053078 | Bacteria | 50683 |
| 575 | Ga0495612_0013710 | 3300053078 | Bacteria | 3265 |
| 576 | Ga0495612_0016114 | 3300053078 | Bacteria | 2994 |
| 577 | Ga0500610_0000312 | 3300053079 | Bacteria | 14602 |
| 578 | Ga0500610_0019460 | 3300053079 | Bacteria | 3300 |
| 579 | Ga0495595_0000044 | 3300053084 | Bacteria | 63329 |
| 580 | Ga0495595_0000495 | 3300053084 | Bacteria | 15043 |
| 581 | Ga0495595_0000953 | 3300053084 | Bacteria | 11131 |
| 582 | Ga0495595_0017397 | 3300053084 | Bacteria | 3093 |
| 583 | Ga0495595_0063149 | 3300053084 | Bacteria | 1738 |
| 584 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 585 | Ga0495619_0000460 | 3300053085 | Bacteria | 27480 |
| 586 | Ga0495619_0008699 | 3300053085 | Bacteria | 6420 |
| 587 | Ga0495619_0044490 | 3300053085 | Bacteria | 2914 |
| 588 | Ga0500643_000693 | 3300053087 | Bacteria | 22498 |
| 589 | Ga0500648_042009 | 3300053097 | Bacteria | 2595 |
| 590 | Ga0500555_008037 | 3300053103 | Bacteria | 3004 |
| 591 | Ga0500572_001347 | 3300053111 | Bacteria | 6809 |
| 592 | Ga0500595_003443 | 3300053119 | Bacteria | 7383 |
| 593 | Ga0500642_0001967 | 3300053130 | Bacteria | 5964 |
| 594 | Ga0500652_000015 | 3300053131 | Bacteria | 131012 |
| 595 | Ga0500559_0001369 | 3300053136 | Bacteria | 13979 |
| 596 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 597 | Ga0500573_0000012 | 3300053140 | Bacteria | 208486 |
| 598 | Ga0500573_0037223 | 3300053140 | Bacteria | 2810 |
| 599 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 600 | Ga0500616_0019516 | 3300053153 | Bacteria | 3820 |
| 601 | Ga0500616_0026183 | 3300053153 | Bacteria | 3230 |
| 602 | Ga0500620_000453 | 3300053155 | Bacteria | 7382 |
| 603 | Ga0500622_0010865 | 3300053156 | Bacteria | 4974 |
| 604 | Ga0500636_0001961 | 3300053177 | Bacteria | 11325 |
| 605 | Ga0500576_008579 | 3300053725 | Bacteria | 4446 |
| 606 | Ga0500645_000062 | 3300053730 | Bacteria | 85561 |
| 607 | Ga0500596_000569 | 3300053735 | Bacteria | 7028 |
| 608 | Ga0501084_0000049 | 3300054114 | Bacteria | 94947 |
| 609 | Ga0501084_0006511 | 3300054114 | Bacteria | 9597 |
| 610 | Ga0501082_0017709 | 3300060353 | Bacteria | 6135 |
| 611 | Ga0501082_0024992 | 3300060353 | Bacteria | 5146 |
| 612 | Ga0501082_0127206 | 3300060353 | Bacteria | 2210 |
| 613 | Ga0530510_0055624 | 3300061734 | Bacteria | 2858 |
| 614 | Ga0530510_0080675 | 3300061734 | Bacteria | 2368 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0072782 | Ga0501073_0072782_855_2381 | 501 |
| 2 | 3300048905 | Ga0496102_0097769 | Ga0496102_0097769_46_1590 | 504 |
| 3 | 3300048907 | Ga0496104_0042159 | Ga0496104_0042159_2682_4226 | 504 |
| 4 | 3300049590 | Ga0501074_0153203 | Ga0501074_0153203_38_1582 | 504 |
| 5 | 3300048906 | Ga0496103_0032806 | Ga0496103_0032806_1596_3140 | 506 |
| 6 | 3300050515 | nmdc:mga0a205_125884_c1 | nmdc:mga0a205_125884_c1_10_1536 | 508 |
| 7 | 3300049572 | Ga0501036_0086031 | Ga0501036_0086031_1065_2606 | 513 |
| 8 | 3300049570 | Ga0501033_0031944 | Ga0501033_0031944_2398_3942 | 514 |
| 9 | 3300049573 | Ga0501037_0126663 | Ga0501037_0126663_267_1811 | 514 |
| 10 | 3300049581 | Ga0501047_0005504 | Ga0501047_0005504_61_1605 | 514 |
| 11 | 3300049581 | Ga0501047_0233092 | Ga0501047_0233092_97_1641 | 514 |
| 12 | 3300049586 | Ga0501070_0177650 | Ga0501070_0177650_167_1711 | 514 |
| 13 | iso_pu_bacteria | 2922185730 | 2922186489 | 528 |
| 14 | 3300046474 | Ga0495605_0036971 | Ga0495605_0036971_11_1600 | 529 |
| 15 | 3300048912 | Ga0496109_0148649 | Ga0496109_0148649_40_1671 | 533 |
| 16 | 3300035724 | Ga0373933_0096345 | Ga0373933_0096345_117_1748 | 535 |
| 17 | iso_pu_bacteria | 2979793036 | 2979798262 | 536 |
| 18 | 3300049571 | Ga0501034_0058090 | Ga0501034_0058090_39_1667 | 542 |
| 19 | 3300009551 | Ga0105238_10081246 | Ga0105238_100812464 | 543 |
| 20 | 3300020069 | Ga0197907_10465604 | Ga0197907_104656041 | 543 |
| 21 | 3300035084 | Ga0373928_0008564 | Ga0373928_0008564_63_1694 | 543 |
| 22 | 3300035691 | Ga0373931_0013316 | Ga0373931_0013316_1121_2752 | 543 |
| 23 | 3300035691 | Ga0373931_0060489 | Ga0373931_0060489_68_1699 | 543 |
| 24 | 3300035725 | Ga0373947_0039728 | Ga0373947_0039728_11_1642 | 543 |
| 25 | 3300037068 | Ga0373925_0084541 | Ga0373925_0084541_759_2390 | 543 |
| 26 | 3300038443 | Ga0395901_0038577 | Ga0395901_0038577_31_1662 | 543 |
| 27 | 3300046525 | Ga0495663_0001212 | Ga0495663_0001212_65_1696 | 543 |
| 28 | 3300048929 | Ga0496126_0165650 | Ga0496126_0165650_22_1653 | 543 |
| 29 | 3300049568 | Ga0501031_0042832 | Ga0501031_0042832_51_1754 | 543 |
| 30 | 3300049570 | Ga0501033_0021051 | Ga0501033_0021051_1063_2694 | 543 |
| 31 | 3300049578 | Ga0501042_0005477 | Ga0501042_0005477_3740_5371 | 543 |
| 32 | 3300049586 | Ga0501070_0102857 | Ga0501070_0102857_666_2297 | 543 |
| 33 | 3300049588 | Ga0501072_0166725 | Ga0501072_0166725_73_1704 | 543 |
| 34 | 3300049589 | Ga0501073_0071284 | Ga0501073_0071284_769_2400 | 543 |
| 35 | 3300049593 | Ga0501077_0070310 | Ga0501077_0070310_23_1654 | 543 |
| 36 | 3300049742 | Ga0501080_0070496 | Ga0501080_0070496_25_1656 | 543 |
| 37 | 3300049822 | Ga0501035_0147909 | Ga0501035_0147909_395_2026 | 543 |
| 38 | 3300049823 | Ga0501044_0037901 | Ga0501044_0037901_757_2388 | 543 |
| 39 | 3300050510 | nmdc:mga06r32_102779_c1 | nmdc:mga06r32_102779_c1_1143_2774 | 543 |
| 40 | 3300053084 | Ga0495595_0063149 | Ga0495595_0063149_93_1727 | 543 |
| 41 | 3300053140 | Ga0500573_0037223 | Ga0500573_0037223_1053_2684 | 543 |
| 42 | 3300053153 | Ga0500616_0026183 | Ga0500616_0026183_1520_3154 | 543 |
| 43 | 3300060353 | Ga0501082_0127206 | Ga0501082_0127206_545_2176 | 543 |
| 44 | 3300035724 | Ga0373933_0002040 | Ga0373933_0002040_3425_5164 | 550 |
| 45 | 3300036401 | Ga0373937_0003145 | Ga0373937_0003145_4021_5760 | 550 |
| 46 | 3300039450 | Ga0436363_1572801 | Ga0436363_1572801_148_1872 | 550 |
| 47 | 3300046462 | Ga0495651_0010936 | Ga0495651_0010936_3847_5586 | 550 |
| 48 | 3300046675 | Ga0495657_0018882 | Ga0495657_0018882_1019_2758 | 550 |
| 49 | 3300053077 | Ga0495601_0001923 | Ga0495601_0001923_7788_9527 | 550 |
| 50 | 3300053078 | Ga0495612_0013710 | Ga0495612_0013710_52_1791 | 550 |
| 51 | 3300053084 | Ga0495595_0000953 | Ga0495595_0000953_2638_4377 | 550 |
| 52 | 3300053085 | Ga0495619_0044490 | Ga0495619_0044490_968_2707 | 550 |
| 53 | iso_pu_bacteria | 2889790730 | 2889792246 | 555 |
| 54 | iso_pu_bacteria | 2958172287 | 2958177214 | 557 |
| 55 | 3300035083 | Ga0373926_0026571 | Ga0373926_0026571_37_1716 | 559 |
| 56 | 3300005436 | Ga0070713_100076504 | Ga0070713_1000765042 | 563 |
| 57 | 3300007788 | Ga0099795_10000411 | Ga0099795_100004117 | 563 |
| 58 | 3300027512 | Ga0209179_1000852 | Ga0209179_10008522 | 563 |
| 59 | 3300035111 | Ga0373923_0000396 | Ga0373923_0000396_3101_4825 | 563 |
| 60 | 3300035113 | Ga0373936_0002567 | Ga0373936_0002567_3181_4905 | 563 |
| 61 | 3300035118 | Ga0373954_0015428 | Ga0373954_0015428_925_2649 | 563 |
| 62 | 3300035171 | Ga0373946_0000630 | Ga0373946_0000630_5535_7259 | 563 |
| 63 | 3300035172 | Ga0373955_0000525 | Ga0373955_0000525_12386_14110 | 563 |
| 64 | 3300035410 | Ga0373924_0001066 | Ga0373924_0001066_3520_5244 | 563 |
| 65 | 3300035692 | Ga0373935_0000006 | Ga0373935_0000006_108274_109998 | 563 |
| 66 | 3300035724 | Ga0373933_0005418 | Ga0373933_0005418_5041_6765 | 563 |
| 67 | 3300035725 | Ga0373947_0000394 | Ga0373947_0000394_13614_15338 | 563 |
| 68 | 3300036401 | Ga0373937_0004380 | Ga0373937_0004380_1572_3296 | 563 |
| 69 | 3300037068 | Ga0373925_0000776 | Ga0373925_0000776_10697_12421 | 563 |
| 70 | 3300046454 | Ga0495592_0000742 | Ga0495592_0000742_7708_9432 | 563 |
| 71 | 3300046462 | Ga0495651_0002087 | Ga0495651_0002087_10376_12100 | 563 |
| 72 | 3300046463 | Ga0495653_0000203 | Ga0495653_0000203_34573_36297 | 563 |
| 73 | 3300046476 | Ga0495662_0007282 | Ga0495662_0007282_2423_4147 | 563 |
| 74 | 3300046477 | Ga0495664_0000017 | Ga0495664_0000017_148454_150178 | 563 |
| 75 | 3300046511 | Ga0495608_0000058 | Ga0495608_0000058_68758_70482 | 563 |
