F483600

General Info

Members Datasets Scaffolds Average Seq Length
854 570 614 569

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0072782|Ga0501073_0072782_855_2381
Length 501
Sequence VKKGVAAAGGTPREFCTITVTDGIAMGHAGMYASLPSRDLIADSVELTMRGHGYDALVGLAGCDKSLPGMMMAMVRMNVPSIFIYGGSILPGSFRGQPITVQDMFEAVGKNSVGALSDEDLDEMEQVACPSAGACGAQFTANTMATVSEAIGLALPYSAGAPAPYEIRDRFCMTAGEMVMELVAKNIRPRDIVTRKALENAAAVXXXXGGSTNAALHLPAIAHECGIDFDLFDVAEIFKKTPYVADLKPGGRYVAKDMFEVGGIPLLMKTLLDNGYLHGDCLTVTGRSIAENLKSVKWNDKQDVVHPANKPLTKTGGVVGLKGNLAPDGAIVKVAGMTELKFSGPARCFDAVRNKKYKEGEVLVIRYEGPRGGPGMREMLSTTAALYGQGMGGKVALITDGRFSGATRGFCIGHVGPEAAVGGPIGLLKDGDIITIDAVAGTIDVKLTADELAARKKDWKPREHQFGSGYLWKYAQQVGPAVKGAVTHPGGEGEKECYADG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
14 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
15 2643221629 Devosia sp. Root105 Isolate Unclassified
16 2643221662 Devosia sp. Root413D1 Isolate Unclassified
17 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
18 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
19 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
20 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
21 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
22 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
23 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
24 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
25 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
26 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
27 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
28 2842694124 Methylopila sp. R-72369 Isolate Unclassified
29 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
30 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
31 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
32 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
33 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
34 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
35 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
36 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
37 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
38 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
39 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
40 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
41 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
42 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
43 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
44 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
45 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
46 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
47 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
48 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
49 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
50 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
51 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
52 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
53 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
54 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
55 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
56 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
57 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
58 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
59 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
60 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
61 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
62 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
63 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
64 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
65 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
66 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
67 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
68 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
69 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
70 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
71 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
72 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
73 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
74 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
75 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
76 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
77 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
78 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
79 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
80 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
81 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
82 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
83 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
84 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
85 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
86 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
87 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
88 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
89 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
90 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
91 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
92 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
93 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
94 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
95 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
96 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
97 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
98 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
99 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
100 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
101 2902330777 Methylobacterium sp. 2A Isolate Unclassified
102 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
103 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
104 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
105 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
106 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
107 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
108 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
109 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
110 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
111 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
112 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
113 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
114 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
115 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
116 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
117 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
118 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
119 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
120 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
121 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
122 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
123 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
124 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
125 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
126 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
127 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
128 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
129 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
130 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
131 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
132 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
133 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
134 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
135 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
136 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
137 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
138 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
139 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
140 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
141 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
142 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
143 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
144 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
145 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
146 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
147 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
148 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
149 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
150 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
151 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
152 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
153 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
154 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
155 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
156 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
157 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
158 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
159 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
160 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
161 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
162 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
163 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
164 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
165 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
166 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
167 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
168 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
169 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
170 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
171 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
172 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
173 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
174 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
175 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
176 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
177 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
178 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
179 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
180 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
181 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
182 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
183 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
184 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
185 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
186 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
187 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
188 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
189 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
190 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
191 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
192 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
193 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
194 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
195 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
196 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
197 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
198 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
199 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
200 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
201 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
202 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
203 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
204 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
205 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
206 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
207 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
208 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
209 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
210 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
211 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
212 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
213 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
214 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
215 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
216 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
217 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
218 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
219 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
220 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
221 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
222 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
223 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
224 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
225 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
226 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
227 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
228 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
229 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
230 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
231 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
232 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
233 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
234 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
235 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
236 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
237 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
238 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
239 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
