F483581

General Info

Members Datasets Scaffolds Average Seq Length
854 349 817 264

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10284267|Ga0105248_102842672
Length 288
Sequence MNASSWHNDATGIAASRLAGRSSVRGCMRVLVSNDDGVDAPGIRILAEGLRGAGHEVWVVAPDRDRSGASNSLTLDQPIRVARIDAFTWRVFGTPTDCVHVALAGLLDHEPDIVVSGINNSANLGDDVIYSGTVAAAMEGRFLGLPAIAVSCATRDHNTGAKHFETAARAAVEITSRLLVDPLPADTILNVNVPDCEWKDLAGFEVSRLGQRHRAEPCIQQTDPRGRPIWWIGPPGAEQDAGPGTDFHAVRTGHVAITPIQVDLTRYKALDKVASWVGALGEALRQRA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
7 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
8 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
9 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
10 2734482264 Dyella sp. AD052 Isolate Unclassified
11 2738543009 Luteibacter sp. OK325 Isolate Unclassified
12 2739367700 Dyella sp. YR388 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
15 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
16 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
17 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
18 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
19 2884411467 Dyella sp. AD56 Isolate Rhizosphere
20 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
21 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
22 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
23 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
24 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
25 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
26 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
27 2919085039 Luteibacter sp. 1214 Isolate Unclassified
28 2919404418 Luteibacter sp. 3190 Isolate Unclassified
29 2919675420 Luteimonas terrae 4099 Isolate Unclassified
30 2928963466 Dyella japonica 1073 Isolate Unclassified
31 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
32 2941471342 Luteibacter sp. 621 Isolate Unclassified
33 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
34 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
41 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
42 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
43 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
44 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
50 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
51 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
52 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
53 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
54 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
126 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
192 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
193 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
214 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
222 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
223 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
224 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
231 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
232 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
331 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
342 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
343 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
344 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
345 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
346 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
348 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
349 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 0.47
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0
Rhizoplane 2.69
Rhizosphere 69.67
Stem 0
Stem Tuber 0
Unclassified 13.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10016336 3300001979 Bacteria 2684
2 JGI24739J22299_10000040 3300001989 Bacteria 35361
3 JGI24737J22298_10012814 3300001990 Bacteria 2734
4 JGI24735J21928_10014781 3300002067 Bacteria 2443
5 JGI24735J21928_10027374 3300002067 Bacteria 1708
6 JGI25156J39149_1000714 3300002705 Bacteria 17738
7 JGI25156J39149_1006236 3300002705 Bacteria 3289
8 JGI25156J39149_1007127 3300002705 Bacteria 2972
9 JGI25162J39368_1000551 3300002737 Bacteria 27687
10 JGI25162J39368_1000783 3300002737 Bacteria 21349
11 JGI25162J39368_1001115 3300002737 Bacteria 16204
12 JGI25162J39368_1003412 3300002737 Bacteria 4625
13 JGI25162J39368_1003477 3300002737 Bacteria 4507
14 JGI25154J39366_1004788 3300002738 Bacteria 2313
15 JGI25157J39369_1000485 3300002741 Bacteria 24711
16 JGI25157J39369_1000595 3300002741 Bacteria 21349
17 JGI25157J39369_1000847 3300002741 Bacteria 15070
18 JGI25157J39369_1001468 3300002741 Bacteria 8740
19 JGI25157J39369_1003714 3300002741 Bacteria 3011
20 JGI25163J39215_1001294 3300002771 Bacteria 4449
21 JGI25164J39214_1000046 3300002772 Bacteria 124984
22 JGI25164J39214_1000191 3300002772 Bacteria 53327
23 JGI25164J39214_1000453 3300002772 Bacteria 21349
24 JGI25164J39214_1000842 3300002772 Bacteria 10606
25 JGI25164J39214_1000905 3300002772 Bacteria 9895
26 JGI25151J46595_10037886 3300003187 Bacteria 1802
27 JGI25165J46597_1000096 3300003214 Bacteria 161294
28 JGI25165J46597_1000877 3300003214 Bacteria 21349
29 JGI25165J46597_1001702 3300003214 Bacteria 9879
30 JGI25165J46597_1003783 3300003214 Bacteria 3553
31 JGI25153J46596_10005437 3300003215 Bacteria 6685
32 rootL2_10010522 3300003322 Bacteria 3038
33 Ga0006562J51391_1021318 3300003578 Bacteria 2800
34 Ga0006562J51391_1103004 3300003578 Bacteria 3204
35 Ga0006562J51391_1103005 3300003578 Bacteria 2520
36 Ga0055538_1001663 3300003751 Bacteria 3952
37 Ga0055539_1000569 3300003752 Bacteria 10496
38 Ga0055533_1002346 3300003756 Bacteria 4347
39 Ga0055525_1000122 3300003759 Bacteria 119205
40 Ga0055525_1000149 3300003759 Bacteria 94324
41 Ga0055527_1000204 3300003760 Bacteria 38984
42 Ga0055527_1000265 3300003760 Bacteria 31658
43 Ga0055527_1001913 3300003760 Bacteria 3873
44 Ga0055535_1000561 3300003761 Bacteria 31664
45 Ga0055535_1000755 3300003761 Bacteria 24057
46 Ga0055535_1000866 3300003761 Bacteria 21349
47 Ga0055535_1001951 3300003761 Bacteria 8573
48 Ga0055535_1003042 3300003761 Bacteria 5088
49 Ga0055542_1000306 3300003762 Bacteria 53983
50 Ga0055542_1000451 3300003762 Bacteria 38982
51 Ga0055542_1000582 3300003762 Bacteria 31664
52 Ga0055542_1000855 3300003762 Bacteria 21349
53 Ga0055542_1001843 3300003762 Bacteria 8573
54 Ga0055542_1002057 3300003762 Bacteria 7552
55 Ga0055529_1000309 3300003763 Bacteria 56116
56 Ga0055529_1000551 3300003763 Bacteria 31664
57 Ga0055529_1000733 3300003763 Bacteria 21349
58 Ga0055529_1000940 3300003763 Bacteria 15455
59 Ga0055536_1002998 3300003781 Bacteria 9246
60 Ga0055530_10003803 3300003791 Bacteria 8309
61 Ga0065165_1000028 3300005262 Bacteria 224430
62 Ga0065165_1008763 3300005262 Bacteria 4663
63 Ga0070658_10015687 3300005327 Bacteria 6059
64 Ga0070658_10373898 3300005327 Bacteria 1222
65 Ga0070658_10397274 3300005327 Bacteria 1184
66 Ga0070670_100193548 3300005331 Bacteria 1767
67 Ga0070666_10000003 3300005335 Bacteria 463666
68 Ga0070666_10002096 3300005335 Bacteria 12133
69 Ga0070680_100117495 3300005336 Bacteria 2217
70 Ga0070680_100146217 3300005336 Bacteria 1983
71 Ga0070680_100268831 3300005336 Bacteria 1443
72 Ga0070682_100001003 3300005337 Bacteria 16333
73 Ga0070682_100017192 3300005337 Bacteria 4214
74 Ga0070660_100164595 3300005339 Bacteria 1789
75 Ga0070689_100023584 3300005340 Bacteria 4607
76 Ga0070661_100061535 3300005344 Bacteria 2756
77 Ga0070661_100078301 3300005344 Bacteria 2438
78 Ga0070661_100100966 3300005344 Bacteria 2146
79 Ga0070692_10002864 3300005345 Bacteria 6835
80 Ga0070659_100003413 3300005366 Bacteria 11320
81 Ga0070659_100010476 3300005366 Bacteria 6821
82 Ga0070659_100178322 3300005366 Bacteria 1743
83 Ga0070667_100000005 3300005367 Bacteria 347268
84 Ga0070667_100034571 3300005367 Bacteria 4229
85 Ga0070667_100058101 3300005367 Bacteria 3270
86 Ga0070667_100185170 3300005367 Bacteria 1843
87 Ga0070714_100000034 3300005435 Bacteria 130742
88 Ga0070714_100029320 3300005435 Bacteria 4574
89 Ga0070713_100000353 3300005436 Bacteria 29733
90 Ga0070663_100023182 3300005455 Bacteria 4158
91 Ga0070663_100089281 3300005455 Bacteria 2280
92 Ga0070663_100328498 3300005455 Bacteria 1232
93 Ga0070662_100021135 3300005457 Bacteria 4441
94 Ga0070681_10000344 3300005458 Bacteria 37503
95 Ga0070681_10002489 3300005458 Bacteria 16870
96 Ga0070681_10020895 3300005458 Bacteria 6556
97 Ga0070681_10025865 3300005458 Bacteria 5901
98 Ga0070679_100008801 3300005530 Bacteria 9520
99 Ga0070679_100042854 3300005530 Bacteria 4508
100 Ga0070679_100137444 3300005530 Bacteria 2425
101 Ga0070679_100245710 3300005530 Bacteria 1746
102 Ga0068853_100003367 3300005539 Bacteria 12234
103 Ga0068853_100003901 3300005539 Bacteria 11433
104 Ga0068853_100023295 3300005539 Bacteria 5181
105 Ga0068853_100034276 3300005539 Bacteria 4309
106 Ga0068853_100119273 3300005539 Bacteria 2351
107 Ga0068853_100138784 3300005539 Bacteria 2181
108 Ga0068853_100458765 3300005539 Bacteria 1199
109 Ga0070672_100002714 3300005543 Bacteria 11316
110 Ga0070672_100011903 3300005543 Bacteria 6082
111 Ga0070696_100002465 3300005546 Bacteria 12261
112 Ga0070696_100003766 3300005546 Bacteria 10129
113 Ga0070696_100047519 3300005546 Bacteria 2978
114 Ga0070693_100010283 3300005547 Bacteria 4684
115 Ga0070693_100027552 3300005547 Bacteria 3081
116 Ga0070693_100038898 3300005547 Bacteria 2662
117 Ga0070693_100102808 3300005547 Bacteria 1744
118 Ga0070665_100001267 3300005548 Bacteria 30338
119 Ga0070665_100011880 3300005548 Bacteria 8795
120 Ga0070665_100059354 3300005548 Bacteria 3835
121 Ga0070665_100235902 3300005548 Bacteria 1830
122 Ga0068855_100024470 3300005563 Bacteria 7223
123 Ga0068855_100028430 3300005563 Bacteria 6689
124 Ga0068855_100037052 3300005563 Bacteria 5803
125 Ga0068855_100095757 3300005563 Bacteria 3421
126 Ga0068855_100103669 3300005563 Bacteria 3272
127 Ga0068855_100108560 3300005563 Bacteria 3187
128 Ga0068855_100571763 3300005563 Bacteria 1222
129 Ga0068855_100843017 3300005563 Bacteria 972
130 Ga0070664_100121338 3300005564 Bacteria 2289
131 Ga0070664_100213877 3300005564 Bacteria 1723
132 Ga0070664_100564243 3300005564 Bacteria 1053
133 Ga0068857_100001580 3300005577 Bacteria 18242
134 Ga0068857_100069236 3300005577 Bacteria 3142
135 Ga0068857_100104071 3300005577 Bacteria 2548
136 Ga0068857_100201643 3300005577 Bacteria 1813
137 Ga0068857_100376957 3300005577 Bacteria 1317
138 Ga0068854_100004721 3300005578 Bacteria 8587
139 Ga0068854_100014481 3300005578 Bacteria 5200
140 Ga0068854_100038122 3300005578 Bacteria 3378
141 Ga0068856_100001468 3300005614 Bacteria 24682
142 Ga0068856_100005447 3300005614 Bacteria 12537
143 Ga0068856_100033308 3300005614 Bacteria 5044
144 Ga0068856_100309468 3300005614 Bacteria 1597
145 Ga0068852_100010889 3300005616 Bacteria 6815
146 Ga0068852_100024583 3300005616 Bacteria 4871
147 Ga0068852_100040375 3300005616 Bacteria 3936
148 Ga0068852_100347198 3300005616 Bacteria 1448
149 Ga0068852_100477872 3300005616 Bacteria 1238
150 Ga0068859_100000265 3300005617 Bacteria 52351
151 Ga0068851_10002041 3300005834 Bacteria 8906
152 Ga0068851_10135254 3300005834 Bacteria 1336
153 Ga0068863_100020907 3300005841 Bacteria 6250
154 Ga0068863_100185119 3300005841 Bacteria 2000
155 Ga0068858_100003531 3300005842 Bacteria 15485
156 Ga0068858_100008948 3300005842 Bacteria 9597
157 Ga0068858_100115545 3300005842 Bacteria 2508
158 Ga0068862_100005271 3300005844 Bacteria 10842
159 Ga0068862_100043064 3300005844 Bacteria 3848
160 Ga0081540_1072453 3300005983 Bacteria 1587
161 Ga0075364_10000356 3300006051 Bacteria 22600
162 Ga0075364_10088551 3300006051 Bacteria 2053
163 Ga0075364_10125075 3300006051 Bacteria 1723
164 Ga0097621_100079578 3300006237 Bacteria 2725
165 Ga0097620_100000265 3300006931 Bacteria 52351
166 Ga0105240_10002519 3300009093 Bacteria 29423
167 Ga0105240_10008512 3300009093 Bacteria 14670
168 Ga0105240_10013886 3300009093 Bacteria 11033
169 Ga0105240_10027090 3300009093 Bacteria 7510
170 Ga0105240_10030925 3300009093 Bacteria 6953