| 76 | 3300046514 | Ga0495618_0000049 | Ga0495618_0000049_53282_55006 | 563 |
| 77 | 3300046516 | Ga0495628_0000022 | Ga0495628_0000022_121600_123324 | 563 |
| 78 | 3300046517 | Ga0495630_0010063 | Ga0495630_0010063_442_2166 | 563 |
| 79 | 3300046529 | Ga0495652_0000008 | Ga0495652_0000008_220314_222038 | 563 |
| 80 | 3300046533 | Ga0495640_0000727 | Ga0495640_0000727_9906_11630 | 563 |
| 81 | 3300046536 | Ga0495587_0000019 | Ga0495587_0000019_11957_13681 | 563 |
| 82 | 3300046543 | Ga0495645_0000006 | Ga0495645_0000006_193342_195066 | 563 |
| 83 | 3300046559 | Ga0495667_0000090 | Ga0495667_0000090_10672_12396 | 563 |
| 84 | 3300046642 | Ga0495634_0002729 | Ga0495634_0002729_12393_14117 | 563 |
| 85 | 3300046663 | Ga0495635_0000023 | Ga0495635_0000023_12189_13913 | 563 |
| 86 | 3300046675 | Ga0495657_0001777 | Ga0495657_0001777_6065_7789 | 563 |
| 87 | 3300046678 | Ga0495599_0000039 | Ga0495599_0000039_84016_85740 | 563 |
| 88 | 3300046679 | Ga0495623_0000073 | Ga0495623_0000073_10655_12379 | 563 |
| 89 | 3300046680 | Ga0495646_0000017 | Ga0495646_0000017_107520_109244 | 563 |
| 90 | 3300046690 | Ga0495624_0006011 | Ga0495624_0006011_5366_7090 | 563 |
| 91 | 3300046809 | Ga0495600_0000043 | Ga0495600_0000043_12947_14671 | 563 |
| 92 | 3300047315 | Ga0495581_0007230 | Ga0495581_0007230_2288_4012 | 563 |
| 93 | 3300047317 | Ga0495604_0000030 | Ga0495604_0000030_15146_16870 | 563 |
| 94 | 3300047319 | Ga0495674_0000009 | Ga0495674_0000009_187028_188752 | 563 |
| 95 | 3300047322 | Ga0495680_0000307 | Ga0495680_0000307_52707_54431 | 563 |
| 96 | 3300047444 | Ga0495675_0001007 | Ga0495675_0001007_4748_6472 | 563 |
| 97 | 3300047471 | Ga0495684_0000031 | Ga0495684_0000031_46287_48011 | 563 |
| 98 | 3300047673 | Ga0495593_0001311 | Ga0495593_0001311_11123_12847 | 563 |
| 99 | 3300048088 | Ga0495602_0000006 | Ga0495602_0000006_148404_150128 | 563 |
| 100 | 3300053077 | Ga0495601_0000007 | Ga0495601_0000007_215930_217654 | 563 |
| 101 | 3300053078 | Ga0495612_0000055 | Ga0495612_0000055_46149_47873 | 563 |
| 102 | 3300053084 | Ga0495595_0000044 | Ga0495595_0000044_46950_48674 | 563 |
| 103 | 3300053085 | Ga0495619_0000023 | Ga0495619_0000023_16059_17783 | 563 |
| 104 | 3300001979 | JGI24740J21852_10002718 | JGI24740J21852_100027185 | 564 |
| 105 | 3300005436 | Ga0070713_100101050 | Ga0070713_1001010501 | 564 |
| 106 | 3300005834 | Ga0068851_10040828 | Ga0068851_100408282 | 564 |
| 107 | 3300005937 | Ga0081455_10003870 | Ga0081455_100038705 | 564 |
| 108 | 3300006914 | Ga0075436_100007214 | Ga0075436_1000072144 | 564 |
| 109 | 3300009147 | Ga0114129_10009088 | Ga0114129_100090885 | 564 |
| 110 | 3300009174 | Ga0105241_10001829 | Ga0105241_1000182910 | 564 |
| 111 | 3300009551 | Ga0105238_10005879 | Ga0105238_100058796 | 564 |
| 112 | 3300025911 | Ga0207654_10001335 | Ga0207654_100013355 | 564 |
| 113 | 3300025913 | Ga0207695_10000402 | Ga0207695_1000040210 | 564 |
| 114 | 3300025924 | Ga0207694_10000095 | Ga0207694_1000009561 | 564 |
| 115 | 3300025949 | Ga0207667_10010528 | Ga0207667_100105286 | 564 |
| 116 | 3300025981 | Ga0207640_10029840 | Ga0207640_100298402 | 564 |
| 117 | 3300026078 | Ga0207702_10000025 | Ga0207702_1000002594 | 564 |
| 118 | 3300026142 | Ga0207698_10018802 | Ga0207698_100188024 | 564 |
| 119 | 3300035086 | Ga0373934_0012745 | Ga0373934_0012745_1136_2860 | 564 |
| 120 | 3300035089 | Ga0373944_0021605 | Ga0373944_0021605_23_1747 | 564 |
| 121 | 3300035116 | Ga0373945_0008605 | Ga0373945_0008605_1106_2830 | 564 |
| 122 | 3300035170 | Ga0373943_0000297 | Ga0373943_0000297_14752_16476 | 564 |
| 123 | 3300035171 | Ga0373946_0009980 | Ga0373946_0009980_1663_3387 | 564 |
| 124 | 3300035172 | Ga0373955_0017841 | Ga0373955_0017841_1374_3098 | 564 |
| 125 | 3300035692 | Ga0373935_0001125 | Ga0373935_0001125_8481_10205 | 564 |
| 126 | 3300035695 | Ga0373927_0002633 | Ga0373927_0002633_1282_3006 | 564 |
| 127 | 3300035725 | Ga0373947_0000159 | Ga0373947_0000159_19922_21646 | 564 |
| 128 | 3300036401 | Ga0373937_0005696 | Ga0373937_0005696_1801_3525 | 564 |
| 129 | 3300037068 | Ga0373925_0008020 | Ga0373925_0008020_1410_3134 | 564 |
| 130 | 3300039447 | Ga0436361_0484868 | Ga0436361_0484868_1248_2972 | 564 |
| 131 | 3300046462 | Ga0495651_0073803 | Ga0495651_0073803_183_1907 | 564 |
| 132 | 3300046524 | Ga0495648_0000895 | Ga0495648_0000895_12451_14175 | 564 |
| 133 | 3300046531 | Ga0495665_0025630 | Ga0495665_0025630_1220_2944 | 564 |
| 134 | 3300046689 | Ga0495613_0010367 | Ga0495613_0010367_437_2161 | 564 |
| 135 | 3300046690 | Ga0495624_0002118 | Ga0495624_0002118_5284_7008 | 564 |
| 136 | 3300047673 | Ga0495593_0004675 | Ga0495593_0004675_2471_4195 | 564 |
| 137 | 3300048913 | Ga0496110_0085005 | Ga0496110_0085005_1020_2744 | 564 |
| 138 | 3300048928 | Ga0496125_0000850 | Ga0496125_0000850_45474_47264 | 564 |
| 139 | 3300049571 | Ga0501034_0041050 | Ga0501034_0041050_1228_2952 | 564 |
| 140 | 3300049589 | Ga0501073_0029473 | Ga0501073_0029473_948_2672 | 564 |
| 141 | 3300050493 | nmdc:mga0k408_21519_c1 | nmdc:mga0k408_21519_c1_1108_2832 | 564 |
| 142 | 3300050507 | nmdc:mga05p37_5957_c1 | nmdc:mga05p37_5957_c1_3309_5033 | 564 |
| 143 | 3300050514 | nmdc:mga08x19_1569_c1 | nmdc:mga08x19_1569_c1_10967_12691 | 564 |
| 144 | 3300053111 | Ga0500572_001347 | Ga0500572_001347_4181_5905 | 564 |
| 145 | 3300053136 | Ga0500559_0001369 | Ga0500559_0001369_7356_9080 | 564 |
| 146 | 3300053725 | Ga0500576_008579 | Ga0500576_008579_1590_3314 | 564 |
| 147 | 3300005937 | Ga0081455_10011629 | Ga0081455_100116292 | 565 |
| 148 | 3300009147 | Ga0114129_10005706 | Ga0114129_100057067 | 565 |
| 149 | 3300025916 | Ga0207663_10110512 | Ga0207663_101105121 | 565 |
| 150 | 3300050507 | nmdc:mga05p37_26358_c1 | nmdc:mga05p37_26358_c1_5118_6842 | 565 |
| 151 | 3300050513 | nmdc:mga0rr50_11883_c1 | nmdc:mga0rr50_11883_c1_2008_3732 | 565 |
| 152 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_883118_884842 | 565 |
| 153 | 3300005367 | Ga0070667_100101319 | Ga0070667_1001013192 | 566 |
| 154 | 3300005436 | Ga0070713_100017657 | Ga0070713_1000176572 | 566 |
| 155 | 3300005466 | Ga0070685_10040776 | Ga0070685_100407762 | 566 |
| 156 | 3300005618 | Ga0068864_100064771 | Ga0068864_1000647711 | 566 |
| 157 | 3300006028 | Ga0070717_10002040 | Ga0070717_100020404 | 566 |
| 158 | 3300025898 | Ga0207692_10028531 | Ga0207692_100285311 | 566 |
| 159 | 3300025900 | Ga0207710_10009424 | Ga0207710_100094242 | 566 |
| 160 | 3300025915 | Ga0207693_10047013 | Ga0207693_100470133 | 566 |
| 161 | 3300025928 | Ga0207700_10014504 | Ga0207700_100145044 | 566 |
| 162 | 3300025939 | Ga0207665_10003464 | Ga0207665_100034648 | 566 |
| 163 | 3300026067 | Ga0207678_10106267 | Ga0207678_101062672 | 566 |
| 164 | 3300031711 | Ga0265314_10002282 | Ga0265314_1000228212 | 566 |
| 165 | 3300036401 | Ga0373937_0007971 | Ga0373937_0007971_201_1925 | 566 |
| 166 | 3300039447 | Ga0436361_0722712 | Ga0436361_0722712_117_1841 | 566 |
| 167 | 3300046454 | Ga0495592_0009467 | Ga0495592_0009467_5283_7007 | 566 |
| 168 | 3300046463 | Ga0495653_0061411 | Ga0495653_0061411_336_2060 | 566 |
| 169 | 3300046511 | Ga0495608_0056757 | Ga0495608_0056757_298_2022 | 566 |
| 170 | 3300046516 | Ga0495628_0021240 | Ga0495628_0021240_463_2187 | 566 |
| 171 | 3300046529 | Ga0495652_0013568 | Ga0495652_0013568_2036_3760 | 566 |
| 172 | 3300046543 | Ga0495645_0003951 | Ga0495645_0003951_323_2047 | 566 |
| 173 | 3300046663 | Ga0495635_0017526 | Ga0495635_0017526_2932_4656 | 566 |
| 174 | 3300046678 | Ga0495599_0020966 | Ga0495599_0020966_389_2113 | 566 |
| 175 | 3300046679 | Ga0495623_0014617 | Ga0495623_0014617_2713_4437 | 566 |
| 176 | 3300046809 | Ga0495600_0010303 | Ga0495600_0010303_3781_5505 | 566 |
| 177 | 3300047317 | Ga0495604_0031736 | Ga0495604_0031736_482_2206 | 566 |
| 178 | 3300047322 | Ga0495680_0034783 | Ga0495680_0034783_1606_3330 | 566 |
| 179 | 3300048088 | Ga0495602_0093924 | Ga0495602_0093924_206_1930 | 566 |
| 180 | 3300048903 | Ga0496100_0045603 | Ga0496100_0045603_901_2625 | 566 |