240 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
241 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
242 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
243 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
244 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
245 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
246 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
247 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
248 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
249 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
250 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
251 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
252 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
253 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
254 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
255 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
256 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
257 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
258 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
259 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
260 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
261 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
262 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
263 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
264 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
265 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
266 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
267 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
268 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
269 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
270 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
271 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
272 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
273 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
274 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
275 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
276 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
277 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
278 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
279 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
280 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
281 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
282 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
283 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
284 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
285 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
286 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
287 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
288 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
289 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
290 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
291 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
292 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
293 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
294 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
295 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
296 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
297 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
298 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
299 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
300 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
301 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
302 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
303 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
304 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
305 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
306 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
307 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
308 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
310 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
312 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
313 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
315 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
360 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
361 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
362 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
363 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
364 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
365 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
366 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
367 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
368 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
369 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
370 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
371 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
372 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
373 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
374 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
375 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
376 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
377 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
378 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
379 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
380 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
381 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
382 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
383 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
384 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
385 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
386 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
387 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
388 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
389 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
390 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
391 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
392 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
393 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
394 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
395 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
396 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
397 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
398 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
399 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
400 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
401 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
402 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
403 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
404 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
405 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
406 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
407 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
408 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
409 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
410 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
411 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
412 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
413 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
414 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
415 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
416 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
417 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
418 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
419 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
420 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
421 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
422 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
423 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
424 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
425 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
426 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
427 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
428 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
429 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
430 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
431 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
432 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
433 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
434 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
435 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
436 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
437 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
438 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
439 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
440 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
441 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
442 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
443 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
444 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
445 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
446 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
447 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
448 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
449 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
450 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
451 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
452 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
453 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
454 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
455 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
456 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
457 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
458 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
459 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
460 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
461 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
462 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
463 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
464 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
465 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
466 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
467 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
468 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
469 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
470 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
471 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
472 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
473 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
474 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
475 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
476 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
477 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
478 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
479 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
480 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
481 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
482 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
483 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
484 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
485 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
486 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
487 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
488 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
500 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
501 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
502 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
503 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
504 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
505 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
506 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
507 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
508 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
509 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
510 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
511 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
512 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
513 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
514 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
515 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
516 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
517 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
520 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
521 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
522 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
523 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
524 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
525 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
526 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
527 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
528 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
529 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
530 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
531 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
532 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
533 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
534 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
535 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
536 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
537 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