171 Ga0105240_10176224 3300009093 Bacteria 2528
172 Ga0111539_10366310 3300009094 Bacteria 1677
173 Ga0105245_10357427 3300009098 Bacteria 1449
174 Ga0105247_10069693 3300009101 Bacteria 2195
175 Ga0105241_10030187 3300009174 Bacteria 4049
176 Ga0105241_10229887 3300009174 Bacteria 1563
177 Ga0105248_10002061 3300009177 Bacteria 22267
178 Ga0105248_10284267 3300009177 Bacteria 1862
179 Ga0105237_10000023 3300009545 Bacteria 226144
180 Ga0105237_10000202 3300009545 Bacteria 84889
181 Ga0105237_10004780 3300009545 Bacteria 15572
182 Ga0105237_10021360 3300009545 Bacteria 6656
183 Ga0105237_10025889 3300009545 Bacteria 5997
184 Ga0105237_10300160 3300009545 Bacteria 1609
185 Ga0105237_10442954 3300009545 Bacteria 1305
186 Ga0105238_10001867 3300009551 Bacteria 21119
187 Ga0105238_10007377 3300009551 Bacteria 11015
188 Ga0105238_10015192 3300009551 Bacteria 7796
189 Ga0105238_10016361 3300009551 Bacteria 7507
190 Ga0105238_10093354 3300009551 Bacteria 2997
191 Ga0105238_10315596 3300009551 Bacteria 1548
192 Ga0105238_10338446 3300009551 Bacteria 1492
193 Ga0105249_10005661 3300009553 Bacteria 10808
194 Ga0105249_10020935 3300009553 Bacteria 5850
195 Ga0105239_10000022 3300010375 Bacteria 257744
196 Ga0105239_10010293 3300010375 Bacteria 10475
197 Ga0105239_10023401 3300010375 Bacteria 6803
198 Ga0105239_10025017 3300010375 Bacteria 6577
199 Ga0105239_10038519 3300010375 Bacteria 5239
200 Ga0105239_10046624 3300010375 Bacteria 4749
201 Ga0105239_10086061 3300010375 Bacteria 3464
202 Ga0105239_10112342 3300010375 Bacteria 3021
203 Ga0105239_10335425 3300010375 Bacteria 1706
204 Ga0105239_11045843 3300010375 Bacteria 939
205 Ga0157347_1005723 3300012502 Bacteria 1195
206 Ga0157373_10019910 3300013100 Bacteria 4881
207 Ga0157373_10020859 3300013100 Bacteria 4756
208 Ga0157373_10175713 3300013100 Bacteria 1507
209 Ga0157373_10411225 3300013100 Bacteria 970
210 Ga0157373_10424162 3300013100 Bacteria 955
211 Ga0157371_10005748 3300013102 Bacteria 10390
212 Ga0157371_10015964 3300013102 Bacteria 5617
213 Ga0157371_10084059 3300013102 Bacteria 2254
214 Ga0157370_10001779 3300013104 Bacteria 26577
215 Ga0157370_10007947 3300013104 Bacteria 11490
216 Ga0157370_10008298 3300013104 Bacteria 11210
217 Ga0157370_10013751 3300013104 Bacteria 8319
218 Ga0157370_10039182 3300013104 Bacteria 4580
219 Ga0157370_10350525 3300013104 Bacteria 1361
220 Ga0157369_10000597 3300013105 Bacteria 46956
221 Ga0157369_10024098 3300013105 Bacteria 6773
222 Ga0157369_10063246 3300013105 Bacteria 3987
223 Ga0157369_10112543 3300013105 Bacteria 2891
224 Ga0157374_10057130 3300013296 Bacteria 3644
225 Ga0157374_10068936 3300013296 Bacteria 3329
226 Ga0157378_10000043 3300013297 Bacteria 107750
227 Ga0157378_10034449 3300013297 Bacteria 4478
228 Ga0157378_10186933 3300013297 Bacteria 1952
229 Ga0163162_10000015 3300013306 Bacteria 261996
230 Ga0163162_10000236 3300013306 Bacteria 50620
231 Ga0157372_10007227 3300013307 Bacteria 11826
232 Ga0157372_10010524 3300013307 Bacteria 9844
233 Ga0157372_10031403 3300013307 Bacteria 5816
234 Ga0157372_10084957 3300013307 Bacteria 3589
235 Ga0157372_10402504 3300013307 Bacteria 1595
236 Ga0157372_10539578 3300013307 Bacteria 1360
237 Ga0157375_10013746 3300013308 Bacteria 7216
238 Ga0163163_10429229 3300014325 Bacteria 1381
239 Ga0157380_10060113 3300014326 Bacteria 3035
240 Ga0182008_10002881 3300014497 Bacteria 10649
241 Ga0182008_10016310 3300014497 Bacteria 3861
242 Ga0182008_10034286 3300014497 Bacteria 2545
243 Ga0157376_10062563 3300014969 Bacteria 3132
244 Ga0157376_10127877 3300014969 Bacteria 2263
245 Ga0182006_1000072 3300015261 Bacteria 133681
246 Ga0182006_1000765 3300015261 Bacteria 21862
247 Ga0182006_1020561 3300015261 Bacteria 2764
248 Ga0182007_10006852 3300015262 Bacteria 4846
249 Ga0182007_10026602 3300015262 Bacteria 2003
250 Ga0182005_1000080 3300015265 Bacteria 76011
251 Ga0182005_1002839 3300015265 Bacteria 6035
252 Ga0182005_1023524 3300015265 Bacteria 1683
253 Ga0183369_1012 3300015685 Bacteria 251554
254 Ga0183368_1004 3300015687 Bacteria 1211761
255 Ga0163161_10003999 3300017792 Bacteria 10318
256 Ga0163161_10213193 3300017792 Bacteria 1493
257 Ga0163161_10281530 3300017792 Bacteria 1304
258 Ga0206356_11572506 3300020070 Bacteria 2274
259 Ga0209784_100047 3300025224 Bacteria 199596
260 Ga0209674_100016 3300025226 Bacteria 696756
261 Ga0209674_100053 3300025226 Bacteria 323159
262 Ga0209674_101380 3300025226 Bacteria 6528
263 Ga0209674_101867 3300025226 Bacteria 4985
264 Ga0209672_100009 3300025228 Bacteria 883623
265 Ga0209672_100056 3300025228 Bacteria 217675
266 Ga0209672_100160 3300025228 Bacteria 57654
267 Ga0209672_102153 3300025228 Bacteria 5198
268 Ga0209563_100077 3300025230 Bacteria 205130
269 Ga0207427_100023 3300025231 Bacteria 439725
270 Ga0207427_100040 3300025231 Bacteria 265135
271 Ga0207427_100050 3300025231 Bacteria 227233
272 Ga0207427_100166 3300025231 Bacteria 73732
273 Ga0209437_100015 3300025233 Bacteria 713457
274 Ga0209437_100120 3300025233 Bacteria 205054
275 Ga0209437_100172 3300025233 Bacteria 140146
276 Ga0209437_100276 3300025233 Bacteria 76094
277 Ga0209437_100288 3300025233 Bacteria 73732
278 Ga0209437_100985 3300025233 Bacteria 10027
279 Ga0209258_100011 3300025242 Bacteria 867542
280 Ga0209258_100043 3300025242 Bacteria 380685
281 Ga0209258_100096 3300025242 Bacteria 217675
282 Ga0209258_100246 3300025242 Bacteria 99606
283 Ga0209258_100598 3300025242 Bacteria 29635
284 Ga0209258_101191 3300025242 Bacteria 10392
285 Ga0209646_1001741 3300025246 Bacteria 5489
286 Ga0209646_1002174 3300025246 Bacteria 4538
287 Ga0209646_1004458 3300025246 Bacteria 2550
288 Ga0209026_1000047 3300025250 Bacteria 261867
289 Ga0209026_1000101 3300025250 Bacteria 154866
290 Ga0209026_1000157 3300025250 Bacteria 106621
291 Ga0209026_1000397 3300025250 Bacteria 38769
292 Ga0209026_1002418 3300025250 Bacteria 7026
293 Ga0209026_1006975 3300025250 Bacteria 2640
294 Ga0209677_111351 3300025253 Bacteria 1397
295 Ga0209148_1000002 3300025254 Bacteria 2399500
296 Ga0209148_1000010 3300025254 Bacteria 1265567
297 Ga0209148_1000013 3300025254 Bacteria 956684
298 Ga0209148_1000024 3300025254 Bacteria 669890
299 Ga0209148_1000052 3300025254 Bacteria 399449
300 Ga0209148_1000101 3300025254 Bacteria 217675
301 Ga0209148_1002776 3300025254 Bacteria 5501
302 Ga0209759_1000287 3300025256 Bacteria 70252
303 Ga0209759_1000453 3300025256 Bacteria 47129
304 Ga0209759_1000807 3300025256 Bacteria 25155
305 Ga0209759_1001871 3300025256 Bacteria 10442
306 Ga0209759_1002250 3300025256 Bacteria 8789
307 Ga0209759_1010351 3300025256 Bacteria 2739
308 Ga0209129_1001629 3300025258 Bacteria 12181
309 Ga0209233_1000009 3300025261 Bacteria 1265567
310 Ga0209233_1000108 3300025261 Bacteria 265137
311 Ga0209233_1000174 3300025261 Bacteria 144639
312 Ga0209233_1000184 3300025261 Bacteria 134246
313 Ga0209233_1000284 3300025261 Bacteria 69746
314 Ga0209233_1017293 3300025261 Bacteria 1968
315 Ga0209233_1018207 3300025261 Bacteria 1896
316 Ga0209455_1000012 3300025272 Bacteria 867234
317 Ga0209455_1000020 3300025272 Bacteria 702259
318 Ga0209455_1000025 3300025272 Bacteria 670673
319 Ga0209455_1000094 3300025272 Bacteria 217675
320 Ga0209455_1000496 3300025272 Bacteria 28759
321 Ga0209673_1003194 3300025273 Bacteria 9941
322 Ga0209675_1024911 3300025291 Bacteria 1518
323 Ga0209676_1001428 3300025292 Bacteria 22617
324 Ga0209676_1002923 3300025292 Bacteria 11166
325 Ga0209676_1006416 3300025292 Bacteria 5814
326 Ga0209676_1007181 3300025292 Bacteria 5311
327 Ga0209025_1022336 3300025294 Bacteria 3361
328 Ga0209025_1027178 3300025294 Bacteria 2846
329 Ga0209758_1001571 3300025297 Bacteria 26194
330 Ga0209758_1033390 3300025297 Bacteria 2068
331 Ga0209050_1000653 3300025298 Bacteria 53609
332 Ga0209256_1005272 3300025299 Bacteria 7540
333 Ga0209256_1017123 3300025299 Bacteria 2426
334 Ga0207426_1008786 3300025302 Bacteria 4046
335 Ga0209051_1002828 3300025303 Bacteria 11965
336 Ga0209051_1004130 3300025303 Bacteria 9090
337 Ga0209257_1000349 3300025304 Bacteria 95064
338 Ga0209257_1008881 3300025304 Bacteria 5546
339 Ga0209257_1030862 3300025304 Bacteria 1723
340 Ga0207656_10000309 3300025321 Bacteria 16926
341 Ga0207680_10000006 3300025903 Bacteria 635950
342 Ga0207680_10001037 3300025903 Bacteria 13116
343 Ga0207680_10008585 3300025903 Bacteria 5024
344 Ga0207680_10093654 3300025903 Bacteria 1917
345 Ga0207647_10000029 3300025904 Bacteria 109732
346 Ga0207647_10000155 3300025904 Bacteria 54186
347 Ga0207647_10032018 3300025904 Bacteria 3382
348 Ga0207705_10062307 3300025909 Bacteria 2694
349 Ga0207705_10210904 3300025909 Bacteria 1473
350 Ga0207705_10246608 3300025909 Bacteria 1361
351 Ga0207654_10129537 3300025911 Bacteria 1595
352 Ga0207654_10178101 3300025911 Bacteria 1385
353 Ga0207707_10000128 3300025912 Bacteria 78104
354 Ga0207707_10000933 3300025912 Bacteria 28273
355 Ga0207707_10007534 3300025912 Bacteria 9482
356 Ga0207707_10117900 3300025912 Bacteria 2320
357 Ga0207695_10000032 3300025913 Bacteria 521283
358 Ga0207695_10000654 3300025913 Bacteria 68735
359 Ga0207695_10001068 3300025913 Bacteria 47945
360 Ga0207695_10005772 3300025913 Bacteria 16296
361 Ga0207695_10006761 3300025913 Bacteria 14788
362 Ga0207695_10055081 3300025913 Bacteria 4147
363 Ga0207695_10064629 3300025913 Bacteria 3765
364 Ga0207695_10114719 3300025913 Bacteria 2669
365 Ga0207671_10000020 3300025914 Bacteria 309636
366 Ga0207671_10000033 3300025914 Bacteria 245869
367 Ga0207671_10000726 3300025914 Bacteria 41902
368 Ga0207671_10022957 3300025914 Bacteria 4711
369 Ga0207671_10030938 3300025914 Bacteria 3991
370 Ga0207671_10032193 3300025914 Bacteria 3904
371 Ga0207671_10039957 3300025914 Bacteria 3473
372 Ga0207660_10272031 3300025917 Bacteria 1342
373 Ga0207657_10173036 3300025919 Bacteria 1748
374 Ga0207649_10072779 3300025920 Bacteria 2200
375 Ga0207649_10113893 3300025920 Bacteria 1812
376 Ga0207652_10002665 3300025921 Bacteria 14980
377 Ga0207652_10053325 3300025921 Bacteria 3474
378 Ga0207652_10090774 3300025921 Bacteria 2685
379 Ga0207652_10116077 3300025921 Bacteria 2378
380 Ga0207694_10001181 3300025924 Bacteria 22601
381 Ga0207694_10008048 3300025924 Bacteria 7973
382 Ga0207694_10008628 3300025924 Bacteria 7695
383 Ga0207694_10035601 3300025924 Bacteria 3820
384 Ga0207694_10156168 3300025924 Bacteria 1840
385 Ga0207694_10293204 3300025924 Bacteria 1338
386 Ga0207659_10126534 3300025926 Bacteria 1966
387 Ga0207700_10002664 3300025928 Bacteria 10287
388 Ga0207664_10000021 3300025929 Bacteria 216875
389 Ga0207664_10016425 3300025929 Bacteria 5399
390 Ga0207690_10013241 3300025932 Bacteria 4952
391 Ga0207690_10122194 3300025932 Bacteria 1893
392 Ga0207706_10007442 3300025933 Bacteria 10126
393 Ga0207706_10148074 3300025933 Bacteria 2065
394 Ga0207670_10026070 3300025936 Bacteria 3680
395 Ga0207669_10044591 3300025937 Bacteria 2607
396 Ga0207691_10032993 3300025940 Bacteria 4823
397 Ga0207711_10000470 3300025941 Bacteria 41566
398 Ga0207689_10100393 3300025942 Bacteria 2377
399 Ga0207689_10396646 3300025942 Bacteria 1150
400 Ga0207689_10550233 3300025942 Bacteria 969
401 Ga0207679_10112227 3300025945 Bacteria 2154
402 Ga0207667_10000130 3300025949 Bacteria 115321
403 Ga0207667_10000416 3300025949 Bacteria 57683
404 Ga0207667_10043422 3300025949 Bacteria 4770
405 Ga0207667_10094525 3300025949 Bacteria 3086
406 Ga0207667_10132317 3300025949 Bacteria 2569
407 Ga0207667_10148214 3300025949 Bacteria 2415
408 Ga0207667_10296209 3300025949 Bacteria 1653
409 Ga0207667_10403195 3300025949 Bacteria 1392
410 Ga0207712_10000771 3300025961 Bacteria 23954
411 Ga0207712_10002780 3300025961 Bacteria 11194
412 Ga0207712_10128718 3300025961 Bacteria 1926
413 Ga0207640_10000103 3300025981 Bacteria 65214
414 Ga0207640_10028015 3300025981 Bacteria 3438
415 Ga0207640_10099336 3300025981 Bacteria 2037
416 Ga0207658_10000006 3300025986 Bacteria 392309
417 Ga0207658_10008000 3300025986 Bacteria 7200
418 Ga0207658_10416062 3300025986 Bacteria 1184
419 Ga0207703_10001094 3300026035 Bacteria 25767
420 Ga0207703_10061090 3300026035 Bacteria 3084