| 181 | 3300048907 | Ga0496104_0000116 | Ga0496104_0000116_48923_50647 | 566 |
| 182 | 3300048908 | Ga0496105_0014705 | Ga0496105_0014705_3535_5259 | 566 |
| 183 | 3300048912 | Ga0496109_0063593 | Ga0496109_0063593_1462_3186 | 566 |
| 184 | 3300053077 | Ga0495601_0001378 | Ga0495601_0001378_759_2483 | 566 |
| 185 | 3300053078 | Ga0495612_0016114 | Ga0495612_0016114_465_2189 | 566 |
| 186 | 3300053084 | Ga0495595_0000495 | Ga0495595_0000495_155_1879 | 566 |
| 187 | 3300053084 | Ga0495595_0017397 | Ga0495595_0017397_219_1943 | 566 |
| 188 | 3300053085 | Ga0495619_0000460 | Ga0495619_0000460_21873_23597 | 566 |
| 189 | 3300053085 | Ga0495619_0008699 | Ga0495619_0008699_4581_6305 | 566 |
| 190 | iso_pu_bacteria | 2889306138 | 2889307804 | 566 |
| 191 | iso_pu_bacteria | 2902405164 | 2902406931 | 566 |
| 192 | 3300031727 | Ga0316576_10036561 | Ga0316576_100365611 | 568 |
| 193 | 3300025916 | Ga0207663_10074920 | Ga0207663_100749202 | 569 |
| 194 | 3300053156 | Ga0500622_0010865 | Ga0500622_0010865_2512_4242 | 569 |
| 195 | 3300053177 | Ga0500636_0001961 | Ga0500636_0001961_3461_5191 | 569 |
| 196 | iso_pu_bacteria | 2883291878 | 2883294602 | 569 |
| 197 | iso_pu_bacteria | 2883354860 | 2883356900 | 569 |
| 198 | iso_pu_bacteria | 2503198000 | 2503202012 | 570 |
| 199 | iso_pu_bacteria | 2508501123 | 2509115565 | 570 |
| 200 | iso_pu_bacteria | 2508501127 | 2509141740 | 570 |
| 201 | iso_pu_bacteria | 2509276018 | 2509371183 | 570 |
| 202 | iso_pu_bacteria | 2509276022 | 2509396674 | 570 |
| 203 | iso_pu_bacteria | 2510065059 | 2510313841 | 570 |
| 204 | iso_pu_bacteria | 2512875016 | 2512931100 | 570 |
| 205 | iso_pu_bacteria | 2512875024 | 2512958817 | 570 |
| 206 | iso_pu_bacteria | 2513237090 | 2513610939 | 570 |
| 207 | iso_pu_bacteria | 2513237164 | 2514037626 | 570 |
| 208 | iso_pu_bacteria | 2513237305 | 2514420256 | 570 |
| 209 | iso_pu_bacteria | 2588253730 | 2588516859 | 570 |
| 210 | iso_pu_bacteria | 2643221595 | 2643989198 | 570 |
| 211 | iso_pu_bacteria | 2643221627 | 2644152770 | 570 |
| 212 | iso_pu_bacteria | 2643221629 | 2644166871 | 570 |
| 213 | iso_pu_bacteria | 2643221662 | 2644349385 | 570 |
| 214 | iso_pu_bacteria | 2687453392 | 2688598826 | 570 |
| 215 | iso_pu_bacteria | 2693429783 | 2694629835 | 570 |
| 216 | iso_pu_bacteria | 2693429784 | 2694636292 | 570 |
| 217 | iso_pu_bacteria | 2721755686 | 2723575772 | 570 |
| 218 | iso_pu_bacteria | 2738541281 | 2738746226 | 570 |
| 219 | iso_pu_bacteria | 2738543032 | 2739355456 | 570 |
| 220 | iso_pu_bacteria | 2756170246 | 2756675714 | 570 |
| 221 | iso_pu_bacteria | 2775506901 | 2776259204 | 570 |
| 222 | iso_pu_bacteria | 2791355123 | 2792749720 | 570 |
| 223 | iso_pu_bacteria | 2837678835 | 2837683123 | 570 |
| 224 | iso_pu_bacteria | 2841734538 | 2841739685 | 570 |
| 225 | iso_pu_bacteria | 2842694124 | 2842697500 | 570 |
| 226 | iso_pu_bacteria | 2844002411 | 2844006220 | 570 |
| 227 | iso_pu_bacteria | 2844009547 | 2844014167 | 570 |
| 228 | iso_pu_bacteria | 2847670302 | 2847675950 | 570 |
| 229 | iso_pu_bacteria | 2847686936 | 2847692604 | 570 |
| 230 | iso_pu_bacteria | 2856314179 | 2856314492 | 570 |
| 231 | iso_pu_bacteria | 2856320880 | 2856325640 | 570 |
| 232 | iso_pu_bacteria | 2856328259 | 2856331517 | 570 |
| 233 | iso_pu_bacteria | 2856334872 | 2856339030 | 570 |
| 234 | iso_pu_bacteria | 2856342000 | 2856342974 | 570 |
| 235 | iso_pu_bacteria | 2856349417 | 2856353897 | 570 |
| 236 | iso_pu_bacteria | 2856356410 | 2856356587 | 570 |
| 237 | iso_pu_bacteria | 2857349434 | 2857350656 | 570 |
| 238 | iso_pu_bacteria | 2857367948 | 2857371037 | 570 |
| 239 | iso_pu_bacteria | 2869162929 | 2869169126 | 570 |
| 240 | iso_pu_bacteria | 2869234852 | 2869235750 | 570 |
| 241 | iso_pu_bacteria | 2869242130 | 2869248477 | 570 |
| 242 | iso_pu_bacteria | 2869249662 | 2869250835 | 570 |
| 243 | iso_pu_bacteria | 2869256925 | 2869262094 | 570 |
| 244 | iso_pu_bacteria | 2869264136 | 2869271121 | 570 |
| 245 | iso_pu_bacteria | 2869271264 | 2869272297 | 570 |
| 246 | iso_pu_bacteria | 2869278585 | 2869279262 | 570 |
| 247 | iso_pu_bacteria | 2871444079 | 2871447030 | 570 |
| 248 | iso_pu_bacteria | 2871451962 | 2871452824 | 570 |
| 249 | iso_pu_bacteria | 2871466892 | 2871472224 | 570 |
| 250 | iso_pu_bacteria | 2871474448 | 2871475961 | 570 |
| 251 | iso_pu_bacteria | 2871481445 | 2871487163 | 570 |
| 252 | iso_pu_bacteria | 2871488783 | 2871495605 | 570 |
| 253 | iso_pu_bacteria | 2871495908 | 2871502861 | 570 |
| 254 | iso_pu_bacteria | 2874116593 | 2874118867 | 570 |
| 255 | iso_pu_bacteria | 2874123672 | 2874130792 | 570 |
| 256 | iso_pu_bacteria | 2874139085 | 2874145009 | 570 |
| 257 | iso_pu_bacteria | 2874146452 | 2874149352 | 570 |
| 258 | iso_pu_bacteria | 2874168670 | 2874174391 | 570 |
| 259 | iso_pu_bacteria | 2876363079 | 2876365644 | 570 |
| 260 | iso_pu_bacteria | 2876377896 | 2876383175 | 570 |
| 261 | iso_pu_bacteria | 2876386047 | 2876388531 | 570 |
| 262 | iso_pu_bacteria | 2876392853 | 2876394608 | 570 |
| 263 | iso_pu_bacteria | 2876399893 | 2876406065 | 570 |
| 264 | iso_pu_bacteria | 2876420981 | 2876424896 | 570 |
| 265 | iso_pu_bacteria | 2878035449 | 2878040021 | 570 |
| 266 | iso_pu_bacteria | 2878738818 | 2878745646 | 570 |
| 267 | iso_pu_bacteria | 2878753008 | 2878757800 | 570 |
| 268 | iso_pu_bacteria | 2878760144 | 2878766753 | 570 |
| 269 | iso_pu_bacteria | 2878767105 | 2878773950 | 570 |
| 270 | iso_pu_bacteria | 2878774303 | 2878775911 | 570 |
| 271 | iso_pu_bacteria | 2878781027 | 2878784017 | 570 |
| 272 | iso_pu_bacteria | 2881147464 | 2881151957 | 570 |
| 273 | iso_pu_bacteria | 2881155292 | 2881155685 | 570 |
| 274 | iso_pu_bacteria | 2881161766 | 2881167904 | 570 |
| 275 | iso_pu_bacteria | 2881853255 | 2881855479 | 570 |
| 276 | iso_pu_bacteria | 2881861095 | 2881868770 | 570 |
| 277 | iso_pu_bacteria | 2882632389 | 2882638676 | 570 |
| 278 | iso_pu_bacteria | 2882912400 | 2882914066 | 570 |
| 279 | iso_pu_bacteria | 2885305155 | 2885309825 | 570 |
| 280 | iso_pu_bacteria | 2885312484 | 2885317572 | 570 |
| 281 | iso_pu_bacteria | 2885318864 | 2885325272 | 570 |
| 282 | iso_pu_bacteria | 2885326080 | 2885329569 | 570 |
| 283 | iso_pu_bacteria | 2888343758 | 2888347253 | 570 |
| 284 | iso_pu_bacteria | 2888350351 | 2888356171 | 570 |
| 285 | iso_pu_bacteria | 2889010040 | 2889011100 | 570 |
| 286 | iso_pu_bacteria | 2889016732 | 2889017175 | 570 |
| 287 | iso_pu_bacteria | 2889914905 | 2889917019 | 570 |
| 288 | iso_pu_bacteria | 2902330777 | 2902336663 | 570 |
| 289 | iso_pu_bacteria | 2903448605 | 2903455431 | 570 |
| 290 | iso_pu_bacteria | 2903492973 | 2903506517 | 570 |
| 291 | iso_pu_bacteria | 2903521522 | 2903523573 | 570 |
| 292 | iso_pu_bacteria | 2903528002 | 2903534207 | 570 |
| 293 | iso_pu_bacteria | 2903540706 | 2903548000 | 570 |
| 294 | iso_pu_bacteria | 2904659560 | 2904661242 | 570 |
| 295 | iso_pu_bacteria | 2906328253 | 2906329644 | 570 |
| 296 | iso_pu_bacteria | 2906363423 | 2906365630 | 570 |
| 297 | iso_pu_bacteria | 2906370794 | 2906372350 | 570 |
| 298 | iso_pu_bacteria | 2906408224 | 2906412956 | 570 |
| 299 | iso_pu_bacteria | 2906414383 | 2906414446 | 570 |
| 300 | iso_pu_bacteria | 2922130491 | 2922135052 | 570 |
| 301 | iso_pu_bacteria | 2922151315 | 2922154629 | 570 |
| 302 | iso_pu_bacteria | 2922172374 | 2922176038 | 570 |
| 303 | iso_pu_bacteria | 2922178524 | 2922182159 | 570 |
| 304 | iso_pu_bacteria | 2924718760 | 2924725455 | 570 |
| 305 | iso_pu_bacteria | 2924726620 | 2924727235 | 570 |
| 306 | iso_pu_bacteria | 2924733363 | 2924739326 | 570 |
| 307 | iso_pu_bacteria | 2924741084 | 2924746002 | 570 |
| 308 | iso_pu_bacteria | 2924748358 | 2924752735 | 570 |
| 309 | iso_pu_bacteria | 2924754689 | 2924756373 | 570 |
| 310 | iso_pu_bacteria | 2924762789 | 2924766813 | 570 |
| 311 | iso_pu_bacteria | 2924776078 | 2924783890 | 570 |
| 312 | iso_pu_bacteria | 2924784321 | 2924785705 | 570 |
| 313 | iso_pu_bacteria | 2928125067 | 2928127108 | 570 |
| 314 | iso_pu_bacteria | 2937813078 | 2937816207 | 570 |