538 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
539 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
540 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
541 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
542 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
543 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
544 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
545 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
546 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
547 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
548 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
549 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
550 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
551 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
552 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
553 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
554 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
555 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
556 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
557 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
558 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
559 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
560 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
561 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
562 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
563 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
564 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
565 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
566 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
567 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
568 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
569 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
570 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.78
Metatranscriptomes 0.12
Isolates 28.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.15
Nodule 23.54
Rhizoplane 5.5
Rhizosphere 59.25
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005092 3300001977 Bacteria 2057
2 JGI24740J21852_10002718 3300001979 Bacteria 7919
3 JGI24737J22298_10026704 3300001990 Bacteria 1823
4 JGI24743J22301_10002476 3300001991 Bacteria 2788
5 JGI24750J21931_1001573 3300002070 Bacteria 2804
6 JGI25165J46597_1000209 3300003214 Bacteria 83865
7 Ga0055542_1001237 3300003762 Bacteria 14181
8 Ga0065707_10082036 3300005295 Bacteria 24003
9 Ga0070690_100012694 3300005330 Bacteria 4961
10 Ga0070680_100005001 3300005336 Bacteria 9989
11 Ga0070680_100014421 3300005336 Bacteria 6177
12 Ga0070682_100008648 3300005337 Bacteria 5748
13 Ga0070682_100032430 3300005337 Bacteria 3168
14 Ga0070660_100017179 3300005339 Bacteria 5270
15 Ga0070660_100023476 3300005339 Bacteria 4568
16 Ga0070660_100091886 3300005339 Bacteria 2395
17 Ga0070691_10029192 3300005341 Bacteria 2580
18 Ga0070661_100000136 3300005344 Bacteria 61339
19 Ga0070661_100025422 3300005344 Bacteria 4255
20 Ga0070692_10013099 3300005345 Bacteria 3859
21 Ga0070674_100001589 3300005356 Bacteria 12172
22 Ga0070674_100074541 3300005356 Bacteria 2408
23 Ga0070659_100049347 3300005366 Bacteria 3309
24 Ga0070667_100025110 3300005367 Bacteria 4953
25 Ga0070667_100101319 3300005367 Bacteria 2487
26 Ga0070713_100017657 3300005436 Bacteria 5403
27 Ga0070713_100076504 3300005436 Bacteria 2843
28 Ga0070713_100101050 3300005436 Bacteria 2498
29 Ga0070713_100146200 3300005436 Bacteria 2099
30 Ga0070700_100012459 3300005441 Bacteria 4748
31 Ga0070678_100000645 3300005456 Bacteria 17064
32 Ga0070681_10019339 3300005458 Bacteria 6816
33 Ga0070681_10050201 3300005458 Bacteria 4163
34 Ga0070681_10193215 3300005458 Bacteria 1955
35 Ga0070685_10040776 3300005466 Bacteria 2643
36 Ga0070679_100110957 3300005530 Bacteria 2729
37 Ga0070679_100116519 3300005530 Bacteria 2656
38 Ga0070684_100013746 3300005535 Bacteria 6534
39 Ga0070684_100057270 3300005535 Bacteria 3402
40 Ga0070697_100007631 3300005536 Bacteria 8420
41 Ga0068853_100005539 3300005539 Bacteria 9904
42 Ga0068853_100028539 3300005539 Bacteria 4694
43 Ga0070695_100014007 3300005545 Bacteria 4829
44 Ga0070665_100000458 3300005548 Bacteria 59389
45 Ga0068855_100075277 3300005563 Bacteria 3920
46 Ga0068855_100098438 3300005563 Bacteria 3369
47 Ga0068855_100240249 3300005563 Bacteria 2024
48 Ga0070664_100014739 3300005564 Bacteria 6384
49 Ga0068852_100015727 3300005616 Bacteria 5880
50 Ga0068859_100042742 3300005617 Bacteria 4553
51 Ga0068864_100064771 3300005618 Bacteria 3170
52 Ga0068861_100073921 3300005719 Bacteria 2649
53 Ga0068851_10040828 3300005834 Bacteria 2332
54 Ga0068851_10045496 3300005834 Bacteria 2218
55 Ga0068860_100001757 3300005843 Bacteria 23123
56 Ga0068860_100098874 3300005843 Bacteria 2783
57 Ga0081455_10000444 3300005937 Bacteria 54433
58 Ga0081455_10003034 3300005937 Bacteria 19573
59 Ga0081455_10003870 3300005937 Bacteria 17056
60 Ga0081455_10011629 3300005937 Bacteria 8830
61 Ga0081538_10010773 3300005981 Bacteria 7474
62 Ga0081538_10048046 3300005981 Bacteria 2609
63 Ga0081540_1022231 3300005983 Bacteria 3747
64 Ga0081539_10006551 3300005985 Bacteria 11109
65 Ga0070717_10002040 3300006028 Bacteria 14141
66 Ga0070717_10024422 3300006028 Bacteria 4800
67 Ga0075365_10006310 3300006038 Bacteria 6511
68 Ga0075368_10005599 3300006042 Bacteria 4332
69 Ga0075368_10016104 3300006042 Bacteria 2782
70 Ga0070712_100002437 3300006175 Bacteria 11465
71 Ga0075362_10010086 3300006177 Bacteria 3676
72 Ga0075367_10006314 3300006178 Bacteria 5977
73 Ga0075367_10042352 3300006178 Bacteria 2664
74 Ga0097621_100034819 3300006237 Bacteria 4019
75 Ga0075370_10016647 3300006353 Bacteria 3957
76 Ga0075430_100000060 3300006846 Bacteria 58237
77 Ga0075430_100024195 3300006846 Bacteria 5170
78 Ga0075430_100056454 3300006846 Bacteria 3302
79 Ga0075431_100027666 3300006847 Bacteria 5819
80 Ga0075431_100174308 3300006847 Bacteria 2209
81 Ga0075434_100036752 3300006871 Bacteria 4845
82 Ga0075436_100000396 3300006914 Bacteria 28016
83 Ga0075436_100007214 3300006914 Bacteria 7604
84 Ga0097620_100042742 3300006931 Bacteria 4553
85 Ga0099795_10000411 3300007788 Bacteria 7838
86 Ga0105240_10110067 3300009093 Bacteria 3335
87 Ga0111539_10028731 3300009094 Bacteria 6782
88 Ga0111539_10040542 3300009094 Bacteria 5604
89 Ga0105245_10000398 3300009098 Bacteria 40337
90 Ga0105247_10054002 3300009101 Bacteria 2479
91 Ga0114129_10005706 3300009147 Bacteria 17633
92 Ga0114129_10009088 3300009147 Bacteria 14162
93 Ga0114129_10013011 3300009147 Bacteria 11851
94 Ga0105243_10000202 3300009148 Bacteria 69670
95 Ga0105243_10073548 3300009148 Bacteria 2770
96 Ga0105243_10096966 3300009148 Bacteria 2440
97 Ga0105241_10001829 3300009174 Bacteria 16143
98 Ga0105241_10030299 3300009174 Bacteria 4042
99 Ga0105242_10163785 3300009176 Bacteria 1949
100 Ga0105248_10030240 3300009177 Bacteria 6046
101 Ga0105237_10014904 3300009545 Bacteria 8107
102 Ga0105237_10088033 3300009545 Bacteria 3095
103 Ga0105238_10004648 3300009551 Bacteria 13589
104 Ga0105238_10005879 3300009551 Bacteria 12154
105 Ga0105238_10039698 3300009551 Bacteria 4773
106 Ga0105238_10081246 3300009551 Bacteria 3230
107 Ga0105249_10113755 3300009553 Bacteria 2561
108 Ga0099796_10003534 3300010159 Bacteria 3644
109 Ga0099796_10015336 3300010159 Bacteria 2238
110 Ga0105239_10057788 3300010375 Bacteria 4256
111 Ga0105239_10113265 3300010375 Bacteria 3008
112 Ga0157373_10000586 3300013100 Bacteria 28347
113 Ga0157373_10019996 3300013100 Bacteria 4870
114 Ga0157371_10000024 3300013102 Bacteria 281202
115 Ga0157369_10166917 3300013105 Bacteria 2321
116 Ga0157378_10049148 3300013297 Bacteria 3752
117 Ga0157372_10022517 3300013307 Bacteria 6819
118 Ga0157372_10253969 3300013307 Bacteria 2041
119 Ga0157375_10101613 3300013308 Bacteria 2959
120 Ga0163163_10000006 3300014325 Bacteria 320401
121 Ga0157380_10006819 3300014326 Bacteria 8072
122 Ga0157380_10016504 3300014326 Bacteria 5447
123 Ga0157380_10134840 3300014326 Bacteria 2112
124 Ga0157379_10119859 3300014968 Bacteria 2366
125 Ga0182006_1040534 3300015261 Bacteria 1833
126 Ga0197907_10465604 3300020069 Bacteria 2395
127 Ga0209674_104793 3300025226 Bacteria 2130
128 Ga0209026_1000024 3300025250 Bacteria 355839
129 Ga0209148_1000050 3300025254 Bacteria 413178
130 Ga0209759_1000389 3300025256 Bacteria 54772
131 Ga0209233_1000013 3300025261 Bacteria 1013785
132 Ga0209233_1000129 3300025261 Bacteria 206511
133 Ga0209455_1000183 3300025272 Bacteria 99952
134 Ga0209758_1000013 3300025297 Bacteria 873003
135 Ga0207692_10028531 3300025898 Bacteria 2641
136 Ga0207710_10009424 3300025900 Bacteria 4110
137 Ga0207688_10001280 3300025901 Bacteria 13032
138 Ga0207647_10014852 3300025904 Bacteria 5355
139 Ga0207647_10025394 3300025904 Bacteria 3894
140 Ga0207699_10027424 3300025906 Bacteria 3153
141 Ga0207645_10007694 3300025907 Bacteria 7589
142 Ga0207643_10001224 3300025908 Bacteria 15168
143 Ga0207705_10002842 3300025909 Bacteria 13242
144 Ga0207705_10008702 3300025909 Bacteria 7395
145 Ga0207654_10001335 3300025911 Bacteria 13110
146 Ga0207654_10002277 3300025911 Bacteria 9842
147 Ga0207707_10040606 3300025912 Bacteria 4063
148 Ga0207707_10058202 3300025912 Bacteria 3363
149 Ga0207707_10077299 3300025912 Bacteria 2905
150 Ga0207707_10137372 3300025912 Bacteria 2137
151 Ga0207695_10000402 3300025913 Bacteria 96771
152 Ga0207695_10034936 3300025913 Bacteria 5459
153 Ga0207695_10039829 3300025913 Bacteria 5048
154 Ga0207695_10052366 3300025913 Bacteria 4277
155 Ga0207695_10093269 3300025913 Bacteria 3020
156 Ga0207671_10006493 3300025914 Bacteria 10407
157 Ga0207693_10006383 3300025915 Bacteria 9771
158 Ga0207693_10047013 3300025915 Bacteria 3391
159 Ga0207693_10047667 3300025915 Bacteria 3366
160 Ga0207693_10067214 3300025915 Bacteria 2806
161 Ga0207663_10074920 3300025916 Bacteria 2194
162 Ga0207663_10110512 3300025916 Bacteria 1864
163 Ga0207660_10022170 3300025917 Bacteria 4277
164 Ga0207657_10000101 3300025919 Bacteria 82962
165 Ga0207657_10029863 3300025919 Bacteria 4955
166 Ga0207657_10037809 3300025919 Bacteria 4306
167 Ga0207657_10058612 3300025919 Bacteria 3312
168 Ga0207657_10071669 3300025919 Bacteria 2934
169 Ga0207649_10000154 3300025920 Bacteria 56342
170 Ga0207649_10000425 3300025920 Bacteria 30960
171 Ga0207652_10015345 3300025921 Bacteria 6220
172 Ga0207652_10029441 3300025921 Bacteria 4591
173 Ga0207646_10013813 3300025922 Bacteria 7702
174 Ga0207694_10000095 3300025924 Bacteria 99130
175 Ga0207694_10006206 3300025924 Bacteria 9123
176 Ga0207694_10033216 3300025924 Bacteria 3953
177 Ga0207687_10026852 3300025927 Bacteria 3858
178 Ga0207700_10014504 3300025928 Bacteria 5166
179 Ga0207690_10014343 3300025932 Bacteria 4788
180 Ga0207690_10036815 3300025932 Bacteria 3172
181 Ga0207690_10054922 3300025932 Bacteria 2680
182 Ga0207706_10013662 3300025933 Bacteria 7372
183 Ga0207709_10000201 3300025935 Bacteria 78554
184 Ga0207669_10000075 3300025937 Bacteria 50601
185 Ga0207669_10065800 3300025937 Bacteria 2250
186 Ga0207669_10066086 3300025937 Bacteria 2247
187 Ga0207665_10003464 3300025939 Bacteria 10538
188 Ga0207691_10009803 3300025940 Bacteria 9197
189 Ga0207711_10016979 3300025941 Bacteria 6045
190 Ga0207679_10005273 3300025945 Bacteria 8104
191 Ga0207667_10000010 3300025949 Bacteria 477432
192 Ga0207667_10004211 3300025949 Bacteria 17659
193 Ga0207667_10010528 3300025949 Bacteria 10808
194 Ga0207640_10000829 3300025981 Bacteria 17600
195 Ga0207640_10029840 3300025981 Bacteria 3352
196 Ga0207703_10109549 3300026035 Bacteria 2354
197 Ga0207639_10003097 3300026041 Bacteria 11175
198 Ga0207639_10032248 3300026041 Bacteria 3855
199 Ga0207639_10045222 3300026041 Bacteria 3314
200 Ga0207678_10035216 3300026067 Bacteria 4359
201 Ga0207678_10106267 3300026067 Bacteria 2395
202 Ga0207708_10001181 3300026075 Bacteria 19661
203 Ga0207702_10000025 3300026078 Bacteria 186312
204 Ga0207702_10014651 3300026078 Bacteria 6506
205 Ga0207702_10016315 3300026078 Bacteria 6148
206 Ga0207648_10005697 3300026089 Bacteria 12493
207 Ga0207675_100007911 3300026118 Bacteria 10021
208 Ga0207683_10000067 3300026121 Bacteria 79552
209 Ga0207683_10008737 3300026121 Bacteria 8649
210 Ga0207698_10018802 3300026142 Bacteria 4718
211 Ga0207698_10021195 3300026142 Bacteria 4489
212 Ga0207698_10035023 3300026142 Bacteria 3668
213 Ga0209179_1000852 3300027512 Bacteria 3388
214 Ga0268266_10000002 3300028379 Bacteria 3059047
215 Ga0268266_10022663 3300028379 Bacteria 5346
216 Ga0268266_10085771 3300028379 Bacteria 2752
217 Ga0268264_10000022 3300028381 Bacteria 476624
218 Ga0265318_10000199 3300028577 Bacteria 52225
219 Ga0265338_10010200 3300028800 Bacteria 11072
220 Ga0265338_10053555 3300028800 Bacteria 3607
221 Ga0307511_10037215 3300030521 Bacteria 4208
222 Ga0265330_10023681 3300031235 Bacteria 2787
223 Ga0265332_10000793 3300031238 Bacteria 19220
224 Ga0265325_10001455 3300031241 Bacteria 16632
225 Ga0265325_10018610 3300031241 Bacteria 3852
226 Ga0265340_10012126 3300031247 Bacteria 4556
227 Ga0265340_10025144 3300031247 Bacteria 3019
228 Ga0265339_10003009 3300031249 Bacteria 11880
229 Ga0265339_10026275 3300031249 Bacteria 3335
230 Ga0265339_10047899 3300031249 Bacteria 2346
231 Ga0265331_10017547 3300031250 Bacteria 3728
232 Ga0265327_10000124 3300031251 Bacteria 169233
233 Ga0265327_10016308 3300031251 Bacteria 4725
234 Ga0265316_10081525 3300031344 Bacteria 2480
235 Ga0265313_10000124 3300031595 Bacteria 77104
236 Ga0265313_10001046 3300031595 Bacteria 26926
237 Ga0265314_10000192 3300031711 Bacteria 91053
238 Ga0265314_10002282 3300031711 Bacteria 19846
239 Ga0265314_10007587 3300031711 Bacteria 9390
240 Ga0265314_10011644 3300031711 Bacteria 7240
241 Ga0265342_10000100 3300031712 Bacteria 94554
242 Ga0265342_10004038 3300031712 Bacteria 11722
243 Ga0265342_10004875 3300031712 Bacteria 10389