421 Ga0207703_10083079 3300026035 Bacteria 2675
422 Ga0207639_10001632 3300026041 Bacteria 15088
423 Ga0207639_10002290 3300026041 Bacteria 12858
424 Ga0207639_10006988 3300026041 Bacteria 7691
425 Ga0207639_10008722 3300026041 Bacteria 6960
426 Ga0207639_10015296 3300026041 Bacteria 5410
427 Ga0207639_10036600 3300026041 Bacteria 3638
428 Ga0207639_10168545 3300026041 Bacteria 1852
429 Ga0207639_10222282 3300026041 Bacteria 1632
430 Ga0207678_10001340 3300026067 Bacteria 22694
431 Ga0207678_10002479 3300026067 Bacteria 16776
432 Ga0207678_10017061 3300026067 Bacteria 6375
433 Ga0207678_10020658 3300026067 Bacteria 5772
434 Ga0207678_10096161 3300026067 Bacteria 2531
435 Ga0207678_10375238 3300026067 Bacteria 1229
436 Ga0207678_10554348 3300026067 Bacteria 1005
437 Ga0207702_10000456 3300026078 Bacteria 46149
438 Ga0207702_10005747 3300026078 Bacteria 10805
439 Ga0207702_10013037 3300026078 Bacteria 6914
440 Ga0207702_10041945 3300026078 Bacteria 3837
441 Ga0207702_10324436 3300026078 Bacteria 1467
442 Ga0207641_10081865 3300026088 Bacteria 2804
443 Ga0207641_10124845 3300026088 Bacteria 2303
444 Ga0207641_10449179 3300026088 Bacteria 1245
445 Ga0207674_10000971 3300026116 Bacteria 37506
446 Ga0207674_10017518 3300026116 Bacteria 7815
447 Ga0207674_10085992 3300026116 Bacteria 3139
448 Ga0207674_10202828 3300026116 Bacteria 1933
449 Ga0207698_10008023 3300026142 Bacteria 6656
450 Ga0207698_10015318 3300026142 Bacteria 5131
451 Ga0207698_10022708 3300026142 Bacteria 4368
452 Ga0207698_10063010 3300026142 Bacteria 2899
453 Ga0268266_10000013 3300028379 Bacteria 649715
454 Ga0268266_10000021 3300028379 Bacteria 522453
455 Ga0268266_10054785 3300028379 Bacteria 3428
456 Ga0268266_10156488 3300028379 Bacteria 2059
457 Ga0268265_10003764 3300028380 Bacteria 10765
458 Ga0268265_10255503 3300028380 Bacteria 1555
459 Ga0268265_10381496 3300028380 Bacteria 1297
460 Ga0316177_1132861 3300030731 Bacteria 1750
461 Ga0314311_1204266 3300030733 Bacteria 3894
462 Ga0316180_1077455 3300030736 Bacteria 1335
463 Ga0307513_10147202 3300031456 Bacteria 2271
464 Ga0307408_100202443 3300031548 Bacteria 1608
465 Ga0307408_100617295 3300031548 Bacteria 965
466 Ga0307508_10221850 3300031616 Bacteria 1490
467 Ga0307516_10027810 3300031730 Bacteria 5731
468 Ga0307516_10041474 3300031730 Bacteria 4574
469 Ga0307405_10230407 3300031731 Bacteria 1365
470 Ga0307413_10003477 3300031824 Bacteria 6634
471 Ga0307413_10113898 3300031824 Bacteria 1816
472 Ga0307413_10163139 3300031824 Bacteria 1568
473 Ga0307413_10237906 3300031824 Bacteria 1342
474 Ga0307410_10119478 3300031852 Bacteria 1920
475 Ga0307406_10003052 3300031901 Bacteria 9112
476 Ga0307406_10072175 3300031901 Bacteria 2265
477 Ga0307406_10250419 3300031901 Bacteria 1334
478 Ga0307412_10027813 3300031911 Bacteria 3531
479 Ga0307412_10090826 3300031911 Bacteria 2136
480 Ga0307412_10285015 3300031911 Bacteria 1298
481 Ga0307412_10342315 3300031911 Bacteria 1197
482 Ga0307409_100247765 3300031995 Bacteria 1627
483 Ga0307416_100016290 3300032002 Bacteria 5162
484 Ga0307416_100056522 3300032002 Bacteria 3168
485 Ga0307414_10002380 3300032004 Bacteria 9831
486 Ga0307414_10021965 3300032004 Bacteria 4016
487 Ga0307414_10091886 3300032004 Bacteria 2257
488 Ga0307414_10435039 3300032004 Bacteria 1147
489 Ga0307414_10453379 3300032004 Bacteria 1125
490 Ga0307415_100312929 3300032126 Bacteria 1306
491 Ga0307415_100337619 3300032126 Bacteria 1263
492 Ga0307507_10180097 3300033179 Bacteria 1512
493 Ga0307510_10009680 3300033180 Bacteria 11472
494 Ga0395899_0000195 3300037312 Bacteria 89015
495 Ga0395899_0038388 3300037312 Bacteria 3586
496 Ga0395899_0257278 3300037312 Bacteria 1195
497 Ga0395900_0000018 3300037418 Bacteria 363472
498 Ga0395900_0000590 3300037418 Bacteria 49754
499 Ga0395900_0001671 3300037418 Bacteria 25867
500 Ga0395900_0005906 3300037418 Bacteria 12783
501 Ga0395900_0022713 3300037418 Bacteria 6420
502 Ga0395900_0038954 3300037418 Bacteria 4899
503 Ga0395898_0000213 3300037466 Bacteria 149036
504 Ga0395898_0003959 3300037466 Bacteria 16322
505 Ga0395898_0005025 3300037466 Bacteria 14348
506 Ga0395898_0008956 3300037466 Bacteria 10537
507 Ga0395901_0000280 3300038443 Bacteria 63153
508 Ga0395901_0026050 3300038443 Bacteria 6005
509 Ga0395901_0058473 3300038443 Bacteria 4009
510 Ga0395901_0196775 3300038443 Bacteria 2113
511 Ga0237819_00016 3300038705 Bacteria 57788
512 Ga0439436_0000077 3300041404 Bacteria 25168
513 Ga0439436_0008203 3300041404 Bacteria 3210
514 Ga0439465_0000644 3300041413 Bacteria 10664
515 Ga0439465_0003155 3300041413 Bacteria 5383
516 Ga0439465_0003459 3300041413 Bacteria 5147
517 Ga0439465_0003773 3300041413 Bacteria 4943
518 Ga0451789_0254233 3300041443 Bacteria 851
519 Ga0451791_1222002 3300041451 Bacteria 2535
520 Ga0451793_0691818 3300041452 Bacteria 3910
521 Ga0451793_0770297 3300041452 Bacteria 1543
522 Ga0451793_1759138 3300041452 Bacteria 2329
523 Ga0451802_0367711 3300041460 Bacteria 2556
524 Ga0451802_0598371 3300041460 Bacteria 3526
525 Ga0451807_0790658 3300041486 Bacteria 3448
526 Ga0451833_0314086 3300041491 Bacteria 1227
527 Ga0451837_0512683 3300041494 Bacteria 1569
528 Ga0451841_0863707 3300041498 Bacteria 1892
529 Ga0451849_0270298 3300041505 Bacteria 1229
530 Ga0451853_1963870 3300041512 Bacteria 910
531 Ga0451853_1972459 3300041512 Bacteria 2999
532 Ga0439431_0028946 3300041997 Bacteria 1366
533 Ga0439445_0002207 3300042004 Bacteria 4318
534 Ga0439432_001663 3300042006 Bacteria 8328
535 Ga0439432_003552 3300042006 Bacteria 5769
536 Ga0439449_0001191 3300042007 Bacteria 10211
537 Ga0439449_0002570 3300042007 Bacteria 7088
538 Ga0439449_0005497 3300042007 Bacteria 4854
539 Ga0439449_0010383 3300042007 Bacteria 3516
540 Ga0439449_0020304 3300042007 Bacteria 2489
541 Ga0439457_010121 3300042014 Bacteria 2177
542 Ga0450894_007665 3300042131 Bacteria 1393
543 Ga0439459_0004199 3300042438 Bacteria 2310
544 Ga0451577_0042692 3300042876 Bacteria 4066
545 Ga0451577_0050412 3300042876 Bacteria 3716
546 Ga0451577_0068951 3300042876 Bacteria 3154
547 Ga0466969_0008996 3300044656 Bacteria 5292
548 Ga0466969_0012302 3300044656 Bacteria 4514
549 Ga0466982_0000020 3300044672 Bacteria 99164
550 Ga0466982_0001149 3300044672 Bacteria 9250
551 Ga0466965_0018012 3300044683 Bacteria 3380
552 Ga0466965_0048771 3300044683 Bacteria 2098
553 Ga0466966_0012209 3300044684 Bacteria 5691
554 Ga0466966_0053515 3300044684 Bacteria 2560
555 Ga0466961_0000944 3300044693 Bacteria 18003
556 Ga0466961_0003373 3300044693 Bacteria 9972
557 Ga0466961_0010106 3300044693 Bacteria 6012
558 Ga0466961_0018571 3300044693 Bacteria 4475
559 Ga0466961_0067987 3300044693 Bacteria 2263
560 Ga0466963_0164429 3300044694 Bacteria 1546
561 Ga0466963_0457744 3300044694 Bacteria 900
562 Ga0466964_0016461 3300044706 Bacteria 2824
563 Ga0466971_0002694 3300044719 Bacteria 7504
564 Ga0466968_0001238 3300044735 Bacteria 9064
565 Ga0466968_0007195 3300044735 Bacteria 4228
566 Ga0466968_0045493 3300044735 Bacteria 1863
567 Ga0466970_0010599 3300044765 Bacteria 4681
568 Ga0466970_0012342 3300044765 Bacteria 4366
569 Ga0466957_0005144 3300044842 Bacteria 7312
570 Ga0466960_0036956 3300044901 Bacteria 2289
571 Ga0466959_0004692 3300045049 Bacteria 9203
572 Ga0466959_0007758 3300045049 Bacteria 7548
573 Ga0466959_0032260 3300045049 Bacteria 3877
574 Ga0466958_0007344 3300045836 Bacteria 6054
575 Ga0466958_0016157 3300045836 Bacteria 4294
576 Ga0466967_0060040 3300045976 Bacteria 3368
577 Ga0466967_0086091 3300045976 Bacteria 2847
578 Ga0466967_0823244 3300045976 Bacteria 922
579 Ga0495617_000117 3300046452 Bacteria 54105
580 Ga0495617_000581 3300046452 Bacteria 18687
581 Ga0495590_0076070 3300046457 Bacteria 1181
582 Ga0495638_0000063 3300046460 Bacteria 185733
583 Ga0495638_0002410 3300046460 Bacteria 15282
584 Ga0495638_0013756 3300046460 Bacteria 5495
585 Ga0495638_0017459 3300046460 Bacteria 4781
586 Ga0495638_0054786 3300046460 Bacteria 2478
587 Ga0495638_0063767 3300046460 Bacteria 2271
588 Ga0495638_0069762 3300046460 Bacteria 2153
589 Ga0495650_0000875 3300046471 Bacteria 35798
590 Ga0495650_0002180 3300046471 Bacteria 16561
591 Ga0495650_0004550 3300046471 Bacteria 9466
592 Ga0495650_0019238 3300046471 Bacteria 3371
593 Ga0495585_0002200 3300046492 Bacteria 14164
594 Ga0495585_0003818 3300046492 Bacteria 10037
595 Ga0495607_0000122 3300046501 Bacteria 81489
596 Ga0495607_0000837 3300046501 Bacteria 29060
597 Ga0495607_0005180 3300046501 Bacteria 9398
598 Ga0495607_0014544 3300046501 Bacteria 5117
599 Ga0495583_0038301 3300046506 Bacteria 2265
600 Ga0495606_0000298 3300046507 Bacteria 85739
601 Ga0495606_0002450 3300046507 Bacteria 21555
602 Ga0495606_0006272 3300046507 Bacteria 11028
603 Ga0495606_0009016 3300046507 Bacteria 8526
604 Ga0495606_0018751 3300046507 Bacteria 5175
605 Ga0495610_0054923 3300046512 Bacteria 1922
606 Ga0495616_0000565 3300046513 Bacteria 28011
607 Ga0495620_0003610 3300046515 Bacteria 8838
608 Ga0495620_0007544 3300046515 Bacteria 5899
609 Ga0495631_0000808 3300046518 Bacteria 19998
610 Ga0495631_0001788 3300046518 Bacteria 12750
611 Ga0495632_0000004 3300046519 Bacteria 381372
612 Ga0495632_0015386 3300046519 Bacteria 4293
613 Ga0495632_0033993 3300046519 Bacteria 2612
614 Ga0495632_0192441 3300046519 Bacteria 931
615 Ga0495637_0003747 3300046520 Bacteria 8024
616 Ga0495643_0061790 3300046522 Bacteria 1985
617 Ga0495648_0002534 3300046524 Bacteria 16751
618 Ga0495648_0004865 3300046524 Bacteria 11320
619 Ga0495663_0008055 3300046525 Bacteria 2916
620 Ga0495663_0034095 3300046525 Bacteria 1522
621 Ga0495654_0064899 3300046530 Bacteria 1744
622 Ga0495609_0003075 3300046538 Bacteria 9784
623 Ga0495621_0117367 3300046539 Bacteria 1026
624 Ga0495597_0109933 3300046542 Bacteria 1156
625 Ga0495633_0009864 3300046558 Bacteria 5247
626 Ga0495656_0032319 3300046615 Bacteria 2128
627 Ga0495668_0003466 3300046616 Bacteria 11779
628 Ga0495611_0000001 3300046648 Bacteria 2628469
629 Ga0495611_0000952 3300046648 Bacteria 15498
630 Ga0495625_0000022 3300046660 Bacteria 278823
631 Ga0495625_0017937 3300046660 Bacteria 5532
632 Ga0495625_0018982 3300046660 Bacteria 5350
633 Ga0495625_0057378 3300046660 Bacteria 2769
634 Ga0495625_0101758 3300046660 Bacteria 1973
635 Ga0495659_0018325 3300046664 Bacteria 2332
636 Ga0495661_0006772 3300046665 Bacteria 8034
637 Ga0495588_0092605 3300046674 Bacteria 1584
638 Ga0495670_0005343 3300046691 Bacteria 6318
639 Ga0495670_0021443 3300046691 Bacteria 3186
640 Ga0495671_0002998 3300046692 Bacteria 10490
641 Ga0495671_0019429 3300046692 Bacteria 3592
642 Ga0495649_0008433 3300046694 Bacteria 6202
643 Ga0495649_0032443 3300046694 Bacteria 2876
644 Ga0495589_0000137 3300046794 Bacteria 67614
645 Ga0495660_0000728 3300046810 Bacteria 25032
646 Ga0495660_0001915 3300046810 Bacteria 13593
647 Ga0495636_0039933 3300047318 Bacteria 1944
648 Ga0495672_0013666 3300047320 Bacteria 5589
649 Ga0495683_0001586 3300047323 Bacteria 14650
650 Ga0495679_000004 3300047446 Bacteria 748056
651 Ga0495685_032761 3300047447 Bacteria 1786
652 Ga0495673_0000202 3300047469 Bacteria 90523
653 Ga0495673_0000749 3300047469 Bacteria 30861
654 Ga0495673_0003957 3300047469 Bacteria 9490
655 Ga0495686_0000017 3300047472 Bacteria 435554
656 Ga0495686_0007599 3300047472 Bacteria 8096
657 Ga0495686_0012978 3300047472 Bacteria 5804
658 Ga0495686_0026186 3300047472 Bacteria 3816
659 Ga0495686_0046373 3300047472 Bacteria 2747
660 Ga0496101_0084988 3300048904 Bacteria 2344
661 Ga0496102_0091951 3300048905 Bacteria 2809
662 Ga0496102_0143100 3300048905 Bacteria 2243
663 Ga0496103_0399812 3300048906 Bacteria 882
664 Ga0496104_0255592 3300048907 Bacteria 1665
665 Ga0496104_0484599 3300048907 Bacteria 1148
666 Ga0496105_0042121 3300048908 Bacteria 3764
667 Ga0496106_0001864 3300048909 Bacteria 15779
668 Ga0496107_0108163 3300048910 Bacteria 2042
669 Ga0496108_0375265 3300048911 Bacteria 1242
670 Ga0496113_0007102 3300048916 Bacteria 7168
671 Ga0496113_0141683 3300048916 Bacteria 1892
672 Ga0496115_0000024 3300048918 Bacteria 154488
673 Ga0496115_0024172 3300048918 Bacteria 4720