| 315 | iso_pu_bacteria | 2937822353 | 2937824890 | 570 |
| 316 | iso_pu_bacteria | 2937836603 | 2937837999 | 570 |
| 317 | iso_pu_bacteria | 2937848649 | 2937855084 | 570 |
| 318 | iso_pu_bacteria | 2937877337 | 2937877421 | 570 |
| 319 | iso_pu_bacteria | 2937891427 | 2937893858 | 570 |
| 320 | iso_pu_bacteria | 2937972304 | 2937975473 | 570 |
| 321 | iso_pu_bacteria | 2937994558 | 2938001876 | 570 |
| 322 | iso_pu_bacteria | 2938014810 | 2938019134 | 570 |
| 323 | iso_pu_bacteria | 2958034702 | 2958035403 | 570 |
| 324 | iso_pu_bacteria | 2958041894 | 2958043590 | 570 |
| 325 | iso_pu_bacteria | 2958064165 | 2958067808 | 570 |
| 326 | iso_pu_bacteria | 2958071322 | 2958072674 | 570 |
| 327 | iso_pu_bacteria | 2958084443 | 2958084527 | 570 |
| 328 | iso_pu_bacteria | 2958100919 | 2958101543 | 570 |
| 329 | iso_pu_bacteria | 2958115193 | 2958118798 | 570 |
| 330 | iso_pu_bacteria | 2958122699 | 2958129654 | 570 |
| 331 | iso_pu_bacteria | 2958165035 | 2958171931 | 570 |
| 332 | iso_pu_bacteria | 2961114664 | 2961116394 | 570 |
| 333 | iso_pu_bacteria | 2961127735 | 2961128663 | 570 |
| 334 | iso_pu_bacteria | 2961163497 | 2961170377 | 570 |
| 335 | iso_pu_bacteria | 2961170736 | 2961174343 | 570 |
| 336 | iso_pu_bacteria | 2961183825 | 2961190167 | 570 |
| 337 | iso_pu_bacteria | 2963644680 | 2963648119 | 570 |
| 338 | iso_pu_bacteria | 2965018300 | 2965025123 | 570 |
| 339 | iso_pu_bacteria | 2965025482 | 2965026577 | 570 |
| 340 | iso_pu_bacteria | 2965032056 | 2965035839 | 570 |
| 341 | iso_pu_bacteria | 2965047637 | 2965054864 | 570 |
| 342 | iso_pu_bacteria | 2965089291 | 2965089319 | 570 |
| 343 | iso_pu_bacteria | 2965102966 | 2965107904 | 570 |
| 344 | iso_pu_bacteria | 2965110997 | 2965115144 | 570 |
| 345 | iso_pu_bacteria | 2965119406 | 2965125695 | 570 |
| 346 | iso_pu_bacteria | 2967996073 | 2968000333 | 570 |
| 347 | iso_pu_bacteria | 2968003550 | 2968003782 | 570 |
| 348 | iso_pu_bacteria | 2968016561 | 2968018050 | 570 |
| 349 | iso_pu_bacteria | 2968083720 | 2968090941 | 570 |
| 350 | iso_pu_bacteria | 2968091066 | 2968096614 | 570 |
| 351 | iso_pu_bacteria | 2968097103 | 2968099977 | 570 |
| 352 | iso_pu_bacteria | 2968110612 | 2968112300 | 570 |
| 353 | iso_pu_bacteria | 2968117919 | 2968121100 | 570 |
| 354 | iso_pu_bacteria | 2968128360 | 2968132666 | 570 |
| 355 | iso_pu_bacteria | 2968138860 | 2968144241 | 570 |
| 356 | iso_pu_bacteria | 2968171901 | 2968178764 | 570 |
| 357 | iso_pu_bacteria | 2970469710 | 2970471775 | 570 |
| 358 | iso_pu_bacteria | 2970489779 | 2970495730 | 570 |
| 359 | iso_pu_bacteria | 2970503327 | 2970506930 | 570 |
| 360 | iso_pu_bacteria | 2970510686 | 2970512851 | 570 |
| 361 | iso_pu_bacteria | 2970532167 | 2970538365 | 570 |
| 362 | iso_pu_bacteria | 2970547951 | 2970552703 | 570 |
| 363 | iso_pu_bacteria | 2970554993 | 2970561609 | 570 |
| 364 | iso_pu_bacteria | 2970593180 | 2970593858 | 570 |
| 365 | iso_pu_bacteria | 2970619444 | 2970620734 | 570 |
| 366 | iso_pu_bacteria | 2970627176 | 2970631362 | 570 |
| 367 | iso_pu_bacteria | 2977821940 | 2977822332 | 570 |
| 368 | iso_pu_bacteria | 2977828996 | 2977832474 | 570 |
| 369 | iso_pu_bacteria | 2977851361 | 2977856946 | 570 |
| 370 | iso_pu_bacteria | 2977864932 | 2977865886 | 570 |
| 371 | iso_pu_bacteria | 2977872689 | 2977875616 | 570 |
| 372 | iso_pu_bacteria | 2977907340 | 2977914768 | 570 |
| 373 | iso_pu_bacteria | 2977915119 | 2977922527 | 570 |
| 374 | iso_pu_bacteria | 2977922695 | 2977929247 | 570 |
| 375 | iso_pu_bacteria | 2977935797 | 2977940913 | 570 |
| 376 | iso_pu_bacteria | 2977942078 | 2977947639 | 570 |
| 377 | iso_pu_bacteria | 2977950692 | 2977955182 | 570 |
| 378 | iso_pu_bacteria | 2979710463 | 2979711672 | 570 |
| 379 | iso_pu_bacteria | 2979772303 | 2979774551 | 570 |
| 380 | iso_pu_bacteria | 2979779861 | 2979786298 | 570 |
| 381 | iso_pu_bacteria | 2979808191 | 2979812125 | 570 |
| 382 | iso_pu_bacteria | 2987636660 | 2987637840 | 570 |
| 383 | iso_pu_bacteria | 2987645492 | 2987645496 | 570 |
| 384 | iso_pu_bacteria | 2987652177 | 2987653852 | 570 |
| 385 | iso_pu_bacteria | 2987659509 | 2987666618 | 570 |
| 386 | iso_pu_bacteria | 2987666974 | 2987668845 | 570 |
| 387 | iso_pu_bacteria | 2987673487 | 2987678242 | 570 |
| 388 | iso_pu_bacteria | 2996310559 | 2996312286 | 570 |
| 389 | iso_pu_bacteria | 2996341866 | 2996346768 | 570 |
| 390 | iso_pu_bacteria | 2996348954 | 2996350559 | 570 |
| 391 | iso_pu_bacteria | 2996386984 | 2996389303 | 570 |
| 392 | iso_pu_bacteria | 3000135777 | 3000140178 | 570 |
| 393 | iso_pu_bacteria | 3004188549 | 3004195620 | 570 |
| 394 | iso_pu_bacteria | 3004195979 | 3004203093 | 570 |
| 395 | iso_pu_bacteria | 3004203850 | 3004205838 | 570 |
| 396 | iso_pu_bacteria | 3004211236 | 3004211897 | 570 |
| 397 | iso_pu_bacteria | 3004218560 | 3004219144 | 570 |
| 398 | iso_pu_bacteria | 3004232784 | 3004236532 | 570 |
| 399 | iso_pu_bacteria | 3004239961 | 3004246812 | 570 |
| 400 | iso_pu_bacteria | 3004268573 | 3004268925 | 570 |
| 401 | iso_pu_bacteria | 3004275668 | 3004277257 | 570 |
| 402 | iso_pu_bacteria | 3004334049 | 3004341288 | 570 |
| 403 | iso_pu_bacteria | 649633066 | 649873342 | 570 |
| 404 | iso_pu_bacteria | 8004300914 | 8004301169 | 570 |
| 405 | iso_pu_bacteria | 8004312739 | 8004312822 | 570 |
| 406 | iso_pu_bacteria | 8004374579 | 8004379311 | 570 |
| 407 | iso_pu_bacteria | 8004445564 | 8004451008 | 570 |
| 408 | iso_pu_bacteria | 8004633249 | 8004633411 | 570 |
| 409 | iso_pu_bacteria | 8004703790 | 8004709700 | 570 |
| 410 | iso_pu_bacteria | 8055617313 | 8055621308 | 570 |
| 411 | 3300005344 | Ga0070661_100000136 | Ga0070661_1000001367 | 571 |
| 412 | 3300025919 | Ga0207657_10000101 | Ga0207657_100001012 | 571 |
| 413 | 3300025920 | Ga0207649_10000154 | Ga0207649_1000015445 | 571 |
| 414 | 3300028577 | Ga0265318_10000199 | Ga0265318_1000019948 | 571 |
| 415 | 3300031241 | Ga0265325_10001455 | Ga0265325_100014552 | 571 |
| 416 | 3300031249 | Ga0265339_10026275 | Ga0265339_100262753 | 571 |
| 417 | 3300031250 | Ga0265331_10017547 | Ga0265331_100175471 | 571 |
| 418 | 3300031251 | Ga0265327_10000124 | Ga0265327_10000124128 | 571 |
| 419 | 3300031344 | Ga0265316_10081525 | Ga0265316_100815252 | 571 |
| 420 | 3300031595 | Ga0265313_10001046 | Ga0265313_1000104616 | 571 |
| 421 | 3300031711 | Ga0265314_10000192 | Ga0265314_1000019255 | 571 |
| 422 | 3300031711 | Ga0265314_10011644 | Ga0265314_100116445 | 571 |
| 423 | 3300031712 | Ga0265342_10004875 | Ga0265342_100048756 | 571 |
| 424 | 3300049579 | Ga0501043_0021229 | Ga0501043_0021229_2020_3744 | 571 |
| 425 | 3300049580 | Ga0501046_0032485 | Ga0501046_0032485_472_2196 | 571 |
| 426 | 3300049586 | Ga0501070_0137367 | Ga0501070_0137367_76_1800 | 571 |
| 427 | 3300049742 | Ga0501080_0112273 | Ga0501080_0112273_317_2041 | 571 |
| 428 | 3300049822 | Ga0501035_0024745 | Ga0501035_0024745_148_1872 | 571 |
| 429 | 3300054114 | Ga0501084_0000049 | Ga0501084_0000049_13881_15596 | 571 |
| 430 | iso_pu_bacteria | 2856364286 | 2856370521 | 571 |
| 431 | iso_pu_bacteria | 2869285874 | 2869291752 | 571 |
| 432 | iso_pu_bacteria | 2871429161 | 2871434962 | 571 |
| 433 | iso_pu_bacteria | 2874155637 | 2874157615 | 571 |
| 434 | iso_pu_bacteria | 2876413966 | 2876415818 | 571 |
| 435 | iso_pu_bacteria | 2878745973 | 2878752096 | 571 |
| 436 | iso_pu_bacteria | 2903492973 | 2903493346 | 571 |
| 437 | iso_pu_bacteria | 2906308376 | 2906314490 | 571 |
| 438 | iso_pu_bacteria | 2906321335 | 2906327658 | 571 |
| 439 | iso_pu_bacteria | 2958130278 | 2958136150 | 571 |
| 440 | iso_pu_bacteria | 2958179912 | 2958185618 | 571 |
| 441 | iso_pu_bacteria | 2961077736 | 2961083995 | 571 |
| 442 | iso_pu_bacteria | 2977843712 | 2977846443 | 571 |
| 443 | iso_pu_bacteria | 8004387939 | 8004394522 | 571 |
| 444 | iso_pu_bacteria | 8004640170 | 8004640346 | 571 |
| 445 | iso_pu_bacteria | 8004714634 | 8004720752 | 571 |
| 446 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013533 | 572 |
| 447 | 3300025924 | Ga0207694_10006206 | Ga0207694_100062066 | 572 |