244 Ga0265342_10006704 3300031712 Bacteria 8534
245 Ga0265342_10013562 3300031712 Bacteria 5459
246 Ga0265342_10017742 3300031712 Bacteria 4622
247 Ga0316576_10036561 3300031727 Bacteria 3511
248 Ga0307516_10017716 3300031730 Bacteria 7420
249 Ga0307405_10042177 3300031731 Bacteria 2776
250 Ga0307412_10073503 3300031911 Bacteria 2339
251 Ga0316583_10000048 3300032133 Bacteria 23093
252 Ga0373958_0002144 3300034819 Bacteria 2737
253 Ga0373926_0026571 3300035083 Bacteria 2026
254 Ga0373928_0008564 3300035084 Bacteria 1987
255 Ga0373934_0012745 3300035086 Bacteria 3174
256 Ga0373944_0021605 3300035089 Bacteria 1864
257 Ga0373923_0000396 3300035111 Bacteria 10077
258 Ga0373936_0002567 3300035113 Bacteria 6820
259 Ga0373939_0013119 3300035114 Bacteria 2125
260 Ga0373945_0004276 3300035116 Bacteria 4531
261 Ga0373945_0008605 3300035116 Bacteria 3327
262 Ga0373954_0015428 3300035118 Bacteria 3415
263 Ga0373943_0000297 3300035170 Bacteria 20643
264 Ga0373946_0000630 3300035171 Bacteria 11740
265 Ga0373946_0009980 3300035171 Bacteria 3511
266 Ga0373955_0000525 3300035172 Bacteria 16320
267 Ga0373955_0017841 3300035172 Bacteria 3518
268 Ga0373924_0001066 3300035410 Bacteria 8749
269 Ga0373931_0001151 3300035691 Bacteria 11249
270 Ga0373931_0013316 3300035691 Bacteria 4003
271 Ga0373931_0049989 3300035691 Bacteria 2223
272 Ga0373931_0060489 3300035691 Bacteria 2039
273 Ga0373935_0000006 3300035692 Bacteria 121726
274 Ga0373935_0001125 3300035692 Bacteria 14588
275 Ga0373927_0002633 3300035695 Bacteria 13084
276 Ga0373927_0013058 3300035695 Bacteria 5523
277 Ga0373933_0002040 3300035724 Bacteria 11607
278 Ga0373933_0005418 3300035724 Bacteria 6943
279 Ga0373933_0096345 3300035724 Bacteria 1831
280 Ga0373947_0000159 3300035725 Bacteria 35943
281 Ga0373947_0000394 3300035725 Bacteria 24570
282 Ga0373947_0021636 3300035725 Bacteria 3723
283 Ga0373947_0039728 3300035725 Bacteria 2800
284 Ga0373937_0003145 3300036401 Bacteria 13816
285 Ga0373937_0004380 3300036401 Bacteria 11989
286 Ga0373937_0005696 3300036401 Bacteria 10698
287 Ga0373937_0007971 3300036401 Bacteria 9182
288 Ga0373937_0085797 3300036401 Bacteria 2914
289 Ga0373925_0000776 3300037068 Bacteria 29348
290 Ga0373925_0008020 3300037068 Bacteria 7689
291 Ga0373925_0040075 3300037068 Bacteria 3467
292 Ga0373925_0073355 3300037068 Bacteria 2590
293 Ga0373925_0084541 3300037068 Bacteria 2418
294 Ga0395899_0007549 3300037312 Bacteria 8397
295 Ga0395900_0048644 3300037418 Bacteria 4368
296 Ga0395900_0093364 3300037418 Bacteria 3091
297 Ga0395900_0110938 3300037418 Bacteria 2817
298 Ga0395898_0002807 3300037466 Bacteria 19970
299 Ga0395898_0009781 3300037466 Bacteria 10050
300 Ga0395905_0094125 3300037471 Bacteria 2810
301 Ga0395901_0038577 3300038443 Bacteria 4942
302 Ga0395901_0094209 3300038443 Bacteria 3136
303 Ga0395901_0165458 3300038443 Bacteria 2322
304 Ga0395901_0223688 3300038443 Bacteria 1967
305 Ga0395901_0246539 3300038443 Bacteria 1862
306 Ga0436365_0088108 3300039437 Bacteria 12770
307 Ga0436365_1571761 3300039437 Bacteria 2617
308 Ga0436361_0484868 3300039447 Bacteria 5733
309 Ga0436361_0722712 3300039447 Bacteria 2726
310 Ga0436363_1572801 3300039450 Bacteria 2548
311 Ga0439453_0004139 3300041408 Bacteria 2139
312 Ga0466966_0031412 3300044684 Bacteria 3444
313 Ga0466963_0022421 3300044694 Bacteria 4000
314 Ga0466959_0040185 3300045049 Bacteria 3456
315 Ga0466958_0042967 3300045836 Bacteria 2721
316 Ga0495592_0000742 3300046454 Bacteria 22699
317 Ga0495592_0009467 3300046454 Bacteria 7324
318 Ga0495603_0027842 3300046455 Bacteria 3408
319 Ga0495629_0066555 3300046459 Bacteria 2515
320 Ga0495638_0004609 3300046460 Bacteria 10434
321 Ga0495638_0029857 3300046460 Bacteria 3515
322 Ga0495651_0002087 3300046462 Bacteria 15401
323 Ga0495651_0010936 3300046462 Bacteria 6982
324 Ga0495651_0073803 3300046462 Bacteria 2589
325 Ga0495653_0000203 3300046463 Bacteria 47869
326 Ga0495653_0061411 3300046463 Bacteria 2844
327 Ga0495650_0000058 3300046471 Bacteria 302308
328 Ga0495580_0037296 3300046472 Bacteria 3490
329 Ga0495605_0036971 3300046474 Bacteria 2459
330 Ga0495662_0007282 3300046476 Bacteria 5474
331 Ga0495664_0000017 3300046477 Bacteria 172210
332 Ga0495584_0015596 3300046491 Bacteria 3874
333 Ga0495594_0016216 3300046499 Bacteria 3923
334 Ga0495596_0029424 3300046500 Bacteria 2202
335 Ga0495607_0057266 3300046501 Bacteria 2234
336 Ga0495583_0001172 3300046506 Bacteria 28294
337 Ga0495608_0000058 3300046511 Bacteria 90246
338 Ga0495608_0056757 3300046511 Bacteria 2585
339 Ga0495618_0000049 3300046514 Bacteria 91727
340 Ga0495628_0000022 3300046516 Bacteria 140362
341 Ga0495628_0021240 3300046516 Bacteria 5344
342 Ga0495630_0010063 3300046517 Bacteria 6813
343 Ga0495648_0000166 3300046524 Bacteria 77879
344 Ga0495648_0000895 3300046524 Bacteria 31207
345 Ga0495663_0001212 3300046525 Bacteria 8286
346 Ga0495652_0000008 3300046529 Bacteria 343637
347 Ga0495652_0013568 3300046529 Bacteria 7333
348 Ga0495665_0025630 3300046531 Bacteria 3167
349 Ga0495640_0000727 3300046533 Bacteria 24699
350 Ga0495587_0000019 3300046536 Bacteria 161972
351 Ga0495645_0000006 3300046543 Bacteria 382503
352 Ga0495645_0003951 3300046543 Bacteria 10114
353 Ga0495667_0000090 3300046559 Bacteria 65991
354 Ga0495668_0000261 3300046616 Bacteria 74577
355 Ga0495668_0009306 3300046616 Bacteria 6040
356 Ga0495634_0002729 3300046642 Bacteria 14525
357 Ga0495625_0000910 3300046660 Bacteria 39828
358 Ga0495635_0000023 3300046663 Bacteria 153429
359 Ga0495635_0017526 3300046663 Bacteria 5002
360 Ga0495659_0011773 3300046664 Bacteria 2821
361 Ga0495657_0001777 3300046675 Bacteria 18440
362 Ga0495657_0018882 3300046675 Bacteria 4983
363 Ga0495599_0000039 3300046678 Bacteria 98345
364 Ga0495599_0020966 3300046678 Bacteria 4074
365 Ga0495623_0000073 3300046679 Bacteria 61884
366 Ga0495623_0014617 3300046679 Bacteria 5078
367 Ga0495646_0000017 3300046680 Bacteria 123549
368 Ga0495613_0010367 3300046689 Bacteria 6922
369 Ga0495624_0002118 3300046690 Bacteria 15142
370 Ga0495624_0006011 3300046690 Bacteria 8658
371 Ga0495624_0035804 3300046690 Bacteria 3203
372 Ga0495600_0000043 3300046809 Bacteria 73475
373 Ga0495600_0000711 3300046809 Bacteria 17482
374 Ga0495600_0010303 3300046809 Bacteria 5800
375 Ga0495581_0007230 3300047315 Bacteria 6421
376 Ga0495604_0000030 3300047317 Bacteria 138597
377 Ga0495604_0031736 3300047317 Bacteria 4190
378 Ga0495674_0000009 3300047319 Bacteria 310479
379 Ga0495676_0052298 3300047321 Bacteria 3261
380 Ga0495680_0000307 3300047322 Bacteria 54880
381 Ga0495680_0034783 3300047322 Bacteria 4065
382 Ga0495675_0001007 3300047444 Bacteria 17156
383 Ga0495684_0000031 3300047471 Bacteria 116753
384 Ga0495593_0001311 3300047673 Bacteria 14588
385 Ga0495593_0004675 3300047673 Bacteria 8142
386 Ga0495602_0000006 3300048088 Bacteria 322593
387 Ga0495602_0093924 3300048088 Bacteria 2480
388 Ga0496100_0045603 3300048903 Bacteria 2814
389 Ga0496100_0061810 3300048903 Bacteria 2469
390 Ga0496101_0024952 3300048904 Bacteria 4144
391 Ga0496101_0051971 3300048904 Bacteria 2953
392 Ga0496102_0000120 3300048905 Bacteria 112432
393 Ga0496102_0000758 3300048905 Bacteria 31549
394 Ga0496102_0006681 3300048905 Bacteria 9851
395 Ga0496102_0056461 3300048905 Bacteria 3582
396 Ga0496102_0097769 3300048905 Bacteria 2723
397 Ga0496103_0000154 3300048906 Bacteria 72239
398 Ga0496103_0000186 3300048906 Bacteria 62771
399 Ga0496103_0001330 3300048906 Bacteria 16750
400 Ga0496103_0032806 3300048906 Bacteria 3170
401 Ga0496103_0062570 3300048906 Bacteria 2317
402 Ga0496103_0104915 3300048906 Bacteria 1792
403 Ga0496104_0000116 3300048907 Bacteria 74423
404 Ga0496104_0000935 3300048907 Bacteria 25059
405 Ga0496104_0002021 3300048907 Bacteria 17617
406 Ga0496104_0042159 3300048907 Bacteria 4282
407 Ga0496104_0049921 3300048907 Bacteria 3946
408 Ga0496105_0000364 3300048908 Bacteria 30030
409 Ga0496105_0014298 3300048908 Bacteria 6316
410 Ga0496105_0014705 3300048908 Bacteria 6231
411 Ga0496105_0018042 3300048908 Bacteria 5664
412 Ga0496106_0001709 3300048909 Bacteria 16390
413 Ga0496106_0005524 3300048909 Bacteria 9356
414 Ga0496106_0036071 3300048909 Bacteria 3699
415 Ga0496107_0010874 3300048910 Bacteria 6333
416 Ga0496107_0025281 3300048910 Bacteria 4203
417 Ga0496107_0077651 3300048910 Bacteria 2419
418 Ga0496108_0001344 3300048911 Bacteria 19333
419 Ga0496108_0007516 3300048911 Bacteria 8837
420 Ga0496109_0002147 3300048912 Bacteria 16399
421 Ga0496109_0009622 3300048912 Bacteria 8243
422 Ga0496109_0063593 3300048912 Bacteria 3375
423 Ga0496109_0148649 3300048912 Bacteria 2193
424 Ga0496110_0085005 3300048913 Bacteria 2824
425 Ga0496111_0000807 3300048914 Bacteria 16805
426 Ga0496111_0011323 3300048914 Bacteria 6003
427 Ga0496112_0000646 3300048915 Bacteria 24167
428 Ga0496112_0157356 3300048915 Bacteria 2239
429 Ga0496113_0000048 3300048916 Bacteria 50958
430 Ga0496114_0005133 3300048917 Bacteria 10211
431 Ga0496114_0006528 3300048917 Bacteria 9192
432 Ga0496115_0000423 3300048918 Bacteria 34595
433 Ga0496115_0024951 3300048918 Bacteria 4651
434 Ga0496115_0124463 3300048918 Bacteria 2123
435 Ga0496116_0004809 3300048919 Bacteria 12742
436 Ga0496116_0005657 3300048919 Bacteria 11507
437 Ga0496117_0000317 3300048920 Bacteria 84472
438 Ga0496117_0000977 3300048920 Bacteria 43773
439 Ga0496117_0021552 3300048920 Bacteria 5207
440 Ga0496118_0000144 3300048921 Bacteria 124411
441 Ga0496118_0000303 3300048921 Bacteria 85332
442 Ga0496120_0001824 3300048923 Bacteria 23801
443 Ga0496121_0000697 3300048924 Bacteria 62465
444 Ga0496121_0000780 3300048924 Bacteria 58378
445 Ga0496121_0000977 3300048924 Bacteria 51197
446 Ga0496124_0000177 3300048927 Bacteria 128355
447 Ga0496124_0000214 3300048927 Bacteria 113007
448 Ga0496124_0001377 3300048927 Bacteria 36428
449 Ga0496125_0000850 3300048928 Bacteria 49000
450 Ga0496125_0001995 3300048928 Bacteria 27692
451 Ga0496126_0000505 3300048929 Bacteria 76567
452 Ga0496126_0165650 3300048929 Bacteria 1886
453 Ga0501290_000061 3300049513 Bacteria 15078
454 Ga0501292_000163 3300049515 Bacteria 10842
455 Ga0501300_001891 3300049523 Bacteria 3123
456 Ga0501031_0017275 3300049568 Bacteria 4688
457 Ga0501031_0042832 3300049568 Bacteria 2955
458 Ga0501032_0025126 3300049569 Bacteria 4107
459 Ga0501032_0036933 3300049569 Bacteria 3333
460 Ga0501033_0008987 3300049570 Bacteria 7714
461 Ga0501033_0021051 3300049570 Bacteria 4923
462 Ga0501033_0031944 3300049570 Bacteria 3952
463 Ga0501034_0000247 3300049571 Bacteria 99828
464 Ga0501034_0004140 3300049571 Bacteria 16237
465 Ga0501034_0007071 3300049571 Bacteria 11968
466 Ga0501034_0007660 3300049571 Bacteria 11490
467 Ga0501034_0041050 3300049571 Bacteria 4681
468 Ga0501034_0058090 3300049571 Bacteria 3888
469 Ga0501034_0058266 3300049571 Bacteria 3881
470 Ga0501036_0086031 3300049572 Bacteria 2658
471 Ga0501037_0000753 3300049573 Bacteria 24482
472 Ga0501037_0008277 3300049573 Bacteria 7624
473 Ga0501037_0126663 3300049573 Bacteria 1833
474 Ga0501039_0074875 3300049575 Bacteria 2632
475 Ga0501041_0010481 3300049577 Bacteria 5462
476 Ga0501042_0005477 3300049578 Bacteria 8177
477 Ga0501043_0000031 3300049579 Bacteria 140707
478 Ga0501043_0021229 3300049579 Bacteria 5090
479 Ga0501046_0003147 3300049580 Bacteria 15238
480 Ga0501046_0013927 3300049580 Bacteria 6792
481 Ga0501046_0032485 3300049580 Bacteria 4226
482 Ga0501047_0001238 3300049581 Bacteria 25278
483 Ga0501047_0005504 3300049581 Bacteria 11918
484 Ga0501047_0031114 3300049581 Bacteria 5147
485 Ga0501047_0039175 3300049581 Bacteria 4585
486 Ga0501047_0051713 3300049581 Bacteria 3970
487 Ga0501047_0113988 3300049581 Bacteria 2585
488 Ga0501047_0233092 3300049581 Bacteria 1694
489 Ga0501068_0022282 3300049584 Bacteria 3703
490 Ga0501068_0039213 3300049584 Bacteria 2840
491 Ga0501068_0064517 3300049584 Bacteria 2229
492 Ga0501069_0000362 3300049585 Bacteria 20433
493 Ga0501070_0006517 3300049586 Bacteria 9928
494 Ga0501070_0102857 3300049586 Bacteria 2362
495 Ga0501070_0137367 3300049586 Bacteria 2018
496 Ga0501070_0177650 3300049586 Bacteria 1752
497 Ga0501071_0036454 3300049587 Bacteria 3508
498 Ga0501071_0090456 3300049587 Bacteria 2247
499 Ga0501072_0005871 3300049588 Bacteria 9351
500 Ga0501072_0166725 3300049588 Bacteria 1757
501 Ga0501073_0029473 3300049589 Bacteria 3921
502 Ga0501073_0050501 3300049589 Bacteria 2914
503 Ga0501073_0069905 3300049589 Bacteria 2446
504 Ga0501073_0071284 3300049589 Bacteria 2421
505 Ga0501073_0072782 3300049589 Bacteria 2393
506 Ga0501074_0004186 3300049590 Bacteria 10310
507 Ga0501074_0040878 3300049590 Bacteria 3357
508 Ga0501074_0153203 3300049590 Bacteria 1647
509 Ga0501075_0034007 3300049591 Bacteria 3794
510 Ga0501075_0056774 3300049591 Bacteria 2948
511 Ga0501076_0037460 3300049592 Bacteria 3803
512 Ga0501076_0071397 3300049592 Bacteria 2777
513 Ga0501077_0001516 3300049593 Bacteria 14004
514 Ga0501077_0070310 3300049593 Bacteria 2218
515 Ga0501206_001361 3300049653 Bacteria 3057
516 Ga0501261_000233 3300049690 Bacteria 7670
517 Ga0501079_0057846 3300049741 Bacteria 2991
518 Ga0501079_0084498 3300049741 Bacteria 2455
519 Ga0501079_0116550 3300049741 Bacteria 2076
520 Ga0501080_0016292 3300049742 Bacteria 6862
521 Ga0501080_0035176 3300049742 Bacteria 4676
522 Ga0501080_0043040 3300049742 Bacteria 4204
523 Ga0501080_0065110 3300049742 Bacteria 3391
524 Ga0501080_0070496 3300049742 Bacteria 3251
525 Ga0501080_0112273 3300049742 Bacteria 2526
526 Ga0501081_0002741 3300049743 Bacteria 11161
527 Ga0501081_0011071 3300049743 Bacteria 5899
528 Ga0501081_0020147 3300049743 Bacteria 4446
529 Ga0501081_0024549 3300049743 Bacteria 4048
530 Ga0501083_0001104 3300049744 Bacteria 18056
531 Ga0501083_0068490 3300049744 Bacteria 2361
532 Ga0501279_000070 3300049775 Bacteria 17566
533 Ga0501035_0000036 3300049822 Bacteria 165008