674 Ga0496115_0076325 3300048918 Bacteria 2723
675 Ga0496116_0079572 3300048919 Bacteria 2039
676 Ga0496117_0029620 3300048920 Bacteria 4217
677 Ga0496117_0071799 3300048920 Bacteria 2318
678 Ga0496117_0081132 3300048920 Bacteria 2130
679 Ga0496118_0000177 3300048921 Bacteria 114183
680 Ga0496118_0002418 3300048921 Bacteria 25175
681 Ga0496118_0002476 3300048921 Bacteria 24790
682 Ga0496118_0004210 3300048921 Bacteria 17288
683 Ga0496118_0004740 3300048921 Bacteria 15919
684 Ga0496118_0027688 3300048921 Bacteria 4789
685 Ga0496118_0110082 3300048921 Bacteria 1831
686 Ga0496118_0127683 3300048921 Bacteria 1640
687 Ga0496118_0304649 3300048921 Bacteria 873
688 Ga0496119_0001058 3300048922 Bacteria 35115
689 Ga0496119_0011077 3300048922 Bacteria 7511
690 Ga0496119_0191123 3300048922 Bacteria 1067
691 Ga0496120_0002531 3300048923 Bacteria 18257
692 Ga0496120_0005836 3300048923 Bacteria 9633
693 Ga0496121_0000045 3300048924 Bacteria 336130
694 Ga0496121_0002752 3300048924 Bacteria 26142
695 Ga0496121_0006364 3300048924 Bacteria 14713
696 Ga0496121_0007030 3300048924 Bacteria 13667
697 Ga0496121_0028511 3300048924 Bacteria 5194
698 Ga0496121_0098342 3300048924 Bacteria 2265
699 Ga0496121_0116490 3300048924 Bacteria 2026
700 Ga0496122_0000463 3300048925 Bacteria 84540
701 Ga0496122_0025121 3300048925 Bacteria 5189
702 Ga0496122_0125885 3300048925 Bacteria 1640
703 Ga0496122_0178467 3300048925 Bacteria 1270
704 Ga0496123_0000151 3300048926 Bacteria 141062
705 Ga0496123_0000296 3300048926 Bacteria 97428
706 Ga0496123_0007960 3300048926 Bacteria 9833
707 Ga0496123_0010916 3300048926 Bacteria 7950
708 Ga0496123_0040635 3300048926 Bacteria 3235
709 Ga0496123_0045771 3300048926 Bacteria 2976
710 Ga0496123_0061677 3300048926 Bacteria 2407
711 Ga0496124_0000482 3300048927 Bacteria 68586
712 Ga0496124_0002985 3300048927 Bacteria 21170
713 Ga0496124_0003150 3300048927 Bacteria 20397
714 Ga0496125_0000344 3300048928 Bacteria 88380
715 Ga0496125_0028954 3300048928 Bacteria 4989
716 Ga0496125_0039288 3300048928 Bacteria 4078
717 Ga0496126_0000581 3300048929 Bacteria 69541
718 Ga0496126_0013162 3300048929 Bacteria 8438
719 Ga0496126_0015164 3300048929 Bacteria 7761
720 Ga0496126_0175956 3300048929 Bacteria 1820
721 Ga0496126_0190285 3300048929 Bacteria 1738
722 Ga0495678_000099 3300049459 Bacteria 106223
723 Ga0495682_0006476 3300049460 Bacteria 4730
724 Ga0501031_0078488 3300049568 Bacteria 2151
725 Ga0501031_0086544 3300049568 Bacteria 2043
726 Ga0501032_0002234 3300049569 Bacteria 15250
727 Ga0501032_0006980 3300049569 Bacteria 8280
728 Ga0501032_0205933 3300049569 Bacteria 1283
729 Ga0501033_0008723 3300049570 Bacteria 7840
730 Ga0501033_0013188 3300049570 Bacteria 6296
731 Ga0501033_0015054 3300049570 Bacteria 5868
732 Ga0501033_0032082 3300049570 Bacteria 3943
733 Ga0501033_0124633 3300049570 Bacteria 1868
734 Ga0501033_0445824 3300049570 Bacteria 899
735 Ga0501034_0000749 3300049571 Bacteria 49004
736 Ga0501034_0005361 3300049571 Bacteria 14039
737 Ga0501034_0009045 3300049571 Bacteria 10460
738 Ga0501034_0055709 3300049571 Bacteria 3978
739 Ga0501034_0114586 3300049571 Bacteria 2684
740 Ga0501034_0240968 3300049571 Bacteria 1754
741 Ga0501034_0605973 3300049571 Bacteria 1000
742 Ga0501036_0019205 3300049572 Bacteria 5734
743 Ga0501036_0100147 3300049572 Bacteria 2451
744 Ga0501036_0174120 3300049572 Bacteria 1812
745 Ga0501037_0000499 3300049573 Bacteria 31684
746 Ga0501037_0022489 3300049573 Bacteria 4664
747 Ga0501037_0045944 3300049573 Bacteria 3204
748 Ga0501037_0049817 3300049573 Bacteria 3066
749 Ga0501038_0003315 3300049574 Bacteria 15016
750 Ga0501038_0020720 3300049574 Bacteria 5909
751 Ga0501039_0002265 3300049575 Bacteria 14289
752 Ga0501039_0052503 3300049575 Bacteria 3154
753 Ga0501039_0065333 3300049575 Bacteria 2822
754 Ga0501042_0158396 3300049578 Bacteria 1633
755 Ga0501043_0002627 3300049579 Bacteria 15124
756 Ga0501043_0012216 3300049579 Bacteria 6713
757 Ga0501043_0014452 3300049579 Bacteria 6179
758 Ga0501043_0056868 3300049579 Bacteria 3072
759 Ga0501043_0112224 3300049579 Bacteria 2140
760 Ga0501043_0211475 3300049579 Bacteria 1503
761 Ga0501046_0003027 3300049580 Bacteria 15530
762 Ga0501046_0038819 3300049580 Bacteria 3819
763 Ga0501046_0043282 3300049580 Bacteria 3585
764 Ga0501047_0018151 3300049581 Bacteria 6741
765 Ga0501047_0038405 3300049581 Bacteria 4633
766 Ga0501047_0043428 3300049581 Bacteria 4342
767 Ga0501047_0056354 3300049581 Bacteria 3800
768 Ga0501047_0066314 3300049581 Bacteria 3479
769 Ga0501048_0048236 3300049582 Bacteria 3038
770 Ga0501067_0253724 3300049583 Bacteria 979
771 Ga0501070_0008013 3300049586 Bacteria 8945
772 Ga0501070_0020130 3300049586 Bacteria 5597
773 Ga0501070_0049330 3300049586 Bacteria 3496
774 Ga0501070_0246544 3300049586 Bacteria 1462
775 Ga0501073_0050433 3300049589 Bacteria 2916
776 Ga0501073_0103846 3300049589 Bacteria 1973
777 Ga0501077_0185606 3300049593 Bacteria 1321
778 Ga0501202_021695 3300049652 Bacteria 1285
779 Ga0501252_007166 3300049682 Bacteria 1257
780 Ga0501225_0004823 3300049705 Bacteria 3988
781 Ga0501079_0096867 3300049741 Bacteria 2287
782 Ga0501080_0031544 3300049742 Bacteria 4937
783 Ga0501080_0033050 3300049742 Bacteria 4827
784 Ga0501080_0089212 3300049742 Bacteria 2864
785 Ga0501080_0104868 3300049742 Bacteria 2621
786 Ga0501275_000227 3300049772 Bacteria 6573
787 Ga0501035_0004851 3300049822 Bacteria 12751
788 Ga0501035_0011534 3300049822 Bacteria 8189
789 Ga0501035_0015245 3300049822 Bacteria 7093
790 Ga0501035_0017817 3300049822 Bacteria 6551
791 Ga0501035_0029374 3300049822 Bacteria 5013
792 Ga0501035_0044167 3300049822 Bacteria 4013
793 Ga0501035_0124664 3300049822 Bacteria 2249
794 Ga0501035_0226568 3300049822 Bacteria 1594
795 Ga0501035_0325564 3300049822 Bacteria 1290
796 Ga0501044_0024669 3300049823 Bacteria 6379
797 Ga0501044_0070459 3300049823 Bacteria 3556
798 Ga0501044_0073227 3300049823 Bacteria 3482
799 Ga0501044_0105390 3300049823 Bacteria 2832
800 Ga0501044_0130531 3300049823 Bacteria 2507
801 Ga0501044_0282966 3300049823 Bacteria 1591
802 Ga0501044_0290150 3300049823 Bacteria 1567
803 Ga0501044_0404938 3300049823 Bacteria 1276
804 Ga0501044_0701654 3300049823 Bacteria 897
805 nmdc:mga00v17_118_c1 3300050491 Bacteria 46536
806 nmdc:mga00v17_7454_c1 3300050491 Bacteria 5840
807 nmdc:mga08y16_283513_c1 3300050511 Bacteria 1708
808 Ga0500643_011271 3300053087 Bacteria 3270
809 Ga0500651_0168738 3300053093 Bacteria 1306
810 Ga0500555_000715 3300053103 Bacteria 12482
811 Ga0500597_000335 3300053120 Bacteria 9709
812 Ga0500627_0176433 3300053158 Bacteria 962
813 Ga0500633_0002326 3300053160 Bacteria 3884
814 Ga0500634_0000146 3300053161 Bacteria 25568
815 Ga0466962_0001160 3300061719 Bacteria 12149
816 Ga0466962_0003497 3300061719 Bacteria 7485
817 Ga0466962_0005665 3300061719 Bacteria 6003

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10096161 Ga0207678_100961612 244
2 3300049742 Ga0501080_0089212 Ga0501080_0089212_1325_2152 254
3 iso_pu_bacteria 2524614729 2525556979 254
4 iso_pu_bacteria 2571042365 2572256232 254
5 iso_pu_bacteria 2627854209 2630648575 254
6 iso_pu_bacteria 2747842501 2748015624 254
7 iso_pu_bacteria 2842780639 2842783622 254
8 iso_pu_bacteria 2895498888 2895499342 254
9 iso_pu_bacteria 2895511927 2895512363 254
10 iso_pu_bacteria 2895522137 2895522375 254
11 iso_pu_bacteria 2895525241 2895527185 254
12 iso_pu_bacteria 2987605356 2987605915 254
13 iso_pu_bacteria 8002869464 8002871572 254
14 3300009094 Ga0111539_10366310 Ga0111539_103663102 255
15 3300013307 Ga0157372_10084957 Ga0157372_100849574 255
16 3300050511 nmdc:mga08y16_283513_c1 nmdc:mga08y16_283513_c1_724_1491 255
17 iso_pu_bacteria 2687453130 2687582919 255
18 iso_pu_bacteria 2818991440 2819563590 255
19 iso_pu_bacteria 2894414249 2894416279 255
20 iso_pu_bacteria 2904463128 2904464099 255
21 iso_pu_bacteria 2593339238 2595446705 256
22 iso_pu_bacteria 2593339239 2595451795 256
23 iso_pu_bacteria 2718218334 2721026648 256
24 iso_pu_bacteria 2734482264 2735833360 256
25 iso_pu_bacteria 2734482264 2735837806 256
26 iso_pu_bacteria 2738543009 2739228400 256
27 iso_pu_bacteria 2842914999 2842917902 256
28 iso_pu_bacteria 2842918807 2842919738 256
29 iso_pu_bacteria 2884338543 2884341354 256
30 iso_pu_bacteria 2919085039 2919087624 256
31 iso_pu_bacteria 2919404418 2919404881 256
32 iso_pu_bacteria 2941471342 2941472811 256
33 iso_pu_bacteria 2953994433 2953995040 256
34 3300005547 Ga0070693_100027552 Ga0070693_1000275524 257
35 3300025913 Ga0207695_10006761 Ga0207695_100067616 257
36 3300031731 Ga0307405_10230407 Ga0307405_102304071 257
37 3300031824 Ga0307413_10113898 Ga0307413_101138982 257
38 3300031852 Ga0307410_10119478 Ga0307410_101194782 257
39 3300031901 Ga0307406_10072175 Ga0307406_100721753 257
40 3300032004 Ga0307414_10435039 Ga0307414_104350392 257
41 3300042876 Ga0451577_0050412 Ga0451577_0050412_1699_2475 257
42 3300046674 Ga0495588_0092605 Ga0495588_0092605_125_904 257
43 3300048904 Ga0496101_0084988 Ga0496101_0084988_713_1489 257
44 3300048910 Ga0496107_0108163 Ga0496107_0108163_729_1505 257
45 3300048924 Ga0496121_0116490 Ga0496121_0116490_685_1461 257
46 3300048929 Ga0496126_0000581 Ga0496126_0000581_59835_60611 257
47 3300005327 Ga0070658_10015687 Ga0070658_100156877 258
48 3300005327 Ga0070658_10373898 Ga0070658_103738982 258
49 3300005335 Ga0070666_10000003 Ga0070666_10000003285 258
50 3300005335 Ga0070666_10002096 Ga0070666_100020969 258
51 3300005367 Ga0070667_100000005 Ga0070667_10000000592 258
52 3300005367 Ga0070667_100034571 Ga0070667_1000345715 258
53 3300005367 Ga0070667_100058101 Ga0070667_1000581011 258
54 3300005367 Ga0070667_100185170 Ga0070667_1001851701 258
55 3300005455 Ga0070663_100023182 Ga0070663_1000231826 258
56 3300005455 Ga0070663_100328498 Ga0070663_1003284982 258
57 3300005457 Ga0070662_100021135 Ga0070662_1000211352 258
58 3300005458 Ga0070681_10020895 Ga0070681_100208952 258
59 3300005530 Ga0070679_100137444 Ga0070679_1001374442 258
60 3300005530 Ga0070679_100245710 Ga0070679_1002457102 258
61 3300005539 Ga0068853_100003367 Ga0068853_10000336711 258
62 3300005539 Ga0068853_100023295 Ga0068853_1000232956 258
63 3300005539 Ga0068853_100034276 Ga0068853_1000342766 258
64 3300005539 Ga0068853_100119273 Ga0068853_1001192732 258
65 3300005539 Ga0068853_100138784 Ga0068853_1001387842 258
66 3300005543 Ga0070672_100011903 Ga0070672_1000119038 258
67 3300005547 Ga0070693_100102808 Ga0070693_1001028081 258
68 3300005548 Ga0070665_100001267 Ga0070665_10000126711 258
69 3300005548 Ga0070665_100011880 Ga0070665_1000118808 258
70 3300005548 Ga0070665_100059354 Ga0070665_1000593544 258
71 3300005548 Ga0070665_100235902 Ga0070665_1002359022 258
72 3300005563 Ga0068855_100024470 Ga0068855_1000244709 258
73 3300005563 Ga0068855_100037052 Ga0068855_1000370523 258
74 3300005563 Ga0068855_100108560 Ga0068855_1001085604 258
75 3300005563 Ga0068855_100571763 Ga0068855_1005717631 258
76 3300005563 Ga0068855_100843017 Ga0068855_1008430171 258
77 3300005564 Ga0070664_100213877 Ga0070664_1002138772 258
78 3300005577 Ga0068857_100104071 Ga0068857_1001040714 258
79 3300005577 Ga0068857_100201643 Ga0068857_1002016432 258
80 3300005614 Ga0068856_100033308 Ga0068856_1000333083 258
81 3300005614 Ga0068856_100309468 Ga0068856_1003094681 258
82 3300005616 Ga0068852_100010889 Ga0068852_10001088910 258
83 3300005616 Ga0068852_100024583 Ga0068852_1000245834 258
84 3300005616 Ga0068852_100040375 Ga0068852_1000403752 258
85 3300005616 Ga0068852_100347198 Ga0068852_1003471982 258
86 3300005616 Ga0068852_100477872 Ga0068852_1004778721 258
87 3300005617 Ga0068859_100000265 Ga0068859_10000026520 258
88 3300005834 Ga0068851_10002041 Ga0068851_100020414 258
89 3300005834 Ga0068851_10135254 Ga0068851_101352541 258
90 3300005841 Ga0068863_100020907 Ga0068863_1000209075 258
91 3300005841 Ga0068863_100185119 Ga0068863_1001851192 258
92 3300005842 Ga0068858_100003531 Ga0068858_1000035312 258
93 3300005842 Ga0068858_100115545 Ga0068858_1001155452 258
94 3300005844 Ga0068862_100005271 Ga0068862_10000527111 258