| 448 | 3300028379 | Ga0268266_10085771 | Ga0268266_100857712 | 572 |
| 449 | 3300031711 | Ga0265314_10007587 | Ga0265314_100075875 | 572 |
| 450 | 3300039437 | Ga0436365_0088108 | Ga0436365_0088108_8622_10340 | 572 |
| 451 | 3300048905 | Ga0496102_0056461 | Ga0496102_0056461_227_1945 | 572 |
| 452 | 3300048906 | Ga0496103_0104915 | Ga0496103_0104915_37_1755 | 572 |
| 453 | 3300048907 | Ga0496104_0049921 | Ga0496104_0049921_1783_3501 | 572 |
| 454 | 3300048910 | Ga0496107_0010874 | Ga0496107_0010874_74_1792 | 572 |
| 455 | 3300048911 | Ga0496108_0007516 | Ga0496108_0007516_1139_2857 | 572 |
| 456 | 3300048912 | Ga0496109_0009622 | Ga0496109_0009622_718_2436 | 572 |
| 457 | 3300048914 | Ga0496111_0011323 | Ga0496111_0011323_418_2136 | 572 |
| 458 | 3300049580 | Ga0501046_0013927 | Ga0501046_0013927_3509_5227 | 572 |
| 459 | 3300049581 | Ga0501047_0001238 | Ga0501047_0001238_4569_6287 | 572 |
| 460 | 3300049581 | Ga0501047_0031114 | Ga0501047_0031114_2854_4572 | 572 |
| 461 | 3300049823 | Ga0501044_0046332 | Ga0501044_0046332_207_1925 | 572 |
| 462 | 3300049823 | Ga0501044_0175169 | Ga0501044_0175169_180_1898 | 572 |
| 463 | 3300053140 | Ga0500573_0000012 | Ga0500573_0000012_127611_129329 | 572 |
| 464 | 3300001990 | JGI24737J22298_10026704 | JGI24737J22298_100267041 | 573 |
| 465 | 3300003214 | JGI25165J46597_1000209 | JGI25165J46597_100020922 | 573 |
| 466 | 3300005295 | Ga0065707_10082036 | Ga0065707_1008203622 | 573 |
| 467 | 3300005356 | Ga0070674_100001589 | Ga0070674_1000015898 | 573 |
| 468 | 3300005456 | Ga0070678_100000645 | Ga0070678_10000064511 | 573 |
| 469 | 3300005530 | Ga0070679_100110957 | Ga0070679_1001109571 | 573 |
| 470 | 3300005548 | Ga0070665_100000458 | Ga0070665_10000045846 | 573 |
| 471 | 3300005563 | Ga0068855_100098438 | Ga0068855_1000984383 | 573 |
| 472 | 3300005834 | Ga0068851_10045496 | Ga0068851_100454961 | 573 |
| 473 | 3300005937 | Ga0081455_10003034 | Ga0081455_100030348 | 573 |
| 474 | 3300009148 | Ga0105243_10000202 | Ga0105243_1000020241 | 573 |
| 475 | 3300009177 | Ga0105248_10030240 | Ga0105248_100302402 | 573 |
| 476 | 3300013102 | Ga0157371_10000024 | Ga0157371_10000024224 | 573 |
| 477 | 3300014326 | Ga0157380_10006819 | Ga0157380_100068194 | 573 |
| 478 | 3300025226 | Ga0209674_104793 | Ga0209674_1047931 | 573 |
| 479 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013928 | 573 |
| 480 | 3300025909 | Ga0207705_10002842 | Ga0207705_1000284211 | 573 |
| 481 | 3300025911 | Ga0207654_10002277 | Ga0207654_100022777 | 573 |
| 482 | 3300025913 | Ga0207695_10039829 | Ga0207695_100398292 | 573 |
| 483 | 3300025920 | Ga0207649_10000425 | Ga0207649_1000042513 | 573 |
| 484 | 3300025921 | Ga0207652_10015345 | Ga0207652_100153452 | 573 |
| 485 | 3300025935 | Ga0207709_10000201 | Ga0207709_1000020178 | 573 |
| 486 | 3300025937 | Ga0207669_10000075 | Ga0207669_1000007538 | 573 |
| 487 | 3300025937 | Ga0207669_10065800 | Ga0207669_100658002 | 573 |
| 488 | 3300025941 | Ga0207711_10016979 | Ga0207711_100169795 | 573 |
| 489 | 3300025949 | Ga0207667_10000010 | Ga0207667_10000010186 | 573 |
| 490 | 3300025981 | Ga0207640_10000829 | Ga0207640_100008294 | 573 |
| 491 | 3300026041 | Ga0207639_10003097 | Ga0207639_100030975 | 573 |
| 492 | 3300026078 | Ga0207702_10014651 | Ga0207702_100146513 | 573 |
| 493 | 3300026121 | Ga0207683_10000067 | Ga0207683_100000676 | 573 |
| 494 | 3300026142 | Ga0207698_10035023 | Ga0207698_100350232 | 573 |
| 495 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022245 | 573 |
| 496 | 3300031731 | Ga0307405_10042177 | Ga0307405_100421772 | 573 |
| 497 | 3300031911 | Ga0307412_10073503 | Ga0307412_100735033 | 573 |
| 498 | 3300035691 | Ga0373931_0049989 | Ga0373931_0049989_418_2139 | 573 |
| 499 | 3300039437 | Ga0436365_1571761 | Ga0436365_1571761_811_2532 | 573 |
| 500 | 3300046471 | Ga0495650_0000058 | Ga0495650_0000058_10769_12490 | 573 |
| 501 | 3300046500 | Ga0495596_0029424 | Ga0495596_0029424_444_2165 | 573 |
| 502 | 3300046506 | Ga0495583_0001172 | Ga0495583_0001172_16052_17773 | 573 |
| 503 | 3300046524 | Ga0495648_0000166 | Ga0495648_0000166_53074_54795 | 573 |
| 504 | 3300046616 | Ga0495668_0000261 | Ga0495668_0000261_21887_23608 | 573 |
| 505 | 3300046616 | Ga0495668_0009306 | Ga0495668_0009306_4118_5839 | 573 |
| 506 | 3300046660 | Ga0495625_0000910 | Ga0495625_0000910_15919_17640 | 573 |
| 507 | 3300046809 | Ga0495600_0000711 | Ga0495600_0000711_8513_10234 | 573 |
| 508 | 3300048905 | Ga0496102_0000120 | Ga0496102_0000120_72207_73928 | 573 |
| 509 | 3300048905 | Ga0496102_0000758 | Ga0496102_0000758_9932_11653 | 573 |
| 510 | 3300048906 | Ga0496103_0000154 | Ga0496103_0000154_4605_6326 | 573 |
| 511 | 3300048906 | Ga0496103_0000186 | Ga0496103_0000186_25791_27512 | 573 |
| 512 | 3300048917 | Ga0496114_0005133 | Ga0496114_0005133_3796_5517 | 573 |
| 513 | 3300048917 | Ga0496114_0006528 | Ga0496114_0006528_122_1843 | 573 |
| 514 | 3300048918 | Ga0496115_0000423 | Ga0496115_0000423_69_1790 | 573 |
| 515 | 3300048919 | Ga0496116_0004809 | Ga0496116_0004809_7015_8736 | 573 |
| 516 | 3300048919 | Ga0496116_0005657 | Ga0496116_0005657_8448_10169 | 573 |
| 517 | 3300048920 | Ga0496117_0000317 | Ga0496117_0000317_10808_12529 | 573 |
| 518 | 3300048920 | Ga0496117_0000977 | Ga0496117_0000977_6930_8651 | 573 |
| 519 | 3300048921 | Ga0496118_0000144 | Ga0496118_0000144_41069_42790 | 573 |
| 520 | 3300048921 | Ga0496118_0000303 | Ga0496118_0000303_10812_12533 | 573 |
| 521 | 3300048924 | Ga0496121_0000697 | Ga0496121_0000697_43143_44864 | 573 |
| 522 | 3300048924 | Ga0496121_0000977 | Ga0496121_0000977_23692_25413 | 573 |
| 523 | 3300048927 | Ga0496124_0000177 | Ga0496124_0000177_25612_27333 | 573 |
| 524 | 3300048927 | Ga0496124_0000214 | Ga0496124_0000214_38505_40226 | 573 |
| 525 | 3300048928 | Ga0496125_0001995 | Ga0496125_0001995_203_1924 | 573 |
| 526 | 3300048929 | Ga0496126_0000505 | Ga0496126_0000505_33781_35502 | 573 |
| 527 | 3300049513 | Ga0501290_000061 | Ga0501290_000061_3183_4904 | 573 |
| 528 | 3300049515 | Ga0501292_000163 | Ga0501292_000163_3186_4907 | 573 |
| 529 | 3300049523 | Ga0501300_001891 | Ga0501300_001891_676_2397 | 573 |
| 530 | 3300049653 | Ga0501206_001361 | Ga0501206_001361_292_2013 | 573 |
| 531 | 3300049690 | Ga0501261_000233 | Ga0501261_000233_1911_3632 | 573 |
| 532 | 3300049775 | Ga0501279_000070 | Ga0501279_000070_3110_4831 | 573 |
| 533 | 3300053079 | Ga0500610_0000312 | Ga0500610_0000312_7929_9650 | 573 |
| 534 | 3300053130 | Ga0500642_0001967 | Ga0500642_0001967_684_2405 | 573 |
| 535 | 3300053730 | Ga0500645_000062 | Ga0500645_000062_73684_75405 | 573 |
| 536 | 3300001977 | JGI24746J21847_1005092 | JGI24746J21847_10050922 | 574 |
| 537 | 3300001991 | JGI24743J22301_10002476 | JGI24743J22301_100024761 | 574 |
| 538 | 3300002070 | JGI24750J21931_1001573 | JGI24750J21931_10015732 | 574 |
| 539 | 3300003762 | Ga0055542_1001237 | Ga0055542_10012378 | 574 |
| 540 | 3300005330 | Ga0070690_100012694 | Ga0070690_1000126944 | 574 |
| 541 | 3300005336 | Ga0070680_100005001 | Ga0070680_1000050012 | 574 |
| 542 | 3300005336 | Ga0070680_100014421 | Ga0070680_1000144215 | 574 |
| 543 | 3300005337 | Ga0070682_100008648 | Ga0070682_1000086482 | 574 |
| 544 | 3300005337 | Ga0070682_100032430 | Ga0070682_1000324302 | 574 |
| 545 | 3300005339 | Ga0070660_100017179 | Ga0070660_1000171792 | 574 |
| 546 | 3300005339 | Ga0070660_100023476 | Ga0070660_1000234763 | 574 |
| 547 | 3300005339 | Ga0070660_100091886 | Ga0070660_1000918862 | 574 |
| 548 | 3300005341 | Ga0070691_10029192 | Ga0070691_100291922 | 574 |
| 549 | 3300005344 | Ga0070661_100025422 | Ga0070661_1000254223 | 574 |
| 550 | 3300005345 | Ga0070692_10013099 | Ga0070692_100130992 | 574 |
| 551 | 3300005356 | Ga0070674_100074541 | Ga0070674_1000745412 | 574 |
| 552 | 3300005366 | Ga0070659_100049347 | Ga0070659_1000493473 | 574 |
| 553 | 3300005367 | Ga0070667_100025110 | Ga0070667_1000251102 | 574 |
| 554 | 3300005436 | Ga0070713_100146200 | Ga0070713_1001462001 | 574 |