534 Ga0501035_0018367 3300049822 Bacteria 6444
535 Ga0501035_0024745 3300049822 Bacteria 5504
536 Ga0501035_0100874 3300049822 Bacteria 2534
537 Ga0501035_0147909 3300049822 Bacteria 2040
538 Ga0501044_0000011 3300049823 Bacteria 257385
539 Ga0501044_0037901 3300049823 Bacteria 5037
540 Ga0501044_0046332 3300049823 Bacteria 4502
541 Ga0501044_0124848 3300049823 Bacteria 2572
542 Ga0501044_0139308 3300049823 Bacteria 2415
543 Ga0501044_0175169 3300049823 Bacteria 2114
544 Ga0501045_0067200 3300049824 Bacteria 2632
545 nmdc:mga00v17_67988_c1 3300050491 Bacteria 2202
546 nmdc:mga0yw44_3978_c1 3300050492 Bacteria 6678
547 nmdc:mga0yw44_7148_c1 3300050492 Bacteria 5468
548 nmdc:mga0k408_21519_c1 3300050493 Bacteria 3623
549 nmdc:mga06z11_36709_c1 3300050494 Bacteria 2421
550 nmdc:mga07m45_9818_c1 3300050496 Bacteria 4978
551 nmdc:mga05p37_26358_c1 3300050507 Bacteria 7070
552 nmdc:mga05p37_5957_c1 3300050507 Bacteria 14345
553 nmdc:mga05p37_6958_c1 3300050507 Bacteria 13331
554 nmdc:mga05p37_79380_c1 3300050507 Bacteria 4041
555 nmdc:mga09592_43052_c1 3300050508 Bacteria 3799
556 nmdc:mga06r32_102779_c1 3300050510 Bacteria 2806
557 nmdc:mga06r32_140339_c1 3300050510 Bacteria 2392
558 nmdc:mga06r32_32705_c1 3300050510 Bacteria 4896
559 nmdc:mga06r32_78400_c1 3300050510 Bacteria 3211
560 nmdc:mga08y16_32250_c1 3300050511 Bacteria 5509
561 nmdc:mga08y16_67602_c1 3300050511 Bacteria 3727
562 nmdc:mga0n895_15036_c1 3300050512 Bacteria 7051
563 nmdc:mga0n895_42047_c1 3300050512 Bacteria 4445
564 nmdc:mga0rr50_11883_c1 3300050513 Bacteria 5595
565 nmdc:mga08x19_1569_c1 3300050514 Bacteria 14173
566 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
567 nmdc:mga0a205_125884_c1 3300050515 Bacteria 2462
568 nmdc:mga0sz30_8254_c1 3300050516 Bacteria 3925
569 Ga0495601_0000007 3300053077 Bacteria 365972
570 Ga0495601_0001378 3300053077 Bacteria 13376
571 Ga0495601_0001923 3300053077 Bacteria 11622
572 Ga0495601_0007958 3300053077 Bacteria 6242
573 Ga0495601_0059481 3300053077 Bacteria 2423
574 Ga0495612_0000055 3300053078 Bacteria 50683
575 Ga0495612_0013710 3300053078 Bacteria 3265
576 Ga0495612_0016114 3300053078 Bacteria 2994
577 Ga0500610_0000312 3300053079 Bacteria 14602
578 Ga0500610_0019460 3300053079 Bacteria 3300
579 Ga0495595_0000044 3300053084 Bacteria 63329
580 Ga0495595_0000495 3300053084 Bacteria 15043
581 Ga0495595_0000953 3300053084 Bacteria 11131
582 Ga0495595_0017397 3300053084 Bacteria 3093
583 Ga0495595_0063149 3300053084 Bacteria 1738
584 Ga0495619_0000023 3300053085 Bacteria 182266
585 Ga0495619_0000460 3300053085 Bacteria 27480
586 Ga0495619_0008699 3300053085 Bacteria 6420
587 Ga0495619_0044490 3300053085 Bacteria 2914
588 Ga0500643_000693 3300053087 Bacteria 22498
589 Ga0500648_042009 3300053097 Bacteria 2595
590 Ga0500555_008037 3300053103 Bacteria 3004
591 Ga0500572_001347 3300053111 Bacteria 6809
592 Ga0500595_003443 3300053119 Bacteria 7383
593 Ga0500642_0001967 3300053130 Bacteria 5964
594 Ga0500652_000015 3300053131 Bacteria 131012
595 Ga0500559_0001369 3300053136 Bacteria 13979
596 Ga0500568_0000001 3300053139 Bacteria 988705
597 Ga0500573_0000012 3300053140 Bacteria 208486
598 Ga0500573_0037223 3300053140 Bacteria 2810
599 Ga0500616_0000006 3300053153 Bacteria 944738
600 Ga0500616_0019516 3300053153 Bacteria 3820
601 Ga0500616_0026183 3300053153 Bacteria 3230
602 Ga0500620_000453 3300053155 Bacteria 7382
603 Ga0500622_0010865 3300053156 Bacteria 4974
604 Ga0500636_0001961 3300053177 Bacteria 11325
605 Ga0500576_008579 3300053725 Bacteria 4446
606 Ga0500645_000062 3300053730 Bacteria 85561
607 Ga0500596_000569 3300053735 Bacteria 7028
608 Ga0501084_0000049 3300054114 Bacteria 94947
609 Ga0501084_0006511 3300054114 Bacteria 9597
610 Ga0501082_0017709 3300060353 Bacteria 6135
611 Ga0501082_0024992 3300060353 Bacteria 5146
612 Ga0501082_0127206 3300060353 Bacteria 2210
613 Ga0530510_0055624 3300061734 Bacteria 2858
614 Ga0530510_0080675 3300061734 Bacteria 2368

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0072782 Ga0501073_0072782_855_2381 501
2 3300048905 Ga0496102_0097769 Ga0496102_0097769_46_1590 504
3 3300048907 Ga0496104_0042159 Ga0496104_0042159_2682_4226 504
4 3300049590 Ga0501074_0153203 Ga0501074_0153203_38_1582 504
5 3300048906 Ga0496103_0032806 Ga0496103_0032806_1596_3140 506
6 3300050515 nmdc:mga0a205_125884_c1 nmdc:mga0a205_125884_c1_10_1536 508
7 3300049572 Ga0501036_0086031 Ga0501036_0086031_1065_2606 513
8 3300049570 Ga0501033_0031944 Ga0501033_0031944_2398_3942 514
9 3300049573 Ga0501037_0126663 Ga0501037_0126663_267_1811 514
10 3300049581 Ga0501047_0005504 Ga0501047_0005504_61_1605 514
11 3300049581 Ga0501047_0233092 Ga0501047_0233092_97_1641 514
12 3300049586 Ga0501070_0177650 Ga0501070_0177650_167_1711 514
13 iso_pu_bacteria 2922185730 2922186489 528
14 3300046474 Ga0495605_0036971 Ga0495605_0036971_11_1600 529
15 3300048912 Ga0496109_0148649 Ga0496109_0148649_40_1671 533
16 3300035724 Ga0373933_0096345 Ga0373933_0096345_117_1748 535
17 iso_pu_bacteria 2979793036 2979798262 536
18 3300049571 Ga0501034_0058090 Ga0501034_0058090_39_1667 542
19 3300009551 Ga0105238_10081246 Ga0105238_100812464 543
20 3300020069 Ga0197907_10465604 Ga0197907_104656041 543
21 3300035084 Ga0373928_0008564 Ga0373928_0008564_63_1694 543
22 3300035691 Ga0373931_0013316 Ga0373931_0013316_1121_2752 543
23 3300035691 Ga0373931_0060489 Ga0373931_0060489_68_1699 543
24 3300035725 Ga0373947_0039728 Ga0373947_0039728_11_1642 543
25 3300037068 Ga0373925_0084541 Ga0373925_0084541_759_2390 543
26 3300038443 Ga0395901_0038577 Ga0395901_0038577_31_1662 543
27 3300046525 Ga0495663_0001212 Ga0495663_0001212_65_1696 543
28 3300048929 Ga0496126_0165650 Ga0496126_0165650_22_1653 543
29 3300049568 Ga0501031_0042832 Ga0501031_0042832_51_1754 543
30 3300049570 Ga0501033_0021051 Ga0501033_0021051_1063_2694 543
31 3300049578 Ga0501042_0005477 Ga0501042_0005477_3740_5371 543
32 3300049586 Ga0501070_0102857 Ga0501070_0102857_666_2297 543
33 3300049588 Ga0501072_0166725 Ga0501072_0166725_73_1704 543
34 3300049589 Ga0501073_0071284 Ga0501073_0071284_769_2400 543
35 3300049593 Ga0501077_0070310 Ga0501077_0070310_23_1654 543
36 3300049742 Ga0501080_0070496 Ga0501080_0070496_25_1656 543
37 3300049822 Ga0501035_0147909 Ga0501035_0147909_395_2026 543
38 3300049823 Ga0501044_0037901 Ga0501044_0037901_757_2388 543
39 3300050510 nmdc:mga06r32_102779_c1 nmdc:mga06r32_102779_c1_1143_2774 543
40 3300053084 Ga0495595_0063149 Ga0495595_0063149_93_1727 543
41 3300053140 Ga0500573_0037223 Ga0500573_0037223_1053_2684 543
42 3300053153 Ga0500616_0026183 Ga0500616_0026183_1520_3154 543
43 3300060353 Ga0501082_0127206 Ga0501082_0127206_545_2176 543
44 3300035724 Ga0373933_0002040 Ga0373933_0002040_3425_5164 550
45 3300036401 Ga0373937_0003145 Ga0373937_0003145_4021_5760 550
46 3300039450 Ga0436363_1572801 Ga0436363_1572801_148_1872 550
47 3300046462 Ga0495651_0010936 Ga0495651_0010936_3847_5586 550
48 3300046675 Ga0495657_0018882 Ga0495657_0018882_1019_2758 550
49 3300053077 Ga0495601_0001923 Ga0495601_0001923_7788_9527 550
50 3300053078 Ga0495612_0013710 Ga0495612_0013710_52_1791 550
51 3300053084 Ga0495595_0000953 Ga0495595_0000953_2638_4377 550
52 3300053085 Ga0495619_0044490 Ga0495619_0044490_968_2707 550
53 iso_pu_bacteria 2889790730 2889792246 555
54 iso_pu_bacteria 2958172287 2958177214 557
55 3300035083 Ga0373926_0026571 Ga0373926_0026571_37_1716 559
56 3300005436 Ga0070713_100076504 Ga0070713_1000765042 563
57 3300007788 Ga0099795_10000411 Ga0099795_100004117 563
58 3300027512 Ga0209179_1000852 Ga0209179_10008522 563
59 3300035111 Ga0373923_0000396 Ga0373923_0000396_3101_4825 563
60 3300035113 Ga0373936_0002567 Ga0373936_0002567_3181_4905 563
61 3300035118 Ga0373954_0015428 Ga0373954_0015428_925_2649 563
62 3300035171 Ga0373946_0000630 Ga0373946_0000630_5535_7259 563
63 3300035172 Ga0373955_0000525 Ga0373955_0000525_12386_14110 563
64 3300035410 Ga0373924_0001066 Ga0373924_0001066_3520_5244 563
65 3300035692 Ga0373935_0000006 Ga0373935_0000006_108274_109998 563
66 3300035724 Ga0373933_0005418 Ga0373933_0005418_5041_6765 563
67 3300035725 Ga0373947_0000394 Ga0373947_0000394_13614_15338 563
68 3300036401 Ga0373937_0004380 Ga0373937_0004380_1572_3296 563
69 3300037068 Ga0373925_0000776 Ga0373925_0000776_10697_12421 563
70 3300046454 Ga0495592_0000742 Ga0495592_0000742_7708_9432 563
71 3300046462 Ga0495651_0002087 Ga0495651_0002087_10376_12100 563
72 3300046463 Ga0495653_0000203 Ga0495653_0000203_34573_36297 563
73 3300046476 Ga0495662_0007282 Ga0495662_0007282_2423_4147 563
74 3300046477 Ga0495664_0000017 Ga0495664_0000017_148454_150178 563
75 3300046511 Ga0495608_0000058 Ga0495608_0000058_68758_70482 563
76 3300046514 Ga0495618_0000049 Ga0495618_0000049_53282_55006 563
77 3300046516 Ga0495628_0000022 Ga0495628_0000022_121600_123324 563
78 3300046517 Ga0495630_0010063 Ga0495630_0010063_442_2166 563
79 3300046529 Ga0495652_0000008 Ga0495652_0000008_220314_222038 563
80 3300046533 Ga0495640_0000727 Ga0495640_0000727_9906_11630 563
81 3300046536 Ga0495587_0000019 Ga0495587_0000019_11957_13681 563
82 3300046543 Ga0495645_0000006 Ga0495645_0000006_193342_195066 563
83 3300046559 Ga0495667_0000090 Ga0495667_0000090_10672_12396 563
84 3300046642 Ga0495634_0002729 Ga0495634_0002729_12393_14117 563
85 3300046663 Ga0495635_0000023 Ga0495635_0000023_12189_13913 563
86 3300046675 Ga0495657_0001777 Ga0495657_0001777_6065_7789 563
87 3300046678 Ga0495599_0000039 Ga0495599_0000039_84016_85740 563
88 3300046679 Ga0495623_0000073 Ga0495623_0000073_10655_12379 563
89 3300046680 Ga0495646_0000017 Ga0495646_0000017_107520_109244 563
90 3300046690 Ga0495624_0006011 Ga0495624_0006011_5366_7090 563
91 3300046809 Ga0495600_0000043 Ga0495600_0000043_12947_14671 563
92 3300047315 Ga0495581_0007230 Ga0495581_0007230_2288_4012 563
93 3300047317 Ga0495604_0000030 Ga0495604_0000030_15146_16870 563
94 3300047319 Ga0495674_0000009 Ga0495674_0000009_187028_188752 563
95 3300047322 Ga0495680_0000307 Ga0495680_0000307_52707_54431 563
96 3300047444 Ga0495675_0001007 Ga0495675_0001007_4748_6472 563
97 3300047471 Ga0495684_0000031 Ga0495684_0000031_46287_48011 563
98 3300047673 Ga0495593_0001311 Ga0495593_0001311_11123_12847 563
99 3300048088 Ga0495602_0000006 Ga0495602_0000006_148404_150128 563
100 3300053077 Ga0495601_0000007 Ga0495601_0000007_215930_217654 563
101 3300053078 Ga0495612_0000055 Ga0495612_0000055_46149_47873 563
102 3300053084 Ga0495595_0000044 Ga0495595_0000044_46950_48674 563
103 3300053085 Ga0495619_0000023 Ga0495619_0000023_16059_17783 563
104 3300001979 JGI24740J21852_10002718 JGI24740J21852_100027185 564
105 3300005436 Ga0070713_100101050 Ga0070713_1001010501 564
106 3300005834 Ga0068851_10040828 Ga0068851_100408282 564
107 3300005937 Ga0081455_10003870 Ga0081455_100038705 564
108 3300006914 Ga0075436_100007214 Ga0075436_1000072144 564
109 3300009147 Ga0114129_10009088 Ga0114129_100090885 564
110 3300009174 Ga0105241_10001829 Ga0105241_1000182910 564
111 3300009551 Ga0105238_10005879 Ga0105238_100058796 564
112 3300025911 Ga0207654_10001335 Ga0207654_100013355 564
113 3300025913 Ga0207695_10000402 Ga0207695_1000040210 564
114 3300025924 Ga0207694_10000095 Ga0207694_1000009561 564
115 3300025949 Ga0207667_10010528 Ga0207667_100105286 564
116 3300025981 Ga0207640_10029840 Ga0207640_100298402 564
117 3300026078 Ga0207702_10000025 Ga0207702_1000002594 564
118 3300026142 Ga0207698_10018802 Ga0207698_100188024 564
119 3300035086 Ga0373934_0012745 Ga0373934_0012745_1136_2860 564
120 3300035089 Ga0373944_0021605 Ga0373944_0021605_23_1747 564
121 3300035116 Ga0373945_0008605 Ga0373945_0008605_1106_2830 564
122 3300035170 Ga0373943_0000297 Ga0373943_0000297_14752_16476 564
123 3300035171 Ga0373946_0009980 Ga0373946_0009980_1663_3387 564
124 3300035172 Ga0373955_0017841 Ga0373955_0017841_1374_3098 564
125 3300035692 Ga0373935_0001125 Ga0373935_0001125_8481_10205 564
126 3300035695 Ga0373927_0002633 Ga0373927_0002633_1282_3006 564
127 3300035725 Ga0373947_0000159 Ga0373947_0000159_19922_21646 564
128 3300036401 Ga0373937_0005696 Ga0373937_0005696_1801_3525 564
129 3300037068 Ga0373925_0008020 Ga0373925_0008020_1410_3134 564
130 3300039447 Ga0436361_0484868 Ga0436361_0484868_1248_2972 564
131 3300046462 Ga0495651_0073803 Ga0495651_0073803_183_1907 564
132 3300046524 Ga0495648_0000895 Ga0495648_0000895_12451_14175 564
133 3300046531 Ga0495665_0025630 Ga0495665_0025630_1220_2944 564
134 3300046689 Ga0495613_0010367 Ga0495613_0010367_437_2161 564
135 3300046690 Ga0495624_0002118 Ga0495624_0002118_5284_7008 564
136 3300047673 Ga0495593_0004675 Ga0495593_0004675_2471_4195 564
137 3300048913 Ga0496110_0085005 Ga0496110_0085005_1020_2744 564
138 3300048928 Ga0496125_0000850 Ga0496125_0000850_45474_47264 564
139 3300049571 Ga0501034_0041050 Ga0501034_0041050_1228_2952 564
140 3300049589 Ga0501073_0029473 Ga0501073_0029473_948_2672 564
141 3300050493 nmdc:mga0k408_21519_c1 nmdc:mga0k408_21519_c1_1108_2832 564
142 3300050507 nmdc:mga05p37_5957_c1 nmdc:mga05p37_5957_c1_3309_5033 564
143 3300050514 nmdc:mga08x19_1569_c1 nmdc:mga08x19_1569_c1_10967_12691 564
144 3300053111 Ga0500572_001347 Ga0500572_001347_4181_5905 564
145 3300053136 Ga0500559_0001369 Ga0500559_0001369_7356_9080 564
146 3300053725 Ga0500576_008579 Ga0500576_008579_1590_3314 564
147 3300005937 Ga0081455_10011629 Ga0081455_100116292 565
148 3300009147 Ga0114129_10005706 Ga0114129_100057067 565
149 3300025916 Ga0207663_10110512 Ga0207663_101105121 565
150 3300050507 nmdc:mga05p37_26358_c1 nmdc:mga05p37_26358_c1_5118_6842 565
151 3300050513 nmdc:mga0rr50_11883_c1 nmdc:mga0rr50_11883_c1_2008_3732 565
152 3300053153 Ga0500616_0000006 Ga0500616_0000006_883118_884842 565
153 3300005367 Ga0070667_100101319 Ga0070667_1001013192 566
154 3300005436 Ga0070713_100017657 Ga0070713_1000176572 566
155 3300005466 Ga0070685_10040776 Ga0070685_100407762 566