95 3300005983 Ga0081540_1072453 Ga0081540_10724532 258
96 3300006051 Ga0075364_10000356 Ga0075364_1000035612 258
97 3300006237 Ga0097621_100079578 Ga0097621_1000795783 258
98 3300006931 Ga0097620_100000265 Ga0097620_10000026520 258
99 3300009093 Ga0105240_10002519 Ga0105240_100025194 258
100 3300009093 Ga0105240_10013886 Ga0105240_100138862 258
101 3300009093 Ga0105240_10176224 Ga0105240_101762244 258
102 3300009098 Ga0105245_10357427 Ga0105245_103574272 258
103 3300009101 Ga0105247_10069693 Ga0105247_100696932 258
104 3300009174 Ga0105241_10030187 Ga0105241_100301872 258
105 3300009174 Ga0105241_10229887 Ga0105241_102298872 258
106 3300009177 Ga0105248_10002061 Ga0105248_1000206114 258
107 3300009177 Ga0105248_10284267 Ga0105248_102842672 258
108 3300009545 Ga0105237_10004780 Ga0105237_1000478011 258
109 3300009545 Ga0105237_10021360 Ga0105237_100213603 258
110 3300009545 Ga0105237_10300160 Ga0105237_103001601 258
111 3300009545 Ga0105237_10442954 Ga0105237_104429542 258
112 3300009551 Ga0105238_10001867 Ga0105238_100018678 258
113 3300009551 Ga0105238_10007377 Ga0105238_100073776 258
114 3300009551 Ga0105238_10015192 Ga0105238_100151926 258
115 3300009553 Ga0105249_10005661 Ga0105249_100056616 258
116 3300009553 Ga0105249_10020935 Ga0105249_100209354 258
117 3300010375 Ga0105239_10010293 Ga0105239_100102939 258
118 3300010375 Ga0105239_10023401 Ga0105239_100234012 258
119 3300010375 Ga0105239_10038519 Ga0105239_100385193 258
120 3300010375 Ga0105239_10046624 Ga0105239_100466244 258
121 3300010375 Ga0105239_10112342 Ga0105239_101123423 258
122 3300010375 Ga0105239_10335425 Ga0105239_103354252 258
123 3300010375 Ga0105239_11045843 Ga0105239_110458431 258
124 3300013105 Ga0157369_10063246 Ga0157369_100632464 258
125 3300013105 Ga0157369_10112543 Ga0157369_101125432 258
126 3300013296 Ga0157374_10057130 Ga0157374_100571302 258
127 3300013296 Ga0157374_10068936 Ga0157374_100689364 258
128 3300013297 Ga0157378_10000043 Ga0157378_1000004368 258
129 3300013297 Ga0157378_10034449 Ga0157378_100344494 258
130 3300013297 Ga0157378_10186933 Ga0157378_101869333 258
131 3300013306 Ga0163162_10000015 Ga0163162_10000015136 258
132 3300013306 Ga0163162_10000236 Ga0163162_100002368 258
133 3300013307 Ga0157372_10031403 Ga0157372_100314036 258
134 3300013308 Ga0157375_10013746 Ga0157375_100137463 258
135 3300014969 Ga0157376_10062563 Ga0157376_100625634 258
136 3300014969 Ga0157376_10127877 Ga0157376_101278772 258
137 3300015261 Ga0182006_1020561 Ga0182006_10205612 258
138 3300017792 Ga0163161_10213193 Ga0163161_102131931 258
139 3300025261 Ga0209233_1017293 Ga0209233_10172932 258
140 3300025321 Ga0207656_10000309 Ga0207656_100003094 258
141 3300025903 Ga0207680_10000006 Ga0207680_10000006432 258
142 3300025903 Ga0207680_10001037 Ga0207680_100010374 258
143 3300025903 Ga0207680_10008585 Ga0207680_100085852 258
144 3300025903 Ga0207680_10093654 Ga0207680_100936542 258
145 3300025904 Ga0207647_10000155 Ga0207647_1000015521 258
146 3300025909 Ga0207705_10062307 Ga0207705_100623073 258
147 3300025911 Ga0207654_10178101 Ga0207654_101781012 258
148 3300025913 Ga0207695_10000032 Ga0207695_1000003225 258
149 3300025913 Ga0207695_10005772 Ga0207695_1000577210 258
150 3300025913 Ga0207695_10055081 Ga0207695_100550814 258
151 3300025913 Ga0207695_10114719 Ga0207695_101147192 258
152 3300025914 Ga0207671_10022957 Ga0207671_100229573 258
153 3300025914 Ga0207671_10030938 Ga0207671_100309382 258
154 3300025914 Ga0207671_10032193 Ga0207671_100321933 258
155 3300025921 Ga0207652_10053325 Ga0207652_100533254 258
156 3300025921 Ga0207652_10116077 Ga0207652_101160772 258
157 3300025924 Ga0207694_10001181 Ga0207694_1000118110 258
158 3300025924 Ga0207694_10008048 Ga0207694_100080487 258
159 3300025924 Ga0207694_10008628 Ga0207694_100086282 258
160 3300025933 Ga0207706_10007442 Ga0207706_100074422 258
161 3300025940 Ga0207691_10032993 Ga0207691_100329936 258
162 3300025941 Ga0207711_10000470 Ga0207711_1000047012 258
163 3300025942 Ga0207689_10100393 Ga0207689_101003931 258
164 3300025942 Ga0207689_10396646 Ga0207689_103966461 258
165 3300025942 Ga0207689_10550233 Ga0207689_105502331 258
166 3300025945 Ga0207679_10112227 Ga0207679_101122272 258
167 3300025949 Ga0207667_10148214 Ga0207667_101482142 258
168 3300025949 Ga0207667_10296209 Ga0207667_102962092 258
169 3300025949 Ga0207667_10403195 Ga0207667_104031951 258
170 3300025961 Ga0207712_10000771 Ga0207712_1000077121 258
171 3300025961 Ga0207712_10002780 Ga0207712_100027807 258
172 3300025961 Ga0207712_10128718 Ga0207712_101287183 258
173 3300025986 Ga0207658_10000006 Ga0207658_10000006280 258
174 3300025986 Ga0207658_10008000 Ga0207658_100080003 258
175 3300025986 Ga0207658_10416062 Ga0207658_104160621 258
176 3300026035 Ga0207703_10001094 Ga0207703_1000109411 258
177 3300026035 Ga0207703_10083079 Ga0207703_100830792 258
178 3300026041 Ga0207639_10001632 Ga0207639_1000163214 258
179 3300026041 Ga0207639_10002290 Ga0207639_100022903 258
180 3300026041 Ga0207639_10006988 Ga0207639_100069882 258
181 3300026041 Ga0207639_10008722 Ga0207639_100087226 258
182 3300026041 Ga0207639_10036600 Ga0207639_100366004 258
183 3300026041 Ga0207639_10168545 Ga0207639_101685452 258
184 3300026067 Ga0207678_10001340 Ga0207678_1000134018 258
185 3300026067 Ga0207678_10017061 Ga0207678_100170613 258
186 3300026067 Ga0207678_10375238 Ga0207678_103752382 258
187 3300026067 Ga0207678_10554348 Ga0207678_105543481 258
188 3300026078 Ga0207702_10005747 Ga0207702_100057479 258
189 3300026078 Ga0207702_10041945 Ga0207702_100419452 258
190 3300026088 Ga0207641_10081865 Ga0207641_100818654 258
191 3300026088 Ga0207641_10124845 Ga0207641_101248454 258
192 3300026088 Ga0207641_10449179 Ga0207641_104491792 258
193 3300026116 Ga0207674_10017518 Ga0207674_100175188 258
194 3300026142 Ga0207698_10008023 Ga0207698_100080234 258
195 3300026142 Ga0207698_10015318 Ga0207698_100153182 258
196 3300026142 Ga0207698_10022708 Ga0207698_100227081 258
197 3300026142 Ga0207698_10063010 Ga0207698_100630102 258
198 3300028379 Ga0268266_10000013 Ga0268266_10000013188 258
199 3300028379 Ga0268266_10000021 Ga0268266_10000021386 258
200 3300028379 Ga0268266_10054785 Ga0268266_100547854 258
201 3300028379 Ga0268266_10156488 Ga0268266_101564882 258
202 3300028380 Ga0268265_10003764 Ga0268265_1000376411 258
203 3300030731 Ga0316177_1132861 Ga0316177_11328612 258
204 3300030733 Ga0314311_1204266 Ga0314311_12042664 258
205 3300030736 Ga0316180_1077455 Ga0316180_10774552 258
206 3300031456 Ga0307513_10147202 Ga0307513_101472023 258
207 3300031548 Ga0307408_100202443 Ga0307408_1002024432 258
208 3300031548 Ga0307408_100617295 Ga0307408_1006172951 258
209 3300031616 Ga0307508_10221850 Ga0307508_102218502 258
210 3300031730 Ga0307516_10027810 Ga0307516_100278103 258
211 3300031730 Ga0307516_10041474 Ga0307516_100414744 258
212 3300031824 Ga0307413_10163139 Ga0307413_101631392 258
213 3300031824 Ga0307413_10237906 Ga0307413_102379061 258
214 3300031901 Ga0307406_10250419 Ga0307406_102504191 258
215 3300031911 Ga0307412_10090826 Ga0307412_100908263 258
216 3300031911 Ga0307412_10285015 Ga0307412_102850152 258
217 3300031911 Ga0307412_10342315 Ga0307412_103423152 258
218 3300031995 Ga0307409_100247765 Ga0307409_1002477652 258
219 3300032002 Ga0307416_100016290 Ga0307416_1000162904 258
220 3300032002 Ga0307416_100056522 Ga0307416_1000565224 258
221 3300032004 Ga0307414_10002380 Ga0307414_100023809 258
222 3300032004 Ga0307414_10091886 Ga0307414_100918862 258
223 3300032126 Ga0307415_100312929 Ga0307415_1003129292 258
224 3300032126 Ga0307415_100337619 Ga0307415_1003376192 258
225 3300033179 Ga0307507_10180097 Ga0307507_101800972 258
226 3300033180 Ga0307510_10009680 Ga0307510_1000968016 258
227 3300038705 Ga0237819_00016 Ga0237819_00016_33109_33900 258
228 3300041413 Ga0439465_0003459 Ga0439465_0003459_4032_4811 258
229 3300041413 Ga0439465_0003773 Ga0439465_0003773_3844_4623 258
230 3300041443 Ga0451789_0254233 Ga0451789_0254233_52_831 258
231 3300041451 Ga0451791_1222002 Ga0451791_1222002_1540_2319 258
232 3300041452 Ga0451793_0770297 Ga0451793_0770297_475_1254 258
233 3300041452 Ga0451793_1759138 Ga0451793_1759138_772_1548 258
234 3300041460 Ga0451802_0367711 Ga0451802_0367711_1371_2150 258
235 3300041460 Ga0451802_0598371 Ga0451802_0598371_897_1673 258
236 3300041486 Ga0451807_0790658 Ga0451807_0790658_1236_2015 258
237 3300041491 Ga0451833_0314086 Ga0451833_0314086_347_1123 258
238 3300041494 Ga0451837_0512683 Ga0451837_0512683_275_1054 258
239 3300041498 Ga0451841_0863707 Ga0451841_0863707_393_1172 258
240 3300041505 Ga0451849_0270298 Ga0451849_0270298_318_1094 258
241 3300041512 Ga0451853_1963870 Ga0451853_1963870_46_876 258
242 3300041512 Ga0451853_1972459 Ga0451853_1972459_1614_2390 258
243 3300041997 Ga0439431_0028946 Ga0439431_0028946_488_1267 258
244 3300042004 Ga0439445_0002207 Ga0439445_0002207_3320_4099 258
245 3300042006 Ga0439432_001663 Ga0439432_001663_4113_4892 258
246 3300042006 Ga0439432_003552 Ga0439432_003552_3464_4243 258
247 3300042007 Ga0439449_0001191 Ga0439449_0001191_3714_4493 258
248 3300042007 Ga0439449_0002570 Ga0439449_0002570_4213_5127 258
249 3300042007 Ga0439449_0010383 Ga0439449_0010383_969_1748 258
250 3300042014 Ga0439457_010121 Ga0439457_010121_586_1365 258
251 3300042876 Ga0451577_0042692 Ga0451577_0042692_708_1508 258
252 3300042876 Ga0451577_0068951 Ga0451577_0068951_783_1559 258
253 3300045976 Ga0466967_0823244 Ga0466967_0823244_20_799 258
254 3300046460 Ga0495638_0054786 Ga0495638_0054786_137_916 258
255 3300046471 Ga0495650_0000875 Ga0495650_0000875_8079_8861 258
256 3300046501 Ga0495607_0014544 Ga0495607_0014544_4235_5104 258
257 3300046507 Ga0495606_0009016 Ga0495606_0009016_3322_4191 258
258 3300046525 Ga0495663_0008055 Ga0495663_0008055_2113_2892 258
259 3300046525 Ga0495663_0034095 Ga0495663_0034095_125_904 258
260 3300046530 Ga0495654_0064899 Ga0495654_0064899_618_1397 258
261 3300046539 Ga0495621_0117367 Ga0495621_0117367_155_934 258
262 3300046558 Ga0495633_0009864 Ga0495633_0009864_2886_3665 258
263 3300046615 Ga0495656_0032319 Ga0495656_0032319_1282_2061 258
264 3300046660 Ga0495625_0057378 Ga0495625_0057378_232_1014 258
265 3300046660 Ga0495625_0101758 Ga0495625_0101758_598_1377 258
266 3300046664 Ga0495659_0018325 Ga0495659_0018325_478_1257 258
267 3300046692 Ga0495671_0019429 Ga0495671_0019429_2366_3145 258
268 3300047318 Ga0495636_0039933 Ga0495636_0039933_787_1566 258
269 3300047320 Ga0495672_0013666 Ga0495672_0013666_1543_2322 258
270 3300047447 Ga0495685_032761 Ga0495685_032761_866_1645 258
271 3300047472 Ga0495686_0007599 Ga0495686_0007599_2771_3547 258
272 3300048905 Ga0496102_0091951 Ga0496102_0091951_1955_2731 258
273 3300048906 Ga0496103_0399812 Ga0496103_0399812_47_823 258
274 3300048920 Ga0496117_0029620 Ga0496117_0029620_729_1505 258
275 3300048921 Ga0496118_0000177 Ga0496118_0000177_5367_6143 258
276 3300048921 Ga0496118_0004210 Ga0496118_0004210_6400_7176 258
277 3300048921 Ga0496118_0027688 Ga0496118_0027688_2782_3609 258
278 3300048921 Ga0496118_0110082 Ga0496118_0110082_700_1482 258
279 3300048921 Ga0496118_0127683 Ga0496118_0127683_642_1418 258
280 3300048922 Ga0496119_0191123 Ga0496119_0191123_238_1020 258
281 3300048924 Ga0496121_0028511 Ga0496121_0028511_1209_1991 258
282 3300048924 Ga0496121_0098342 Ga0496121_0098342_1439_2215 258
283 3300048925 Ga0496122_0000463 Ga0496122_0000463_2693_3469 258
284 3300048926 Ga0496123_0000151 Ga0496123_0000151_136081_136860 258
285 3300048926 Ga0496123_0000296 Ga0496123_0000296_55709_56485 258
286 3300048926 Ga0496123_0007960 Ga0496123_0007960_2151_2930 258
287 3300048927 Ga0496124_0003150 Ga0496124_0003150_15309_16166 258
288 3300048928 Ga0496125_0028954 Ga0496125_0028954_1166_1948 258
289 3300048929 Ga0496126_0013162 Ga0496126_0013162_1894_2673 258
290 3300049569 Ga0501032_0002234 Ga0501032_0002234_3009_3872 258
291 3300049570 Ga0501033_0032082 Ga0501033_0032082_2050_2913 258
292 3300049570 Ga0501033_0124633 Ga0501033_0124633_34_813 258
293 3300049571 Ga0501034_0009045 Ga0501034_0009045_3466_4275 258
294 3300049571 Ga0501034_0055709 Ga0501034_0055709_98_961 258