| 555 | 3300005441 | Ga0070700_100012459 | Ga0070700_1000124592 | 574 |
| 556 | 3300005458 | Ga0070681_10019339 | Ga0070681_100193396 | 574 |
| 557 | 3300005458 | Ga0070681_10050201 | Ga0070681_100502012 | 574 |
| 558 | 3300005458 | Ga0070681_10193215 | Ga0070681_101932151 | 574 |
| 559 | 3300005530 | Ga0070679_100116519 | Ga0070679_1001165191 | 574 |
| 560 | 3300005535 | Ga0070684_100013746 | Ga0070684_1000137461 | 574 |
| 561 | 3300005535 | Ga0070684_100057270 | Ga0070684_1000572701 | 574 |
| 562 | 3300005536 | Ga0070697_100007631 | Ga0070697_1000076314 | 574 |
| 563 | 3300005539 | Ga0068853_100005539 | Ga0068853_1000055397 | 574 |
| 564 | 3300005539 | Ga0068853_100028539 | Ga0068853_1000285394 | 574 |
| 565 | 3300005545 | Ga0070695_100014007 | Ga0070695_1000140073 | 574 |
| 566 | 3300005563 | Ga0068855_100075277 | Ga0068855_1000752772 | 574 |
| 567 | 3300005563 | Ga0068855_100240249 | Ga0068855_1002402492 | 574 |
| 568 | 3300005564 | Ga0070664_100014739 | Ga0070664_1000147394 | 574 |
| 569 | 3300005616 | Ga0068852_100015727 | Ga0068852_1000157272 | 574 |
| 570 | 3300005617 | Ga0068859_100042742 | Ga0068859_1000427424 | 574 |
| 571 | 3300005719 | Ga0068861_100073921 | Ga0068861_1000739212 | 574 |
| 572 | 3300005843 | Ga0068860_100001757 | Ga0068860_1000017578 | 574 |
| 573 | 3300005843 | Ga0068860_100098874 | Ga0068860_1000988742 | 574 |
| 574 | 3300005937 | Ga0081455_10000444 | Ga0081455_100004447 | 574 |
| 575 | 3300005981 | Ga0081538_10010773 | Ga0081538_100107735 | 574 |
| 576 | 3300005981 | Ga0081538_10048046 | Ga0081538_100480462 | 574 |
| 577 | 3300005983 | Ga0081540_1022231 | Ga0081540_10222314 | 574 |
| 578 | 3300005985 | Ga0081539_10006551 | Ga0081539_100065514 | 574 |
| 579 | 3300006028 | Ga0070717_10024422 | Ga0070717_100244223 | 574 |
| 580 | 3300006038 | Ga0075365_10006310 | Ga0075365_100063106 | 574 |
| 581 | 3300006042 | Ga0075368_10005599 | Ga0075368_100055992 | 574 |
| 582 | 3300006042 | Ga0075368_10016104 | Ga0075368_100161042 | 574 |
| 583 | 3300006175 | Ga0070712_100002437 | Ga0070712_1000024376 | 574 |
| 584 | 3300006177 | Ga0075362_10010086 | Ga0075362_100100862 | 574 |
| 585 | 3300006178 | Ga0075367_10006314 | Ga0075367_100063142 | 574 |
| 586 | 3300006178 | Ga0075367_10042352 | Ga0075367_100423522 | 574 |
| 587 | 3300006237 | Ga0097621_100034819 | Ga0097621_1000348194 | 574 |
| 588 | 3300006353 | Ga0075370_10016647 | Ga0075370_100166472 | 574 |
| 589 | 3300006846 | Ga0075430_100000060 | Ga0075430_10000006024 | 574 |
| 590 | 3300006846 | Ga0075430_100024195 | Ga0075430_1000241954 | 574 |
| 591 | 3300006846 | Ga0075430_100056454 | Ga0075430_1000564543 | 574 |
| 592 | 3300006847 | Ga0075431_100027666 | Ga0075431_1000276664 | 574 |
| 593 | 3300006847 | Ga0075431_100174308 | Ga0075431_1001743081 | 574 |
| 594 | 3300006871 | Ga0075434_100036752 | Ga0075434_1000367524 | 574 |
| 595 | 3300006914 | Ga0075436_100000396 | Ga0075436_10000039614 | 574 |
| 596 | 3300006931 | Ga0097620_100042742 | Ga0097620_1000427424 | 574 |
| 597 | 3300009093 | Ga0105240_10110067 | Ga0105240_101100671 | 574 |
| 598 | 3300009094 | Ga0111539_10028731 | Ga0111539_100287312 | 574 |
| 599 | 3300009094 | Ga0111539_10040542 | Ga0111539_100405423 | 574 |
| 600 | 3300009098 | Ga0105245_10000398 | Ga0105245_100003989 | 574 |
| 601 | 3300009101 | Ga0105247_10054002 | Ga0105247_100540022 | 574 |
| 602 | 3300009147 | Ga0114129_10013011 | Ga0114129_100130115 | 574 |
| 603 | 3300009148 | Ga0105243_10073548 | Ga0105243_100735482 | 574 |
| 604 | 3300009148 | Ga0105243_10096966 | Ga0105243_100969661 | 574 |
| 605 | 3300009174 | Ga0105241_10030299 | Ga0105241_100302992 | 574 |
| 606 | 3300009176 | Ga0105242_10163785 | Ga0105242_101637851 | 574 |
| 607 | 3300009545 | Ga0105237_10014904 | Ga0105237_100149043 | 574 |
| 608 | 3300009545 | Ga0105237_10088033 | Ga0105237_100880332 | 574 |
| 609 | 3300009551 | Ga0105238_10004648 | Ga0105238_100046488 | 574 |
| 610 | 3300009551 | Ga0105238_10039698 | Ga0105238_100396983 | 574 |
| 611 | 3300009553 | Ga0105249_10113755 | Ga0105249_101137552 | 574 |
| 612 | 3300010159 | Ga0099796_10003534 | Ga0099796_100035342 | 574 |
| 613 | 3300010159 | Ga0099796_10015336 | Ga0099796_100153361 | 574 |
| 614 | 3300010375 | Ga0105239_10057788 | Ga0105239_100577882 | 574 |
| 615 | 3300010375 | Ga0105239_10113265 | Ga0105239_101132651 | 574 |
| 616 | 3300013100 | Ga0157373_10000586 | Ga0157373_1000058629 | 574 |
| 617 | 3300013100 | Ga0157373_10019996 | Ga0157373_100199965 | 574 |
| 618 | 3300013105 | Ga0157369_10166917 | Ga0157369_101669172 | 574 |
| 619 | 3300013297 | Ga0157378_10049148 | Ga0157378_100491481 | 574 |
| 620 | 3300013307 | Ga0157372_10022517 | Ga0157372_100225172 | 574 |
| 621 | 3300013307 | Ga0157372_10253969 | Ga0157372_102539691 | 574 |
| 622 | 3300013308 | Ga0157375_10101613 | Ga0157375_101016131 | 574 |
| 623 | 3300014325 | Ga0163163_10000006 | Ga0163163_10000006152 | 574 |
| 624 | 3300014326 | Ga0157380_10016504 | Ga0157380_100165042 | 574 |
| 625 | 3300014326 | Ga0157380_10134840 | Ga0157380_101348401 | 574 |
| 626 | 3300014968 | Ga0157379_10119859 | Ga0157379_101198592 | 574 |
| 627 | 3300015261 | Ga0182006_1040534 | Ga0182006_10405341 | 574 |
| 628 | 3300025250 | Ga0209026_1000024 | Ga0209026_1000024195 | 574 |
| 629 | 3300025254 | Ga0209148_1000050 | Ga0209148_1000050161 | 574 |
| 630 | 3300025256 | Ga0209759_1000389 | Ga0209759_100038916 | 574 |
| 631 | 3300025261 | Ga0209233_1000129 | Ga0209233_1000129130 | 574 |
| 632 | 3300025272 | Ga0209455_1000183 | Ga0209455_100018364 | 574 |
| 633 | 3300025901 | Ga0207688_10001280 | Ga0207688_100012803 | 574 |
| 634 | 3300025904 | Ga0207647_10014852 | Ga0207647_100148525 | 574 |
| 635 | 3300025904 | Ga0207647_10025394 | Ga0207647_100253942 | 574 |
| 636 | 3300025906 | Ga0207699_10027424 | Ga0207699_100274242 | 574 |
| 637 | 3300025907 | Ga0207645_10007694 | Ga0207645_100076944 | 574 |
| 638 | 3300025908 | Ga0207643_10001224 | Ga0207643_100012247 | 574 |
| 639 | 3300025909 | Ga0207705_10008702 | Ga0207705_100087025 | 574 |
| 640 | 3300025912 | Ga0207707_10040606 | Ga0207707_100406062 | 574 |
| 641 | 3300025912 | Ga0207707_10058202 | Ga0207707_100582023 | 574 |
| 642 | 3300025912 | Ga0207707_10077299 | Ga0207707_100772993 | 574 |
| 643 | 3300025912 | Ga0207707_10137372 | Ga0207707_101373722 | 574 |
| 644 | 3300025913 | Ga0207695_10034936 | Ga0207695_100349363 | 574 |
| 645 | 3300025913 | Ga0207695_10052366 | Ga0207695_100523663 | 574 |
| 646 | 3300025913 | Ga0207695_10093269 | Ga0207695_100932692 | 574 |
| 647 | 3300025914 | Ga0207671_10006493 | Ga0207671_100064935 | 574 |
| 648 | 3300025915 | Ga0207693_10006383 | Ga0207693_100063835 | 574 |
| 649 | 3300025915 | Ga0207693_10047667 | Ga0207693_100476672 | 574 |
| 650 | 3300025915 | Ga0207693_10067214 | Ga0207693_100672143 | 574 |
| 651 | 3300025917 | Ga0207660_10022170 | Ga0207660_100221702 | 574 |
| 652 | 3300025919 | Ga0207657_10029863 | Ga0207657_100298633 | 574 |
| 653 | 3300025919 | Ga0207657_10037809 | Ga0207657_100378092 | 574 |
| 654 | 3300025919 | Ga0207657_10058612 | Ga0207657_100586122 | 574 |
| 655 | 3300025919 | Ga0207657_10071669 | Ga0207657_100716692 | 574 |
| 656 | 3300025921 | Ga0207652_10029441 | Ga0207652_100294412 | 574 |
| 657 | 3300025922 | Ga0207646_10013813 | Ga0207646_100138132 | 574 |
| 658 | 3300025924 | Ga0207694_10033216 | Ga0207694_100332164 | 574 |
| 659 | 3300025927 | Ga0207687_10026852 | Ga0207687_100268522 | 574 |
| 660 | 3300025932 | Ga0207690_10014343 | Ga0207690_100143431 | 574 |
| 661 | 3300025932 | Ga0207690_10036815 | Ga0207690_100368152 | 574 |
| 662 | 3300025932 | Ga0207690_10054922 | Ga0207690_100549222 | 574 |
| 663 | 3300025933 | Ga0207706_10013662 | Ga0207706_100136624 | 574 |
| 664 | 3300025937 | Ga0207669_10066086 | Ga0207669_100660862 | 574 |
| 665 | 3300025940 | Ga0207691_10009803 | Ga0207691_100098036 | 574 |
| 666 | 3300025945 | Ga0207679_10005273 | Ga0207679_100052736 | 574 |
| 667 | 3300025949 | Ga0207667_10004211 | Ga0207667_100042119 | 574 |