156 3300005618 Ga0068864_100064771 Ga0068864_1000647711 566
157 3300006028 Ga0070717_10002040 Ga0070717_100020404 566
158 3300025898 Ga0207692_10028531 Ga0207692_100285311 566
159 3300025900 Ga0207710_10009424 Ga0207710_100094242 566
160 3300025915 Ga0207693_10047013 Ga0207693_100470133 566
161 3300025928 Ga0207700_10014504 Ga0207700_100145044 566
162 3300025939 Ga0207665_10003464 Ga0207665_100034648 566
163 3300026067 Ga0207678_10106267 Ga0207678_101062672 566
164 3300031711 Ga0265314_10002282 Ga0265314_1000228212 566
165 3300036401 Ga0373937_0007971 Ga0373937_0007971_201_1925 566
166 3300039447 Ga0436361_0722712 Ga0436361_0722712_117_1841 566
167 3300046454 Ga0495592_0009467 Ga0495592_0009467_5283_7007 566
168 3300046463 Ga0495653_0061411 Ga0495653_0061411_336_2060 566
169 3300046511 Ga0495608_0056757 Ga0495608_0056757_298_2022 566
170 3300046516 Ga0495628_0021240 Ga0495628_0021240_463_2187 566
171 3300046529 Ga0495652_0013568 Ga0495652_0013568_2036_3760 566
172 3300046543 Ga0495645_0003951 Ga0495645_0003951_323_2047 566
173 3300046663 Ga0495635_0017526 Ga0495635_0017526_2932_4656 566
174 3300046678 Ga0495599_0020966 Ga0495599_0020966_389_2113 566
175 3300046679 Ga0495623_0014617 Ga0495623_0014617_2713_4437 566
176 3300046809 Ga0495600_0010303 Ga0495600_0010303_3781_5505 566
177 3300047317 Ga0495604_0031736 Ga0495604_0031736_482_2206 566
178 3300047322 Ga0495680_0034783 Ga0495680_0034783_1606_3330 566
179 3300048088 Ga0495602_0093924 Ga0495602_0093924_206_1930 566
180 3300048903 Ga0496100_0045603 Ga0496100_0045603_901_2625 566
181 3300048907 Ga0496104_0000116 Ga0496104_0000116_48923_50647 566
182 3300048908 Ga0496105_0014705 Ga0496105_0014705_3535_5259 566
183 3300048912 Ga0496109_0063593 Ga0496109_0063593_1462_3186 566
184 3300053077 Ga0495601_0001378 Ga0495601_0001378_759_2483 566
185 3300053078 Ga0495612_0016114 Ga0495612_0016114_465_2189 566
186 3300053084 Ga0495595_0000495 Ga0495595_0000495_155_1879 566
187 3300053084 Ga0495595_0017397 Ga0495595_0017397_219_1943 566
188 3300053085 Ga0495619_0000460 Ga0495619_0000460_21873_23597 566
189 3300053085 Ga0495619_0008699 Ga0495619_0008699_4581_6305 566
190 iso_pu_bacteria 2889306138 2889307804 566
191 iso_pu_bacteria 2902405164 2902406931 566
192 3300031727 Ga0316576_10036561 Ga0316576_100365611 568
193 3300025916 Ga0207663_10074920 Ga0207663_100749202 569
194 3300053156 Ga0500622_0010865 Ga0500622_0010865_2512_4242 569
195 3300053177 Ga0500636_0001961 Ga0500636_0001961_3461_5191 569
196 iso_pu_bacteria 2883291878 2883294602 569
197 iso_pu_bacteria 2883354860 2883356900 569
198 iso_pu_bacteria 2503198000 2503202012 570
199 iso_pu_bacteria 2508501123 2509115565 570
200 iso_pu_bacteria 2508501127 2509141740 570
201 iso_pu_bacteria 2509276018 2509371183 570
202 iso_pu_bacteria 2509276022 2509396674 570
203 iso_pu_bacteria 2510065059 2510313841 570
204 iso_pu_bacteria 2512875016 2512931100 570
205 iso_pu_bacteria 2512875024 2512958817 570
206 iso_pu_bacteria 2513237090 2513610939 570
207 iso_pu_bacteria 2513237164 2514037626 570
208 iso_pu_bacteria 2513237305 2514420256 570
209 iso_pu_bacteria 2588253730 2588516859 570
210 iso_pu_bacteria 2643221595 2643989198 570
211 iso_pu_bacteria 2643221627 2644152770 570
212 iso_pu_bacteria 2643221629 2644166871 570
213 iso_pu_bacteria 2643221662 2644349385 570
214 iso_pu_bacteria 2687453392 2688598826 570
215 iso_pu_bacteria 2693429783 2694629835 570
216 iso_pu_bacteria 2693429784 2694636292 570
217 iso_pu_bacteria 2721755686 2723575772 570
218 iso_pu_bacteria 2738541281 2738746226 570
219 iso_pu_bacteria 2738543032 2739355456 570
220 iso_pu_bacteria 2756170246 2756675714 570
221 iso_pu_bacteria 2775506901 2776259204 570
222 iso_pu_bacteria 2791355123 2792749720 570
223 iso_pu_bacteria 2837678835 2837683123 570
224 iso_pu_bacteria 2841734538 2841739685 570
225 iso_pu_bacteria 2842694124 2842697500 570
226 iso_pu_bacteria 2844002411 2844006220 570
227 iso_pu_bacteria 2844009547 2844014167 570
228 iso_pu_bacteria 2847670302 2847675950 570
229 iso_pu_bacteria 2847686936 2847692604 570
230 iso_pu_bacteria 2856314179 2856314492 570
231 iso_pu_bacteria 2856320880 2856325640 570
232 iso_pu_bacteria 2856328259 2856331517 570
233 iso_pu_bacteria 2856334872 2856339030 570
234 iso_pu_bacteria 2856342000 2856342974 570
235 iso_pu_bacteria 2856349417 2856353897 570
236 iso_pu_bacteria 2856356410 2856356587 570
237 iso_pu_bacteria 2857349434 2857350656 570
238 iso_pu_bacteria 2857367948 2857371037 570
239 iso_pu_bacteria 2869162929 2869169126 570
240 iso_pu_bacteria 2869234852 2869235750 570
241 iso_pu_bacteria 2869242130 2869248477 570
242 iso_pu_bacteria 2869249662 2869250835 570
243 iso_pu_bacteria 2869256925 2869262094 570
244 iso_pu_bacteria 2869264136 2869271121 570
245 iso_pu_bacteria 2869271264 2869272297 570
246 iso_pu_bacteria 2869278585 2869279262 570
247 iso_pu_bacteria 2871444079 2871447030 570
248 iso_pu_bacteria 2871451962 2871452824 570
249 iso_pu_bacteria 2871466892 2871472224 570
250 iso_pu_bacteria 2871474448 2871475961 570
251 iso_pu_bacteria 2871481445 2871487163 570
252 iso_pu_bacteria 2871488783 2871495605 570
253 iso_pu_bacteria 2871495908 2871502861 570
254 iso_pu_bacteria 2874116593 2874118867 570
255 iso_pu_bacteria 2874123672 2874130792 570
256 iso_pu_bacteria 2874139085 2874145009 570
257 iso_pu_bacteria 2874146452 2874149352 570
258 iso_pu_bacteria 2874168670 2874174391 570
259 iso_pu_bacteria 2876363079 2876365644 570
260 iso_pu_bacteria 2876377896 2876383175 570
261 iso_pu_bacteria 2876386047 2876388531 570
262 iso_pu_bacteria 2876392853 2876394608 570
263 iso_pu_bacteria 2876399893 2876406065 570
264 iso_pu_bacteria 2876420981 2876424896 570
265 iso_pu_bacteria 2878035449 2878040021 570
266 iso_pu_bacteria 2878738818 2878745646 570
267 iso_pu_bacteria 2878753008 2878757800 570
268 iso_pu_bacteria 2878760144 2878766753 570
269 iso_pu_bacteria 2878767105 2878773950 570
270 iso_pu_bacteria 2878774303 2878775911 570
271 iso_pu_bacteria 2878781027 2878784017 570
272 iso_pu_bacteria 2881147464 2881151957 570
273 iso_pu_bacteria 2881155292 2881155685 570
274 iso_pu_bacteria 2881161766 2881167904 570
275 iso_pu_bacteria 2881853255 2881855479 570
276 iso_pu_bacteria 2881861095 2881868770 570
277 iso_pu_bacteria 2882632389 2882638676 570
278 iso_pu_bacteria 2882912400 2882914066 570
279 iso_pu_bacteria 2885305155 2885309825 570
280 iso_pu_bacteria 2885312484 2885317572 570
281 iso_pu_bacteria 2885318864 2885325272 570
282 iso_pu_bacteria 2885326080 2885329569 570
283 iso_pu_bacteria 2888343758 2888347253 570
284 iso_pu_bacteria 2888350351 2888356171 570
285 iso_pu_bacteria 2889010040 2889011100 570
286 iso_pu_bacteria 2889016732 2889017175 570
287 iso_pu_bacteria 2889914905 2889917019 570
288 iso_pu_bacteria 2902330777 2902336663 570
289 iso_pu_bacteria 2903448605 2903455431 570
290 iso_pu_bacteria 2903492973 2903506517 570
291 iso_pu_bacteria 2903521522 2903523573 570
292 iso_pu_bacteria 2903528002 2903534207 570
293 iso_pu_bacteria 2903540706 2903548000 570
294 iso_pu_bacteria 2904659560 2904661242 570
295 iso_pu_bacteria 2906328253 2906329644 570
296 iso_pu_bacteria 2906363423 2906365630 570
297 iso_pu_bacteria 2906370794 2906372350 570
298 iso_pu_bacteria 2906408224 2906412956 570
299 iso_pu_bacteria 2906414383 2906414446 570
300 iso_pu_bacteria 2922130491 2922135052 570
301 iso_pu_bacteria 2922151315 2922154629 570
302 iso_pu_bacteria 2922172374 2922176038 570
303 iso_pu_bacteria 2922178524 2922182159 570
304 iso_pu_bacteria 2924718760 2924725455 570
305 iso_pu_bacteria 2924726620 2924727235 570
306 iso_pu_bacteria 2924733363 2924739326 570
307 iso_pu_bacteria 2924741084 2924746002 570
308 iso_pu_bacteria 2924748358 2924752735 570
309 iso_pu_bacteria 2924754689 2924756373 570
310 iso_pu_bacteria 2924762789 2924766813 570
311 iso_pu_bacteria 2924776078 2924783890 570
312 iso_pu_bacteria 2924784321 2924785705 570
313 iso_pu_bacteria 2928125067 2928127108 570
314 iso_pu_bacteria 2937813078 2937816207 570
315 iso_pu_bacteria 2937822353 2937824890 570
316 iso_pu_bacteria 2937836603 2937837999 570
317 iso_pu_bacteria 2937848649 2937855084 570
318 iso_pu_bacteria 2937877337 2937877421 570
319 iso_pu_bacteria 2937891427 2937893858 570
320 iso_pu_bacteria 2937972304 2937975473 570
321 iso_pu_bacteria 2937994558 2938001876 570
322 iso_pu_bacteria 2938014810 2938019134 570
323 iso_pu_bacteria 2958034702 2958035403 570
324 iso_pu_bacteria 2958041894 2958043590 570
325 iso_pu_bacteria 2958064165 2958067808 570
326 iso_pu_bacteria 2958071322 2958072674 570
327 iso_pu_bacteria 2958084443 2958084527 570
328 iso_pu_bacteria 2958100919 2958101543 570
329 iso_pu_bacteria 2958115193 2958118798 570
330 iso_pu_bacteria 2958122699 2958129654 570
331 iso_pu_bacteria 2958165035 2958171931 570
332 iso_pu_bacteria 2961114664 2961116394 570
333 iso_pu_bacteria 2961127735 2961128663 570
334 iso_pu_bacteria 2961163497 2961170377 570
335 iso_pu_bacteria 2961170736 2961174343 570
336 iso_pu_bacteria 2961183825 2961190167 570
337 iso_pu_bacteria 2963644680 2963648119 570
338 iso_pu_bacteria 2965018300 2965025123 570
339 iso_pu_bacteria 2965025482 2965026577 570
340 iso_pu_bacteria 2965032056 2965035839 570
341 iso_pu_bacteria 2965047637 2965054864 570
342 iso_pu_bacteria 2965089291 2965089319 570
343 iso_pu_bacteria 2965102966 2965107904 570
344 iso_pu_bacteria 2965110997 2965115144 570
345 iso_pu_bacteria 2965119406 2965125695 570
346 iso_pu_bacteria 2967996073 2968000333 570
347 iso_pu_bacteria 2968003550 2968003782 570
348 iso_pu_bacteria 2968016561 2968018050 570
349 iso_pu_bacteria 2968083720 2968090941 570
350 iso_pu_bacteria 2968091066 2968096614 570
351 iso_pu_bacteria 2968097103 2968099977 570
352 iso_pu_bacteria 2968110612 2968112300 570
353 iso_pu_bacteria 2968117919 2968121100 570
354 iso_pu_bacteria 2968128360 2968132666 570
355 iso_pu_bacteria 2968138860 2968144241 570
356 iso_pu_bacteria 2968171901 2968178764 570
357 iso_pu_bacteria 2970469710 2970471775 570
358 iso_pu_bacteria 2970489779 2970495730 570
359 iso_pu_bacteria 2970503327 2970506930 570
360 iso_pu_bacteria 2970510686 2970512851 570
361 iso_pu_bacteria 2970532167 2970538365 570
362 iso_pu_bacteria 2970547951 2970552703 570
363 iso_pu_bacteria 2970554993 2970561609 570
364 iso_pu_bacteria 2970593180 2970593858 570
365 iso_pu_bacteria 2970619444 2970620734 570
366 iso_pu_bacteria 2970627176 2970631362 570
367 iso_pu_bacteria 2977821940 2977822332 570
368 iso_pu_bacteria 2977828996 2977832474 570
369 iso_pu_bacteria 2977851361 2977856946 570
370 iso_pu_bacteria 2977864932 2977865886 570
371 iso_pu_bacteria 2977872689 2977875616 570
372 iso_pu_bacteria 2977907340 2977914768 570
373 iso_pu_bacteria 2977915119 2977922527 570
374 iso_pu_bacteria 2977922695 2977929247 570
375 iso_pu_bacteria 2977935797 2977940913 570
376 iso_pu_bacteria 2977942078 2977947639 570
377 iso_pu_bacteria 2977950692 2977955182 570
378 iso_pu_bacteria 2979710463 2979711672 570
379 iso_pu_bacteria 2979772303 2979774551 570
380 iso_pu_bacteria 2979779861 2979786298 570
381 iso_pu_bacteria 2979808191 2979812125 570
382 iso_pu_bacteria 2987636660 2987637840 570
383 iso_pu_bacteria 2987645492 2987645496 570
384 iso_pu_bacteria 2987652177 2987653852 570
385 iso_pu_bacteria 2987659509 2987666618 570
386 iso_pu_bacteria 2987666974 2987668845 570
387 iso_pu_bacteria 2987673487 2987678242 570
388 iso_pu_bacteria 2996310559 2996312286 570
389 iso_pu_bacteria 2996341866 2996346768 570
390 iso_pu_bacteria 2996348954 2996350559 570
391 iso_pu_bacteria 2996386984 2996389303 570
392 iso_pu_bacteria 3000135777 3000140178 570
393 iso_pu_bacteria 3004188549 3004195620 570
394 iso_pu_bacteria 3004195979 3004203093 570
395 iso_pu_bacteria 3004203850 3004205838 570
396 iso_pu_bacteria 3004211236 3004211897 570
397 iso_pu_bacteria 3004218560 3004219144 570
398 iso_pu_bacteria 3004232784 3004236532 570
399 iso_pu_bacteria 3004239961 3004246812 570
400 iso_pu_bacteria 3004268573 3004268925 570
401 iso_pu_bacteria 3004275668 3004277257 570
402 iso_pu_bacteria 3004334049 3004341288 570
403 iso_pu_bacteria 649633066 649873342 570
404 iso_pu_bacteria 8004300914 8004301169 570
405 iso_pu_bacteria 8004312739 8004312822 570
406 iso_pu_bacteria 8004374579 8004379311 570
407 iso_pu_bacteria 8004445564 8004451008 570
408 iso_pu_bacteria 8004633249 8004633411 570
409 iso_pu_bacteria 8004703790 8004709700 570
410 iso_pu_bacteria 8055617313 8055621308 570
411 3300005344 Ga0070661_100000136 Ga0070661_1000001367 571
412 3300025919 Ga0207657_10000101 Ga0207657_100001012 571
413 3300025920 Ga0207649_10000154 Ga0207649_1000015445 571
414 3300028577 Ga0265318_10000199 Ga0265318_1000019948 571
415 3300031241 Ga0265325_10001455 Ga0265325_100014552 571
416 3300031249 Ga0265339_10026275 Ga0265339_100262753 571
417 3300031250 Ga0265331_10017547 Ga0265331_100175471 571
418 3300031251 Ga0265327_10000124 Ga0265327_10000124128 571
419 3300031344 Ga0265316_10081525 Ga0265316_100815252 571
420 3300031595 Ga0265313_10001046 Ga0265313_1000104616 571
421 3300031711 Ga0265314_10000192 Ga0265314_1000019255 571
422 3300031711 Ga0265314_10011644 Ga0265314_100116445 571
423 3300031712 Ga0265342_10004875 Ga0265342_100048756 571
424 3300049579 Ga0501043_0021229 Ga0501043_0021229_2020_3744 571
425 3300049580 Ga0501046_0032485 Ga0501046_0032485_472_2196 571
426 3300049586 Ga0501070_0137367 Ga0501070_0137367_76_1800 571
427 3300049742 Ga0501080_0112273 Ga0501080_0112273_317_2041 571
428 3300049822 Ga0501035_0024745 Ga0501035_0024745_148_1872 571
429 3300054114 Ga0501084_0000049 Ga0501084_0000049_13881_15596 571
430 iso_pu_bacteria 2856364286 2856370521 571
431 iso_pu_bacteria 2869285874 2869291752 571
432 iso_pu_bacteria 2871429161 2871434962 571
433 iso_pu_bacteria 2874155637 2874157615 571
434 iso_pu_bacteria 2876413966 2876415818 571
435 iso_pu_bacteria 2878745973 2878752096 571