295 3300049571 Ga0501034_0240968 Ga0501034_0240968_563_1342 258
296 3300049572 Ga0501036_0019205 Ga0501036_0019205_2349_3128 258
297 3300049573 Ga0501037_0000499 Ga0501037_0000499_16352_17215 258
298 3300049573 Ga0501037_0022489 Ga0501037_0022489_2199_2978 258
299 3300049574 Ga0501038_0003315 Ga0501038_0003315_1261_2124 258
300 3300049574 Ga0501038_0020720 Ga0501038_0020720_4244_5023 258
301 3300049575 Ga0501039_0002265 Ga0501039_0002265_10490_11353 258
302 3300049575 Ga0501039_0052503 Ga0501039_0052503_2339_3118 258
303 3300049579 Ga0501043_0014452 Ga0501043_0014452_2250_3113 258
304 3300049580 Ga0501046_0003027 Ga0501046_0003027_13179_14042 258
305 3300049581 Ga0501047_0066314 Ga0501047_0066314_1599_2462 258
306 3300049583 Ga0501067_0253724 Ga0501067_0253724_136_912 258
307 3300049586 Ga0501070_0020130 Ga0501070_0020130_2443_3222 258
308 3300049589 Ga0501073_0050433 Ga0501073_0050433_584_1447 258
309 3300049589 Ga0501073_0103846 Ga0501073_0103846_163_939 258
310 3300049652 Ga0501202_021695 Ga0501202_021695_230_1108 258
311 3300049682 Ga0501252_007166 Ga0501252_007166_393_1172 258
312 3300049705 Ga0501225_0004823 Ga0501225_0004823_2931_3710 258
313 3300049742 Ga0501080_0031544 Ga0501080_0031544_3040_3903 258
314 3300049742 Ga0501080_0033050 Ga0501080_0033050_720_1496 258
315 3300049742 Ga0501080_0104868 Ga0501080_0104868_776_1555 258
316 3300049772 Ga0501275_000227 Ga0501275_000227_3640_4443 258
317 3300049822 Ga0501035_0004851 Ga0501035_0004851_9484_10347 258
318 3300049822 Ga0501035_0015245 Ga0501035_0015245_2403_3182 258
319 3300049823 Ga0501044_0105390 Ga0501044_0105390_1737_2600 258
320 3300050491 nmdc:mga00v17_118_c1 nmdc:mga00v17_118_c1_25517_26305 258
321 3300053087 Ga0500643_011271 Ga0500643_011271_361_1137 258
322 3300053120 Ga0500597_000335 Ga0500597_000335_5559_6335 258
323 3300053161 Ga0500634_0000146 Ga0500634_0000146_4774_5553 258
324 iso_pu_bacteria 8003014200 8003014873 258
325 3300005327 Ga0070658_10397274 Ga0070658_103972742 259
326 3300005331 Ga0070670_100193548 Ga0070670_1001935482 259
327 3300005336 Ga0070680_100117495 Ga0070680_1001174953 259
328 3300005543 Ga0070672_100002714 Ga0070672_1000027147 259
329 3300005564 Ga0070664_100121338 Ga0070664_1001213383 259
330 3300005564 Ga0070664_100564243 Ga0070664_1005642432 259
331 3300005844 Ga0068862_100043064 Ga0068862_1000430645 259
332 3300006051 Ga0075364_10088551 Ga0075364_100885512 259
333 3300006051 Ga0075364_10125075 Ga0075364_101250752 259
334 3300013100 Ga0157373_10175713 Ga0157373_101757132 259
335 3300013102 Ga0157371_10084059 Ga0157371_100840591 259
336 3300013307 Ga0157372_10010524 Ga0157372_100105242 259
337 3300013307 Ga0157372_10402504 Ga0157372_104025042 259
338 3300014326 Ga0157380_10060113 Ga0157380_100601132 259
339 3300015685 Ga0183369_1012 Ga0183369_1012180 259
340 3300025909 Ga0207705_10246608 Ga0207705_102466082 259
341 3300025917 Ga0207660_10272031 Ga0207660_102720312 259
342 3300025926 Ga0207659_10126534 Ga0207659_101265342 259
343 3300025937 Ga0207669_10044591 Ga0207669_100445912 259
344 3300028380 Ga0268265_10255503 Ga0268265_102555032 259
345 3300031824 Ga0307413_10003477 Ga0307413_100034774 259
346 3300037312 Ga0395899_0038388 Ga0395899_0038388_2057_2836 259
347 3300037312 Ga0395899_0257278 Ga0395899_0257278_143_922 259
348 3300037418 Ga0395900_0001671 Ga0395900_0001671_23343_24122 259
349 3300037418 Ga0395900_0022713 Ga0395900_0022713_1123_1902 259
350 3300037418 Ga0395900_0038954 Ga0395900_0038954_3824_4603 259
351 3300037466 Ga0395898_0005025 Ga0395898_0005025_9219_9998 259
352 3300037466 Ga0395898_0008956 Ga0395898_0008956_5547_6326 259
353 3300038443 Ga0395901_0000280 Ga0395901_0000280_22388_23167 259
354 3300038443 Ga0395901_0026050 Ga0395901_0026050_450_1229 259
355 3300038443 Ga0395901_0058473 Ga0395901_0058473_1683_2462 259
356 3300042007 Ga0439449_0005497 Ga0439449_0005497_868_1734 259
357 3300049570 Ga0501033_0008723 Ga0501033_0008723_2527_3306 259
358 3300049571 Ga0501034_0000749 Ga0501034_0000749_11339_12121 259
359 3300049571 Ga0501034_0605973 Ga0501034_0605973_82_861 259
360 3300049579 Ga0501043_0112224 Ga0501043_0112224_1230_2009 259
361 3300049579 Ga0501043_0211475 Ga0501043_0211475_623_1402 259
362 3300049580 Ga0501046_0038819 Ga0501046_0038819_1567_2346 259
363 3300049581 Ga0501047_0043428 Ga0501047_0043428_3328_4107 259
364 3300049581 Ga0501047_0056354 Ga0501047_0056354_753_1532 259
365 3300049822 Ga0501035_0011534 Ga0501035_0011534_5650_6429 259
366 3300049822 Ga0501035_0017817 Ga0501035_0017817_4822_5601 259
367 3300049822 Ga0501035_0226568 Ga0501035_0226568_794_1573 259
368 3300049823 Ga0501044_0070459 Ga0501044_0070459_294_1073 259
369 3300049823 Ga0501044_0404938 Ga0501044_0404938_17_796 259
370 3300049823 Ga0501044_0701654 Ga0501044_0701654_97_876 259
371 3300050491 nmdc:mga00v17_7454_c1 nmdc:mga00v17_7454_c1_1004_1786 259
372 3300053158 Ga0500627_0176433 Ga0500627_0176433_78_863 259
373 iso_pu_bacteria 2643221577 2643894257 259
374 iso_pu_bacteria 2643221685 2644476459 259
375 iso_pu_bacteria 2739367700 2739730793 259
376 iso_pu_bacteria 2884411467 2884414376 259
377 iso_pu_bacteria 2895395659 2895398554 259
378 iso_pu_bacteria 2919675420 2919677152 259
379 iso_pu_bacteria 2928963466 2928964130 259
380 iso_pu_bacteria 2939611941 2939614630 259
381 3300003578 Ga0006562J51391_1103004 Ga0006562J51391_11030042 260
382 3300003578 Ga0006562J51391_1103005 Ga0006562J51391_11030053 260
383 3300005262 Ga0065165_1000028 Ga0065165_100002890 260
384 3300005336 Ga0070680_100268831 Ga0070680_1002688311 260
385 3300005344 Ga0070661_100061535 Ga0070661_1000615352 260
386 3300005366 Ga0070659_100178322 Ga0070659_1001783222 260
387 3300005539 Ga0068853_100458765 Ga0068853_1004587652 260
388 3300010375 Ga0105239_10025017 Ga0105239_100250179 260
389 3300013100 Ga0157373_10424162 Ga0157373_104241622 260
390 3300013104 Ga0157370_10001779 Ga0157370_1000177913 260
391 3300013104 Ga0157370_10008298 Ga0157370_1000829815 260
392 3300013105 Ga0157369_10000597 Ga0157369_1000059715 260
393 3300014497 Ga0182008_10002881 Ga0182008_1000288111 260
394 3300014497 Ga0182008_10016310 Ga0182008_100163102 260
395 3300015261 Ga0182006_1000072 Ga0182006_100007258 260
396 3300015261 Ga0182006_1000765 Ga0182006_100076528 260
397 3300015262 Ga0182007_10006852 Ga0182007_100068523 260
398 3300015265 Ga0182005_1000080 Ga0182005_100008012 260
399 3300015265 Ga0182005_1002839 Ga0182005_10028395 260
400 3300015265 Ga0182005_1023524 Ga0182005_10235242 260
401 3300017792 Ga0163161_10003999 Ga0163161_100039994 260
402 3300017792 Ga0163161_10281530 Ga0163161_102815302 260
403 3300025226 Ga0209674_101867 Ga0209674_1018673 260
404 3300025233 Ga0209437_100985 Ga0209437_1009858 260
405 3300025254 Ga0209148_1002776 Ga0209148_10027764 260
406 3300025299 Ga0209256_1017123 Ga0209256_10171231 260
407 3300025302 Ga0207426_1008786 Ga0207426_10087864 260
408 3300025303 Ga0209051_1002828 Ga0209051_10028289 260
409 3300025904 Ga0207647_10000029 Ga0207647_1000002942 260
410 3300025920 Ga0207649_10113893 Ga0207649_101138932 260
411 3300031911 Ga0307412_10027813 Ga0307412_100278133 260
412 3300037418 Ga0395900_0000590 Ga0395900_0000590_41429_42211 260
413 3300037418 Ga0395900_0005906 Ga0395900_0005906_6025_6840 260
414 3300041404 Ga0439436_0000077 Ga0439436_0000077_9542_10324 260
415 3300041413 Ga0439465_0000644 Ga0439465_0000644_6325_7107 260
416 3300042131 Ga0450894_007665 Ga0450894_007665_513_1295 260
417 3300044672 Ga0466982_0001149 Ga0466982_0001149_6599_7381 260
418 3300044735 Ga0466968_0007195 Ga0466968_0007195_2836_3618 260
419 3300046452 Ga0495617_000117 Ga0495617_000117_3953_4735 260
420 3300046452 Ga0495617_000581 Ga0495617_000581_15669_16451 260
421 3300046457 Ga0495590_0076070 Ga0495590_0076070_176_958 260
422 3300046460 Ga0495638_0017459 Ga0495638_0017459_33_815 260
423 3300046460 Ga0495638_0069762 Ga0495638_0069762_33_815 260
424 3300046471 Ga0495650_0004550 Ga0495650_0004550_2090_2872 260
425 3300046471 Ga0495650_0019238 Ga0495650_0019238_752_1534 260
426 3300046492 Ga0495585_0002200 Ga0495585_0002200_9021_9803 260
427 3300046492 Ga0495585_0003818 Ga0495585_0003818_5171_5953 260
428 3300046501 Ga0495607_0000122 Ga0495607_0000122_54615_55397 260
429 3300046501 Ga0495607_0000837 Ga0495607_0000837_15593_16375 260
430 3300046501 Ga0495607_0005180 Ga0495607_0005180_6949_7731 260
431 3300046506 Ga0495583_0038301 Ga0495583_0038301_48_830 260
432 3300046507 Ga0495606_0000298 Ga0495606_0000298_81043_81825 260
433 3300046507 Ga0495606_0006272 Ga0495606_0006272_2499_3281 260
434 3300046507 Ga0495606_0018751 Ga0495606_0018751_1005_1787 260
435 3300046512 Ga0495610_0054923 Ga0495610_0054923_113_895 260
436 3300046513 Ga0495616_0000565 Ga0495616_0000565_20033_20815 260
437 3300046515 Ga0495620_0003610 Ga0495620_0003610_6086_6868 260
438 3300046515 Ga0495620_0007544 Ga0495620_0007544_1890_2672 260
439 3300046518 Ga0495631_0000808 Ga0495631_0000808_6893_7675 260
440 3300046518 Ga0495631_0001788 Ga0495631_0001788_4720_5502 260
441 3300046519 Ga0495632_0000004 Ga0495632_0000004_282991_283809 260
442 3300046519 Ga0495632_0015386 Ga0495632_0015386_1857_2639 260
443 3300046519 Ga0495632_0033993 Ga0495632_0033993_333_1115 260
444 3300046519 Ga0495632_0192441 Ga0495632_0192441_97_879 260
445 3300046520 Ga0495637_0003747 Ga0495637_0003747_2367_3149 260
446 3300046522 Ga0495643_0061790 Ga0495643_0061790_545_1327 260
447 3300046524 Ga0495648_0002534 Ga0495648_0002534_8900_9682 260
448 3300046524 Ga0495648_0004865 Ga0495648_0004865_6819_7601 260
449 3300046538 Ga0495609_0003075 Ga0495609_0003075_525_1307 260
450 3300046616 Ga0495668_0003466 Ga0495668_0003466_6362_7144 260
451 3300046648 Ga0495611_0000001 Ga0495611_0000001_2038386_2039168 260
452 3300046648 Ga0495611_0000952 Ga0495611_0000952_7509_8291 260
453 3300046660 Ga0495625_0000022 Ga0495625_0000022_217631_218413 260
454 3300046660 Ga0495625_0017937 Ga0495625_0017937_3940_4722 260
455 3300046660 Ga0495625_0018982 Ga0495625_0018982_1965_2747 260
456 3300046665 Ga0495661_0006772 Ga0495661_0006772_917_1699 260
457 3300046691 Ga0495670_0005343 Ga0495670_0005343_4146_4928 260
458 3300046691 Ga0495670_0021443 Ga0495670_0021443_1494_2276 260
459 3300046692 Ga0495671_0002998 Ga0495671_0002998_4285_5067 260
460 3300046694 Ga0495649_0032443 Ga0495649_0032443_1223_2005 260
461 3300046794 Ga0495589_0000137 Ga0495589_0000137_28352_29134 260
462 3300046810 Ga0495660_0000728 Ga0495660_0000728_20334_21116 260
463 3300046810 Ga0495660_0001915 Ga0495660_0001915_3961_4743 260
464 3300047323 Ga0495683_0001586 Ga0495683_0001586_7480_8262 260
465 3300047446 Ga0495679_000004 Ga0495679_000004_149136_149918 260
466 3300047469 Ga0495673_0000202 Ga0495673_0000202_19257_20039 260
467 3300047469 Ga0495673_0000749 Ga0495673_0000749_26170_26952 260
468 3300047469 Ga0495673_0003957 Ga0495673_0003957_4743_5525 260
469 3300047472 Ga0495686_0000017 Ga0495686_0000017_66377_67159 260
470 3300047472 Ga0495686_0012978 Ga0495686_0012978_3915_4697 260
471 3300047472 Ga0495686_0026186 Ga0495686_0026186_1938_2720 260
472 3300047472 Ga0495686_0046373 Ga0495686_0046373_1184_1966 260
473 3300048905 Ga0496102_0143100 Ga0496102_0143100_477_1259 260
474 3300048909 Ga0496106_0001864 Ga0496106_0001864_7228_8010 260
475 3300048911 Ga0496108_0375265 Ga0496108_0375265_301_1083 260
476 3300048919 Ga0496116_0079572 Ga0496116_0079572_1173_1955 260
477 3300048920 Ga0496117_0081132 Ga0496117_0081132_1129_1911 260
478 3300048921 Ga0496118_0002418 Ga0496118_0002418_9847_10629 260
479 3300048921 Ga0496118_0002476 Ga0496118_0002476_5163_5945 260
480 3300048921 Ga0496118_0304649 Ga0496118_0304649_22_843 260
481 3300048924 Ga0496121_0000045 Ga0496121_0000045_223985_224767 260
482 3300048924 Ga0496121_0002752 Ga0496121_0002752_3950_4732 260
483 3300048924 Ga0496121_0007030 Ga0496121_0007030_8971_9753 260
484 3300048925 Ga0496122_0025121 Ga0496122_0025121_789_1571 260
485 3300048925 Ga0496122_0125885 Ga0496122_0125885_776_1558 260
486 3300048925 Ga0496122_0178467 Ga0496122_0178467_120_941 260
487 3300048926 Ga0496123_0010916 Ga0496123_0010916_3629_4411 260