| 668 | 3300026035 | Ga0207703_10109549 | Ga0207703_101095491 | 574 |
| 669 | 3300026041 | Ga0207639_10032248 | Ga0207639_100322483 | 574 |
| 670 | 3300026041 | Ga0207639_10045222 | Ga0207639_100452222 | 574 |
| 671 | 3300026067 | Ga0207678_10035216 | Ga0207678_100352163 | 574 |
| 672 | 3300026075 | Ga0207708_10001181 | Ga0207708_1000118114 | 574 |
| 673 | 3300026078 | Ga0207702_10016315 | Ga0207702_100163155 | 574 |
| 674 | 3300026089 | Ga0207648_10005697 | Ga0207648_100056977 | 574 |
| 675 | 3300026118 | Ga0207675_100007911 | Ga0207675_1000079115 | 574 |
| 676 | 3300026121 | Ga0207683_10008737 | Ga0207683_100087373 | 574 |
| 677 | 3300026142 | Ga0207698_10021195 | Ga0207698_100211952 | 574 |
| 678 | 3300028379 | Ga0268266_10022663 | Ga0268266_100226633 | 574 |
| 679 | 3300028381 | Ga0268264_10000022 | Ga0268264_10000022110 | 574 |
| 680 | 3300028800 | Ga0265338_10010200 | Ga0265338_100102002 | 574 |
| 681 | 3300028800 | Ga0265338_10053555 | Ga0265338_100535553 | 574 |
| 682 | 3300030521 | Ga0307511_10037215 | Ga0307511_100372151 | 574 |
| 683 | 3300031235 | Ga0265330_10023681 | Ga0265330_100236812 | 574 |
| 684 | 3300031238 | Ga0265332_10000793 | Ga0265332_1000079319 | 574 |
| 685 | 3300031241 | Ga0265325_10018610 | Ga0265325_100186103 | 574 |
| 686 | 3300031247 | Ga0265340_10012126 | Ga0265340_100121263 | 574 |
| 687 | 3300031247 | Ga0265340_10025144 | Ga0265340_100251442 | 574 |
| 688 | 3300031249 | Ga0265339_10003009 | Ga0265339_100030094 | 574 |
| 689 | 3300031249 | Ga0265339_10047899 | Ga0265339_100478992 | 574 |
| 690 | 3300031251 | Ga0265327_10016308 | Ga0265327_100163082 | 574 |
| 691 | 3300031595 | Ga0265313_10000124 | Ga0265313_1000012465 | 574 |
| 692 | 3300031712 | Ga0265342_10000100 | Ga0265342_1000010049 | 574 |
| 693 | 3300031712 | Ga0265342_10004038 | Ga0265342_100040386 | 574 |
| 694 | 3300031712 | Ga0265342_10006704 | Ga0265342_100067045 | 574 |
| 695 | 3300031712 | Ga0265342_10013562 | Ga0265342_100135622 | 574 |
| 696 | 3300031712 | Ga0265342_10017742 | Ga0265342_100177423 | 574 |
| 697 | 3300031730 | Ga0307516_10017716 | Ga0307516_100177165 | 574 |
| 698 | 3300032133 | Ga0316583_10000048 | Ga0316583_1000004810 | 574 |
| 699 | 3300034819 | Ga0373958_0002144 | Ga0373958_0002144_432_2156 | 574 |
| 700 | 3300035114 | Ga0373939_0013119 | Ga0373939_0013119_16_1740 | 574 |
| 701 | 3300035116 | Ga0373945_0004276 | Ga0373945_0004276_189_1913 | 574 |
| 702 | 3300035691 | Ga0373931_0001151 | Ga0373931_0001151_9488_11212 | 574 |
| 703 | 3300035695 | Ga0373927_0013058 | Ga0373927_0013058_1514_3238 | 574 |
| 704 | 3300035725 | Ga0373947_0021636 | Ga0373947_0021636_889_2613 | 574 |
| 705 | 3300036401 | Ga0373937_0085797 | Ga0373937_0085797_754_2493 | 574 |
| 706 | 3300037068 | Ga0373925_0040075 | Ga0373925_0040075_405_2129 | 574 |
| 707 | 3300037068 | Ga0373925_0073355 | Ga0373925_0073355_190_1914 | 574 |
| 708 | 3300037312 | Ga0395899_0007549 | Ga0395899_0007549_1184_2911 | 574 |
| 709 | 3300037418 | Ga0395900_0048644 | Ga0395900_0048644_1079_2806 | 574 |
| 710 | 3300037418 | Ga0395900_0093364 | Ga0395900_0093364_989_2716 | 574 |
| 711 | 3300037418 | Ga0395900_0110938 | Ga0395900_0110938_944_2668 | 574 |
| 712 | 3300037466 | Ga0395898_0002807 | Ga0395898_0002807_13198_14925 | 574 |
| 713 | 3300037466 | Ga0395898_0009781 | Ga0395898_0009781_6685_8415 | 574 |
| 714 | 3300037471 | Ga0395905_0094125 | Ga0395905_0094125_873_2597 | 574 |
| 715 | 3300038443 | Ga0395901_0094209 | Ga0395901_0094209_965_2689 | 574 |
| 716 | 3300038443 | Ga0395901_0165458 | Ga0395901_0165458_421_2148 | 574 |
| 717 | 3300038443 | Ga0395901_0223688 | Ga0395901_0223688_35_1771 | 574 |
| 718 | 3300038443 | Ga0395901_0246539 | Ga0395901_0246539_118_1842 | 574 |
| 719 | 3300041408 | Ga0439453_0004139 | Ga0439453_0004139_360_2084 | 574 |
| 720 | 3300044684 | Ga0466966_0031412 | Ga0466966_0031412_826_2553 | 574 |
| 721 | 3300044694 | Ga0466963_0022421 | Ga0466963_0022421_1564_3291 | 574 |
| 722 | 3300045049 | Ga0466959_0040185 | Ga0466959_0040185_1298_3022 | 574 |
| 723 | 3300045836 | Ga0466958_0042967 | Ga0466958_0042967_601_2328 | 574 |
| 724 | 3300046455 | Ga0495603_0027842 | Ga0495603_0027842_182_1906 | 574 |
| 725 | 3300046459 | Ga0495629_0066555 | Ga0495629_0066555_63_1787 | 574 |
| 726 | 3300046460 | Ga0495638_0004609 | Ga0495638_0004609_6493_8223 | 574 |
| 727 | 3300046460 | Ga0495638_0029857 | Ga0495638_0029857_184_1908 | 574 |
| 728 | 3300046472 | Ga0495580_0037296 | Ga0495580_0037296_1286_3010 | 574 |
| 729 | 3300046491 | Ga0495584_0015596 | Ga0495584_0015596_231_1955 | 574 |
| 730 | 3300046499 | Ga0495594_0016216 | Ga0495594_0016216_1743_3467 | 574 |
| 731 | 3300046501 | Ga0495607_0057266 | Ga0495607_0057266_23_1747 | 574 |
| 732 | 3300046664 | Ga0495659_0011773 | Ga0495659_0011773_632_2356 | 574 |
| 733 | 3300046690 | Ga0495624_0035804 | Ga0495624_0035804_1073_2797 | 574 |
| 734 | 3300047321 | Ga0495676_0052298 | Ga0495676_0052298_416_2140 | 574 |
| 735 | 3300048903 | Ga0496100_0061810 | Ga0496100_0061810_188_1912 | 574 |
| 736 | 3300048904 | Ga0496101_0024952 | Ga0496101_0024952_1017_2741 | 574 |
| 737 | 3300048904 | Ga0496101_0051971 | Ga0496101_0051971_812_2536 | 574 |
| 738 | 3300048905 | Ga0496102_0006681 | Ga0496102_0006681_3830_5554 | 574 |
| 739 | 3300048906 | Ga0496103_0001330 | Ga0496103_0001330_2029_3753 | 574 |
| 740 | 3300048906 | Ga0496103_0062570 | Ga0496103_0062570_61_1785 | 574 |
| 741 | 3300048907 | Ga0496104_0000935 | Ga0496104_0000935_12972_14696 | 574 |
| 742 | 3300048907 | Ga0496104_0002021 | Ga0496104_0002021_10370_12094 | 574 |
| 743 | 3300048908 | Ga0496105_0000364 | Ga0496105_0000364_15307_17031 | 574 |
| 744 | 3300048908 | Ga0496105_0014298 | Ga0496105_0014298_3883_5607 | 574 |
| 745 | 3300048908 | Ga0496105_0018042 | Ga0496105_0018042_653_2377 | 574 |
| 746 | 3300048909 | Ga0496106_0001709 | Ga0496106_0001709_3437_5161 | 574 |
| 747 | 3300048909 | Ga0496106_0005524 | Ga0496106_0005524_3327_5051 | 574 |
| 748 | 3300048909 | Ga0496106_0036071 | Ga0496106_0036071_570_2294 | 574 |
| 749 | 3300048910 | Ga0496107_0025281 | Ga0496107_0025281_1881_3605 | 574 |
| 750 | 3300048910 | Ga0496107_0077651 | Ga0496107_0077651_598_2322 | 574 |
| 751 | 3300048911 | Ga0496108_0001344 | Ga0496108_0001344_10002_11726 | 574 |
| 752 | 3300048912 | Ga0496109_0002147 | Ga0496109_0002147_10628_12352 | 574 |
| 753 | 3300048914 | Ga0496111_0000807 | Ga0496111_0000807_4569_6293 | 574 |
| 754 | 3300048915 | Ga0496112_0000646 | Ga0496112_0000646_10684_12408 | 574 |
| 755 | 3300048915 | Ga0496112_0157356 | Ga0496112_0157356_235_1959 | 574 |
| 756 | 3300048916 | Ga0496113_0000048 | Ga0496113_0000048_36820_38544 | 574 |
| 757 | 3300048918 | Ga0496115_0024951 | Ga0496115_0024951_753_2477 | 574 |
| 758 | 3300048918 | Ga0496115_0124463 | Ga0496115_0124463_382_2106 | 574 |
| 759 | 3300048920 | Ga0496117_0021552 | Ga0496117_0021552_2315_4039 | 574 |
| 760 | 3300048923 | Ga0496120_0001824 | Ga0496120_0001824_14006_15733 | 574 |
| 761 | 3300048924 | Ga0496121_0000780 | Ga0496121_0000780_23101_24825 | 574 |
| 762 | 3300048927 | Ga0496124_0001377 | Ga0496124_0001377_18190_19914 | 574 |
| 763 | 3300049568 | Ga0501031_0017275 | Ga0501031_0017275_381_2135 | 574 |
| 764 | 3300049569 | Ga0501032_0025126 | Ga0501032_0025126_349_2103 | 574 |
| 765 | 3300049569 | Ga0501032_0036933 | Ga0501032_0036933_331_2055 | 574 |
| 766 | 3300049570 | Ga0501033_0008987 | Ga0501033_0008987_373_2127 | 574 |
| 767 | 3300049571 | Ga0501034_0000247 | Ga0501034_0000247_34236_35960 | 574 |
| 768 | 3300049571 | Ga0501034_0004140 | Ga0501034_0004140_12439_14163 | 574 |
| 769 | 3300049571 | Ga0501034_0007071 | Ga0501034_0007071_4130_5854 | 574 |
| 770 | 3300049571 | Ga0501034_0007660 | Ga0501034_0007660_7232_8956 | 574 |
| 771 | 3300049571 | Ga0501034_0058266 | Ga0501034_0058266_1085_2824 | 574 |
| 772 | 3300049573 | Ga0501037_0000753 | Ga0501037_0000753_16487_18241 | 574 |
| 773 | 3300049573 | Ga0501037_0008277 | Ga0501037_0008277_3444_5183 | 574 |
| 774 | 3300049575 | Ga0501039_0074875 | Ga0501039_0074875_741_2465 | 574 |