436 iso_pu_bacteria 2903492973 2903493346 571
437 iso_pu_bacteria 2906308376 2906314490 571
438 iso_pu_bacteria 2906321335 2906327658 571
439 iso_pu_bacteria 2958130278 2958136150 571
440 iso_pu_bacteria 2958179912 2958185618 571
441 iso_pu_bacteria 2961077736 2961083995 571
442 iso_pu_bacteria 2977843712 2977846443 571
443 iso_pu_bacteria 8004387939 8004394522 571
444 iso_pu_bacteria 8004640170 8004640346 571
445 iso_pu_bacteria 8004714634 8004720752 571
446 3300025297 Ga0209758_1000013 Ga0209758_1000013533 572
447 3300025924 Ga0207694_10006206 Ga0207694_100062066 572
448 3300028379 Ga0268266_10085771 Ga0268266_100857712 572
449 3300031711 Ga0265314_10007587 Ga0265314_100075875 572
450 3300039437 Ga0436365_0088108 Ga0436365_0088108_8622_10340 572
451 3300048905 Ga0496102_0056461 Ga0496102_0056461_227_1945 572
452 3300048906 Ga0496103_0104915 Ga0496103_0104915_37_1755 572
453 3300048907 Ga0496104_0049921 Ga0496104_0049921_1783_3501 572
454 3300048910 Ga0496107_0010874 Ga0496107_0010874_74_1792 572
455 3300048911 Ga0496108_0007516 Ga0496108_0007516_1139_2857 572
456 3300048912 Ga0496109_0009622 Ga0496109_0009622_718_2436 572
457 3300048914 Ga0496111_0011323 Ga0496111_0011323_418_2136 572
458 3300049580 Ga0501046_0013927 Ga0501046_0013927_3509_5227 572
459 3300049581 Ga0501047_0001238 Ga0501047_0001238_4569_6287 572
460 3300049581 Ga0501047_0031114 Ga0501047_0031114_2854_4572 572
461 3300049823 Ga0501044_0046332 Ga0501044_0046332_207_1925 572
462 3300049823 Ga0501044_0175169 Ga0501044_0175169_180_1898 572
463 3300053140 Ga0500573_0000012 Ga0500573_0000012_127611_129329 572
464 3300001990 JGI24737J22298_10026704 JGI24737J22298_100267041 573
465 3300003214 JGI25165J46597_1000209 JGI25165J46597_100020922 573
466 3300005295 Ga0065707_10082036 Ga0065707_1008203622 573
467 3300005356 Ga0070674_100001589 Ga0070674_1000015898 573
468 3300005456 Ga0070678_100000645 Ga0070678_10000064511 573
469 3300005530 Ga0070679_100110957 Ga0070679_1001109571 573
470 3300005548 Ga0070665_100000458 Ga0070665_10000045846 573
471 3300005563 Ga0068855_100098438 Ga0068855_1000984383 573
472 3300005834 Ga0068851_10045496 Ga0068851_100454961 573
473 3300005937 Ga0081455_10003034 Ga0081455_100030348 573
474 3300009148 Ga0105243_10000202 Ga0105243_1000020241 573
475 3300009177 Ga0105248_10030240 Ga0105248_100302402 573
476 3300013102 Ga0157371_10000024 Ga0157371_10000024224 573
477 3300014326 Ga0157380_10006819 Ga0157380_100068194 573
478 3300025226 Ga0209674_104793 Ga0209674_1047931 573
479 3300025261 Ga0209233_1000013 Ga0209233_1000013928 573
480 3300025909 Ga0207705_10002842 Ga0207705_1000284211 573
481 3300025911 Ga0207654_10002277 Ga0207654_100022777 573
482 3300025913 Ga0207695_10039829 Ga0207695_100398292 573
483 3300025920 Ga0207649_10000425 Ga0207649_1000042513 573
484 3300025921 Ga0207652_10015345 Ga0207652_100153452 573
485 3300025935 Ga0207709_10000201 Ga0207709_1000020178 573
486 3300025937 Ga0207669_10000075 Ga0207669_1000007538 573
487 3300025937 Ga0207669_10065800 Ga0207669_100658002 573
488 3300025941 Ga0207711_10016979 Ga0207711_100169795 573
489 3300025949 Ga0207667_10000010 Ga0207667_10000010186 573
490 3300025981 Ga0207640_10000829 Ga0207640_100008294 573
491 3300026041 Ga0207639_10003097 Ga0207639_100030975 573
492 3300026078 Ga0207702_10014651 Ga0207702_100146513 573
493 3300026121 Ga0207683_10000067 Ga0207683_100000676 573
494 3300026142 Ga0207698_10035023 Ga0207698_100350232 573
495 3300028379 Ga0268266_10000002 Ga0268266_100000022245 573
496 3300031731 Ga0307405_10042177 Ga0307405_100421772 573
497 3300031911 Ga0307412_10073503 Ga0307412_100735033 573
498 3300035691 Ga0373931_0049989 Ga0373931_0049989_418_2139 573
499 3300039437 Ga0436365_1571761 Ga0436365_1571761_811_2532 573
500 3300046471 Ga0495650_0000058 Ga0495650_0000058_10769_12490 573
501 3300046500 Ga0495596_0029424 Ga0495596_0029424_444_2165 573
502 3300046506 Ga0495583_0001172 Ga0495583_0001172_16052_17773 573
503 3300046524 Ga0495648_0000166 Ga0495648_0000166_53074_54795 573
504 3300046616 Ga0495668_0000261 Ga0495668_0000261_21887_23608 573
505 3300046616 Ga0495668_0009306 Ga0495668_0009306_4118_5839 573
506 3300046660 Ga0495625_0000910 Ga0495625_0000910_15919_17640 573
507 3300046809 Ga0495600_0000711 Ga0495600_0000711_8513_10234 573
508 3300048905 Ga0496102_0000120 Ga0496102_0000120_72207_73928 573
509 3300048905 Ga0496102_0000758 Ga0496102_0000758_9932_11653 573
510 3300048906 Ga0496103_0000154 Ga0496103_0000154_4605_6326 573
511 3300048906 Ga0496103_0000186 Ga0496103_0000186_25791_27512 573
512 3300048917 Ga0496114_0005133 Ga0496114_0005133_3796_5517 573
513 3300048917 Ga0496114_0006528 Ga0496114_0006528_122_1843 573
514 3300048918 Ga0496115_0000423 Ga0496115_0000423_69_1790 573
515 3300048919 Ga0496116_0004809 Ga0496116_0004809_7015_8736 573
516 3300048919 Ga0496116_0005657 Ga0496116_0005657_8448_10169 573
517 3300048920 Ga0496117_0000317 Ga0496117_0000317_10808_12529 573
518 3300048920 Ga0496117_0000977 Ga0496117_0000977_6930_8651 573
519 3300048921 Ga0496118_0000144 Ga0496118_0000144_41069_42790 573
520 3300048921 Ga0496118_0000303 Ga0496118_0000303_10812_12533 573
521 3300048924 Ga0496121_0000697 Ga0496121_0000697_43143_44864 573
522 3300048924 Ga0496121_0000977 Ga0496121_0000977_23692_25413 573
523 3300048927 Ga0496124_0000177 Ga0496124_0000177_25612_27333 573
524 3300048927 Ga0496124_0000214 Ga0496124_0000214_38505_40226 573
525 3300048928 Ga0496125_0001995 Ga0496125_0001995_203_1924 573
526 3300048929 Ga0496126_0000505 Ga0496126_0000505_33781_35502 573
527 3300049513 Ga0501290_000061 Ga0501290_000061_3183_4904 573
528 3300049515 Ga0501292_000163 Ga0501292_000163_3186_4907 573
529 3300049523 Ga0501300_001891 Ga0501300_001891_676_2397 573
530 3300049653 Ga0501206_001361 Ga0501206_001361_292_2013 573
531 3300049690 Ga0501261_000233 Ga0501261_000233_1911_3632 573
532 3300049775 Ga0501279_000070 Ga0501279_000070_3110_4831 573
533 3300053079 Ga0500610_0000312 Ga0500610_0000312_7929_9650 573
534 3300053130 Ga0500642_0001967 Ga0500642_0001967_684_2405 573
535 3300053730 Ga0500645_000062 Ga0500645_000062_73684_75405 573
536 3300001977 JGI24746J21847_1005092 JGI24746J21847_10050922 574
537 3300001991 JGI24743J22301_10002476 JGI24743J22301_100024761 574
538 3300002070 JGI24750J21931_1001573 JGI24750J21931_10015732 574
539 3300003762 Ga0055542_1001237 Ga0055542_10012378 574
540 3300005330 Ga0070690_100012694 Ga0070690_1000126944 574
541 3300005336 Ga0070680_100005001 Ga0070680_1000050012 574
542 3300005336 Ga0070680_100014421 Ga0070680_1000144215 574
543 3300005337 Ga0070682_100008648 Ga0070682_1000086482 574
544 3300005337 Ga0070682_100032430 Ga0070682_1000324302 574
545 3300005339 Ga0070660_100017179 Ga0070660_1000171792 574
546 3300005339 Ga0070660_100023476 Ga0070660_1000234763 574
547 3300005339 Ga0070660_100091886 Ga0070660_1000918862 574
548 3300005341 Ga0070691_10029192 Ga0070691_100291922 574
549 3300005344 Ga0070661_100025422 Ga0070661_1000254223 574
550 3300005345 Ga0070692_10013099 Ga0070692_100130992 574
551 3300005356 Ga0070674_100074541 Ga0070674_1000745412 574
552 3300005366 Ga0070659_100049347 Ga0070659_1000493473 574
553 3300005367 Ga0070667_100025110 Ga0070667_1000251102 574
554 3300005436 Ga0070713_100146200 Ga0070713_1001462001 574
555 3300005441 Ga0070700_100012459 Ga0070700_1000124592 574
556 3300005458 Ga0070681_10019339 Ga0070681_100193396 574
557 3300005458 Ga0070681_10050201 Ga0070681_100502012 574
558 3300005458 Ga0070681_10193215 Ga0070681_101932151 574
559 3300005530 Ga0070679_100116519 Ga0070679_1001165191 574
560 3300005535 Ga0070684_100013746 Ga0070684_1000137461 574
561 3300005535 Ga0070684_100057270 Ga0070684_1000572701 574
562 3300005536 Ga0070697_100007631 Ga0070697_1000076314 574
563 3300005539 Ga0068853_100005539 Ga0068853_1000055397 574
564 3300005539 Ga0068853_100028539 Ga0068853_1000285394 574
565 3300005545 Ga0070695_100014007 Ga0070695_1000140073 574
566 3300005563 Ga0068855_100075277 Ga0068855_1000752772 574
567 3300005563 Ga0068855_100240249 Ga0068855_1002402492 574
568 3300005564 Ga0070664_100014739 Ga0070664_1000147394 574
569 3300005616 Ga0068852_100015727 Ga0068852_1000157272 574
570 3300005617 Ga0068859_100042742 Ga0068859_1000427424 574
571 3300005719 Ga0068861_100073921 Ga0068861_1000739212 574
572 3300005843 Ga0068860_100001757 Ga0068860_1000017578 574
573 3300005843 Ga0068860_100098874 Ga0068860_1000988742 574
574 3300005937 Ga0081455_10000444 Ga0081455_100004447 574
575 3300005981 Ga0081538_10010773 Ga0081538_100107735 574
576 3300005981 Ga0081538_10048046 Ga0081538_100480462 574
577 3300005983 Ga0081540_1022231 Ga0081540_10222314 574
578 3300005985 Ga0081539_10006551 Ga0081539_100065514 574
579 3300006028 Ga0070717_10024422 Ga0070717_100244223 574
580 3300006038 Ga0075365_10006310 Ga0075365_100063106 574
581 3300006042 Ga0075368_10005599 Ga0075368_100055992 574
582 3300006042 Ga0075368_10016104 Ga0075368_100161042 574
583 3300006175 Ga0070712_100002437 Ga0070712_1000024376 574
584 3300006177 Ga0075362_10010086 Ga0075362_100100862 574
585 3300006178 Ga0075367_10006314 Ga0075367_100063142 574
586 3300006178 Ga0075367_10042352 Ga0075367_100423522 574
587 3300006237 Ga0097621_100034819 Ga0097621_1000348194 574
588 3300006353 Ga0075370_10016647 Ga0075370_100166472 574
589 3300006846 Ga0075430_100000060 Ga0075430_10000006024 574
590 3300006846 Ga0075430_100024195 Ga0075430_1000241954 574
591 3300006846 Ga0075430_100056454 Ga0075430_1000564543 574
592 3300006847 Ga0075431_100027666 Ga0075431_1000276664 574
593 3300006847 Ga0075431_100174308 Ga0075431_1001743081 574
594 3300006871 Ga0075434_100036752 Ga0075434_1000367524 574
595 3300006914 Ga0075436_100000396 Ga0075436_10000039614 574
596 3300006931 Ga0097620_100042742 Ga0097620_1000427424 574
597 3300009093 Ga0105240_10110067 Ga0105240_101100671 574
598 3300009094 Ga0111539_10028731 Ga0111539_100287312 574
599 3300009094 Ga0111539_10040542 Ga0111539_100405423 574
600 3300009098 Ga0105245_10000398 Ga0105245_100003989 574
601 3300009101 Ga0105247_10054002 Ga0105247_100540022 574
602 3300009147 Ga0114129_10013011 Ga0114129_100130115 574
603 3300009148 Ga0105243_10073548 Ga0105243_100735482 574
604 3300009148 Ga0105243_10096966 Ga0105243_100969661 574
605 3300009174 Ga0105241_10030299 Ga0105241_100302992 574
606 3300009176 Ga0105242_10163785 Ga0105242_101637851 574
607 3300009545 Ga0105237_10014904 Ga0105237_100149043 574
608 3300009545 Ga0105237_10088033 Ga0105237_100880332 574
609 3300009551 Ga0105238_10004648 Ga0105238_100046488 574
610 3300009551 Ga0105238_10039698 Ga0105238_100396983 574
611 3300009553 Ga0105249_10113755 Ga0105249_101137552 574
612 3300010159 Ga0099796_10003534 Ga0099796_100035342 574
613 3300010159 Ga0099796_10015336 Ga0099796_100153361 574
614 3300010375 Ga0105239_10057788 Ga0105239_100577882 574
615 3300010375 Ga0105239_10113265 Ga0105239_101132651 574
616 3300013100 Ga0157373_10000586 Ga0157373_1000058629 574
617 3300013100 Ga0157373_10019996 Ga0157373_100199965 574
618 3300013105 Ga0157369_10166917 Ga0157369_101669172 574
619 3300013297 Ga0157378_10049148 Ga0157378_100491481 574
620 3300013307 Ga0157372_10022517 Ga0157372_100225172 574
621 3300013307 Ga0157372_10253969 Ga0157372_102539691 574
622 3300013308 Ga0157375_10101613 Ga0157375_101016131 574
623 3300014325 Ga0163163_10000006 Ga0163163_10000006152 574
624 3300014326 Ga0157380_10016504 Ga0157380_100165042 574
625 3300014326 Ga0157380_10134840 Ga0157380_101348401 574
626 3300014968 Ga0157379_10119859 Ga0157379_101198592 574
627 3300015261 Ga0182006_1040534 Ga0182006_10405341 574
628 3300025250 Ga0209026_1000024 Ga0209026_1000024195 574
629 3300025254 Ga0209148_1000050 Ga0209148_1000050161 574
630 3300025256 Ga0209759_1000389 Ga0209759_100038916 574
631 3300025261 Ga0209233_1000129 Ga0209233_1000129130 574
632 3300025272 Ga0209455_1000183 Ga0209455_100018364 574
633 3300025901 Ga0207688_10001280 Ga0207688_100012803 574
634 3300025904 Ga0207647_10014852 Ga0207647_100148525 574
635 3300025904 Ga0207647_10025394 Ga0207647_100253942 574
636 3300025906 Ga0207699_10027424 Ga0207699_100274242 574
637 3300025907 Ga0207645_10007694 Ga0207645_100076944 574
638 3300025908 Ga0207643_10001224 Ga0207643_100012247 574
639 3300025909 Ga0207705_10008702 Ga0207705_100087025 574
640 3300025912 Ga0207707_10040606 Ga0207707_100406062 574
641 3300025912 Ga0207707_10058202 Ga0207707_100582023 574
642 3300025912 Ga0207707_10077299 Ga0207707_100772993 574
643 3300025912 Ga0207707_10137372 Ga0207707_101373722 574
644 3300025913 Ga0207695_10034936 Ga0207695_100349363 574
645 3300025913 Ga0207695_10052366 Ga0207695_100523663 574
646 3300025913 Ga0207695_10093269 Ga0207695_100932692 574
647 3300025914 Ga0207671_10006493 Ga0207671_100064935 574
648 3300025915 Ga0207693_10006383 Ga0207693_100063835 574
649 3300025915 Ga0207693_10047667 Ga0207693_100476672 574
650 3300025915 Ga0207693_10067214 Ga0207693_100672143 574
651 3300025917 Ga0207660_10022170 Ga0207660_100221702 574
652 3300025919 Ga0207657_10029863 Ga0207657_100298633 574
653 3300025919 Ga0207657_10037809 Ga0207657_100378092 574
654 3300025919 Ga0207657_10058612 Ga0207657_100586122 574
655 3300025919 Ga0207657_10071669 Ga0207657_100716692 574
656 3300025921 Ga0207652_10029441 Ga0207652_100294412 574
657 3300025922 Ga0207646_10013813 Ga0207646_100138132 574
658 3300025924 Ga0207694_10033216 Ga0207694_100332164 574
659 3300025927 Ga0207687_10026852 Ga0207687_100268522 574
660 3300025932 Ga0207690_10014343 Ga0207690_100143431 574
661 3300025932 Ga0207690_10036815 Ga0207690_100368152 574
662 3300025932 Ga0207690_10054922 Ga0207690_100549222 574
663 3300025933 Ga0207706_10013662 Ga0207706_100136624 574
664 3300025937 Ga0207669_10066086 Ga0207669_100660862 574
665 3300025940 Ga0207691_10009803 Ga0207691_100098036 574
666 3300025945 Ga0207679_10005273 Ga0207679_100052736 574
667 3300025949 Ga0207667_10004211 Ga0207667_100042119 574
668 3300026035 Ga0207703_10109549 Ga0207703_101095491 574
669 3300026041 Ga0207639_10032248 Ga0207639_100322483 574
670 3300026041 Ga0207639_10045222 Ga0207639_100452222 574
671 3300026067 Ga0207678_10035216 Ga0207678_100352163 574
672 3300026075 Ga0207708_10001181 Ga0207708_1000118114 574
673 3300026078 Ga0207702_10016315 Ga0207702_100163155 574
674 3300026089 Ga0207648_10005697 Ga0207648_100056977 574
675 3300026118 Ga0207675_100007911 Ga0207675_1000079115 574
676 3300026121 Ga0207683_10008737 Ga0207683_100087373 574
677 3300026142 Ga0207698_10021195 Ga0207698_100211952 574
678 3300028379 Ga0268266_10022663 Ga0268266_100226633 574
679 3300028381 Ga0268264_10000022 Ga0268264_10000022110 574
680 3300028800 Ga0265338_10010200 Ga0265338_100102002 574
681 3300028800 Ga0265338_10053555 Ga0265338_100535553 574
682 3300030521 Ga0307511_10037215 Ga0307511_100372151 574
683 3300031235 Ga0265330_10023681 Ga0265330_100236812 574
684 3300031238 Ga0265332_10000793 Ga0265332_1000079319 574
685 3300031241 Ga0265325_10018610 Ga0265325_100186103 574
686 3300031247 Ga0265340_10012126 Ga0265340_100121263 574
687 3300031247 Ga0265340_10025144 Ga0265340_100251442 574
688 3300031249 Ga0265339_10003009 Ga0265339_100030094 574
689 3300031249 Ga0265339_10047899 Ga0265339_100478992 574
690 3300031251 Ga0265327_10016308 Ga0265327_100163082 574
691 3300031595 Ga0265313_10000124 Ga0265313_1000012465 574
692 3300031712 Ga0265342_10000100 Ga0265342_1000010049 574
693 3300031712 Ga0265342_10004038 Ga0265342_100040386 574
694 3300031712 Ga0265342_10006704 Ga0265342_100067045 574
695 3300031712 Ga0265342_10013562 Ga0265342_100135622 574
696 3300031712 Ga0265342_10017742 Ga0265342_100177423 574
697 3300031730 Ga0307516_10017716 Ga0307516_100177165 574
698 3300032133 Ga0316583_10000048 Ga0316583_1000004810 574
699 3300034819 Ga0373958_0002144 Ga0373958_0002144_432_2156 574
700 3300035114 Ga0373939_0013119 Ga0373939_0013119_16_1740 574
701 3300035116 Ga0373945_0004276 Ga0373945_0004276_189_1913 574
702 3300035691 Ga0373931_0001151 Ga0373931_0001151_9488_11212 574
703 3300035695 Ga0373927_0013058 Ga0373927_0013058_1514_3238 574
704 3300035725 Ga0373947_0021636 Ga0373947_0021636_889_2613 574
705 3300036401 Ga0373937_0085797 Ga0373937_0085797_754_2493 574
706 3300037068 Ga0373925_0040075 Ga0373925_0040075_405_2129 574
707 3300037068 Ga0373925_0073355 Ga0373925_0073355_190_1914 574
708 3300037312 Ga0395899_0007549 Ga0395899_0007549_1184_2911 574
709 3300037418 Ga0395900_0048644 Ga0395900_0048644_1079_2806 574
710 3300037418 Ga0395900_0093364 Ga0395900_0093364_989_2716 574
711 3300037418 Ga0395900_0110938 Ga0395900_0110938_944_2668 574
712 3300037466 Ga0395898_0002807 Ga0395898_0002807_13198_14925 574
713 3300037466 Ga0395898_0009781 Ga0395898_0009781_6685_8415 574
714 3300037471 Ga0395905_0094125 Ga0395905_0094125_873_2597 574
715 3300038443 Ga0395901_0094209 Ga0395901_0094209_965_2689 574
716 3300038443 Ga0395901_0165458 Ga0395901_0165458_421_2148 574
717 3300038443 Ga0395901_0223688 Ga0395901_0223688_35_1771 574
718 3300038443 Ga0395901_0246539 Ga0395901_0246539_118_1842 574
719 3300041408 Ga0439453_0004139 Ga0439453_0004139_360_2084 574
720 3300044684 Ga0466966_0031412 Ga0466966_0031412_826_2553 574
721 3300044694 Ga0466963_0022421 Ga0466963_0022421_1564_3291 574
722 3300045049 Ga0466959_0040185 Ga0466959_0040185_1298_3022 574
723 3300045836 Ga0466958_0042967 Ga0466958_0042967_601_2328 574
724 3300046455 Ga0495603_0027842 Ga0495603_0027842_182_1906 574
725 3300046459 Ga0495629_0066555 Ga0495629_0066555_63_1787 574
726 3300046460 Ga0495638_0004609 Ga0495638_0004609_6493_8223 574
727 3300046460 Ga0495638_0029857 Ga0495638_0029857_184_1908 574
728 3300046472 Ga0495580_0037296 Ga0495580_0037296_1286_3010 574
729 3300046491 Ga0495584_0015596 Ga0495584_0015596_231_1955 574
730 3300046499 Ga0495594_0016216 Ga0495594_0016216_1743_3467 574
731 3300046501 Ga0495607_0057266 Ga0495607_0057266_23_1747 574
732 3300046664 Ga0495659_0011773 Ga0495659_0011773_632_2356 574
733 3300046690 Ga0495624_0035804 Ga0495624_0035804_1073_2797 574
734 3300047321 Ga0495676_0052298 Ga0495676_0052298_416_2140 574
735 3300048903 Ga0496100_0061810 Ga0496100_0061810_188_1912 574
736 3300048904 Ga0496101_0024952 Ga0496101_0024952_1017_2741 574
737 3300048904 Ga0496101_0051971 Ga0496101_0051971_812_2536 574
738 3300048905 Ga0496102_0006681 Ga0496102_0006681_3830_5554 574
739 3300048906 Ga0496103_0001330 Ga0496103_0001330_2029_3753 574
740 3300048906 Ga0496103_0062570 Ga0496103_0062570_61_1785 574
741 3300048907 Ga0496104_0000935 Ga0496104_0000935_12972_14696 574
742 3300048907 Ga0496104_0002021 Ga0496104_0002021_10370_12094 574
743 3300048908 Ga0496105_0000364 Ga0496105_0000364_15307_17031 574
744 3300048908 Ga0496105_0014298 Ga0496105_0014298_3883_5607 574
745 3300048908 Ga0496105_0018042 Ga0496105_0018042_653_2377 574
746 3300048909 Ga0496106_0001709 Ga0496106_0001709_3437_5161 574
747 3300048909 Ga0496106_0005524 Ga0496106_0005524_3327_5051 574
748 3300048909 Ga0496106_0036071 Ga0496106_0036071_570_2294 574
749 3300048910 Ga0496107_0025281 Ga0496107_0025281_1881_3605 574
750 3300048910 Ga0496107_0077651 Ga0496107_0077651_598_2322 574
751 3300048911 Ga0496108_0001344 Ga0496108_0001344_10002_11726 574
752 3300048912 Ga0496109_0002147 Ga0496109_0002147_10628_12352 574
753 3300048914 Ga0496111_0000807 Ga0496111_0000807_4569_6293 574
754 3300048915 Ga0496112_0000646 Ga0496112_0000646_10684_12408 574
755 3300048915 Ga0496112_0157356 Ga0496112_0157356_235_1959 574
756 3300048916 Ga0496113_0000048 Ga0496113_0000048_36820_38544 574
757 3300048918 Ga0496115_0024951 Ga0496115_0024951_753_2477 574
758 3300048918 Ga0496115_0124463 Ga0496115_0124463_382_2106 574
759 3300048920 Ga0496117_0021552 Ga0496117_0021552_2315_4039 574
760 3300048923 Ga0496120_0001824 Ga0496120_0001824_14006_15733 574
761 3300048924 Ga0496121_0000780 Ga0496121_0000780_23101_24825 574
762 3300048927 Ga0496124_0001377 Ga0496124_0001377_18190_19914 574
763 3300049568 Ga0501031_0017275 Ga0501031_0017275_381_2135 574
764 3300049569 Ga0501032_0025126 Ga0501032_0025126_349_2103 574
765 3300049569 Ga0501032_0036933 Ga0501032_0036933_331_2055 574
766 3300049570 Ga0501033_0008987 Ga0501033_0008987_373_2127 574
767 3300049571 Ga0501034_0000247 Ga0501034_0000247_34236_35960 574
768 3300049571 Ga0501034_0004140 Ga0501034_0004140_12439_14163 574
769 3300049571 Ga0501034_0007071 Ga0501034_0007071_4130_5854 574
770 3300049571 Ga0501034_0007660 Ga0501034_0007660_7232_8956 574
771 3300049571 Ga0501034_0058266 Ga0501034_0058266_1085_2824 574
772 3300049573 Ga0501037_0000753 Ga0501037_0000753_16487_18241 574
773 3300049573 Ga0501037_0008277 Ga0501037_0008277_3444_5183 574
774 3300049575 Ga0501039_0074875 Ga0501039_0074875_741_2465 574
775 3300049577 Ga0501041_0010481 Ga0501041_0010481_486_2210 574
776 3300049579 Ga0501043_0000031 Ga0501043_0000031_132830_134584 574
777 3300049580 Ga0501046_0003147 Ga0501046_0003147_3339_5063 574
778 3300049581 Ga0501047_0039175 Ga0501047_0039175_1250_2974 574
779 3300049581 Ga0501047_0051713 Ga0501047_0051713_475_2199 574
780 3300049581 Ga0501047_0113988 Ga0501047_0113988_253_1977 574
781 3300049584 Ga0501068_0022282 Ga0501068_0022282_1532_3286 574
782 3300049584 Ga0501068_0039213 Ga0501068_0039213_112_1851 574
783 3300049584 Ga0501068_0064517 Ga0501068_0064517_131_1855 574
784 3300049585 Ga0501069_0000362 Ga0501069_0000362_16877_18631 574
785 3300049586 Ga0501070_0006517 Ga0501070_0006517_2073_3827 574
786 3300049587 Ga0501071_0036454 Ga0501071_0036454_94_1818 574
787 3300049587 Ga0501071_0090456 Ga0501071_0090456_173_1927 574
788 3300049588 Ga0501072_0005871 Ga0501072_0005871_4200_5924 574
789 3300049589 Ga0501073_0050501 Ga0501073_0050501_33_1757 574
790 3300049589 Ga0501073_0069905 Ga0501073_0069905_331_2055 574
791 3300049590 Ga0501074_0004186 Ga0501074_0004186_4157_5911 574
792 3300049590 Ga0501074_0040878 Ga0501074_0040878_470_2194 574
793 3300049591 Ga0501075_0034007 Ga0501075_0034007_399_2123 574
794 3300049591 Ga0501075_0056774 Ga0501075_0056774_25_1749 574
795 3300049592 Ga0501076_0037460 Ga0501076_0037460_1942_3675 574
796 3300049592 Ga0501076_0071397 Ga0501076_0071397_443_2167 574
797 3300049593 Ga0501077_0001516 Ga0501077_0001516_2251_3975 574
798 3300049741 Ga0501079_0057846 Ga0501079_0057846_204_1928 574
799 3300049741 Ga0501079_0084498 Ga0501079_0084498_680_2404 574
800 3300049741 Ga0501079_0116550 Ga0501079_0116550_326_2050 574
801 3300049742 Ga0501080_0016292 Ga0501080_0016292_4785_6539 574
802 3300049742 Ga0501080_0035176 Ga0501080_0035176_2671_4395 574
803 3300049742 Ga0501080_0043040 Ga0501080_0043040_246_1979 574
804 3300049742 Ga0501080_0065110 Ga0501080_0065110_353_2077 574
805 3300049743 Ga0501081_0002741 Ga0501081_0002741_821_2545 574
806 3300049743 Ga0501081_0011071 Ga0501081_0011071_2413_4137 574
807 3300049743 Ga0501081_0020147 Ga0501081_0020147_2259_3983 574
808 3300049743 Ga0501081_0024549 Ga0501081_0024549_229_1962 574
809 3300049744 Ga0501083_0001104 Ga0501083_0001104_3008_4762 574
810 3300049744 Ga0501083_0068490 Ga0501083_0068490_598_2322 574
811 3300049822 Ga0501035_0000036 Ga0501035_0000036_20893_22647 574
812 3300049822 Ga0501035_0018367 Ga0501035_0018367_3356_5110 574
813 3300049822 Ga0501035_0100874 Ga0501035_0100874_205_1929 574
814 3300049823 Ga0501044_0000011 Ga0501044_0000011_129607_131361 574
815 3300049823 Ga0501044_0124848 Ga0501044_0124848_632_2356 574
816 3300049823 Ga0501044_0139308 Ga0501044_0139308_109_1833 574
817 3300049824 Ga0501045_0067200 Ga0501045_0067200_626_2350 574
818 3300050491 nmdc:mga00v17_67988_c1 nmdc:mga00v17_67988_c1_126_1850 574
819 3300050492 nmdc:mga0yw44_3978_c1 nmdc:mga0yw44_3978_c1_651_2375 574
820 3300050492 nmdc:mga0yw44_7148_c1 nmdc:mga0yw44_7148_c1_817_2541 574
821 3300050494 nmdc:mga06z11_36709_c1 nmdc:mga06z11_36709_c1_434_2158 574
822 3300050496 nmdc:mga07m45_9818_c1 nmdc:mga07m45_9818_c1_3144_4868 574
823 3300050507 nmdc:mga05p37_6958_c1 nmdc:mga05p37_6958_c1_7075_8799 574
824 3300050507 nmdc:mga05p37_79380_c1 nmdc:mga05p37_79380_c1_855_2579 574
825 3300050508 nmdc:mga09592_43052_c1 nmdc:mga09592_43052_c1_1760_3484 574
826 3300050510 nmdc:mga06r32_140339_c1 nmdc:mga06r32_140339_c1_346_2076 574
827 3300050510 nmdc:mga06r32_32705_c1 nmdc:mga06r32_32705_c1_2728_4452 574
828 3300050510 nmdc:mga06r32_78400_c1 nmdc:mga06r32_78400_c1_40_1812 574
829 3300050511 nmdc:mga08y16_32250_c1 nmdc:mga08y16_32250_c1_3231_4955 574
830 3300050511 nmdc:mga08y16_67602_c1 nmdc:mga08y16_67602_c1_1264_2988 574
831 3300050512 nmdc:mga0n895_15036_c1 nmdc:mga0n895_15036_c1_2769_4493 574
832 3300050512 nmdc:mga0n895_42047_c1 nmdc:mga0n895_42047_c1_317_2041 574
833 3300050514 nmdc:mga08x19_4_c1 nmdc:mga08x19_4_c1_98846_100570 574
834 3300050516 nmdc:mga0sz30_8254_c1 nmdc:mga0sz30_8254_c1_38_1762 574
835 3300053077 Ga0495601_0007958 Ga0495601_0007958_1274_2998 574
836 3300053077 Ga0495601_0059481 Ga0495601_0059481_34_1758 574
837 3300053079 Ga0500610_0019460 Ga0500610_0019460_1293_3017 574
838 3300053087 Ga0500643_000693 Ga0500643_000693_7703_9436 574
839 3300053097 Ga0500648_042009 Ga0500648_042009_567_2291 574
840 3300053103 Ga0500555_008037 Ga0500555_008037_44_1768 574
841 3300053119 Ga0500595_003443 Ga0500595_003443_1151_2875 574
842 3300053131 Ga0500652_000015 Ga0500652_000015_58408_60132 574
843 3300053139 Ga0500568_0000001 Ga0500568_0000001_478750_480474 574
844 3300053153 Ga0500616_0019516 Ga0500616_0019516_953_2683 574
845 3300053155 Ga0500620_000453 Ga0500620_000453_3489_5213 574
846 3300053735 Ga0500596_000569 Ga0500596_000569_4845_6569 574
847 3300054114 Ga0501084_0006511 Ga0501084_0006511_6890_8614 574
848 3300060353 Ga0501082_0017709 Ga0501082_0017709_2887_4611 574
849 3300060353 Ga0501082_0024992 Ga0501082_0024992_3407_5131 574
850 3300061734 Ga0530510_0055624 Ga0530510_0055624_464_2188 574
851 3300061734 Ga0530510_0080675 Ga0530510_0080675_316_2040 574
852 iso_pu_bacteria 2970524798 2970530741 574
853 iso_pu_bacteria 2979742915 2979746985 574
854 iso_pu_bacteria 8004395343 8004400298 574

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00920

ILVD_EDD

Dehydratase family

1

485

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ze4-assembly1.cif.gz_A the structure of holo- structure of dhad complex with [2fe-2s] cluster 0.9668 4 558
6ovt-assembly1.cif.gz_A crystal structure of ilvd from mycobacterium tuberculosis 0.9634 8 559
5ym0-assembly1.cif.gz_A the crystal structure of dhad 0.9627 5 559
6ovt-assembly1.cif.gz_D crystal structure of ilvd from mycobacterium tuberculosis 0.9582 10 559
6ovt-assembly1.cif.gz_C crystal structure of ilvd from mycobacterium tuberculosis 0.9575 8 559
ID Description Score Start End Superfamily
af_Q58672_371_522_3.50.30.80 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like 0.9697 383 530 3.50.30.80
af_I1M137_1_420_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9693 4 381 3.40.50.1820
af_Q2FWK7_1_375_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9652 11 381 3.40.50.360
af_A0A1D6KMC8_411_524_3.50.30.80 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like 0.964 384 489 3.50.30.80
af_Q2FWK7_1_375_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9526 11 381 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A528TIC4-F1-model_v4 Dihydroxy-acid dehydratase (EC 4.2.1.9) 0.9987 387 486 GO:0004160
GO:0009082
AF-A0A7C5CCM4-F1-model_v4 Dihydroxy-acid dehydratase (EC 4.2.1.9) 0.994 245 572 GO:0004160
GO:0009082
AF-A0A4V1KZT7-F1-model_v4 deleted 0.9923 1 572
AF-A0A2E5J660-F1-model_v4 Dihydroxy-acid dehydratase (DAD) (EC 4.2.1.9) 0.9907 8 572 GO:0000287
GO:0004160
GO:0009097
GO:0009099
GO:0051537
AF-A0A661SYQ9-F1-model_v4 deleted 0.9906 406 559

Feature Viewer

pLDDT pTM Quality
89.86 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map