488 3300048926 Ga0496123_0040635 Ga0496123_0040635_31_813 260
489 3300048926 Ga0496123_0045771 Ga0496123_0045771_18_800 260
490 3300048926 Ga0496123_0061677 Ga0496123_0061677_850_1632 260
491 3300048927 Ga0496124_0000482 Ga0496124_0000482_59423_60205 260
492 3300048927 Ga0496124_0002985 Ga0496124_0002985_16116_16898 260
493 3300048928 Ga0496125_0039288 Ga0496125_0039288_1984_2766 260
494 3300048929 Ga0496126_0175956 Ga0496126_0175956_24_806 260
495 3300049459 Ga0495678_000099 Ga0495678_000099_79424_80206 260
496 3300049460 Ga0495682_0006476 Ga0495682_0006476_1089_1871 260
497 3300049741 Ga0501079_0096867 Ga0501079_0096867_1348_2157 260
498 3300053093 Ga0500651_0168738 Ga0500651_0168738_30_812 260
499 3300053103 Ga0500555_000715 Ga0500555_000715_5104_5886 260
500 3300053160 Ga0500633_0002326 Ga0500633_0002326_1959_2741 260
501 3300025294 Ga0209025_1027178 Ga0209025_10271784 261
502 3300041413 Ga0439465_0003155 Ga0439465_0003155_844_1635 261
503 3300042007 Ga0439449_0020304 Ga0439449_0020304_1324_2115 261
504 3300049586 Ga0501070_0008013 Ga0501070_0008013_1109_1894 261
505 3300002067 JGI24735J21928_10027374 JGI24735J21928_100273742 262
506 3300002705 JGI25156J39149_1007127 JGI25156J39149_10071272 262
507 3300002741 JGI25157J39369_1003714 JGI25157J39369_10037143 262
508 3300003187 JGI25151J46595_10037886 JGI25151J46595_100378863 262
509 3300003322 rootL2_10010522 rootL2_100105222 262
510 3300003759 Ga0055525_1000122 Ga0055525_100012242 262
511 3300003759 Ga0055525_1000149 Ga0055525_100014921 262
512 3300003760 Ga0055527_1000204 Ga0055527_100020415 262
513 3300003761 Ga0055535_1000755 Ga0055535_100075515 262
514 3300003762 Ga0055542_1000451 Ga0055542_100045115 262
515 3300003763 Ga0055529_1000940 Ga0055529_100094017 262
516 3300003781 Ga0055536_1002998 Ga0055536_10029989 262
517 3300003791 Ga0055530_10003803 Ga0055530_100038037 262
518 3300005337 Ga0070682_100017192 Ga0070682_1000171924 262
519 3300005339 Ga0070660_100164595 Ga0070660_1001645952 262
520 3300005366 Ga0070659_100010476 Ga0070659_1000104764 262
521 3300005539 Ga0068853_100003901 Ga0068853_1000039013 262
522 3300005546 Ga0070696_100047519 Ga0070696_1000475194 262
523 3300005547 Ga0070693_100038898 Ga0070693_1000388982 262
524 3300005563 Ga0068855_100028430 Ga0068855_1000284308 262
525 3300005563 Ga0068855_100103669 Ga0068855_1001036692 262
526 3300005614 Ga0068856_100001468 Ga0068856_10000146816 262
527 3300009545 Ga0105237_10000202 Ga0105237_1000020274 262
528 3300009551 Ga0105238_10016361 Ga0105238_100163618 262
529 3300009551 Ga0105238_10093354 Ga0105238_100933541 262
530 3300013100 Ga0157373_10020859 Ga0157373_100208594 262
531 3300013102 Ga0157371_10005748 Ga0157371_100057488 262
532 3300013104 Ga0157370_10013751 Ga0157370_100137514 262
533 3300013104 Ga0157370_10039182 Ga0157370_100391822 262
534 3300013104 Ga0157370_10350525 Ga0157370_103505251 262
535 3300013307 Ga0157372_10007227 Ga0157372_100072278 262
536 3300014497 Ga0182008_10034286 Ga0182008_100342862 262
537 3300015262 Ga0182007_10026602 Ga0182007_100266022 262
538 3300015687 Ga0183368_1004 Ga0183368_1004277 262
539 3300020070 Ga0206356_11572506 Ga0206356_115725062 262
540 3300025226 Ga0209674_100016 Ga0209674_100016359 262
541 3300025228 Ga0209672_100056 Ga0209672_100056119 262
542 3300025230 Ga0209563_100077 Ga0209563_10007776 262
543 3300025242 Ga0209258_100096 Ga0209258_100096119 262
544 3300025242 Ga0209258_101191 Ga0209258_1011918 262
545 3300025246 Ga0209646_1004458 Ga0209646_10044582 262
546 3300025250 Ga0209026_1000397 Ga0209026_100039738 262
547 3300025254 Ga0209148_1000101 Ga0209148_1000101119 262
548 3300025256 Ga0209759_1002250 Ga0209759_10022504 262
549 3300025272 Ga0209455_1000094 Ga0209455_1000094119 262
550 3300025272 Ga0209455_1000496 Ga0209455_10004968 262
551 3300025273 Ga0209673_1003194 Ga0209673_10031949 262
552 3300025291 Ga0209675_1024911 Ga0209675_10249112 262
553 3300025292 Ga0209676_1001428 Ga0209676_10014289 262
554 3300025292 Ga0209676_1002923 Ga0209676_100292310 262
555 3300025292 Ga0209676_1006416 Ga0209676_10064169 262
556 3300025292 Ga0209676_1007181 Ga0209676_10071818 262
557 3300025294 Ga0209025_1022336 Ga0209025_10223361 262
558 3300025297 Ga0209758_1033390 Ga0209758_10333902 262
559 3300025298 Ga0209050_1000653 Ga0209050_100065311 262
560 3300025299 Ga0209256_1005272 Ga0209256_10052729 262
561 3300025303 Ga0209051_1004130 Ga0209051_10041309 262
562 3300025304 Ga0209257_1000349 Ga0209257_100034979 262
563 3300025304 Ga0209257_1008881 Ga0209257_10088812 262
564 3300025304 Ga0209257_1030862 Ga0209257_10308622 262
565 3300025914 Ga0207671_10000726 Ga0207671_1000072645 262
566 3300025919 Ga0207657_10173036 Ga0207657_101730362 262
567 3300025924 Ga0207694_10035601 Ga0207694_100356014 262
568 3300025932 Ga0207690_10013241 Ga0207690_100132415 262
569 3300025949 Ga0207667_10043422 Ga0207667_100434223 262
570 3300025949 Ga0207667_10094525 Ga0207667_100945254 262
571 3300025981 Ga0207640_10028015 Ga0207640_100280154 262
572 3300026041 Ga0207639_10015296 Ga0207639_100152966 262
573 3300026067 Ga0207678_10002479 Ga0207678_100024798 262
574 3300026078 Ga0207702_10000456 Ga0207702_100004568 262
575 3300031901 Ga0307406_10003052 Ga0307406_100030523 262
576 3300032004 Ga0307414_10021965 Ga0307414_100219653 262
577 3300032004 Ga0307414_10453379 Ga0307414_104533792 262
578 3300041404 Ga0439436_0008203 Ga0439436_0008203_181_984 262
579 3300045976 Ga0466967_0086091 Ga0466967_0086091_1411_2202 262
580 3300048907 Ga0496104_0255592 Ga0496104_0255592_170_961 262
581 3300048916 Ga0496113_0007102 Ga0496113_0007102_4553_5344 262
582 3300048918 Ga0496115_0000024 Ga0496115_0000024_148432_149223 262
583 3300049568 Ga0501031_0078488 Ga0501031_0078488_27_824 262
584 3300049568 Ga0501031_0086544 Ga0501031_0086544_266_1108 262
585 3300049569 Ga0501032_0205933 Ga0501032_0205933_300_1112 262
586 3300049570 Ga0501033_0013188 Ga0501033_0013188_798_1586 262
587 3300049570 Ga0501033_0015054 Ga0501033_0015054_4494_5336 262
588 3300049570 Ga0501033_0445824 Ga0501033_0445824_87_881 262
589 3300049571 Ga0501034_0005361 Ga0501034_0005361_5405_6199 262
590 3300049571 Ga0501034_0114586 Ga0501034_0114586_1162_1974 262
591 3300049572 Ga0501036_0100147 Ga0501036_0100147_1403_2215 262
592 3300049572 Ga0501036_0174120 Ga0501036_0174120_463_1305 262
593 3300049573 Ga0501037_0045944 Ga0501037_0045944_703_1545 262
594 3300049573 Ga0501037_0049817 Ga0501037_0049817_2041_2835 262
595 3300049575 Ga0501039_0065333 Ga0501039_0065333_1181_2023 262
596 3300049578 Ga0501042_0158396 Ga0501042_0158396_60_902 262
597 3300049579 Ga0501043_0002627 Ga0501043_0002627_9412_10215 262
598 3300049579 Ga0501043_0012216 Ga0501043_0012216_3728_4516 262
599 3300049579 Ga0501043_0056868 Ga0501043_0056868_719_1561 262
600 3300049580 Ga0501046_0043282 Ga0501046_0043282_2148_2990 262
601 3300049581 Ga0501047_0018151 Ga0501047_0018151_3559_4347 262
602 3300049582 Ga0501048_0048236 Ga0501048_0048236_627_1469 262
603 3300049586 Ga0501070_0049330 Ga0501070_0049330_1909_2703 262
604 3300049593 Ga0501077_0185606 Ga0501077_0185606_470_1264 262
605 3300049822 Ga0501035_0029374 Ga0501035_0029374_1857_2645 262
606 3300049822 Ga0501035_0044167 Ga0501035_0044167_2084_2878 262
607 3300049822 Ga0501035_0124664 Ga0501035_0124664_924_1712 262
608 3300049822 Ga0501035_0325564 Ga0501035_0325564_424_1236 262
609 3300049823 Ga0501044_0024669 Ga0501044_0024669_3195_3983 262
610 3300049823 Ga0501044_0073227 Ga0501044_0073227_1902_2696 262
611 3300049823 Ga0501044_0130531 Ga0501044_0130531_736_1524 262
612 3300049823 Ga0501044_0282966 Ga0501044_0282966_758_1570 262
613 3300049823 Ga0501044_0290150 Ga0501044_0290150_35_877 262
614 3300001979 JGI24740J21852_10016336 JGI24740J21852_100163361 263
615 3300001989 JGI24739J22299_10000040 JGI24739J22299_1000004031 263
616 3300001990 JGI24737J22298_10012814 JGI24737J22298_100128144 263
617 3300002067 JGI24735J21928_10014781 JGI24735J21928_100147812 263
618 3300002705 JGI25156J39149_1000714 JGI25156J39149_10007143 263
619 3300002705 JGI25156J39149_1006236 JGI25156J39149_10062363 263
620 3300002737 JGI25162J39368_1000551 JGI25162J39368_100055118 263
621 3300002737 JGI25162J39368_1000783 JGI25162J39368_100078326 263
622 3300002737 JGI25162J39368_1001115 JGI25162J39368_100111515 263
623 3300002737 JGI25162J39368_1003412 JGI25162J39368_10034121 263
624 3300002737 JGI25162J39368_1003477 JGI25162J39368_10034777 263
625 3300002738 JGI25154J39366_1004788 JGI25154J39366_10047882 263
626 3300002741 JGI25157J39369_1000485 JGI25157J39369_10004853 263
627 3300002741 JGI25157J39369_1000595 JGI25157J39369_100059526 263
628 3300002741 JGI25157J39369_1000847 JGI25157J39369_100084716 263
629 3300002741 JGI25157J39369_1001468 JGI25157J39369_100146813 263
630 3300002771 JGI25163J39215_1001294 JGI25163J39215_10012944 263
631 3300002772 JGI25164J39214_1000046 JGI25164J39214_100004634 263
632 3300002772 JGI25164J39214_1000191 JGI25164J39214_100019136 263
633 3300002772 JGI25164J39214_1000453 JGI25164J39214_100045326 263
634 3300002772 JGI25164J39214_1000842 JGI25164J39214_10008425 263
635 3300002772 JGI25164J39214_1000905 JGI25164J39214_10009059 263
636 3300003214 JGI25165J46597_1000096 JGI25165J46597_100009631 263
637 3300003214 JGI25165J46597_1000877 JGI25165J46597_100087726 263
638 3300003214 JGI25165J46597_1001702 JGI25165J46597_10017027 263
639 3300003214 JGI25165J46597_1003783 JGI25165J46597_10037833 263
640 3300003215 JGI25153J46596_10005437 JGI25153J46596_100054374 263
641 3300003578 Ga0006562J51391_1021318 Ga0006562J51391_10213181 263
642 3300003751 Ga0055538_1001663 Ga0055538_10016633 263
643 3300003752 Ga0055539_1000569 Ga0055539_100056910 263
644 3300003756 Ga0055533_1002346 Ga0055533_10023464 263
645 3300003760 Ga0055527_1000265 Ga0055527_100026529 263
646 3300003760 Ga0055527_1001913 Ga0055527_10019132 263
647 3300003761 Ga0055535_1000561 Ga0055535_100056129 263
648 3300003761 Ga0055535_1000866 Ga0055535_100086626 263
649 3300003761 Ga0055535_1001951 Ga0055535_10019515 263
650 3300003761 Ga0055535_1003042 Ga0055535_10030424 263
651 3300003762 Ga0055542_1000306 Ga0055542_100030623 263
652 3300003762 Ga0055542_1000582 Ga0055542_10005827 263
653 3300003762 Ga0055542_1000855 Ga0055542_100085526 263
654 3300003762 Ga0055542_1001843 Ga0055542_10018435 263
655 3300003762 Ga0055542_1002057 Ga0055542_10020577 263
656 3300003763 Ga0055529_1000309 Ga0055529_10003096 263
657 3300003763 Ga0055529_1000551 Ga0055529_10005517 263
658 3300003763 Ga0055529_1000733 Ga0055529_100073326 263
659 3300005262 Ga0065165_1008763 Ga0065165_10087636 263
660 3300005336 Ga0070680_100146217 Ga0070680_1001462172 263
661 3300005337 Ga0070682_100001003 Ga0070682_10000100316 263
662 3300005340 Ga0070689_100023584 Ga0070689_1000235844 263
663 3300005344 Ga0070661_100078301 Ga0070661_1000783012 263
664 3300005344 Ga0070661_100100966 Ga0070661_1001009662 263
665 3300005345 Ga0070692_10002864 Ga0070692_100028648 263
666 3300005366 Ga0070659_100003413 Ga0070659_1000034132 263
667 3300005435 Ga0070714_100000034 Ga0070714_100000034124 263
668 3300005435 Ga0070714_100029320 Ga0070714_1000293207 263
669 3300005436 Ga0070713_100000353 Ga0070713_1000003533 263
670 3300005455 Ga0070663_100089281 Ga0070663_1000892812 263
671 3300005458 Ga0070681_10000344 Ga0070681_1000034413 263
672 3300005458 Ga0070681_10002489 Ga0070681_100024898 263
673 3300005458 Ga0070681_10025865 Ga0070681_100258651 263
674 3300005530 Ga0070679_100008801 Ga0070679_10000880110 263
675 3300005530 Ga0070679_100042854 Ga0070679_1000428544 263
676 3300005546 Ga0070696_100002465 Ga0070696_1000024658 263
677 3300005546 Ga0070696_100003766 Ga0070696_1000037664 263
678 3300005547 Ga0070693_100010283 Ga0070693_1000102832 263
679 3300005563 Ga0068855_100095757 Ga0068855_1000957572 263
680 3300005577 Ga0068857_100001580 Ga0068857_10000158010 263
681 3300005577 Ga0068857_100069236 Ga0068857_1000692362 263
682 3300005577 Ga0068857_100376957 Ga0068857_1003769572 263
683 3300005578 Ga0068854_100004721 Ga0068854_1000047214 263
684 3300005578 Ga0068854_100014481 Ga0068854_1000144815 263
685 3300005578 Ga0068854_100038122 Ga0068854_1000381222 263
686 3300005614 Ga0068856_100005447 Ga0068856_1000054478 263
687 3300005842 Ga0068858_100008948 Ga0068858_10000894815 263
688 3300009093 Ga0105240_10008512 Ga0105240_1000851214 263
689 3300009093 Ga0105240_10027090 Ga0105240_100270907 263
690 3300009093 Ga0105240_10030925 Ga0105240_100309258 263
691 3300009545 Ga0105237_10000023 Ga0105237_1000002339 263
692 3300009545 Ga0105237_10025889 Ga0105237_100258897 263
693 3300009551 Ga0105238_10315596 Ga0105238_103155962 263
694 3300009551 Ga0105238_10338446 Ga0105238_103384462 263
695 3300010375 Ga0105239_10000022 Ga0105239_1000002274 263
696 3300010375 Ga0105239_10086061 Ga0105239_100860613 263
697 3300012502 Ga0157347_1005723 Ga0157347_10057231 263
698 3300013100 Ga0157373_10019910 Ga0157373_100199106 263
699 3300013100 Ga0157373_10411225 Ga0157373_104112251 263
700 3300013102 Ga0157371_10015964 Ga0157371_100159647 263
701 3300013104 Ga0157370_10007947 Ga0157370_100079478 263
702 3300013105 Ga0157369_10024098 Ga0157369_100240988 263
703 3300013307 Ga0157372_10539578 Ga0157372_105395781 263
704 3300014325 Ga0163163_10429229 Ga0163163_104292292 263
705 3300025224 Ga0209784_100047 Ga0209784_100047155 263
706 3300025226 Ga0209674_100053 Ga0209674_100053122 263
707 3300025226 Ga0209674_101380 Ga0209674_1013808 263
708 3300025228 Ga0209672_100009 Ga0209672_100009257 263
709 3300025228 Ga0209672_100160 Ga0209672_10016050 263
710 3300025228 Ga0209672_102153 Ga0209672_1021538 263
711 3300025231 Ga0207427_100023 Ga0207427_100023339 263
712 3300025231 Ga0207427_100040 Ga0207427_10004089 263
713 3300025231 Ga0207427_100050 Ga0207427_100050308 263
714 3300025231 Ga0207427_100166 Ga0207427_10016610 263
715 3300025233 Ga0209437_100015 Ga0209437_100015577 263
716 3300025233 Ga0209437_100120 Ga0209437_10012033 263
717 3300025233 Ga0209437_100172 Ga0209437_10017289 263
718 3300025233 Ga0209437_100276 Ga0209437_10027630 263
719 3300025233 Ga0209437_100288 Ga0209437_10028875 263
720 3300025242 Ga0209258_100011 Ga0209258_100011386 263
721 3300025242 Ga0209258_100043 Ga0209258_10004358 263
722 3300025242 Ga0209258_100246 Ga0209258_10024649 263
723 3300025242 Ga0209258_100598 Ga0209258_1005985 263
724 3300025246 Ga0209646_1001741 Ga0209646_10017415 263
725 3300025246 Ga0209646_1002174 Ga0209646_10021744 263
726 3300025250 Ga0209026_1000047 Ga0209026_100004758 263
727 3300025250 Ga0209026_1000101 Ga0209026_100010179 263
728 3300025250 Ga0209026_1000157 Ga0209026_100015728 263
729 3300025250 Ga0209026_1002418 Ga0209026_10024188 263
730 3300025250 Ga0209026_1006975 Ga0209026_10069751 263
731 3300025253 Ga0209677_111351 Ga0209677_1113512 263
732 3300025254 Ga0209148_1000002 Ga0209148_10000021978 263
733 3300025254 Ga0209148_1000010 Ga0209148_1000010338 263
734 3300025254 Ga0209148_1000013 Ga0209148_1000013386 263
735 3300025254 Ga0209148_1000024 Ga0209148_1000024483 263
736 3300025254 Ga0209148_1000052 Ga0209148_1000052298 263
737 3300025256 Ga0209759_1000287 Ga0209759_100028721 263
738 3300025256 Ga0209759_1000453 Ga0209759_100045312 263
739 3300025256 Ga0209759_1000807 Ga0209759_100080718 263
740 3300025256 Ga0209759_1001871 Ga0209759_100187114 263
741 3300025256 Ga0209759_1010351 Ga0209759_10103513 263
742 3300025258 Ga0209129_1001629 Ga0209129_10016297 263
743 3300025261 Ga0209233_1000009 Ga0209233_1000009834 263
744 3300025261 Ga0209233_1000108 Ga0209233_1000108137 263
745 3300025261 Ga0209233_1000174 Ga0209233_1000174137 263
746 3300025261 Ga0209233_1000184 Ga0209233_1000184129 263
747 3300025261 Ga0209233_1000284 Ga0209233_100028471 263
748 3300025261 Ga0209233_1018207 Ga0209233_10182072 263
749 3300025272 Ga0209455_1000012 Ga0209455_1000012386 263
750 3300025272 Ga0209455_1000020 Ga0209455_1000020266 263
751 3300025272 Ga0209455_1000025 Ga0209455_1000025483 263
752 3300025297 Ga0209758_1001571 Ga0209758_100157110 263
753 3300025904 Ga0207647_10032018 Ga0207647_100320182 263
754 3300025909 Ga0207705_10210904 Ga0207705_102109042 263
755 3300025911 Ga0207654_10129537 Ga0207654_101295372 263
756 3300025912 Ga0207707_10000128 Ga0207707_1000012843 263
757 3300025912 Ga0207707_10000933 Ga0207707_1000093310 263
758 3300025912 Ga0207707_10007534 Ga0207707_100075348 263
759 3300025912 Ga0207707_10117900 Ga0207707_101179002 263
760 3300025913 Ga0207695_10000654 Ga0207695_100006549 263
761 3300025913 Ga0207695_10001068 Ga0207695_1000106845 263
762 3300025913 Ga0207695_10064629 Ga0207695_100646294 263
763 3300025914 Ga0207671_10000020 Ga0207671_10000020196 263
764 3300025914 Ga0207671_10000033 Ga0207671_1000003359 263
765 3300025914 Ga0207671_10039957 Ga0207671_100399574 263
766 3300025920 Ga0207649_10072779 Ga0207649_100727792 263
767 3300025921 Ga0207652_10002665 Ga0207652_1000266510 263
768 3300025921 Ga0207652_10090774 Ga0207652_100907743 263
769 3300025924 Ga0207694_10156168 Ga0207694_101561682 263
770 3300025924 Ga0207694_10293204 Ga0207694_102932042 263
771 3300025928 Ga0207700_10002664 Ga0207700_100026649 263
772 3300025929 Ga0207664_10000021 Ga0207664_1000002199 263
773 3300025929 Ga0207664_10016425 Ga0207664_100164254 263
774 3300025932 Ga0207690_10122194 Ga0207690_101221943 263
775 3300025933 Ga0207706_10148074 Ga0207706_101480742 263
776 3300025936 Ga0207670_10026070 Ga0207670_100260703 263
777 3300025949 Ga0207667_10000130 Ga0207667_1000013084 263
778 3300025949 Ga0207667_10000416 Ga0207667_1000041661 263
779 3300025949 Ga0207667_10132317 Ga0207667_101323172 263
780 3300025981 Ga0207640_10000103 Ga0207640_1000010371 263
781 3300025981 Ga0207640_10099336 Ga0207640_100993362 263
782 3300026035 Ga0207703_10061090 Ga0207703_100610901 263
783 3300026041 Ga0207639_10222282 Ga0207639_102222821 263
784 3300026067 Ga0207678_10020658 Ga0207678_100206582 263
785 3300026078 Ga0207702_10013037 Ga0207702_100130373 263
786 3300026078 Ga0207702_10324436 Ga0207702_103244362 263
787 3300026116 Ga0207674_10000971 Ga0207674_1000097131 263
788 3300026116 Ga0207674_10085992 Ga0207674_100859924 263
789 3300026116 Ga0207674_10202828 Ga0207674_102028283 263
790 3300028380 Ga0268265_10381496 Ga0268265_103814962 263
791 3300037312 Ga0395899_0000195 Ga0395899_0000195_1526_2383 263
792 3300037418 Ga0395900_0000018 Ga0395900_0000018_206841_207698 263
793 3300037466 Ga0395898_0000213 Ga0395898_0000213_75214_76062 263
794 3300037466 Ga0395898_0003959 Ga0395898_0003959_13940_14797 263
795 3300038443 Ga0395901_0196775 Ga0395901_0196775_1273_2070 263
796 3300041452 Ga0451793_0691818 Ga0451793_0691818_1140_1940 263
797 3300042438 Ga0439459_0004199 Ga0439459_0004199_1460_2257 263
798 3300044656 Ga0466969_0008996 Ga0466969_0008996_160_954 263
799 3300044656 Ga0466969_0012302 Ga0466969_0012302_1430_2287 263
800 3300044672 Ga0466982_0000020 Ga0466982_0000020_52127_52972 263
801 3300044683 Ga0466965_0018012 Ga0466965_0018012_1468_2424 263
802 3300044683 Ga0466965_0048771 Ga0466965_0048771_532_1377 263
803 3300044684 Ga0466966_0012209 Ga0466966_0012209_72_917 263
804 3300044684 Ga0466966_0053515 Ga0466966_0053515_27_857 263
805 3300044693 Ga0466961_0000944 Ga0466961_0000944_1434_2390 263
806 3300044693 Ga0466961_0003373 Ga0466961_0003373_5075_5869 263
807 3300044693 Ga0466961_0010106 Ga0466961_0010106_1999_2829 263
808 3300044693 Ga0466961_0018571 Ga0466961_0018571_2314_3108 263
809 3300044693 Ga0466961_0067987 Ga0466961_0067987_803_1648 263
810 3300044694 Ga0466963_0164429 Ga0466963_0164429_340_1185 263
811 3300044694 Ga0466963_0457744 Ga0466963_0457744_70_864 263
812 3300044706 Ga0466964_0016461 Ga0466964_0016461_534_1331 263
813 3300044719 Ga0466971_0002694 Ga0466971_0002694_1694_2491 263
814 3300044735 Ga0466968_0001238 Ga0466968_0001238_447_1292 263
815 3300044735 Ga0466968_0045493 Ga0466968_0045493_901_1725 263
816 3300044765 Ga0466970_0010599 Ga0466970_0010599_3135_3959 263
817 3300044765 Ga0466970_0012342 Ga0466970_0012342_1808_2653 263
818 3300044842 Ga0466957_0005144 Ga0466957_0005144_1624_2448 263
819 3300044901 Ga0466960_0036956 Ga0466960_0036956_1209_2006 263
820 3300045049 Ga0466959_0004692 Ga0466959_0004692_1154_2110 263
821 3300045049 Ga0466959_0007758 Ga0466959_0007758_5587_6444 263
822 3300045049 Ga0466959_0032260 Ga0466959_0032260_1570_2394 263
823 3300045836 Ga0466958_0007344 Ga0466958_0007344_2201_2995 263
824 3300045836 Ga0466958_0016157 Ga0466958_0016157_846_1802 263
825 3300045976 Ga0466967_0060040 Ga0466967_0060040_943_1737 263
826 3300046460 Ga0495638_0000063 Ga0495638_0000063_85868_86665 263
827 3300046460 Ga0495638_0002410 Ga0495638_0002410_10196_11038 263
828 3300046460 Ga0495638_0013756 Ga0495638_0013756_3720_4514 263
829 3300046460 Ga0495638_0063767 Ga0495638_0063767_138_971 263
830 3300046471 Ga0495650_0002180 Ga0495650_0002180_10996_11838 263
831 3300046507 Ga0495606_0002450 Ga0495606_0002450_19788_20582 263
832 3300046542 Ga0495597_0109933 Ga0495597_0109933_19_813 263
833 3300046694 Ga0495649_0008433 Ga0495649_0008433_1319_2113 263
834 3300048907 Ga0496104_0484599 Ga0496104_0484599_134_928 263
835 3300048908 Ga0496105_0042121 Ga0496105_0042121_736_1530 263
836 3300048916 Ga0496113_0141683 Ga0496113_0141683_363_1160 263
837 3300048918 Ga0496115_0024172 Ga0496115_0024172_2636_3430 263
838 3300048918 Ga0496115_0076325 Ga0496115_0076325_1057_1899 263
839 3300048920 Ga0496117_0071799 Ga0496117_0071799_814_1608 263
840 3300048921 Ga0496118_0004740 Ga0496118_0004740_8632_9426 263
841 3300048922 Ga0496119_0001058 Ga0496119_0001058_18869_19663 263
842 3300048922 Ga0496119_0011077 Ga0496119_0011077_1988_2812 263
843 3300048923 Ga0496120_0002531 Ga0496120_0002531_6368_7192 263
844 3300048923 Ga0496120_0005836 Ga0496120_0005836_2102_2896 263
845 3300048924 Ga0496121_0006364 Ga0496121_0006364_8926_9726 263
846 3300048928 Ga0496125_0000344 Ga0496125_0000344_51537_52334 263
847 3300048929 Ga0496126_0015164 Ga0496126_0015164_1617_2441 263
848 3300048929 Ga0496126_0190285 Ga0496126_0190285_86_928 263
849 3300049569 Ga0501032_0006980 Ga0501032_0006980_5214_6011 263
850 3300049581 Ga0501047_0038405 Ga0501047_0038405_3069_3866 263
851 3300049586 Ga0501070_0246544 Ga0501070_0246544_210_1007 263
852 3300061719 Ga0466962_0001160 Ga0466962_0001160_9468_10424 263
853 3300061719 Ga0466962_0003497 Ga0466962_0003497_6382_7176 263
854 3300061719 Ga0466962_0005665 Ga0466962_0005665_4233_5030 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01975

SurE

Survival protein SurE

30

216

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ty2-assembly1.cif.gz_B structure of a 5'-nucleotidase (sure) from coxiella burnetii 0.9488 1 250
3ty2-assembly1.cif.gz_B structure of a 5'-nucleotidase (sure) from coxiella burnetii 0.9343 1 250
4xh8-assembly1.cif.gz_B crystal structure of e112a/d230a mutant of stationary phase survival protein (sure) from salmonella typhimurium 0.9232 1 251
4zg5-assembly1.cif.gz_A structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus 0.9217 1 244
4zg5-assembly1.cif.gz_C structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus 0.9195 1 242
ID Description Score Start End Superfamily
4qeaA00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.9287 1 239 3.40.1210.10
4xgbA00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.9127 1 251 3.40.1210.10
4qeaA00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.8965 1 239 3.40.1210.10
2wqkB00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.8788 1 247 3.40.1210.10
2wqkB00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.8721 1 247 3.40.1210.10
ID Description Score Start End GO Terms
AF-A0A2Z7A139-F1-model_v4 Survival protein SurE-like phosphatase/nucleotidase domain-containing protein 0.9779 1 242 GO:0000166
GO:0004309
GO:0004719
GO:0005737
GO:0008253
GO:0008254
GO:0036211
GO:0046872
AF-A0A6P0ELH0-F1-model_v4 deleted 0.9745 107 223
AF-A0A356U3L7-F1-model_v4 deleted 0.9723 1 119
AF-A0A7C7HRH0-F1-model_v4 5'-nucleotidase (EC 3.1.3.5) 0.9703 1 220 GO:0000166
GO:0004309
GO:0005737
GO:0008254
GO:0046872
GO:0106411
AF-M5CXX0-F1-model_v4 deleted 0.9698 1 254

Feature Viewer

pLDDT pTM Quality
88.71 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map