| 775 | 3300049577 | Ga0501041_0010481 | Ga0501041_0010481_486_2210 | 574 |
| 776 | 3300049579 | Ga0501043_0000031 | Ga0501043_0000031_132830_134584 | 574 |
| 777 | 3300049580 | Ga0501046_0003147 | Ga0501046_0003147_3339_5063 | 574 |
| 778 | 3300049581 | Ga0501047_0039175 | Ga0501047_0039175_1250_2974 | 574 |
| 779 | 3300049581 | Ga0501047_0051713 | Ga0501047_0051713_475_2199 | 574 |
| 780 | 3300049581 | Ga0501047_0113988 | Ga0501047_0113988_253_1977 | 574 |
| 781 | 3300049584 | Ga0501068_0022282 | Ga0501068_0022282_1532_3286 | 574 |
| 782 | 3300049584 | Ga0501068_0039213 | Ga0501068_0039213_112_1851 | 574 |
| 783 | 3300049584 | Ga0501068_0064517 | Ga0501068_0064517_131_1855 | 574 |
| 784 | 3300049585 | Ga0501069_0000362 | Ga0501069_0000362_16877_18631 | 574 |
| 785 | 3300049586 | Ga0501070_0006517 | Ga0501070_0006517_2073_3827 | 574 |
| 786 | 3300049587 | Ga0501071_0036454 | Ga0501071_0036454_94_1818 | 574 |
| 787 | 3300049587 | Ga0501071_0090456 | Ga0501071_0090456_173_1927 | 574 |
| 788 | 3300049588 | Ga0501072_0005871 | Ga0501072_0005871_4200_5924 | 574 |
| 789 | 3300049589 | Ga0501073_0050501 | Ga0501073_0050501_33_1757 | 574 |
| 790 | 3300049589 | Ga0501073_0069905 | Ga0501073_0069905_331_2055 | 574 |
| 791 | 3300049590 | Ga0501074_0004186 | Ga0501074_0004186_4157_5911 | 574 |
| 792 | 3300049590 | Ga0501074_0040878 | Ga0501074_0040878_470_2194 | 574 |
| 793 | 3300049591 | Ga0501075_0034007 | Ga0501075_0034007_399_2123 | 574 |
| 794 | 3300049591 | Ga0501075_0056774 | Ga0501075_0056774_25_1749 | 574 |
| 795 | 3300049592 | Ga0501076_0037460 | Ga0501076_0037460_1942_3675 | 574 |
| 796 | 3300049592 | Ga0501076_0071397 | Ga0501076_0071397_443_2167 | 574 |
| 797 | 3300049593 | Ga0501077_0001516 | Ga0501077_0001516_2251_3975 | 574 |
| 798 | 3300049741 | Ga0501079_0057846 | Ga0501079_0057846_204_1928 | 574 |
| 799 | 3300049741 | Ga0501079_0084498 | Ga0501079_0084498_680_2404 | 574 |
| 800 | 3300049741 | Ga0501079_0116550 | Ga0501079_0116550_326_2050 | 574 |
| 801 | 3300049742 | Ga0501080_0016292 | Ga0501080_0016292_4785_6539 | 574 |
| 802 | 3300049742 | Ga0501080_0035176 | Ga0501080_0035176_2671_4395 | 574 |
| 803 | 3300049742 | Ga0501080_0043040 | Ga0501080_0043040_246_1979 | 574 |
| 804 | 3300049742 | Ga0501080_0065110 | Ga0501080_0065110_353_2077 | 574 |
| 805 | 3300049743 | Ga0501081_0002741 | Ga0501081_0002741_821_2545 | 574 |
| 806 | 3300049743 | Ga0501081_0011071 | Ga0501081_0011071_2413_4137 | 574 |
| 807 | 3300049743 | Ga0501081_0020147 | Ga0501081_0020147_2259_3983 | 574 |
| 808 | 3300049743 | Ga0501081_0024549 | Ga0501081_0024549_229_1962 | 574 |
| 809 | 3300049744 | Ga0501083_0001104 | Ga0501083_0001104_3008_4762 | 574 |
| 810 | 3300049744 | Ga0501083_0068490 | Ga0501083_0068490_598_2322 | 574 |
| 811 | 3300049822 | Ga0501035_0000036 | Ga0501035_0000036_20893_22647 | 574 |
| 812 | 3300049822 | Ga0501035_0018367 | Ga0501035_0018367_3356_5110 | 574 |
| 813 | 3300049822 | Ga0501035_0100874 | Ga0501035_0100874_205_1929 | 574 |
| 814 | 3300049823 | Ga0501044_0000011 | Ga0501044_0000011_129607_131361 | 574 |
| 815 | 3300049823 | Ga0501044_0124848 | Ga0501044_0124848_632_2356 | 574 |
| 816 | 3300049823 | Ga0501044_0139308 | Ga0501044_0139308_109_1833 | 574 |
| 817 | 3300049824 | Ga0501045_0067200 | Ga0501045_0067200_626_2350 | 574 |
| 818 | 3300050491 | nmdc:mga00v17_67988_c1 | nmdc:mga00v17_67988_c1_126_1850 | 574 |
| 819 | 3300050492 | nmdc:mga0yw44_3978_c1 | nmdc:mga0yw44_3978_c1_651_2375 | 574 |
| 820 | 3300050492 | nmdc:mga0yw44_7148_c1 | nmdc:mga0yw44_7148_c1_817_2541 | 574 |
| 821 | 3300050494 | nmdc:mga06z11_36709_c1 | nmdc:mga06z11_36709_c1_434_2158 | 574 |
| 822 | 3300050496 | nmdc:mga07m45_9818_c1 | nmdc:mga07m45_9818_c1_3144_4868 | 574 |
| 823 | 3300050507 | nmdc:mga05p37_6958_c1 | nmdc:mga05p37_6958_c1_7075_8799 | 574 |
| 824 | 3300050507 | nmdc:mga05p37_79380_c1 | nmdc:mga05p37_79380_c1_855_2579 | 574 |
| 825 | 3300050508 | nmdc:mga09592_43052_c1 | nmdc:mga09592_43052_c1_1760_3484 | 574 |
| 826 | 3300050510 | nmdc:mga06r32_140339_c1 | nmdc:mga06r32_140339_c1_346_2076 | 574 |
| 827 | 3300050510 | nmdc:mga06r32_32705_c1 | nmdc:mga06r32_32705_c1_2728_4452 | 574 |
| 828 | 3300050510 | nmdc:mga06r32_78400_c1 | nmdc:mga06r32_78400_c1_40_1812 | 574 |
| 829 | 3300050511 | nmdc:mga08y16_32250_c1 | nmdc:mga08y16_32250_c1_3231_4955 | 574 |
| 830 | 3300050511 | nmdc:mga08y16_67602_c1 | nmdc:mga08y16_67602_c1_1264_2988 | 574 |
| 831 | 3300050512 | nmdc:mga0n895_15036_c1 | nmdc:mga0n895_15036_c1_2769_4493 | 574 |
| 832 | 3300050512 | nmdc:mga0n895_42047_c1 | nmdc:mga0n895_42047_c1_317_2041 | 574 |
| 833 | 3300050514 | nmdc:mga08x19_4_c1 | nmdc:mga08x19_4_c1_98846_100570 | 574 |
| 834 | 3300050516 | nmdc:mga0sz30_8254_c1 | nmdc:mga0sz30_8254_c1_38_1762 | 574 |
| 835 | 3300053077 | Ga0495601_0007958 | Ga0495601_0007958_1274_2998 | 574 |
| 836 | 3300053077 | Ga0495601_0059481 | Ga0495601_0059481_34_1758 | 574 |
| 837 | 3300053079 | Ga0500610_0019460 | Ga0500610_0019460_1293_3017 | 574 |
| 838 | 3300053087 | Ga0500643_000693 | Ga0500643_000693_7703_9436 | 574 |
| 839 | 3300053097 | Ga0500648_042009 | Ga0500648_042009_567_2291 | 574 |
| 840 | 3300053103 | Ga0500555_008037 | Ga0500555_008037_44_1768 | 574 |
| 841 | 3300053119 | Ga0500595_003443 | Ga0500595_003443_1151_2875 | 574 |
| 842 | 3300053131 | Ga0500652_000015 | Ga0500652_000015_58408_60132 | 574 |
| 843 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_478750_480474 | 574 |
| 844 | 3300053153 | Ga0500616_0019516 | Ga0500616_0019516_953_2683 | 574 |
| 845 | 3300053155 | Ga0500620_000453 | Ga0500620_000453_3489_5213 | 574 |
| 846 | 3300053735 | Ga0500596_000569 | Ga0500596_000569_4845_6569 | 574 |
| 847 | 3300054114 | Ga0501084_0006511 | Ga0501084_0006511_6890_8614 | 574 |
| 848 | 3300060353 | Ga0501082_0017709 | Ga0501082_0017709_2887_4611 | 574 |
| 849 | 3300060353 | Ga0501082_0024992 | Ga0501082_0024992_3407_5131 | 574 |
| 850 | 3300061734 | Ga0530510_0055624 | Ga0530510_0055624_464_2188 | 574 |
| 851 | 3300061734 | Ga0530510_0080675 | Ga0530510_0080675_316_2040 | 574 |
| 852 | iso_pu_bacteria | 2970524798 | 2970530741 | 574 |
| 853 | iso_pu_bacteria | 2979742915 | 2979746985 | 574 |
| 854 | iso_pu_bacteria | 8004395343 | 8004400298 | 574 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ze4-assembly1.cif.gz_A | the structure of holo- structure of dhad complex with [2fe-2s] cluster | 0.9668 | 4 | 558 |
| 6ovt-assembly1.cif.gz_A | crystal structure of ilvd from mycobacterium tuberculosis | 0.9634 | 8 | 559 |
| 5ym0-assembly1.cif.gz_A | the crystal structure of dhad | 0.9627 | 5 | 559 |
| 6ovt-assembly1.cif.gz_D | crystal structure of ilvd from mycobacterium tuberculosis | 0.9582 | 10 | 559 |
| 6ovt-assembly1.cif.gz_C | crystal structure of ilvd from mycobacterium tuberculosis | 0.9575 | 8 | 559 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58672_371_522_3.50.30.80 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like | 0.9697 | 383 | 530 | 3.50.30.80 |
| af_I1M137_1_420_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9693 | 4 | 381 | 3.40.50.1820 |
| af_Q2FWK7_1_375_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9652 | 11 | 381 | 3.40.50.360 |
| af_A0A1D6KMC8_411_524_3.50.30.80 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like | 0.964 | 384 | 489 | 3.50.30.80 |
| af_Q2FWK7_1_375_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9526 | 11 | 381 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528TIC4-F1-model_v4 | Dihydroxy-acid dehydratase (EC 4.2.1.9) | 0.9987 | 387 | 486 |
GO:0004160
GO:0009082 |
| AF-A0A7C5CCM4-F1-model_v4 | Dihydroxy-acid dehydratase (EC 4.2.1.9) | 0.994 | 245 | 572 |
GO:0004160
GO:0009082 |
| AF-A0A4V1KZT7-F1-model_v4 | deleted | 0.9923 | 1 | 572 |
|
| AF-A0A2E5J660-F1-model_v4 | Dihydroxy-acid dehydratase (DAD) (EC 4.2.1.9) | 0.9907 | 8 | 572 |
GO:0000287
GO:0004160 GO:0009097 GO:0009099 GO:0051537 |
| AF-A0A661SYQ9-F1-model_v4 | deleted | 0.9906 | 406 | 559 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar