F483581
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 349 | 817 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10284267|Ga0105248_102842672 |
| Length | 288 |
| Sequence | MNASSWHNDATGIAASRLAGRSSVRGCMRVLVSNDDGVDAPGIRILAEGLRGAGHEVWVVAPDRDRSGASNSLTLDQPIRVARIDAFTWRVFGTPTDCVHVALAGLLDHEPDIVVSGINNSANLGDDVIYSGTVAAAMEGRFLGLPAIAVSCATRDHNTGAKHFETAARAAVEITSRLLVDPLPADTILNVNVPDCEWKDLAGFEVSRLGQRHRAEPCIQQTDPRGRPIWWIGPPGAEQDAGPGTDFHAVRTGHVAITPIQVDLTRYKALDKVASWVGALGEALRQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 4 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 5 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 6 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 7 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 8 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 9 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 10 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 11 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 12 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 13 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 14 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 15 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 16 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 17 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 18 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 19 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 20 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 21 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 22 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 23 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 24 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 25 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 26 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 27 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 28 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 29 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 30 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 31 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 32 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 33 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 34 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 35 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 36 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 37 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 38 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 39 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 40 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 41 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 42 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 43 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 44 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 49 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 50 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 126 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 192 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 193 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 194 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 214 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 215 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 216 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 222 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 223 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 224 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 231 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 232 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 235 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 331 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 332 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 342 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 343 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 346 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 347 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 348 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 349 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.2 |
| Metatranscriptomes | 0.47 |
| Isolates | 4.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.29 |
| Nodule | 0 |
| Rhizoplane | 2.69 |
| Rhizosphere | 69.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10016336 | 3300001979 | Bacteria | 2684 |
| 2 | JGI24739J22299_10000040 | 3300001989 | Bacteria | 35361 |
| 3 | JGI24737J22298_10012814 | 3300001990 | Bacteria | 2734 |
| 4 | JGI24735J21928_10014781 | 3300002067 | Bacteria | 2443 |
| 5 | JGI24735J21928_10027374 | 3300002067 | Bacteria | 1708 |
| 6 | JGI25156J39149_1000714 | 3300002705 | Bacteria | 17738 |
| 7 | JGI25156J39149_1006236 | 3300002705 | Bacteria | 3289 |
| 8 | JGI25156J39149_1007127 | 3300002705 | Bacteria | 2972 |
| 9 | JGI25162J39368_1000551 | 3300002737 | Bacteria | 27687 |
| 10 | JGI25162J39368_1000783 | 3300002737 | Bacteria | 21349 |
| 11 | JGI25162J39368_1001115 | 3300002737 | Bacteria | 16204 |
| 12 | JGI25162J39368_1003412 | 3300002737 | Bacteria | 4625 |
| 13 | JGI25162J39368_1003477 | 3300002737 | Bacteria | 4507 |
| 14 | JGI25154J39366_1004788 | 3300002738 | Bacteria | 2313 |
| 15 | JGI25157J39369_1000485 | 3300002741 | Bacteria | 24711 |
| 16 | JGI25157J39369_1000595 | 3300002741 | Bacteria | 21349 |
| 17 | JGI25157J39369_1000847 | 3300002741 | Bacteria | 15070 |
| 18 | JGI25157J39369_1001468 | 3300002741 | Bacteria | 8740 |
| 19 | JGI25157J39369_1003714 | 3300002741 | Bacteria | 3011 |
| 20 | JGI25163J39215_1001294 | 3300002771 | Bacteria | 4449 |
| 21 | JGI25164J39214_1000046 | 3300002772 | Bacteria | 124984 |
| 22 | JGI25164J39214_1000191 | 3300002772 | Bacteria | 53327 |
| 23 | JGI25164J39214_1000453 | 3300002772 | Bacteria | 21349 |
| 24 | JGI25164J39214_1000842 | 3300002772 | Bacteria | 10606 |
| 25 | JGI25164J39214_1000905 | 3300002772 | Bacteria | 9895 |
| 26 | JGI25151J46595_10037886 | 3300003187 | Bacteria | 1802 |
| 27 | JGI25165J46597_1000096 | 3300003214 | Bacteria | 161294 |
| 28 | JGI25165J46597_1000877 | 3300003214 | Bacteria | 21349 |
| 29 | JGI25165J46597_1001702 | 3300003214 | Bacteria | 9879 |
| 30 | JGI25165J46597_1003783 | 3300003214 | Bacteria | 3553 |
| 31 | JGI25153J46596_10005437 | 3300003215 | Bacteria | 6685 |
| 32 | rootL2_10010522 | 3300003322 | Bacteria | 3038 |
| 33 | Ga0006562J51391_1021318 | 3300003578 | Bacteria | 2800 |
| 34 | Ga0006562J51391_1103004 | 3300003578 | Bacteria | 3204 |
| 35 | Ga0006562J51391_1103005 | 3300003578 | Bacteria | 2520 |
| 36 | Ga0055538_1001663 | 3300003751 | Bacteria | 3952 |
| 37 | Ga0055539_1000569 | 3300003752 | Bacteria | 10496 |
| 38 | Ga0055533_1002346 | 3300003756 | Bacteria | 4347 |
| 39 | Ga0055525_1000122 | 3300003759 | Bacteria | 119205 |
| 40 | Ga0055525_1000149 | 3300003759 | Bacteria | 94324 |
| 41 | Ga0055527_1000204 | 3300003760 | Bacteria | 38984 |
| 42 | Ga0055527_1000265 | 3300003760 | Bacteria | 31658 |
| 43 | Ga0055527_1001913 | 3300003760 | Bacteria | 3873 |
| 44 | Ga0055535_1000561 | 3300003761 | Bacteria | 31664 |
| 45 | Ga0055535_1000755 | 3300003761 | Bacteria | 24057 |
| 46 | Ga0055535_1000866 | 3300003761 | Bacteria | 21349 |
| 47 | Ga0055535_1001951 | 3300003761 | Bacteria | 8573 |
| 48 | Ga0055535_1003042 | 3300003761 | Bacteria | 5088 |
| 49 | Ga0055542_1000306 | 3300003762 | Bacteria | 53983 |
| 50 | Ga0055542_1000451 | 3300003762 | Bacteria | 38982 |
| 51 | Ga0055542_1000582 | 3300003762 | Bacteria | 31664 |
| 52 | Ga0055542_1000855 | 3300003762 | Bacteria | 21349 |
| 53 | Ga0055542_1001843 | 3300003762 | Bacteria | 8573 |
| 54 | Ga0055542_1002057 | 3300003762 | Bacteria | 7552 |
| 55 | Ga0055529_1000309 | 3300003763 | Bacteria | 56116 |
| 56 | Ga0055529_1000551 | 3300003763 | Bacteria | 31664 |
| 57 | Ga0055529_1000733 | 3300003763 | Bacteria | 21349 |
| 58 | Ga0055529_1000940 | 3300003763 | Bacteria | 15455 |
| 59 | Ga0055536_1002998 | 3300003781 | Bacteria | 9246 |
| 60 | Ga0055530_10003803 | 3300003791 | Bacteria | 8309 |
| 61 | Ga0065165_1000028 | 3300005262 | Bacteria | 224430 |
| 62 | Ga0065165_1008763 | 3300005262 | Bacteria | 4663 |
| 63 | Ga0070658_10015687 | 3300005327 | Bacteria | 6059 |
| 64 | Ga0070658_10373898 | 3300005327 | Bacteria | 1222 |
| 65 | Ga0070658_10397274 | 3300005327 | Bacteria | 1184 |
| 66 | Ga0070670_100193548 | 3300005331 | Bacteria | 1767 |
| 67 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 68 | Ga0070666_10002096 | 3300005335 | Bacteria | 12133 |
| 69 | Ga0070680_100117495 | 3300005336 | Bacteria | 2217 |
| 70 | Ga0070680_100146217 | 3300005336 | Bacteria | 1983 |
| 71 | Ga0070680_100268831 | 3300005336 | Bacteria | 1443 |
| 72 | Ga0070682_100001003 | 3300005337 | Bacteria | 16333 |
| 73 | Ga0070682_100017192 | 3300005337 | Bacteria | 4214 |
| 74 | Ga0070660_100164595 | 3300005339 | Bacteria | 1789 |
| 75 | Ga0070689_100023584 | 3300005340 | Bacteria | 4607 |
| 76 | Ga0070661_100061535 | 3300005344 | Bacteria | 2756 |
| 77 | Ga0070661_100078301 | 3300005344 | Bacteria | 2438 |
| 78 | Ga0070661_100100966 | 3300005344 | Bacteria | 2146 |
| 79 | Ga0070692_10002864 | 3300005345 | Bacteria | 6835 |
| 80 | Ga0070659_100003413 | 3300005366 | Bacteria | 11320 |
| 81 | Ga0070659_100010476 | 3300005366 | Bacteria | 6821 |
| 82 | Ga0070659_100178322 | 3300005366 | Bacteria | 1743 |
| 83 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 84 | Ga0070667_100034571 | 3300005367 | Bacteria | 4229 |
| 85 | Ga0070667_100058101 | 3300005367 | Bacteria | 3270 |
| 86 | Ga0070667_100185170 | 3300005367 | Bacteria | 1843 |
| 87 | Ga0070714_100000034 | 3300005435 | Bacteria | 130742 |
| 88 | Ga0070714_100029320 | 3300005435 | Bacteria | 4574 |
| 89 | Ga0070713_100000353 | 3300005436 | Bacteria | 29733 |
| 90 | Ga0070663_100023182 | 3300005455 | Bacteria | 4158 |
| 91 | Ga0070663_100089281 | 3300005455 | Bacteria | 2280 |
| 92 | Ga0070663_100328498 | 3300005455 | Bacteria | 1232 |
| 93 | Ga0070662_100021135 | 3300005457 | Bacteria | 4441 |
| 94 | Ga0070681_10000344 | 3300005458 | Bacteria | 37503 |
| 95 | Ga0070681_10002489 | 3300005458 | Bacteria | 16870 |
| 96 | Ga0070681_10020895 | 3300005458 | Bacteria | 6556 |
| 97 | Ga0070681_10025865 | 3300005458 | Bacteria | 5901 |
| 98 | Ga0070679_100008801 | 3300005530 | Bacteria | 9520 |
| 99 | Ga0070679_100042854 | 3300005530 | Bacteria | 4508 |
| 100 | Ga0070679_100137444 | 3300005530 | Bacteria | 2425 |
| 101 | Ga0070679_100245710 | 3300005530 | Bacteria | 1746 |
| 102 | Ga0068853_100003367 | 3300005539 | Bacteria | 12234 |
| 103 | Ga0068853_100003901 | 3300005539 | Bacteria | 11433 |
| 104 | Ga0068853_100023295 | 3300005539 | Bacteria | 5181 |
| 105 | Ga0068853_100034276 | 3300005539 | Bacteria | 4309 |
| 106 | Ga0068853_100119273 | 3300005539 | Bacteria | 2351 |
| 107 | Ga0068853_100138784 | 3300005539 | Bacteria | 2181 |
| 108 | Ga0068853_100458765 | 3300005539 | Bacteria | 1199 |
| 109 | Ga0070672_100002714 | 3300005543 | Bacteria | 11316 |
| 110 | Ga0070672_100011903 | 3300005543 | Bacteria | 6082 |
| 111 | Ga0070696_100002465 | 3300005546 | Bacteria | 12261 |
| 112 | Ga0070696_100003766 | 3300005546 | Bacteria | 10129 |
| 113 | Ga0070696_100047519 | 3300005546 | Bacteria | 2978 |
| 114 | Ga0070693_100010283 | 3300005547 | Bacteria | 4684 |
| 115 | Ga0070693_100027552 | 3300005547 | Bacteria | 3081 |
| 116 | Ga0070693_100038898 | 3300005547 | Bacteria | 2662 |
| 117 | Ga0070693_100102808 | 3300005547 | Bacteria | 1744 |
| 118 | Ga0070665_100001267 | 3300005548 | Bacteria | 30338 |
| 119 | Ga0070665_100011880 | 3300005548 | Bacteria | 8795 |
| 120 | Ga0070665_100059354 | 3300005548 | Bacteria | 3835 |
| 121 | Ga0070665_100235902 | 3300005548 | Bacteria | 1830 |
| 122 | Ga0068855_100024470 | 3300005563 | Bacteria | 7223 |
| 123 | Ga0068855_100028430 | 3300005563 | Bacteria | 6689 |
| 124 | Ga0068855_100037052 | 3300005563 | Bacteria | 5803 |
| 125 | Ga0068855_100095757 | 3300005563 | Bacteria | 3421 |
| 126 | Ga0068855_100103669 | 3300005563 | Bacteria | 3272 |
| 127 | Ga0068855_100108560 | 3300005563 | Bacteria | 3187 |
| 128 | Ga0068855_100571763 | 3300005563 | Bacteria | 1222 |
| 129 | Ga0068855_100843017 | 3300005563 | Bacteria | 972 |
| 130 | Ga0070664_100121338 | 3300005564 | Bacteria | 2289 |
| 131 | Ga0070664_100213877 | 3300005564 | Bacteria | 1723 |
| 132 | Ga0070664_100564243 | 3300005564 | Bacteria | 1053 |
| 133 | Ga0068857_100001580 | 3300005577 | Bacteria | 18242 |
| 134 | Ga0068857_100069236 | 3300005577 | Bacteria | 3142 |
| 135 | Ga0068857_100104071 | 3300005577 | Bacteria | 2548 |
| 136 | Ga0068857_100201643 | 3300005577 | Bacteria | 1813 |
| 137 | Ga0068857_100376957 | 3300005577 | Bacteria | 1317 |
| 138 | Ga0068854_100004721 | 3300005578 | Bacteria | 8587 |
| 139 | Ga0068854_100014481 | 3300005578 | Bacteria | 5200 |
| 140 | Ga0068854_100038122 | 3300005578 | Bacteria | 3378 |
| 141 | Ga0068856_100001468 | 3300005614 | Bacteria | 24682 |
| 142 | Ga0068856_100005447 | 3300005614 | Bacteria | 12537 |
| 143 | Ga0068856_100033308 | 3300005614 | Bacteria | 5044 |
| 144 | Ga0068856_100309468 | 3300005614 | Bacteria | 1597 |
| 145 | Ga0068852_100010889 | 3300005616 | Bacteria | 6815 |
| 146 | Ga0068852_100024583 | 3300005616 | Bacteria | 4871 |
| 147 | Ga0068852_100040375 | 3300005616 | Bacteria | 3936 |
| 148 | Ga0068852_100347198 | 3300005616 | Bacteria | 1448 |
| 149 | Ga0068852_100477872 | 3300005616 | Bacteria | 1238 |
| 150 | Ga0068859_100000265 | 3300005617 | Bacteria | 52351 |
| 151 | Ga0068851_10002041 | 3300005834 | Bacteria | 8906 |
| 152 | Ga0068851_10135254 | 3300005834 | Bacteria | 1336 |
| 153 | Ga0068863_100020907 | 3300005841 | Bacteria | 6250 |
| 154 | Ga0068863_100185119 | 3300005841 | Bacteria | 2000 |
| 155 | Ga0068858_100003531 | 3300005842 | Bacteria | 15485 |
| 156 | Ga0068858_100008948 | 3300005842 | Bacteria | 9597 |
| 157 | Ga0068858_100115545 | 3300005842 | Bacteria | 2508 |
| 158 | Ga0068862_100005271 | 3300005844 | Bacteria | 10842 |
| 159 | Ga0068862_100043064 | 3300005844 | Bacteria | 3848 |
| 160 | Ga0081540_1072453 | 3300005983 | Bacteria | 1587 |
| 161 | Ga0075364_10000356 | 3300006051 | Bacteria | 22600 |
| 162 | Ga0075364_10088551 | 3300006051 | Bacteria | 2053 |
| 163 | Ga0075364_10125075 | 3300006051 | Bacteria | 1723 |
| 164 | Ga0097621_100079578 | 3300006237 | Bacteria | 2725 |
| 165 | Ga0097620_100000265 | 3300006931 | Bacteria | 52351 |
| 166 | Ga0105240_10002519 | 3300009093 | Bacteria | 29423 |
| 167 | Ga0105240_10008512 | 3300009093 | Bacteria | 14670 |
| 168 | Ga0105240_10013886 | 3300009093 | Bacteria | 11033 |
| 169 | Ga0105240_10027090 | 3300009093 | Bacteria | 7510 |
| 170 | Ga0105240_10030925 | 3300009093 | Bacteria | 6953 |
| 171 | Ga0105240_10176224 | 3300009093 | Bacteria | 2528 |
| 172 | Ga0111539_10366310 | 3300009094 | Bacteria | 1677 |
| 173 | Ga0105245_10357427 | 3300009098 | Bacteria | 1449 |
| 174 | Ga0105247_10069693 | 3300009101 | Bacteria | 2195 |
| 175 | Ga0105241_10030187 | 3300009174 | Bacteria | 4049 |
| 176 | Ga0105241_10229887 | 3300009174 | Bacteria | 1563 |
| 177 | Ga0105248_10002061 | 3300009177 | Bacteria | 22267 |
| 178 | Ga0105248_10284267 | 3300009177 | Bacteria | 1862 |
| 179 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 180 | Ga0105237_10000202 | 3300009545 | Bacteria | 84889 |
| 181 | Ga0105237_10004780 | 3300009545 | Bacteria | 15572 |
| 182 | Ga0105237_10021360 | 3300009545 | Bacteria | 6656 |
| 183 | Ga0105237_10025889 | 3300009545 | Bacteria | 5997 |
| 184 | Ga0105237_10300160 | 3300009545 | Bacteria | 1609 |
| 185 | Ga0105237_10442954 | 3300009545 | Bacteria | 1305 |
| 186 | Ga0105238_10001867 | 3300009551 | Bacteria | 21119 |
| 187 | Ga0105238_10007377 | 3300009551 | Bacteria | 11015 |
| 188 | Ga0105238_10015192 | 3300009551 | Bacteria | 7796 |
| 189 | Ga0105238_10016361 | 3300009551 | Bacteria | 7507 |
| 190 | Ga0105238_10093354 | 3300009551 | Bacteria | 2997 |
| 191 | Ga0105238_10315596 | 3300009551 | Bacteria | 1548 |
| 192 | Ga0105238_10338446 | 3300009551 | Bacteria | 1492 |
| 193 | Ga0105249_10005661 | 3300009553 | Bacteria | 10808 |
| 194 | Ga0105249_10020935 | 3300009553 | Bacteria | 5850 |
| 195 | Ga0105239_10000022 | 3300010375 | Bacteria | 257744 |
| 196 | Ga0105239_10010293 | 3300010375 | Bacteria | 10475 |
| 197 | Ga0105239_10023401 | 3300010375 | Bacteria | 6803 |
| 198 | Ga0105239_10025017 | 3300010375 | Bacteria | 6577 |
| 199 | Ga0105239_10038519 | 3300010375 | Bacteria | 5239 |
| 200 | Ga0105239_10046624 | 3300010375 | Bacteria | 4749 |
| 201 | Ga0105239_10086061 | 3300010375 | Bacteria | 3464 |
| 202 | Ga0105239_10112342 | 3300010375 | Bacteria | 3021 |
| 203 | Ga0105239_10335425 | 3300010375 | Bacteria | 1706 |
| 204 | Ga0105239_11045843 | 3300010375 | Bacteria | 939 |
| 205 | Ga0157347_1005723 | 3300012502 | Bacteria | 1195 |
| 206 | Ga0157373_10019910 | 3300013100 | Bacteria | 4881 |
| 207 | Ga0157373_10020859 | 3300013100 | Bacteria | 4756 |
| 208 | Ga0157373_10175713 | 3300013100 | Bacteria | 1507 |
| 209 | Ga0157373_10411225 | 3300013100 | Bacteria | 970 |
| 210 | Ga0157373_10424162 | 3300013100 | Bacteria | 955 |
| 211 | Ga0157371_10005748 | 3300013102 | Bacteria | 10390 |
| 212 | Ga0157371_10015964 | 3300013102 | Bacteria | 5617 |
| 213 | Ga0157371_10084059 | 3300013102 | Bacteria | 2254 |
| 214 | Ga0157370_10001779 | 3300013104 | Bacteria | 26577 |
| 215 | Ga0157370_10007947 | 3300013104 | Bacteria | 11490 |
| 216 | Ga0157370_10008298 | 3300013104 | Bacteria | 11210 |
| 217 | Ga0157370_10013751 | 3300013104 | Bacteria | 8319 |
| 218 | Ga0157370_10039182 | 3300013104 | Bacteria | 4580 |
| 219 | Ga0157370_10350525 | 3300013104 | Bacteria | 1361 |
| 220 | Ga0157369_10000597 | 3300013105 | Bacteria | 46956 |
| 221 | Ga0157369_10024098 | 3300013105 | Bacteria | 6773 |
| 222 | Ga0157369_10063246 | 3300013105 | Bacteria | 3987 |
| 223 | Ga0157369_10112543 | 3300013105 | Bacteria | 2891 |
| 224 | Ga0157374_10057130 | 3300013296 | Bacteria | 3644 |
| 225 | Ga0157374_10068936 | 3300013296 | Bacteria | 3329 |
| 226 | Ga0157378_10000043 | 3300013297 | Bacteria | 107750 |
| 227 | Ga0157378_10034449 | 3300013297 | Bacteria | 4478 |
| 228 | Ga0157378_10186933 | 3300013297 | Bacteria | 1952 |
| 229 | Ga0163162_10000015 | 3300013306 | Bacteria | 261996 |
| 230 | Ga0163162_10000236 | 3300013306 | Bacteria | 50620 |
| 231 | Ga0157372_10007227 | 3300013307 | Bacteria | 11826 |
| 232 | Ga0157372_10010524 | 3300013307 | Bacteria | 9844 |
| 233 | Ga0157372_10031403 | 3300013307 | Bacteria | 5816 |
| 234 | Ga0157372_10084957 | 3300013307 | Bacteria | 3589 |
| 235 | Ga0157372_10402504 | 3300013307 | Bacteria | 1595 |
| 236 | Ga0157372_10539578 | 3300013307 | Bacteria | 1360 |
| 237 | Ga0157375_10013746 | 3300013308 | Bacteria | 7216 |
| 238 | Ga0163163_10429229 | 3300014325 | Bacteria | 1381 |
| 239 | Ga0157380_10060113 | 3300014326 | Bacteria | 3035 |
| 240 | Ga0182008_10002881 | 3300014497 | Bacteria | 10649 |
| 241 | Ga0182008_10016310 | 3300014497 | Bacteria | 3861 |
| 242 | Ga0182008_10034286 | 3300014497 | Bacteria | 2545 |
| 243 | Ga0157376_10062563 | 3300014969 | Bacteria | 3132 |
| 244 | Ga0157376_10127877 | 3300014969 | Bacteria | 2263 |
| 245 | Ga0182006_1000072 | 3300015261 | Bacteria | 133681 |
| 246 | Ga0182006_1000765 | 3300015261 | Bacteria | 21862 |
| 247 | Ga0182006_1020561 | 3300015261 | Bacteria | 2764 |
| 248 | Ga0182007_10006852 | 3300015262 | Bacteria | 4846 |
| 249 | Ga0182007_10026602 | 3300015262 | Bacteria | 2003 |
| 250 | Ga0182005_1000080 | 3300015265 | Bacteria | 76011 |
| 251 | Ga0182005_1002839 | 3300015265 | Bacteria | 6035 |
| 252 | Ga0182005_1023524 | 3300015265 | Bacteria | 1683 |
| 253 | Ga0183369_1012 | 3300015685 | Bacteria | 251554 |
| 254 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 255 | Ga0163161_10003999 | 3300017792 | Bacteria | 10318 |
| 256 | Ga0163161_10213193 | 3300017792 | Bacteria | 1493 |
| 257 | Ga0163161_10281530 | 3300017792 | Bacteria | 1304 |
| 258 | Ga0206356_11572506 | 3300020070 | Bacteria | 2274 |
| 259 | Ga0209784_100047 | 3300025224 | Bacteria | 199596 |
| 260 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 261 | Ga0209674_100053 | 3300025226 | Bacteria | 323159 |
| 262 | Ga0209674_101380 | 3300025226 | Bacteria | 6528 |
| 263 | Ga0209674_101867 | 3300025226 | Bacteria | 4985 |
| 264 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 265 | Ga0209672_100056 | 3300025228 | Bacteria | 217675 |
| 266 | Ga0209672_100160 | 3300025228 | Bacteria | 57654 |
| 267 | Ga0209672_102153 | 3300025228 | Bacteria | 5198 |
| 268 | Ga0209563_100077 | 3300025230 | Bacteria | 205130 |
| 269 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 270 | Ga0207427_100040 | 3300025231 | Bacteria | 265135 |
| 271 | Ga0207427_100050 | 3300025231 | Bacteria | 227233 |
| 272 | Ga0207427_100166 | 3300025231 | Bacteria | 73732 |
| 273 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 274 | Ga0209437_100120 | 3300025233 | Bacteria | 205054 |
| 275 | Ga0209437_100172 | 3300025233 | Bacteria | 140146 |
| 276 | Ga0209437_100276 | 3300025233 | Bacteria | 76094 |
| 277 | Ga0209437_100288 | 3300025233 | Bacteria | 73732 |
| 278 | Ga0209437_100985 | 3300025233 | Bacteria | 10027 |
| 279 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 280 | Ga0209258_100043 | 3300025242 | Bacteria | 380685 |
| 281 | Ga0209258_100096 | 3300025242 | Bacteria | 217675 |
| 282 | Ga0209258_100246 | 3300025242 | Bacteria | 99606 |
| 283 | Ga0209258_100598 | 3300025242 | Bacteria | 29635 |
| 284 | Ga0209258_101191 | 3300025242 | Bacteria | 10392 |
| 285 | Ga0209646_1001741 | 3300025246 | Bacteria | 5489 |
| 286 | Ga0209646_1002174 | 3300025246 | Bacteria | 4538 |
| 287 | Ga0209646_1004458 | 3300025246 | Bacteria | 2550 |
| 288 | Ga0209026_1000047 | 3300025250 | Bacteria | 261867 |
| 289 | Ga0209026_1000101 | 3300025250 | Bacteria | 154866 |
| 290 | Ga0209026_1000157 | 3300025250 | Bacteria | 106621 |
| 291 | Ga0209026_1000397 | 3300025250 | Bacteria | 38769 |
| 292 | Ga0209026_1002418 | 3300025250 | Bacteria | 7026 |
| 293 | Ga0209026_1006975 | 3300025250 | Bacteria | 2640 |
| 294 | Ga0209677_111351 | 3300025253 | Bacteria | 1397 |
| 295 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 296 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 297 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 298 | Ga0209148_1000024 | 3300025254 | Bacteria | 669890 |
| 299 | Ga0209148_1000052 | 3300025254 | Bacteria | 399449 |
| 300 | Ga0209148_1000101 | 3300025254 | Bacteria | 217675 |
| 301 | Ga0209148_1002776 | 3300025254 | Bacteria | 5501 |
| 302 | Ga0209759_1000287 | 3300025256 | Bacteria | 70252 |
| 303 | Ga0209759_1000453 | 3300025256 | Bacteria | 47129 |
| 304 | Ga0209759_1000807 | 3300025256 | Bacteria | 25155 |
| 305 | Ga0209759_1001871 | 3300025256 | Bacteria | 10442 |
| 306 | Ga0209759_1002250 | 3300025256 | Bacteria | 8789 |
| 307 | Ga0209759_1010351 | 3300025256 | Bacteria | 2739 |
| 308 | Ga0209129_1001629 | 3300025258 | Bacteria | 12181 |
| 309 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 310 | Ga0209233_1000108 | 3300025261 | Bacteria | 265137 |
| 311 | Ga0209233_1000174 | 3300025261 | Bacteria | 144639 |
| 312 | Ga0209233_1000184 | 3300025261 | Bacteria | 134246 |
| 313 | Ga0209233_1000284 | 3300025261 | Bacteria | 69746 |
| 314 | Ga0209233_1017293 | 3300025261 | Bacteria | 1968 |
| 315 | Ga0209233_1018207 | 3300025261 | Bacteria | 1896 |
| 316 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 317 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 318 | Ga0209455_1000025 | 3300025272 | Bacteria | 670673 |
| 319 | Ga0209455_1000094 | 3300025272 | Bacteria | 217675 |
| 320 | Ga0209455_1000496 | 3300025272 | Bacteria | 28759 |
| 321 | Ga0209673_1003194 | 3300025273 | Bacteria | 9941 |
| 322 | Ga0209675_1024911 | 3300025291 | Bacteria | 1518 |
| 323 | Ga0209676_1001428 | 3300025292 | Bacteria | 22617 |
| 324 | Ga0209676_1002923 | 3300025292 | Bacteria | 11166 |
| 325 | Ga0209676_1006416 | 3300025292 | Bacteria | 5814 |
| 326 | Ga0209676_1007181 | 3300025292 | Bacteria | 5311 |
| 327 | Ga0209025_1022336 | 3300025294 | Bacteria | 3361 |
| 328 | Ga0209025_1027178 | 3300025294 | Bacteria | 2846 |
| 329 | Ga0209758_1001571 | 3300025297 | Bacteria | 26194 |
| 330 | Ga0209758_1033390 | 3300025297 | Bacteria | 2068 |
| 331 | Ga0209050_1000653 | 3300025298 | Bacteria | 53609 |
| 332 | Ga0209256_1005272 | 3300025299 | Bacteria | 7540 |
| 333 | Ga0209256_1017123 | 3300025299 | Bacteria | 2426 |
| 334 | Ga0207426_1008786 | 3300025302 | Bacteria | 4046 |
| 335 | Ga0209051_1002828 | 3300025303 | Bacteria | 11965 |
| 336 | Ga0209051_1004130 | 3300025303 | Bacteria | 9090 |
| 337 | Ga0209257_1000349 | 3300025304 | Bacteria | 95064 |
| 338 | Ga0209257_1008881 | 3300025304 | Bacteria | 5546 |
| 339 | Ga0209257_1030862 | 3300025304 | Bacteria | 1723 |
| 340 | Ga0207656_10000309 | 3300025321 | Bacteria | 16926 |
| 341 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 342 | Ga0207680_10001037 | 3300025903 | Bacteria | 13116 |
| 343 | Ga0207680_10008585 | 3300025903 | Bacteria | 5024 |
| 344 | Ga0207680_10093654 | 3300025903 | Bacteria | 1917 |
| 345 | Ga0207647_10000029 | 3300025904 | Bacteria | 109732 |
| 346 | Ga0207647_10000155 | 3300025904 | Bacteria | 54186 |
| 347 | Ga0207647_10032018 | 3300025904 | Bacteria | 3382 |
| 348 | Ga0207705_10062307 | 3300025909 | Bacteria | 2694 |
| 349 | Ga0207705_10210904 | 3300025909 | Bacteria | 1473 |
| 350 | Ga0207705_10246608 | 3300025909 | Bacteria | 1361 |
| 351 | Ga0207654_10129537 | 3300025911 | Bacteria | 1595 |
| 352 | Ga0207654_10178101 | 3300025911 | Bacteria | 1385 |
| 353 | Ga0207707_10000128 | 3300025912 | Bacteria | 78104 |
| 354 | Ga0207707_10000933 | 3300025912 | Bacteria | 28273 |
| 355 | Ga0207707_10007534 | 3300025912 | Bacteria | 9482 |
| 356 | Ga0207707_10117900 | 3300025912 | Bacteria | 2320 |
| 357 | Ga0207695_10000032 | 3300025913 | Bacteria | 521283 |
| 358 | Ga0207695_10000654 | 3300025913 | Bacteria | 68735 |
| 359 | Ga0207695_10001068 | 3300025913 | Bacteria | 47945 |
| 360 | Ga0207695_10005772 | 3300025913 | Bacteria | 16296 |
| 361 | Ga0207695_10006761 | 3300025913 | Bacteria | 14788 |
| 362 | Ga0207695_10055081 | 3300025913 | Bacteria | 4147 |
| 363 | Ga0207695_10064629 | 3300025913 | Bacteria | 3765 |
| 364 | Ga0207695_10114719 | 3300025913 | Bacteria | 2669 |
| 365 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 366 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 367 | Ga0207671_10000726 | 3300025914 | Bacteria | 41902 |
| 368 | Ga0207671_10022957 | 3300025914 | Bacteria | 4711 |
| 369 | Ga0207671_10030938 | 3300025914 | Bacteria | 3991 |
| 370 | Ga0207671_10032193 | 3300025914 | Bacteria | 3904 |
| 371 | Ga0207671_10039957 | 3300025914 | Bacteria | 3473 |
| 372 | Ga0207660_10272031 | 3300025917 | Bacteria | 1342 |
| 373 | Ga0207657_10173036 | 3300025919 | Bacteria | 1748 |
| 374 | Ga0207649_10072779 | 3300025920 | Bacteria | 2200 |
| 375 | Ga0207649_10113893 | 3300025920 | Bacteria | 1812 |
| 376 | Ga0207652_10002665 | 3300025921 | Bacteria | 14980 |
| 377 | Ga0207652_10053325 | 3300025921 | Bacteria | 3474 |
| 378 | Ga0207652_10090774 | 3300025921 | Bacteria | 2685 |
| 379 | Ga0207652_10116077 | 3300025921 | Bacteria | 2378 |
| 380 | Ga0207694_10001181 | 3300025924 | Bacteria | 22601 |
| 381 | Ga0207694_10008048 | 3300025924 | Bacteria | 7973 |
| 382 | Ga0207694_10008628 | 3300025924 | Bacteria | 7695 |
| 383 | Ga0207694_10035601 | 3300025924 | Bacteria | 3820 |
| 384 | Ga0207694_10156168 | 3300025924 | Bacteria | 1840 |
| 385 | Ga0207694_10293204 | 3300025924 | Bacteria | 1338 |
| 386 | Ga0207659_10126534 | 3300025926 | Bacteria | 1966 |
| 387 | Ga0207700_10002664 | 3300025928 | Bacteria | 10287 |
| 388 | Ga0207664_10000021 | 3300025929 | Bacteria | 216875 |
| 389 | Ga0207664_10016425 | 3300025929 | Bacteria | 5399 |
| 390 | Ga0207690_10013241 | 3300025932 | Bacteria | 4952 |
| 391 | Ga0207690_10122194 | 3300025932 | Bacteria | 1893 |
| 392 | Ga0207706_10007442 | 3300025933 | Bacteria | 10126 |
| 393 | Ga0207706_10148074 | 3300025933 | Bacteria | 2065 |
| 394 | Ga0207670_10026070 | 3300025936 | Bacteria | 3680 |
| 395 | Ga0207669_10044591 | 3300025937 | Bacteria | 2607 |
| 396 | Ga0207691_10032993 | 3300025940 | Bacteria | 4823 |
| 397 | Ga0207711_10000470 | 3300025941 | Bacteria | 41566 |
| 398 | Ga0207689_10100393 | 3300025942 | Bacteria | 2377 |
| 399 | Ga0207689_10396646 | 3300025942 | Bacteria | 1150 |
| 400 | Ga0207689_10550233 | 3300025942 | Bacteria | 969 |
| 401 | Ga0207679_10112227 | 3300025945 | Bacteria | 2154 |
| 402 | Ga0207667_10000130 | 3300025949 | Bacteria | 115321 |
| 403 | Ga0207667_10000416 | 3300025949 | Bacteria | 57683 |
| 404 | Ga0207667_10043422 | 3300025949 | Bacteria | 4770 |
| 405 | Ga0207667_10094525 | 3300025949 | Bacteria | 3086 |
| 406 | Ga0207667_10132317 | 3300025949 | Bacteria | 2569 |
| 407 | Ga0207667_10148214 | 3300025949 | Bacteria | 2415 |
| 408 | Ga0207667_10296209 | 3300025949 | Bacteria | 1653 |
| 409 | Ga0207667_10403195 | 3300025949 | Bacteria | 1392 |
| 410 | Ga0207712_10000771 | 3300025961 | Bacteria | 23954 |
| 411 | Ga0207712_10002780 | 3300025961 | Bacteria | 11194 |
| 412 | Ga0207712_10128718 | 3300025961 | Bacteria | 1926 |
| 413 | Ga0207640_10000103 | 3300025981 | Bacteria | 65214 |
| 414 | Ga0207640_10028015 | 3300025981 | Bacteria | 3438 |
| 415 | Ga0207640_10099336 | 3300025981 | Bacteria | 2037 |
| 416 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 417 | Ga0207658_10008000 | 3300025986 | Bacteria | 7200 |
| 418 | Ga0207658_10416062 | 3300025986 | Bacteria | 1184 |
| 419 | Ga0207703_10001094 | 3300026035 | Bacteria | 25767 |
| 420 | Ga0207703_10061090 | 3300026035 | Bacteria | 3084 |
| 421 | Ga0207703_10083079 | 3300026035 | Bacteria | 2675 |
| 422 | Ga0207639_10001632 | 3300026041 | Bacteria | 15088 |
| 423 | Ga0207639_10002290 | 3300026041 | Bacteria | 12858 |
| 424 | Ga0207639_10006988 | 3300026041 | Bacteria | 7691 |
| 425 | Ga0207639_10008722 | 3300026041 | Bacteria | 6960 |
| 426 | Ga0207639_10015296 | 3300026041 | Bacteria | 5410 |
| 427 | Ga0207639_10036600 | 3300026041 | Bacteria | 3638 |
| 428 | Ga0207639_10168545 | 3300026041 | Bacteria | 1852 |
| 429 | Ga0207639_10222282 | 3300026041 | Bacteria | 1632 |
| 430 | Ga0207678_10001340 | 3300026067 | Bacteria | 22694 |
| 431 | Ga0207678_10002479 | 3300026067 | Bacteria | 16776 |
| 432 | Ga0207678_10017061 | 3300026067 | Bacteria | 6375 |
| 433 | Ga0207678_10020658 | 3300026067 | Bacteria | 5772 |
| 434 | Ga0207678_10096161 | 3300026067 | Bacteria | 2531 |
| 435 | Ga0207678_10375238 | 3300026067 | Bacteria | 1229 |
| 436 | Ga0207678_10554348 | 3300026067 | Bacteria | 1005 |
| 437 | Ga0207702_10000456 | 3300026078 | Bacteria | 46149 |
| 438 | Ga0207702_10005747 | 3300026078 | Bacteria | 10805 |
| 439 | Ga0207702_10013037 | 3300026078 | Bacteria | 6914 |
| 440 | Ga0207702_10041945 | 3300026078 | Bacteria | 3837 |
| 441 | Ga0207702_10324436 | 3300026078 | Bacteria | 1467 |
| 442 | Ga0207641_10081865 | 3300026088 | Bacteria | 2804 |
| 443 | Ga0207641_10124845 | 3300026088 | Bacteria | 2303 |
| 444 | Ga0207641_10449179 | 3300026088 | Bacteria | 1245 |
| 445 | Ga0207674_10000971 | 3300026116 | Bacteria | 37506 |
| 446 | Ga0207674_10017518 | 3300026116 | Bacteria | 7815 |
| 447 | Ga0207674_10085992 | 3300026116 | Bacteria | 3139 |
| 448 | Ga0207674_10202828 | 3300026116 | Bacteria | 1933 |
| 449 | Ga0207698_10008023 | 3300026142 | Bacteria | 6656 |
| 450 | Ga0207698_10015318 | 3300026142 | Bacteria | 5131 |
| 451 | Ga0207698_10022708 | 3300026142 | Bacteria | 4368 |
| 452 | Ga0207698_10063010 | 3300026142 | Bacteria | 2899 |
| 453 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 454 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 455 | Ga0268266_10054785 | 3300028379 | Bacteria | 3428 |
| 456 | Ga0268266_10156488 | 3300028379 | Bacteria | 2059 |
| 457 | Ga0268265_10003764 | 3300028380 | Bacteria | 10765 |
| 458 | Ga0268265_10255503 | 3300028380 | Bacteria | 1555 |
| 459 | Ga0268265_10381496 | 3300028380 | Bacteria | 1297 |
| 460 | Ga0316177_1132861 | 3300030731 | Bacteria | 1750 |
| 461 | Ga0314311_1204266 | 3300030733 | Bacteria | 3894 |
| 462 | Ga0316180_1077455 | 3300030736 | Bacteria | 1335 |
| 463 | Ga0307513_10147202 | 3300031456 | Bacteria | 2271 |
| 464 | Ga0307408_100202443 | 3300031548 | Bacteria | 1608 |
| 465 | Ga0307408_100617295 | 3300031548 | Bacteria | 965 |
| 466 | Ga0307508_10221850 | 3300031616 | Bacteria | 1490 |
| 467 | Ga0307516_10027810 | 3300031730 | Bacteria | 5731 |
| 468 | Ga0307516_10041474 | 3300031730 | Bacteria | 4574 |
| 469 | Ga0307405_10230407 | 3300031731 | Bacteria | 1365 |
| 470 | Ga0307413_10003477 | 3300031824 | Bacteria | 6634 |
| 471 | Ga0307413_10113898 | 3300031824 | Bacteria | 1816 |
| 472 | Ga0307413_10163139 | 3300031824 | Bacteria | 1568 |
| 473 | Ga0307413_10237906 | 3300031824 | Bacteria | 1342 |
| 474 | Ga0307410_10119478 | 3300031852 | Bacteria | 1920 |
| 475 | Ga0307406_10003052 | 3300031901 | Bacteria | 9112 |
| 476 | Ga0307406_10072175 | 3300031901 | Bacteria | 2265 |
| 477 | Ga0307406_10250419 | 3300031901 | Bacteria | 1334 |
| 478 | Ga0307412_10027813 | 3300031911 | Bacteria | 3531 |
| 479 | Ga0307412_10090826 | 3300031911 | Bacteria | 2136 |
| 480 | Ga0307412_10285015 | 3300031911 | Bacteria | 1298 |
| 481 | Ga0307412_10342315 | 3300031911 | Bacteria | 1197 |
| 482 | Ga0307409_100247765 | 3300031995 | Bacteria | 1627 |
| 483 | Ga0307416_100016290 | 3300032002 | Bacteria | 5162 |
| 484 | Ga0307416_100056522 | 3300032002 | Bacteria | 3168 |
| 485 | Ga0307414_10002380 | 3300032004 | Bacteria | 9831 |
| 486 | Ga0307414_10021965 | 3300032004 | Bacteria | 4016 |
| 487 | Ga0307414_10091886 | 3300032004 | Bacteria | 2257 |
| 488 | Ga0307414_10435039 | 3300032004 | Bacteria | 1147 |
| 489 | Ga0307414_10453379 | 3300032004 | Bacteria | 1125 |
| 490 | Ga0307415_100312929 | 3300032126 | Bacteria | 1306 |
| 491 | Ga0307415_100337619 | 3300032126 | Bacteria | 1263 |
| 492 | Ga0307507_10180097 | 3300033179 | Bacteria | 1512 |
| 493 | Ga0307510_10009680 | 3300033180 | Bacteria | 11472 |
| 494 | Ga0395899_0000195 | 3300037312 | Bacteria | 89015 |
| 495 | Ga0395899_0038388 | 3300037312 | Bacteria | 3586 |
| 496 | Ga0395899_0257278 | 3300037312 | Bacteria | 1195 |
| 497 | Ga0395900_0000018 | 3300037418 | Bacteria | 363472 |
| 498 | Ga0395900_0000590 | 3300037418 | Bacteria | 49754 |
| 499 | Ga0395900_0001671 | 3300037418 | Bacteria | 25867 |
| 500 | Ga0395900_0005906 | 3300037418 | Bacteria | 12783 |
| 501 | Ga0395900_0022713 | 3300037418 | Bacteria | 6420 |
| 502 | Ga0395900_0038954 | 3300037418 | Bacteria | 4899 |
| 503 | Ga0395898_0000213 | 3300037466 | Bacteria | 149036 |
| 504 | Ga0395898_0003959 | 3300037466 | Bacteria | 16322 |
| 505 | Ga0395898_0005025 | 3300037466 | Bacteria | 14348 |
| 506 | Ga0395898_0008956 | 3300037466 | Bacteria | 10537 |
| 507 | Ga0395901_0000280 | 3300038443 | Bacteria | 63153 |
| 508 | Ga0395901_0026050 | 3300038443 | Bacteria | 6005 |
| 509 | Ga0395901_0058473 | 3300038443 | Bacteria | 4009 |
| 510 | Ga0395901_0196775 | 3300038443 | Bacteria | 2113 |
| 511 | Ga0237819_00016 | 3300038705 | Bacteria | 57788 |
| 512 | Ga0439436_0000077 | 3300041404 | Bacteria | 25168 |
| 513 | Ga0439436_0008203 | 3300041404 | Bacteria | 3210 |
| 514 | Ga0439465_0000644 | 3300041413 | Bacteria | 10664 |
| 515 | Ga0439465_0003155 | 3300041413 | Bacteria | 5383 |
| 516 | Ga0439465_0003459 | 3300041413 | Bacteria | 5147 |
| 517 | Ga0439465_0003773 | 3300041413 | Bacteria | 4943 |
| 518 | Ga0451789_0254233 | 3300041443 | Bacteria | 851 |
| 519 | Ga0451791_1222002 | 3300041451 | Bacteria | 2535 |
| 520 | Ga0451793_0691818 | 3300041452 | Bacteria | 3910 |
| 521 | Ga0451793_0770297 | 3300041452 | Bacteria | 1543 |
| 522 | Ga0451793_1759138 | 3300041452 | Bacteria | 2329 |
| 523 | Ga0451802_0367711 | 3300041460 | Bacteria | 2556 |
| 524 | Ga0451802_0598371 | 3300041460 | Bacteria | 3526 |
| 525 | Ga0451807_0790658 | 3300041486 | Bacteria | 3448 |
| 526 | Ga0451833_0314086 | 3300041491 | Bacteria | 1227 |
| 527 | Ga0451837_0512683 | 3300041494 | Bacteria | 1569 |
| 528 | Ga0451841_0863707 | 3300041498 | Bacteria | 1892 |
| 529 | Ga0451849_0270298 | 3300041505 | Bacteria | 1229 |
| 530 | Ga0451853_1963870 | 3300041512 | Bacteria | 910 |
| 531 | Ga0451853_1972459 | 3300041512 | Bacteria | 2999 |
| 532 | Ga0439431_0028946 | 3300041997 | Bacteria | 1366 |
| 533 | Ga0439445_0002207 | 3300042004 | Bacteria | 4318 |
| 534 | Ga0439432_001663 | 3300042006 | Bacteria | 8328 |
| 535 | Ga0439432_003552 | 3300042006 | Bacteria | 5769 |
| 536 | Ga0439449_0001191 | 3300042007 | Bacteria | 10211 |
| 537 | Ga0439449_0002570 | 3300042007 | Bacteria | 7088 |
| 538 | Ga0439449_0005497 | 3300042007 | Bacteria | 4854 |
| 539 | Ga0439449_0010383 | 3300042007 | Bacteria | 3516 |
| 540 | Ga0439449_0020304 | 3300042007 | Bacteria | 2489 |
| 541 | Ga0439457_010121 | 3300042014 | Bacteria | 2177 |
| 542 | Ga0450894_007665 | 3300042131 | Bacteria | 1393 |
| 543 | Ga0439459_0004199 | 3300042438 | Bacteria | 2310 |
| 544 | Ga0451577_0042692 | 3300042876 | Bacteria | 4066 |
| 545 | Ga0451577_0050412 | 3300042876 | Bacteria | 3716 |
| 546 | Ga0451577_0068951 | 3300042876 | Bacteria | 3154 |
| 547 | Ga0466969_0008996 | 3300044656 | Bacteria | 5292 |
| 548 | Ga0466969_0012302 | 3300044656 | Bacteria | 4514 |
| 549 | Ga0466982_0000020 | 3300044672 | Bacteria | 99164 |
| 550 | Ga0466982_0001149 | 3300044672 | Bacteria | 9250 |
| 551 | Ga0466965_0018012 | 3300044683 | Bacteria | 3380 |
| 552 | Ga0466965_0048771 | 3300044683 | Bacteria | 2098 |
| 553 | Ga0466966_0012209 | 3300044684 | Bacteria | 5691 |
| 554 | Ga0466966_0053515 | 3300044684 | Bacteria | 2560 |
| 555 | Ga0466961_0000944 | 3300044693 | Bacteria | 18003 |
| 556 | Ga0466961_0003373 | 3300044693 | Bacteria | 9972 |
| 557 | Ga0466961_0010106 | 3300044693 | Bacteria | 6012 |
| 558 | Ga0466961_0018571 | 3300044693 | Bacteria | 4475 |
| 559 | Ga0466961_0067987 | 3300044693 | Bacteria | 2263 |
| 560 | Ga0466963_0164429 | 3300044694 | Bacteria | 1546 |
| 561 | Ga0466963_0457744 | 3300044694 | Bacteria | 900 |
| 562 | Ga0466964_0016461 | 3300044706 | Bacteria | 2824 |
| 563 | Ga0466971_0002694 | 3300044719 | Bacteria | 7504 |
| 564 | Ga0466968_0001238 | 3300044735 | Bacteria | 9064 |
| 565 | Ga0466968_0007195 | 3300044735 | Bacteria | 4228 |
| 566 | Ga0466968_0045493 | 3300044735 | Bacteria | 1863 |
| 567 | Ga0466970_0010599 | 3300044765 | Bacteria | 4681 |
| 568 | Ga0466970_0012342 | 3300044765 | Bacteria | 4366 |
| 569 | Ga0466957_0005144 | 3300044842 | Bacteria | 7312 |
| 570 | Ga0466960_0036956 | 3300044901 | Bacteria | 2289 |
| 571 | Ga0466959_0004692 | 3300045049 | Bacteria | 9203 |
| 572 | Ga0466959_0007758 | 3300045049 | Bacteria | 7548 |
| 573 | Ga0466959_0032260 | 3300045049 | Bacteria | 3877 |
| 574 | Ga0466958_0007344 | 3300045836 | Bacteria | 6054 |
| 575 | Ga0466958_0016157 | 3300045836 | Bacteria | 4294 |
| 576 | Ga0466967_0060040 | 3300045976 | Bacteria | 3368 |
| 577 | Ga0466967_0086091 | 3300045976 | Bacteria | 2847 |
| 578 | Ga0466967_0823244 | 3300045976 | Bacteria | 922 |
| 579 | Ga0495617_000117 | 3300046452 | Bacteria | 54105 |
| 580 | Ga0495617_000581 | 3300046452 | Bacteria | 18687 |
| 581 | Ga0495590_0076070 | 3300046457 | Bacteria | 1181 |
| 582 | Ga0495638_0000063 | 3300046460 | Bacteria | 185733 |
| 583 | Ga0495638_0002410 | 3300046460 | Bacteria | 15282 |
| 584 | Ga0495638_0013756 | 3300046460 | Bacteria | 5495 |
| 585 | Ga0495638_0017459 | 3300046460 | Bacteria | 4781 |
| 586 | Ga0495638_0054786 | 3300046460 | Bacteria | 2478 |
| 587 | Ga0495638_0063767 | 3300046460 | Bacteria | 2271 |
| 588 | Ga0495638_0069762 | 3300046460 | Bacteria | 2153 |
| 589 | Ga0495650_0000875 | 3300046471 | Bacteria | 35798 |
| 590 | Ga0495650_0002180 | 3300046471 | Bacteria | 16561 |
| 591 | Ga0495650_0004550 | 3300046471 | Bacteria | 9466 |
| 592 | Ga0495650_0019238 | 3300046471 | Bacteria | 3371 |
| 593 | Ga0495585_0002200 | 3300046492 | Bacteria | 14164 |
| 594 | Ga0495585_0003818 | 3300046492 | Bacteria | 10037 |
| 595 | Ga0495607_0000122 | 3300046501 | Bacteria | 81489 |
| 596 | Ga0495607_0000837 | 3300046501 | Bacteria | 29060 |
| 597 | Ga0495607_0005180 | 3300046501 | Bacteria | 9398 |
| 598 | Ga0495607_0014544 | 3300046501 | Bacteria | 5117 |
| 599 | Ga0495583_0038301 | 3300046506 | Bacteria | 2265 |
| 600 | Ga0495606_0000298 | 3300046507 | Bacteria | 85739 |
| 601 | Ga0495606_0002450 | 3300046507 | Bacteria | 21555 |
| 602 | Ga0495606_0006272 | 3300046507 | Bacteria | 11028 |
| 603 | Ga0495606_0009016 | 3300046507 | Bacteria | 8526 |
| 604 | Ga0495606_0018751 | 3300046507 | Bacteria | 5175 |
| 605 | Ga0495610_0054923 | 3300046512 | Bacteria | 1922 |
| 606 | Ga0495616_0000565 | 3300046513 | Bacteria | 28011 |
| 607 | Ga0495620_0003610 | 3300046515 | Bacteria | 8838 |
| 608 | Ga0495620_0007544 | 3300046515 | Bacteria | 5899 |
| 609 | Ga0495631_0000808 | 3300046518 | Bacteria | 19998 |
| 610 | Ga0495631_0001788 | 3300046518 | Bacteria | 12750 |
| 611 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 612 | Ga0495632_0015386 | 3300046519 | Bacteria | 4293 |
| 613 | Ga0495632_0033993 | 3300046519 | Bacteria | 2612 |
| 614 | Ga0495632_0192441 | 3300046519 | Bacteria | 931 |
| 615 | Ga0495637_0003747 | 3300046520 | Bacteria | 8024 |
| 616 | Ga0495643_0061790 | 3300046522 | Bacteria | 1985 |
| 617 | Ga0495648_0002534 | 3300046524 | Bacteria | 16751 |
| 618 | Ga0495648_0004865 | 3300046524 | Bacteria | 11320 |
| 619 | Ga0495663_0008055 | 3300046525 | Bacteria | 2916 |
| 620 | Ga0495663_0034095 | 3300046525 | Bacteria | 1522 |
| 621 | Ga0495654_0064899 | 3300046530 | Bacteria | 1744 |
| 622 | Ga0495609_0003075 | 3300046538 | Bacteria | 9784 |
| 623 | Ga0495621_0117367 | 3300046539 | Bacteria | 1026 |
| 624 | Ga0495597_0109933 | 3300046542 | Bacteria | 1156 |
| 625 | Ga0495633_0009864 | 3300046558 | Bacteria | 5247 |
| 626 | Ga0495656_0032319 | 3300046615 | Bacteria | 2128 |
| 627 | Ga0495668_0003466 | 3300046616 | Bacteria | 11779 |
| 628 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 629 | Ga0495611_0000952 | 3300046648 | Bacteria | 15498 |
| 630 | Ga0495625_0000022 | 3300046660 | Bacteria | 278823 |
| 631 | Ga0495625_0017937 | 3300046660 | Bacteria | 5532 |
| 632 | Ga0495625_0018982 | 3300046660 | Bacteria | 5350 |
| 633 | Ga0495625_0057378 | 3300046660 | Bacteria | 2769 |
| 634 | Ga0495625_0101758 | 3300046660 | Bacteria | 1973 |
| 635 | Ga0495659_0018325 | 3300046664 | Bacteria | 2332 |
| 636 | Ga0495661_0006772 | 3300046665 | Bacteria | 8034 |
| 637 | Ga0495588_0092605 | 3300046674 | Bacteria | 1584 |
| 638 | Ga0495670_0005343 | 3300046691 | Bacteria | 6318 |
| 639 | Ga0495670_0021443 | 3300046691 | Bacteria | 3186 |
| 640 | Ga0495671_0002998 | 3300046692 | Bacteria | 10490 |
| 641 | Ga0495671_0019429 | 3300046692 | Bacteria | 3592 |
| 642 | Ga0495649_0008433 | 3300046694 | Bacteria | 6202 |
| 643 | Ga0495649_0032443 | 3300046694 | Bacteria | 2876 |
| 644 | Ga0495589_0000137 | 3300046794 | Bacteria | 67614 |
| 645 | Ga0495660_0000728 | 3300046810 | Bacteria | 25032 |
| 646 | Ga0495660_0001915 | 3300046810 | Bacteria | 13593 |
| 647 | Ga0495636_0039933 | 3300047318 | Bacteria | 1944 |
| 648 | Ga0495672_0013666 | 3300047320 | Bacteria | 5589 |
| 649 | Ga0495683_0001586 | 3300047323 | Bacteria | 14650 |
| 650 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 651 | Ga0495685_032761 | 3300047447 | Bacteria | 1786 |
| 652 | Ga0495673_0000202 | 3300047469 | Bacteria | 90523 |
| 653 | Ga0495673_0000749 | 3300047469 | Bacteria | 30861 |
| 654 | Ga0495673_0003957 | 3300047469 | Bacteria | 9490 |
| 655 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 656 | Ga0495686_0007599 | 3300047472 | Bacteria | 8096 |
| 657 | Ga0495686_0012978 | 3300047472 | Bacteria | 5804 |
| 658 | Ga0495686_0026186 | 3300047472 | Bacteria | 3816 |
| 659 | Ga0495686_0046373 | 3300047472 | Bacteria | 2747 |
| 660 | Ga0496101_0084988 | 3300048904 | Bacteria | 2344 |
| 661 | Ga0496102_0091951 | 3300048905 | Bacteria | 2809 |
| 662 | Ga0496102_0143100 | 3300048905 | Bacteria | 2243 |
| 663 | Ga0496103_0399812 | 3300048906 | Bacteria | 882 |
| 664 | Ga0496104_0255592 | 3300048907 | Bacteria | 1665 |
| 665 | Ga0496104_0484599 | 3300048907 | Bacteria | 1148 |
| 666 | Ga0496105_0042121 | 3300048908 | Bacteria | 3764 |
| 667 | Ga0496106_0001864 | 3300048909 | Bacteria | 15779 |
| 668 | Ga0496107_0108163 | 3300048910 | Bacteria | 2042 |
| 669 | Ga0496108_0375265 | 3300048911 | Bacteria | 1242 |
| 670 | Ga0496113_0007102 | 3300048916 | Bacteria | 7168 |
| 671 | Ga0496113_0141683 | 3300048916 | Bacteria | 1892 |
| 672 | Ga0496115_0000024 | 3300048918 | Bacteria | 154488 |
| 673 | Ga0496115_0024172 | 3300048918 | Bacteria | 4720 |
| 674 | Ga0496115_0076325 | 3300048918 | Bacteria | 2723 |
| 675 | Ga0496116_0079572 | 3300048919 | Bacteria | 2039 |
| 676 | Ga0496117_0029620 | 3300048920 | Bacteria | 4217 |
| 677 | Ga0496117_0071799 | 3300048920 | Bacteria | 2318 |
| 678 | Ga0496117_0081132 | 3300048920 | Bacteria | 2130 |
| 679 | Ga0496118_0000177 | 3300048921 | Bacteria | 114183 |
| 680 | Ga0496118_0002418 | 3300048921 | Bacteria | 25175 |
| 681 | Ga0496118_0002476 | 3300048921 | Bacteria | 24790 |
| 682 | Ga0496118_0004210 | 3300048921 | Bacteria | 17288 |
| 683 | Ga0496118_0004740 | 3300048921 | Bacteria | 15919 |
| 684 | Ga0496118_0027688 | 3300048921 | Bacteria | 4789 |
| 685 | Ga0496118_0110082 | 3300048921 | Bacteria | 1831 |
| 686 | Ga0496118_0127683 | 3300048921 | Bacteria | 1640 |
| 687 | Ga0496118_0304649 | 3300048921 | Bacteria | 873 |
| 688 | Ga0496119_0001058 | 3300048922 | Bacteria | 35115 |
| 689 | Ga0496119_0011077 | 3300048922 | Bacteria | 7511 |
| 690 | Ga0496119_0191123 | 3300048922 | Bacteria | 1067 |
| 691 | Ga0496120_0002531 | 3300048923 | Bacteria | 18257 |
| 692 | Ga0496120_0005836 | 3300048923 | Bacteria | 9633 |
| 693 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 694 | Ga0496121_0002752 | 3300048924 | Bacteria | 26142 |
| 695 | Ga0496121_0006364 | 3300048924 | Bacteria | 14713 |
| 696 | Ga0496121_0007030 | 3300048924 | Bacteria | 13667 |
| 697 | Ga0496121_0028511 | 3300048924 | Bacteria | 5194 |
| 698 | Ga0496121_0098342 | 3300048924 | Bacteria | 2265 |
| 699 | Ga0496121_0116490 | 3300048924 | Bacteria | 2026 |
| 700 | Ga0496122_0000463 | 3300048925 | Bacteria | 84540 |
| 701 | Ga0496122_0025121 | 3300048925 | Bacteria | 5189 |
| 702 | Ga0496122_0125885 | 3300048925 | Bacteria | 1640 |
| 703 | Ga0496122_0178467 | 3300048925 | Bacteria | 1270 |
| 704 | Ga0496123_0000151 | 3300048926 | Bacteria | 141062 |
| 705 | Ga0496123_0000296 | 3300048926 | Bacteria | 97428 |
| 706 | Ga0496123_0007960 | 3300048926 | Bacteria | 9833 |
| 707 | Ga0496123_0010916 | 3300048926 | Bacteria | 7950 |
| 708 | Ga0496123_0040635 | 3300048926 | Bacteria | 3235 |
| 709 | Ga0496123_0045771 | 3300048926 | Bacteria | 2976 |
| 710 | Ga0496123_0061677 | 3300048926 | Bacteria | 2407 |
| 711 | Ga0496124_0000482 | 3300048927 | Bacteria | 68586 |
| 712 | Ga0496124_0002985 | 3300048927 | Bacteria | 21170 |
| 713 | Ga0496124_0003150 | 3300048927 | Bacteria | 20397 |
| 714 | Ga0496125_0000344 | 3300048928 | Bacteria | 88380 |
| 715 | Ga0496125_0028954 | 3300048928 | Bacteria | 4989 |
| 716 | Ga0496125_0039288 | 3300048928 | Bacteria | 4078 |
| 717 | Ga0496126_0000581 | 3300048929 | Bacteria | 69541 |
| 718 | Ga0496126_0013162 | 3300048929 | Bacteria | 8438 |
| 719 | Ga0496126_0015164 | 3300048929 | Bacteria | 7761 |
| 720 | Ga0496126_0175956 | 3300048929 | Bacteria | 1820 |
| 721 | Ga0496126_0190285 | 3300048929 | Bacteria | 1738 |
| 722 | Ga0495678_000099 | 3300049459 | Bacteria | 106223 |
| 723 | Ga0495682_0006476 | 3300049460 | Bacteria | 4730 |
| 724 | Ga0501031_0078488 | 3300049568 | Bacteria | 2151 |
| 725 | Ga0501031_0086544 | 3300049568 | Bacteria | 2043 |
| 726 | Ga0501032_0002234 | 3300049569 | Bacteria | 15250 |
| 727 | Ga0501032_0006980 | 3300049569 | Bacteria | 8280 |
| 728 | Ga0501032_0205933 | 3300049569 | Bacteria | 1283 |
| 729 | Ga0501033_0008723 | 3300049570 | Bacteria | 7840 |
| 730 | Ga0501033_0013188 | 3300049570 | Bacteria | 6296 |
| 731 | Ga0501033_0015054 | 3300049570 | Bacteria | 5868 |
| 732 | Ga0501033_0032082 | 3300049570 | Bacteria | 3943 |
| 733 | Ga0501033_0124633 | 3300049570 | Bacteria | 1868 |
| 734 | Ga0501033_0445824 | 3300049570 | Bacteria | 899 |
| 735 | Ga0501034_0000749 | 3300049571 | Bacteria | 49004 |
| 736 | Ga0501034_0005361 | 3300049571 | Bacteria | 14039 |
| 737 | Ga0501034_0009045 | 3300049571 | Bacteria | 10460 |
| 738 | Ga0501034_0055709 | 3300049571 | Bacteria | 3978 |
| 739 | Ga0501034_0114586 | 3300049571 | Bacteria | 2684 |
| 740 | Ga0501034_0240968 | 3300049571 | Bacteria | 1754 |
| 741 | Ga0501034_0605973 | 3300049571 | Bacteria | 1000 |
| 742 | Ga0501036_0019205 | 3300049572 | Bacteria | 5734 |
| 743 | Ga0501036_0100147 | 3300049572 | Bacteria | 2451 |
| 744 | Ga0501036_0174120 | 3300049572 | Bacteria | 1812 |
| 745 | Ga0501037_0000499 | 3300049573 | Bacteria | 31684 |
| 746 | Ga0501037_0022489 | 3300049573 | Bacteria | 4664 |
| 747 | Ga0501037_0045944 | 3300049573 | Bacteria | 3204 |
| 748 | Ga0501037_0049817 | 3300049573 | Bacteria | 3066 |
| 749 | Ga0501038_0003315 | 3300049574 | Bacteria | 15016 |
| 750 | Ga0501038_0020720 | 3300049574 | Bacteria | 5909 |
| 751 | Ga0501039_0002265 | 3300049575 | Bacteria | 14289 |
| 752 | Ga0501039_0052503 | 3300049575 | Bacteria | 3154 |
| 753 | Ga0501039_0065333 | 3300049575 | Bacteria | 2822 |
| 754 | Ga0501042_0158396 | 3300049578 | Bacteria | 1633 |
| 755 | Ga0501043_0002627 | 3300049579 | Bacteria | 15124 |
| 756 | Ga0501043_0012216 | 3300049579 | Bacteria | 6713 |
| 757 | Ga0501043_0014452 | 3300049579 | Bacteria | 6179 |
| 758 | Ga0501043_0056868 | 3300049579 | Bacteria | 3072 |
| 759 | Ga0501043_0112224 | 3300049579 | Bacteria | 2140 |
| 760 | Ga0501043_0211475 | 3300049579 | Bacteria | 1503 |
| 761 | Ga0501046_0003027 | 3300049580 | Bacteria | 15530 |
| 762 | Ga0501046_0038819 | 3300049580 | Bacteria | 3819 |
| 763 | Ga0501046_0043282 | 3300049580 | Bacteria | 3585 |
| 764 | Ga0501047_0018151 | 3300049581 | Bacteria | 6741 |
| 765 | Ga0501047_0038405 | 3300049581 | Bacteria | 4633 |
| 766 | Ga0501047_0043428 | 3300049581 | Bacteria | 4342 |
| 767 | Ga0501047_0056354 | 3300049581 | Bacteria | 3800 |
| 768 | Ga0501047_0066314 | 3300049581 | Bacteria | 3479 |
| 769 | Ga0501048_0048236 | 3300049582 | Bacteria | 3038 |
| 770 | Ga0501067_0253724 | 3300049583 | Bacteria | 979 |
| 771 | Ga0501070_0008013 | 3300049586 | Bacteria | 8945 |
| 772 | Ga0501070_0020130 | 3300049586 | Bacteria | 5597 |
| 773 | Ga0501070_0049330 | 3300049586 | Bacteria | 3496 |
| 774 | Ga0501070_0246544 | 3300049586 | Bacteria | 1462 |
| 775 | Ga0501073_0050433 | 3300049589 | Bacteria | 2916 |
| 776 | Ga0501073_0103846 | 3300049589 | Bacteria | 1973 |
| 777 | Ga0501077_0185606 | 3300049593 | Bacteria | 1321 |
| 778 | Ga0501202_021695 | 3300049652 | Bacteria | 1285 |
| 779 | Ga0501252_007166 | 3300049682 | Bacteria | 1257 |
| 780 | Ga0501225_0004823 | 3300049705 | Bacteria | 3988 |
| 781 | Ga0501079_0096867 | 3300049741 | Bacteria | 2287 |
| 782 | Ga0501080_0031544 | 3300049742 | Bacteria | 4937 |
| 783 | Ga0501080_0033050 | 3300049742 | Bacteria | 4827 |
| 784 | Ga0501080_0089212 | 3300049742 | Bacteria | 2864 |
| 785 | Ga0501080_0104868 | 3300049742 | Bacteria | 2621 |
| 786 | Ga0501275_000227 | 3300049772 | Bacteria | 6573 |
| 787 | Ga0501035_0004851 | 3300049822 | Bacteria | 12751 |
| 788 | Ga0501035_0011534 | 3300049822 | Bacteria | 8189 |
| 789 | Ga0501035_0015245 | 3300049822 | Bacteria | 7093 |
| 790 | Ga0501035_0017817 | 3300049822 | Bacteria | 6551 |
| 791 | Ga0501035_0029374 | 3300049822 | Bacteria | 5013 |
| 792 | Ga0501035_0044167 | 3300049822 | Bacteria | 4013 |
| 793 | Ga0501035_0124664 | 3300049822 | Bacteria | 2249 |
| 794 | Ga0501035_0226568 | 3300049822 | Bacteria | 1594 |
| 795 | Ga0501035_0325564 | 3300049822 | Bacteria | 1290 |
| 796 | Ga0501044_0024669 | 3300049823 | Bacteria | 6379 |
| 797 | Ga0501044_0070459 | 3300049823 | Bacteria | 3556 |
| 798 | Ga0501044_0073227 | 3300049823 | Bacteria | 3482 |
| 799 | Ga0501044_0105390 | 3300049823 | Bacteria | 2832 |
| 800 | Ga0501044_0130531 | 3300049823 | Bacteria | 2507 |
| 801 | Ga0501044_0282966 | 3300049823 | Bacteria | 1591 |
| 802 | Ga0501044_0290150 | 3300049823 | Bacteria | 1567 |
| 803 | Ga0501044_0404938 | 3300049823 | Bacteria | 1276 |
| 804 | Ga0501044_0701654 | 3300049823 | Bacteria | 897 |
| 805 | nmdc:mga00v17_118_c1 | 3300050491 | Bacteria | 46536 |
| 806 | nmdc:mga00v17_7454_c1 | 3300050491 | Bacteria | 5840 |
| 807 | nmdc:mga08y16_283513_c1 | 3300050511 | Bacteria | 1708 |
| 808 | Ga0500643_011271 | 3300053087 | Bacteria | 3270 |
| 809 | Ga0500651_0168738 | 3300053093 | Bacteria | 1306 |
| 810 | Ga0500555_000715 | 3300053103 | Bacteria | 12482 |
| 811 | Ga0500597_000335 | 3300053120 | Bacteria | 9709 |
| 812 | Ga0500627_0176433 | 3300053158 | Bacteria | 962 |
| 813 | Ga0500633_0002326 | 3300053160 | Bacteria | 3884 |
| 814 | Ga0500634_0000146 | 3300053161 | Bacteria | 25568 |
| 815 | Ga0466962_0001160 | 3300061719 | Bacteria | 12149 |
| 816 | Ga0466962_0003497 | 3300061719 | Bacteria | 7485 |
| 817 | Ga0466962_0005665 | 3300061719 | Bacteria | 6003 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10096161 | Ga0207678_100961612 | 244 |
| 2 | 3300049742 | Ga0501080_0089212 | Ga0501080_0089212_1325_2152 | 254 |
| 3 | iso_pu_bacteria | 2524614729 | 2525556979 | 254 |
| 4 | iso_pu_bacteria | 2571042365 | 2572256232 | 254 |
| 5 | iso_pu_bacteria | 2627854209 | 2630648575 | 254 |
| 6 | iso_pu_bacteria | 2747842501 | 2748015624 | 254 |
| 7 | iso_pu_bacteria | 2842780639 | 2842783622 | 254 |
| 8 | iso_pu_bacteria | 2895498888 | 2895499342 | 254 |
| 9 | iso_pu_bacteria | 2895511927 | 2895512363 | 254 |
| 10 | iso_pu_bacteria | 2895522137 | 2895522375 | 254 |
| 11 | iso_pu_bacteria | 2895525241 | 2895527185 | 254 |
| 12 | iso_pu_bacteria | 2987605356 | 2987605915 | 254 |
| 13 | iso_pu_bacteria | 8002869464 | 8002871572 | 254 |
| 14 | 3300009094 | Ga0111539_10366310 | Ga0111539_103663102 | 255 |
| 15 | 3300013307 | Ga0157372_10084957 | Ga0157372_100849574 | 255 |
| 16 | 3300050511 | nmdc:mga08y16_283513_c1 | nmdc:mga08y16_283513_c1_724_1491 | 255 |
| 17 | iso_pu_bacteria | 2687453130 | 2687582919 | 255 |
| 18 | iso_pu_bacteria | 2818991440 | 2819563590 | 255 |
| 19 | iso_pu_bacteria | 2894414249 | 2894416279 | 255 |
| 20 | iso_pu_bacteria | 2904463128 | 2904464099 | 255 |
| 21 | iso_pu_bacteria | 2593339238 | 2595446705 | 256 |
| 22 | iso_pu_bacteria | 2593339239 | 2595451795 | 256 |
| 23 | iso_pu_bacteria | 2718218334 | 2721026648 | 256 |
| 24 | iso_pu_bacteria | 2734482264 | 2735833360 | 256 |
| 25 | iso_pu_bacteria | 2734482264 | 2735837806 | 256 |
| 26 | iso_pu_bacteria | 2738543009 | 2739228400 | 256 |
| 27 | iso_pu_bacteria | 2842914999 | 2842917902 | 256 |
| 28 | iso_pu_bacteria | 2842918807 | 2842919738 | 256 |
| 29 | iso_pu_bacteria | 2884338543 | 2884341354 | 256 |
| 30 | iso_pu_bacteria | 2919085039 | 2919087624 | 256 |
| 31 | iso_pu_bacteria | 2919404418 | 2919404881 | 256 |
| 32 | iso_pu_bacteria | 2941471342 | 2941472811 | 256 |
| 33 | iso_pu_bacteria | 2953994433 | 2953995040 | 256 |
| 34 | 3300005547 | Ga0070693_100027552 | Ga0070693_1000275524 | 257 |
| 35 | 3300025913 | Ga0207695_10006761 | Ga0207695_100067616 | 257 |
| 36 | 3300031731 | Ga0307405_10230407 | Ga0307405_102304071 | 257 |
| 37 | 3300031824 | Ga0307413_10113898 | Ga0307413_101138982 | 257 |
| 38 | 3300031852 | Ga0307410_10119478 | Ga0307410_101194782 | 257 |
| 39 | 3300031901 | Ga0307406_10072175 | Ga0307406_100721753 | 257 |
| 40 | 3300032004 | Ga0307414_10435039 | Ga0307414_104350392 | 257 |
| 41 | 3300042876 | Ga0451577_0050412 | Ga0451577_0050412_1699_2475 | 257 |
| 42 | 3300046674 | Ga0495588_0092605 | Ga0495588_0092605_125_904 | 257 |
| 43 | 3300048904 | Ga0496101_0084988 | Ga0496101_0084988_713_1489 | 257 |
| 44 | 3300048910 | Ga0496107_0108163 | Ga0496107_0108163_729_1505 | 257 |
| 45 | 3300048924 | Ga0496121_0116490 | Ga0496121_0116490_685_1461 | 257 |
| 46 | 3300048929 | Ga0496126_0000581 | Ga0496126_0000581_59835_60611 | 257 |
| 47 | 3300005327 | Ga0070658_10015687 | Ga0070658_100156877 | 258 |
| 48 | 3300005327 | Ga0070658_10373898 | Ga0070658_103738982 | 258 |
| 49 | 3300005335 | Ga0070666_10000003 | Ga0070666_10000003285 | 258 |
| 50 | 3300005335 | Ga0070666_10002096 | Ga0070666_100020969 | 258 |
| 51 | 3300005367 | Ga0070667_100000005 | Ga0070667_10000000592 | 258 |
| 52 | 3300005367 | Ga0070667_100034571 | Ga0070667_1000345715 | 258 |
| 53 | 3300005367 | Ga0070667_100058101 | Ga0070667_1000581011 | 258 |
| 54 | 3300005367 | Ga0070667_100185170 | Ga0070667_1001851701 | 258 |
| 55 | 3300005455 | Ga0070663_100023182 | Ga0070663_1000231826 | 258 |
| 56 | 3300005455 | Ga0070663_100328498 | Ga0070663_1003284982 | 258 |
| 57 | 3300005457 | Ga0070662_100021135 | Ga0070662_1000211352 | 258 |
| 58 | 3300005458 | Ga0070681_10020895 | Ga0070681_100208952 | 258 |
| 59 | 3300005530 | Ga0070679_100137444 | Ga0070679_1001374442 | 258 |
| 60 | 3300005530 | Ga0070679_100245710 | Ga0070679_1002457102 | 258 |
| 61 | 3300005539 | Ga0068853_100003367 | Ga0068853_10000336711 | 258 |
| 62 | 3300005539 | Ga0068853_100023295 | Ga0068853_1000232956 | 258 |
| 63 | 3300005539 | Ga0068853_100034276 | Ga0068853_1000342766 | 258 |
| 64 | 3300005539 | Ga0068853_100119273 | Ga0068853_1001192732 | 258 |
| 65 | 3300005539 | Ga0068853_100138784 | Ga0068853_1001387842 | 258 |
| 66 | 3300005543 | Ga0070672_100011903 | Ga0070672_1000119038 | 258 |
| 67 | 3300005547 | Ga0070693_100102808 | Ga0070693_1001028081 | 258 |
| 68 | 3300005548 | Ga0070665_100001267 | Ga0070665_10000126711 | 258 |
| 69 | 3300005548 | Ga0070665_100011880 | Ga0070665_1000118808 | 258 |
| 70 | 3300005548 | Ga0070665_100059354 | Ga0070665_1000593544 | 258 |
| 71 | 3300005548 | Ga0070665_100235902 | Ga0070665_1002359022 | 258 |
| 72 | 3300005563 | Ga0068855_100024470 | Ga0068855_1000244709 | 258 |
| 73 | 3300005563 | Ga0068855_100037052 | Ga0068855_1000370523 | 258 |
| 74 | 3300005563 | Ga0068855_100108560 | Ga0068855_1001085604 | 258 |
| 75 | 3300005563 | Ga0068855_100571763 | Ga0068855_1005717631 | 258 |
| 76 | 3300005563 | Ga0068855_100843017 | Ga0068855_1008430171 | 258 |
| 77 | 3300005564 | Ga0070664_100213877 | Ga0070664_1002138772 | 258 |
| 78 | 3300005577 | Ga0068857_100104071 | Ga0068857_1001040714 | 258 |
| 79 | 3300005577 | Ga0068857_100201643 | Ga0068857_1002016432 | 258 |
| 80 | 3300005614 | Ga0068856_100033308 | Ga0068856_1000333083 | 258 |
| 81 | 3300005614 | Ga0068856_100309468 | Ga0068856_1003094681 | 258 |
| 82 | 3300005616 | Ga0068852_100010889 | Ga0068852_10001088910 | 258 |
| 83 | 3300005616 | Ga0068852_100024583 | Ga0068852_1000245834 | 258 |
| 84 | 3300005616 | Ga0068852_100040375 | Ga0068852_1000403752 | 258 |
| 85 | 3300005616 | Ga0068852_100347198 | Ga0068852_1003471982 | 258 |
| 86 | 3300005616 | Ga0068852_100477872 | Ga0068852_1004778721 | 258 |
| 87 | 3300005617 | Ga0068859_100000265 | Ga0068859_10000026520 | 258 |
| 88 | 3300005834 | Ga0068851_10002041 | Ga0068851_100020414 | 258 |
| 89 | 3300005834 | Ga0068851_10135254 | Ga0068851_101352541 | 258 |
| 90 | 3300005841 | Ga0068863_100020907 | Ga0068863_1000209075 | 258 |
| 91 | 3300005841 | Ga0068863_100185119 | Ga0068863_1001851192 | 258 |
| 92 | 3300005842 | Ga0068858_100003531 | Ga0068858_1000035312 | 258 |
| 93 | 3300005842 | Ga0068858_100115545 | Ga0068858_1001155452 | 258 |
| 94 | 3300005844 | Ga0068862_100005271 | Ga0068862_10000527111 | 258 |
| 95 | 3300005983 | Ga0081540_1072453 | Ga0081540_10724532 | 258 |
| 96 | 3300006051 | Ga0075364_10000356 | Ga0075364_1000035612 | 258 |
| 97 | 3300006237 | Ga0097621_100079578 | Ga0097621_1000795783 | 258 |
| 98 | 3300006931 | Ga0097620_100000265 | Ga0097620_10000026520 | 258 |
| 99 | 3300009093 | Ga0105240_10002519 | Ga0105240_100025194 | 258 |
| 100 | 3300009093 | Ga0105240_10013886 | Ga0105240_100138862 | 258 |
| 101 | 3300009093 | Ga0105240_10176224 | Ga0105240_101762244 | 258 |
| 102 | 3300009098 | Ga0105245_10357427 | Ga0105245_103574272 | 258 |
| 103 | 3300009101 | Ga0105247_10069693 | Ga0105247_100696932 | 258 |
| 104 | 3300009174 | Ga0105241_10030187 | Ga0105241_100301872 | 258 |
| 105 | 3300009174 | Ga0105241_10229887 | Ga0105241_102298872 | 258 |
| 106 | 3300009177 | Ga0105248_10002061 | Ga0105248_1000206114 | 258 |
| 107 | 3300009177 | Ga0105248_10284267 | Ga0105248_102842672 | 258 |
| 108 | 3300009545 | Ga0105237_10004780 | Ga0105237_1000478011 | 258 |
| 109 | 3300009545 | Ga0105237_10021360 | Ga0105237_100213603 | 258 |
| 110 | 3300009545 | Ga0105237_10300160 | Ga0105237_103001601 | 258 |
| 111 | 3300009545 | Ga0105237_10442954 | Ga0105237_104429542 | 258 |
| 112 | 3300009551 | Ga0105238_10001867 | Ga0105238_100018678 | 258 |
| 113 | 3300009551 | Ga0105238_10007377 | Ga0105238_100073776 | 258 |
| 114 | 3300009551 | Ga0105238_10015192 | Ga0105238_100151926 | 258 |
| 115 | 3300009553 | Ga0105249_10005661 | Ga0105249_100056616 | 258 |
| 116 | 3300009553 | Ga0105249_10020935 | Ga0105249_100209354 | 258 |
| 117 | 3300010375 | Ga0105239_10010293 | Ga0105239_100102939 | 258 |
| 118 | 3300010375 | Ga0105239_10023401 | Ga0105239_100234012 | 258 |
| 119 | 3300010375 | Ga0105239_10038519 | Ga0105239_100385193 | 258 |
| 120 | 3300010375 | Ga0105239_10046624 | Ga0105239_100466244 | 258 |
| 121 | 3300010375 | Ga0105239_10112342 | Ga0105239_101123423 | 258 |
| 122 | 3300010375 | Ga0105239_10335425 | Ga0105239_103354252 | 258 |
| 123 | 3300010375 | Ga0105239_11045843 | Ga0105239_110458431 | 258 |
| 124 | 3300013105 | Ga0157369_10063246 | Ga0157369_100632464 | 258 |
| 125 | 3300013105 | Ga0157369_10112543 | Ga0157369_101125432 | 258 |
| 126 | 3300013296 | Ga0157374_10057130 | Ga0157374_100571302 | 258 |
| 127 | 3300013296 | Ga0157374_10068936 | Ga0157374_100689364 | 258 |
| 128 | 3300013297 | Ga0157378_10000043 | Ga0157378_1000004368 | 258 |
| 129 | 3300013297 | Ga0157378_10034449 | Ga0157378_100344494 | 258 |
| 130 | 3300013297 | Ga0157378_10186933 | Ga0157378_101869333 | 258 |
| 131 | 3300013306 | Ga0163162_10000015 | Ga0163162_10000015136 | 258 |
| 132 | 3300013306 | Ga0163162_10000236 | Ga0163162_100002368 | 258 |
| 133 | 3300013307 | Ga0157372_10031403 | Ga0157372_100314036 | 258 |
| 134 | 3300013308 | Ga0157375_10013746 | Ga0157375_100137463 | 258 |
| 135 | 3300014969 | Ga0157376_10062563 | Ga0157376_100625634 | 258 |
| 136 | 3300014969 | Ga0157376_10127877 | Ga0157376_101278772 | 258 |
| 137 | 3300015261 | Ga0182006_1020561 | Ga0182006_10205612 | 258 |
| 138 | 3300017792 | Ga0163161_10213193 | Ga0163161_102131931 | 258 |
| 139 | 3300025261 | Ga0209233_1017293 | Ga0209233_10172932 | 258 |
| 140 | 3300025321 | Ga0207656_10000309 | Ga0207656_100003094 | 258 |
| 141 | 3300025903 | Ga0207680_10000006 | Ga0207680_10000006432 | 258 |
| 142 | 3300025903 | Ga0207680_10001037 | Ga0207680_100010374 | 258 |
| 143 | 3300025903 | Ga0207680_10008585 | Ga0207680_100085852 | 258 |
| 144 | 3300025903 | Ga0207680_10093654 | Ga0207680_100936542 | 258 |
| 145 | 3300025904 | Ga0207647_10000155 | Ga0207647_1000015521 | 258 |
| 146 | 3300025909 | Ga0207705_10062307 | Ga0207705_100623073 | 258 |
| 147 | 3300025911 | Ga0207654_10178101 | Ga0207654_101781012 | 258 |
| 148 | 3300025913 | Ga0207695_10000032 | Ga0207695_1000003225 | 258 |
| 149 | 3300025913 | Ga0207695_10005772 | Ga0207695_1000577210 | 258 |
| 150 | 3300025913 | Ga0207695_10055081 | Ga0207695_100550814 | 258 |
| 151 | 3300025913 | Ga0207695_10114719 | Ga0207695_101147192 | 258 |
| 152 | 3300025914 | Ga0207671_10022957 | Ga0207671_100229573 | 258 |
| 153 | 3300025914 | Ga0207671_10030938 | Ga0207671_100309382 | 258 |
| 154 | 3300025914 | Ga0207671_10032193 | Ga0207671_100321933 | 258 |
| 155 | 3300025921 | Ga0207652_10053325 | Ga0207652_100533254 | 258 |
| 156 | 3300025921 | Ga0207652_10116077 | Ga0207652_101160772 | 258 |
| 157 | 3300025924 | Ga0207694_10001181 | Ga0207694_1000118110 | 258 |
| 158 | 3300025924 | Ga0207694_10008048 | Ga0207694_100080487 | 258 |
| 159 | 3300025924 | Ga0207694_10008628 | Ga0207694_100086282 | 258 |
| 160 | 3300025933 | Ga0207706_10007442 | Ga0207706_100074422 | 258 |
| 161 | 3300025940 | Ga0207691_10032993 | Ga0207691_100329936 | 258 |
| 162 | 3300025941 | Ga0207711_10000470 | Ga0207711_1000047012 | 258 |
| 163 | 3300025942 | Ga0207689_10100393 | Ga0207689_101003931 | 258 |
| 164 | 3300025942 | Ga0207689_10396646 | Ga0207689_103966461 | 258 |
| 165 | 3300025942 | Ga0207689_10550233 | Ga0207689_105502331 | 258 |
| 166 | 3300025945 | Ga0207679_10112227 | Ga0207679_101122272 | 258 |
| 167 | 3300025949 | Ga0207667_10148214 | Ga0207667_101482142 | 258 |
| 168 | 3300025949 | Ga0207667_10296209 | Ga0207667_102962092 | 258 |
| 169 | 3300025949 | Ga0207667_10403195 | Ga0207667_104031951 | 258 |
| 170 | 3300025961 | Ga0207712_10000771 | Ga0207712_1000077121 | 258 |
| 171 | 3300025961 | Ga0207712_10002780 | Ga0207712_100027807 | 258 |
| 172 | 3300025961 | Ga0207712_10128718 | Ga0207712_101287183 | 258 |
| 173 | 3300025986 | Ga0207658_10000006 | Ga0207658_10000006280 | 258 |
| 174 | 3300025986 | Ga0207658_10008000 | Ga0207658_100080003 | 258 |
| 175 | 3300025986 | Ga0207658_10416062 | Ga0207658_104160621 | 258 |
| 176 | 3300026035 | Ga0207703_10001094 | Ga0207703_1000109411 | 258 |
| 177 | 3300026035 | Ga0207703_10083079 | Ga0207703_100830792 | 258 |
| 178 | 3300026041 | Ga0207639_10001632 | Ga0207639_1000163214 | 258 |
| 179 | 3300026041 | Ga0207639_10002290 | Ga0207639_100022903 | 258 |
| 180 | 3300026041 | Ga0207639_10006988 | Ga0207639_100069882 | 258 |
| 181 | 3300026041 | Ga0207639_10008722 | Ga0207639_100087226 | 258 |
| 182 | 3300026041 | Ga0207639_10036600 | Ga0207639_100366004 | 258 |
| 183 | 3300026041 | Ga0207639_10168545 | Ga0207639_101685452 | 258 |
| 184 | 3300026067 | Ga0207678_10001340 | Ga0207678_1000134018 | 258 |
| 185 | 3300026067 | Ga0207678_10017061 | Ga0207678_100170613 | 258 |
| 186 | 3300026067 | Ga0207678_10375238 | Ga0207678_103752382 | 258 |
| 187 | 3300026067 | Ga0207678_10554348 | Ga0207678_105543481 | 258 |
| 188 | 3300026078 | Ga0207702_10005747 | Ga0207702_100057479 | 258 |
| 189 | 3300026078 | Ga0207702_10041945 | Ga0207702_100419452 | 258 |
| 190 | 3300026088 | Ga0207641_10081865 | Ga0207641_100818654 | 258 |
| 191 | 3300026088 | Ga0207641_10124845 | Ga0207641_101248454 | 258 |
| 192 | 3300026088 | Ga0207641_10449179 | Ga0207641_104491792 | 258 |
| 193 | 3300026116 | Ga0207674_10017518 | Ga0207674_100175188 | 258 |
| 194 | 3300026142 | Ga0207698_10008023 | Ga0207698_100080234 | 258 |
| 195 | 3300026142 | Ga0207698_10015318 | Ga0207698_100153182 | 258 |
| 196 | 3300026142 | Ga0207698_10022708 | Ga0207698_100227081 | 258 |
| 197 | 3300026142 | Ga0207698_10063010 | Ga0207698_100630102 | 258 |
| 198 | 3300028379 | Ga0268266_10000013 | Ga0268266_10000013188 | 258 |
| 199 | 3300028379 | Ga0268266_10000021 | Ga0268266_10000021386 | 258 |
| 200 | 3300028379 | Ga0268266_10054785 | Ga0268266_100547854 | 258 |
| 201 | 3300028379 | Ga0268266_10156488 | Ga0268266_101564882 | 258 |
| 202 | 3300028380 | Ga0268265_10003764 | Ga0268265_1000376411 | 258 |
| 203 | 3300030731 | Ga0316177_1132861 | Ga0316177_11328612 | 258 |
| 204 | 3300030733 | Ga0314311_1204266 | Ga0314311_12042664 | 258 |
| 205 | 3300030736 | Ga0316180_1077455 | Ga0316180_10774552 | 258 |
| 206 | 3300031456 | Ga0307513_10147202 | Ga0307513_101472023 | 258 |
| 207 | 3300031548 | Ga0307408_100202443 | Ga0307408_1002024432 | 258 |
| 208 | 3300031548 | Ga0307408_100617295 | Ga0307408_1006172951 | 258 |
| 209 | 3300031616 | Ga0307508_10221850 | Ga0307508_102218502 | 258 |
| 210 | 3300031730 | Ga0307516_10027810 | Ga0307516_100278103 | 258 |
| 211 | 3300031730 | Ga0307516_10041474 | Ga0307516_100414744 | 258 |
| 212 | 3300031824 | Ga0307413_10163139 | Ga0307413_101631392 | 258 |
| 213 | 3300031824 | Ga0307413_10237906 | Ga0307413_102379061 | 258 |
| 214 | 3300031901 | Ga0307406_10250419 | Ga0307406_102504191 | 258 |
| 215 | 3300031911 | Ga0307412_10090826 | Ga0307412_100908263 | 258 |
| 216 | 3300031911 | Ga0307412_10285015 | Ga0307412_102850152 | 258 |
| 217 | 3300031911 | Ga0307412_10342315 | Ga0307412_103423152 | 258 |
| 218 | 3300031995 | Ga0307409_100247765 | Ga0307409_1002477652 | 258 |
| 219 | 3300032002 | Ga0307416_100016290 | Ga0307416_1000162904 | 258 |
| 220 | 3300032002 | Ga0307416_100056522 | Ga0307416_1000565224 | 258 |
| 221 | 3300032004 | Ga0307414_10002380 | Ga0307414_100023809 | 258 |
| 222 | 3300032004 | Ga0307414_10091886 | Ga0307414_100918862 | 258 |
| 223 | 3300032126 | Ga0307415_100312929 | Ga0307415_1003129292 | 258 |
| 224 | 3300032126 | Ga0307415_100337619 | Ga0307415_1003376192 | 258 |
| 225 | 3300033179 | Ga0307507_10180097 | Ga0307507_101800972 | 258 |
| 226 | 3300033180 | Ga0307510_10009680 | Ga0307510_1000968016 | 258 |
| 227 | 3300038705 | Ga0237819_00016 | Ga0237819_00016_33109_33900 | 258 |
| 228 | 3300041413 | Ga0439465_0003459 | Ga0439465_0003459_4032_4811 | 258 |
| 229 | 3300041413 | Ga0439465_0003773 | Ga0439465_0003773_3844_4623 | 258 |
| 230 | 3300041443 | Ga0451789_0254233 | Ga0451789_0254233_52_831 | 258 |
| 231 | 3300041451 | Ga0451791_1222002 | Ga0451791_1222002_1540_2319 | 258 |
| 232 | 3300041452 | Ga0451793_0770297 | Ga0451793_0770297_475_1254 | 258 |
| 233 | 3300041452 | Ga0451793_1759138 | Ga0451793_1759138_772_1548 | 258 |
| 234 | 3300041460 | Ga0451802_0367711 | Ga0451802_0367711_1371_2150 | 258 |
| 235 | 3300041460 | Ga0451802_0598371 | Ga0451802_0598371_897_1673 | 258 |
| 236 | 3300041486 | Ga0451807_0790658 | Ga0451807_0790658_1236_2015 | 258 |
| 237 | 3300041491 | Ga0451833_0314086 | Ga0451833_0314086_347_1123 | 258 |
| 238 | 3300041494 | Ga0451837_0512683 | Ga0451837_0512683_275_1054 | 258 |
| 239 | 3300041498 | Ga0451841_0863707 | Ga0451841_0863707_393_1172 | 258 |
| 240 | 3300041505 | Ga0451849_0270298 | Ga0451849_0270298_318_1094 | 258 |
| 241 | 3300041512 | Ga0451853_1963870 | Ga0451853_1963870_46_876 | 258 |
| 242 | 3300041512 | Ga0451853_1972459 | Ga0451853_1972459_1614_2390 | 258 |
| 243 | 3300041997 | Ga0439431_0028946 | Ga0439431_0028946_488_1267 | 258 |
| 244 | 3300042004 | Ga0439445_0002207 | Ga0439445_0002207_3320_4099 | 258 |
| 245 | 3300042006 | Ga0439432_001663 | Ga0439432_001663_4113_4892 | 258 |
| 246 | 3300042006 | Ga0439432_003552 | Ga0439432_003552_3464_4243 | 258 |
| 247 | 3300042007 | Ga0439449_0001191 | Ga0439449_0001191_3714_4493 | 258 |
| 248 | 3300042007 | Ga0439449_0002570 | Ga0439449_0002570_4213_5127 | 258 |
| 249 | 3300042007 | Ga0439449_0010383 | Ga0439449_0010383_969_1748 | 258 |
| 250 | 3300042014 | Ga0439457_010121 | Ga0439457_010121_586_1365 | 258 |
| 251 | 3300042876 | Ga0451577_0042692 | Ga0451577_0042692_708_1508 | 258 |
| 252 | 3300042876 | Ga0451577_0068951 | Ga0451577_0068951_783_1559 | 258 |
| 253 | 3300045976 | Ga0466967_0823244 | Ga0466967_0823244_20_799 | 258 |
| 254 | 3300046460 | Ga0495638_0054786 | Ga0495638_0054786_137_916 | 258 |
| 255 | 3300046471 | Ga0495650_0000875 | Ga0495650_0000875_8079_8861 | 258 |
| 256 | 3300046501 | Ga0495607_0014544 | Ga0495607_0014544_4235_5104 | 258 |
| 257 | 3300046507 | Ga0495606_0009016 | Ga0495606_0009016_3322_4191 | 258 |
| 258 | 3300046525 | Ga0495663_0008055 | Ga0495663_0008055_2113_2892 | 258 |
| 259 | 3300046525 | Ga0495663_0034095 | Ga0495663_0034095_125_904 | 258 |
| 260 | 3300046530 | Ga0495654_0064899 | Ga0495654_0064899_618_1397 | 258 |
| 261 | 3300046539 | Ga0495621_0117367 | Ga0495621_0117367_155_934 | 258 |
| 262 | 3300046558 | Ga0495633_0009864 | Ga0495633_0009864_2886_3665 | 258 |
| 263 | 3300046615 | Ga0495656_0032319 | Ga0495656_0032319_1282_2061 | 258 |
| 264 | 3300046660 | Ga0495625_0057378 | Ga0495625_0057378_232_1014 | 258 |
| 265 | 3300046660 | Ga0495625_0101758 | Ga0495625_0101758_598_1377 | 258 |
| 266 | 3300046664 | Ga0495659_0018325 | Ga0495659_0018325_478_1257 | 258 |
| 267 | 3300046692 | Ga0495671_0019429 | Ga0495671_0019429_2366_3145 | 258 |
| 268 | 3300047318 | Ga0495636_0039933 | Ga0495636_0039933_787_1566 | 258 |
| 269 | 3300047320 | Ga0495672_0013666 | Ga0495672_0013666_1543_2322 | 258 |
| 270 | 3300047447 | Ga0495685_032761 | Ga0495685_032761_866_1645 | 258 |
| 271 | 3300047472 | Ga0495686_0007599 | Ga0495686_0007599_2771_3547 | 258 |
| 272 | 3300048905 | Ga0496102_0091951 | Ga0496102_0091951_1955_2731 | 258 |
| 273 | 3300048906 | Ga0496103_0399812 | Ga0496103_0399812_47_823 | 258 |
| 274 | 3300048920 | Ga0496117_0029620 | Ga0496117_0029620_729_1505 | 258 |
| 275 | 3300048921 | Ga0496118_0000177 | Ga0496118_0000177_5367_6143 | 258 |
| 276 | 3300048921 | Ga0496118_0004210 | Ga0496118_0004210_6400_7176 | 258 |
| 277 | 3300048921 | Ga0496118_0027688 | Ga0496118_0027688_2782_3609 | 258 |
| 278 | 3300048921 | Ga0496118_0110082 | Ga0496118_0110082_700_1482 | 258 |
| 279 | 3300048921 | Ga0496118_0127683 | Ga0496118_0127683_642_1418 | 258 |
| 280 | 3300048922 | Ga0496119_0191123 | Ga0496119_0191123_238_1020 | 258 |
| 281 | 3300048924 | Ga0496121_0028511 | Ga0496121_0028511_1209_1991 | 258 |
| 282 | 3300048924 | Ga0496121_0098342 | Ga0496121_0098342_1439_2215 | 258 |
| 283 | 3300048925 | Ga0496122_0000463 | Ga0496122_0000463_2693_3469 | 258 |
| 284 | 3300048926 | Ga0496123_0000151 | Ga0496123_0000151_136081_136860 | 258 |
| 285 | 3300048926 | Ga0496123_0000296 | Ga0496123_0000296_55709_56485 | 258 |
| 286 | 3300048926 | Ga0496123_0007960 | Ga0496123_0007960_2151_2930 | 258 |
| 287 | 3300048927 | Ga0496124_0003150 | Ga0496124_0003150_15309_16166 | 258 |
| 288 | 3300048928 | Ga0496125_0028954 | Ga0496125_0028954_1166_1948 | 258 |
| 289 | 3300048929 | Ga0496126_0013162 | Ga0496126_0013162_1894_2673 | 258 |
| 290 | 3300049569 | Ga0501032_0002234 | Ga0501032_0002234_3009_3872 | 258 |
| 291 | 3300049570 | Ga0501033_0032082 | Ga0501033_0032082_2050_2913 | 258 |
| 292 | 3300049570 | Ga0501033_0124633 | Ga0501033_0124633_34_813 | 258 |
| 293 | 3300049571 | Ga0501034_0009045 | Ga0501034_0009045_3466_4275 | 258 |
| 294 | 3300049571 | Ga0501034_0055709 | Ga0501034_0055709_98_961 | 258 |
| 295 | 3300049571 | Ga0501034_0240968 | Ga0501034_0240968_563_1342 | 258 |
| 296 | 3300049572 | Ga0501036_0019205 | Ga0501036_0019205_2349_3128 | 258 |
| 297 | 3300049573 | Ga0501037_0000499 | Ga0501037_0000499_16352_17215 | 258 |
| 298 | 3300049573 | Ga0501037_0022489 | Ga0501037_0022489_2199_2978 | 258 |
| 299 | 3300049574 | Ga0501038_0003315 | Ga0501038_0003315_1261_2124 | 258 |
| 300 | 3300049574 | Ga0501038_0020720 | Ga0501038_0020720_4244_5023 | 258 |
| 301 | 3300049575 | Ga0501039_0002265 | Ga0501039_0002265_10490_11353 | 258 |
| 302 | 3300049575 | Ga0501039_0052503 | Ga0501039_0052503_2339_3118 | 258 |
| 303 | 3300049579 | Ga0501043_0014452 | Ga0501043_0014452_2250_3113 | 258 |
| 304 | 3300049580 | Ga0501046_0003027 | Ga0501046_0003027_13179_14042 | 258 |
| 305 | 3300049581 | Ga0501047_0066314 | Ga0501047_0066314_1599_2462 | 258 |
| 306 | 3300049583 | Ga0501067_0253724 | Ga0501067_0253724_136_912 | 258 |
| 307 | 3300049586 | Ga0501070_0020130 | Ga0501070_0020130_2443_3222 | 258 |
| 308 | 3300049589 | Ga0501073_0050433 | Ga0501073_0050433_584_1447 | 258 |
| 309 | 3300049589 | Ga0501073_0103846 | Ga0501073_0103846_163_939 | 258 |
| 310 | 3300049652 | Ga0501202_021695 | Ga0501202_021695_230_1108 | 258 |
| 311 | 3300049682 | Ga0501252_007166 | Ga0501252_007166_393_1172 | 258 |
| 312 | 3300049705 | Ga0501225_0004823 | Ga0501225_0004823_2931_3710 | 258 |
| 313 | 3300049742 | Ga0501080_0031544 | Ga0501080_0031544_3040_3903 | 258 |
| 314 | 3300049742 | Ga0501080_0033050 | Ga0501080_0033050_720_1496 | 258 |
| 315 | 3300049742 | Ga0501080_0104868 | Ga0501080_0104868_776_1555 | 258 |
| 316 | 3300049772 | Ga0501275_000227 | Ga0501275_000227_3640_4443 | 258 |
| 317 | 3300049822 | Ga0501035_0004851 | Ga0501035_0004851_9484_10347 | 258 |
| 318 | 3300049822 | Ga0501035_0015245 | Ga0501035_0015245_2403_3182 | 258 |
| 319 | 3300049823 | Ga0501044_0105390 | Ga0501044_0105390_1737_2600 | 258 |
| 320 | 3300050491 | nmdc:mga00v17_118_c1 | nmdc:mga00v17_118_c1_25517_26305 | 258 |
| 321 | 3300053087 | Ga0500643_011271 | Ga0500643_011271_361_1137 | 258 |
| 322 | 3300053120 | Ga0500597_000335 | Ga0500597_000335_5559_6335 | 258 |
| 323 | 3300053161 | Ga0500634_0000146 | Ga0500634_0000146_4774_5553 | 258 |
| 324 | iso_pu_bacteria | 8003014200 | 8003014873 | 258 |
| 325 | 3300005327 | Ga0070658_10397274 | Ga0070658_103972742 | 259 |
| 326 | 3300005331 | Ga0070670_100193548 | Ga0070670_1001935482 | 259 |
| 327 | 3300005336 | Ga0070680_100117495 | Ga0070680_1001174953 | 259 |
| 328 | 3300005543 | Ga0070672_100002714 | Ga0070672_1000027147 | 259 |
| 329 | 3300005564 | Ga0070664_100121338 | Ga0070664_1001213383 | 259 |
| 330 | 3300005564 | Ga0070664_100564243 | Ga0070664_1005642432 | 259 |
| 331 | 3300005844 | Ga0068862_100043064 | Ga0068862_1000430645 | 259 |
| 332 | 3300006051 | Ga0075364_10088551 | Ga0075364_100885512 | 259 |
| 333 | 3300006051 | Ga0075364_10125075 | Ga0075364_101250752 | 259 |
| 334 | 3300013100 | Ga0157373_10175713 | Ga0157373_101757132 | 259 |
| 335 | 3300013102 | Ga0157371_10084059 | Ga0157371_100840591 | 259 |
| 336 | 3300013307 | Ga0157372_10010524 | Ga0157372_100105242 | 259 |
| 337 | 3300013307 | Ga0157372_10402504 | Ga0157372_104025042 | 259 |
| 338 | 3300014326 | Ga0157380_10060113 | Ga0157380_100601132 | 259 |
| 339 | 3300015685 | Ga0183369_1012 | Ga0183369_1012180 | 259 |
| 340 | 3300025909 | Ga0207705_10246608 | Ga0207705_102466082 | 259 |
| 341 | 3300025917 | Ga0207660_10272031 | Ga0207660_102720312 | 259 |
| 342 | 3300025926 | Ga0207659_10126534 | Ga0207659_101265342 | 259 |
| 343 | 3300025937 | Ga0207669_10044591 | Ga0207669_100445912 | 259 |
| 344 | 3300028380 | Ga0268265_10255503 | Ga0268265_102555032 | 259 |
| 345 | 3300031824 | Ga0307413_10003477 | Ga0307413_100034774 | 259 |
| 346 | 3300037312 | Ga0395899_0038388 | Ga0395899_0038388_2057_2836 | 259 |
| 347 | 3300037312 | Ga0395899_0257278 | Ga0395899_0257278_143_922 | 259 |
| 348 | 3300037418 | Ga0395900_0001671 | Ga0395900_0001671_23343_24122 | 259 |
| 349 | 3300037418 | Ga0395900_0022713 | Ga0395900_0022713_1123_1902 | 259 |
| 350 | 3300037418 | Ga0395900_0038954 | Ga0395900_0038954_3824_4603 | 259 |
| 351 | 3300037466 | Ga0395898_0005025 | Ga0395898_0005025_9219_9998 | 259 |
| 352 | 3300037466 | Ga0395898_0008956 | Ga0395898_0008956_5547_6326 | 259 |
| 353 | 3300038443 | Ga0395901_0000280 | Ga0395901_0000280_22388_23167 | 259 |
| 354 | 3300038443 | Ga0395901_0026050 | Ga0395901_0026050_450_1229 | 259 |
| 355 | 3300038443 | Ga0395901_0058473 | Ga0395901_0058473_1683_2462 | 259 |
| 356 | 3300042007 | Ga0439449_0005497 | Ga0439449_0005497_868_1734 | 259 |
| 357 | 3300049570 | Ga0501033_0008723 | Ga0501033_0008723_2527_3306 | 259 |
| 358 | 3300049571 | Ga0501034_0000749 | Ga0501034_0000749_11339_12121 | 259 |
| 359 | 3300049571 | Ga0501034_0605973 | Ga0501034_0605973_82_861 | 259 |
| 360 | 3300049579 | Ga0501043_0112224 | Ga0501043_0112224_1230_2009 | 259 |
| 361 | 3300049579 | Ga0501043_0211475 | Ga0501043_0211475_623_1402 | 259 |
| 362 | 3300049580 | Ga0501046_0038819 | Ga0501046_0038819_1567_2346 | 259 |
| 363 | 3300049581 | Ga0501047_0043428 | Ga0501047_0043428_3328_4107 | 259 |
| 364 | 3300049581 | Ga0501047_0056354 | Ga0501047_0056354_753_1532 | 259 |
| 365 | 3300049822 | Ga0501035_0011534 | Ga0501035_0011534_5650_6429 | 259 |
| 366 | 3300049822 | Ga0501035_0017817 | Ga0501035_0017817_4822_5601 | 259 |
| 367 | 3300049822 | Ga0501035_0226568 | Ga0501035_0226568_794_1573 | 259 |
| 368 | 3300049823 | Ga0501044_0070459 | Ga0501044_0070459_294_1073 | 259 |
| 369 | 3300049823 | Ga0501044_0404938 | Ga0501044_0404938_17_796 | 259 |
| 370 | 3300049823 | Ga0501044_0701654 | Ga0501044_0701654_97_876 | 259 |
| 371 | 3300050491 | nmdc:mga00v17_7454_c1 | nmdc:mga00v17_7454_c1_1004_1786 | 259 |
| 372 | 3300053158 | Ga0500627_0176433 | Ga0500627_0176433_78_863 | 259 |
| 373 | iso_pu_bacteria | 2643221577 | 2643894257 | 259 |
| 374 | iso_pu_bacteria | 2643221685 | 2644476459 | 259 |
| 375 | iso_pu_bacteria | 2739367700 | 2739730793 | 259 |
| 376 | iso_pu_bacteria | 2884411467 | 2884414376 | 259 |
| 377 | iso_pu_bacteria | 2895395659 | 2895398554 | 259 |
| 378 | iso_pu_bacteria | 2919675420 | 2919677152 | 259 |
| 379 | iso_pu_bacteria | 2928963466 | 2928964130 | 259 |
| 380 | iso_pu_bacteria | 2939611941 | 2939614630 | 259 |
| 381 | 3300003578 | Ga0006562J51391_1103004 | Ga0006562J51391_11030042 | 260 |
| 382 | 3300003578 | Ga0006562J51391_1103005 | Ga0006562J51391_11030053 | 260 |
| 383 | 3300005262 | Ga0065165_1000028 | Ga0065165_100002890 | 260 |
| 384 | 3300005336 | Ga0070680_100268831 | Ga0070680_1002688311 | 260 |
| 385 | 3300005344 | Ga0070661_100061535 | Ga0070661_1000615352 | 260 |
| 386 | 3300005366 | Ga0070659_100178322 | Ga0070659_1001783222 | 260 |
| 387 | 3300005539 | Ga0068853_100458765 | Ga0068853_1004587652 | 260 |
| 388 | 3300010375 | Ga0105239_10025017 | Ga0105239_100250179 | 260 |
| 389 | 3300013100 | Ga0157373_10424162 | Ga0157373_104241622 | 260 |
| 390 | 3300013104 | Ga0157370_10001779 | Ga0157370_1000177913 | 260 |
| 391 | 3300013104 | Ga0157370_10008298 | Ga0157370_1000829815 | 260 |
| 392 | 3300013105 | Ga0157369_10000597 | Ga0157369_1000059715 | 260 |
| 393 | 3300014497 | Ga0182008_10002881 | Ga0182008_1000288111 | 260 |
| 394 | 3300014497 | Ga0182008_10016310 | Ga0182008_100163102 | 260 |
| 395 | 3300015261 | Ga0182006_1000072 | Ga0182006_100007258 | 260 |
| 396 | 3300015261 | Ga0182006_1000765 | Ga0182006_100076528 | 260 |
| 397 | 3300015262 | Ga0182007_10006852 | Ga0182007_100068523 | 260 |
| 398 | 3300015265 | Ga0182005_1000080 | Ga0182005_100008012 | 260 |
| 399 | 3300015265 | Ga0182005_1002839 | Ga0182005_10028395 | 260 |
| 400 | 3300015265 | Ga0182005_1023524 | Ga0182005_10235242 | 260 |
| 401 | 3300017792 | Ga0163161_10003999 | Ga0163161_100039994 | 260 |
| 402 | 3300017792 | Ga0163161_10281530 | Ga0163161_102815302 | 260 |
| 403 | 3300025226 | Ga0209674_101867 | Ga0209674_1018673 | 260 |
| 404 | 3300025233 | Ga0209437_100985 | Ga0209437_1009858 | 260 |
| 405 | 3300025254 | Ga0209148_1002776 | Ga0209148_10027764 | 260 |
| 406 | 3300025299 | Ga0209256_1017123 | Ga0209256_10171231 | 260 |
| 407 | 3300025302 | Ga0207426_1008786 | Ga0207426_10087864 | 260 |
| 408 | 3300025303 | Ga0209051_1002828 | Ga0209051_10028289 | 260 |
| 409 | 3300025904 | Ga0207647_10000029 | Ga0207647_1000002942 | 260 |
| 410 | 3300025920 | Ga0207649_10113893 | Ga0207649_101138932 | 260 |
| 411 | 3300031911 | Ga0307412_10027813 | Ga0307412_100278133 | 260 |
| 412 | 3300037418 | Ga0395900_0000590 | Ga0395900_0000590_41429_42211 | 260 |
| 413 | 3300037418 | Ga0395900_0005906 | Ga0395900_0005906_6025_6840 | 260 |
| 414 | 3300041404 | Ga0439436_0000077 | Ga0439436_0000077_9542_10324 | 260 |
| 415 | 3300041413 | Ga0439465_0000644 | Ga0439465_0000644_6325_7107 | 260 |
| 416 | 3300042131 | Ga0450894_007665 | Ga0450894_007665_513_1295 | 260 |
| 417 | 3300044672 | Ga0466982_0001149 | Ga0466982_0001149_6599_7381 | 260 |
| 418 | 3300044735 | Ga0466968_0007195 | Ga0466968_0007195_2836_3618 | 260 |
| 419 | 3300046452 | Ga0495617_000117 | Ga0495617_000117_3953_4735 | 260 |
| 420 | 3300046452 | Ga0495617_000581 | Ga0495617_000581_15669_16451 | 260 |
| 421 | 3300046457 | Ga0495590_0076070 | Ga0495590_0076070_176_958 | 260 |
| 422 | 3300046460 | Ga0495638_0017459 | Ga0495638_0017459_33_815 | 260 |
| 423 | 3300046460 | Ga0495638_0069762 | Ga0495638_0069762_33_815 | 260 |
| 424 | 3300046471 | Ga0495650_0004550 | Ga0495650_0004550_2090_2872 | 260 |
| 425 | 3300046471 | Ga0495650_0019238 | Ga0495650_0019238_752_1534 | 260 |
| 426 | 3300046492 | Ga0495585_0002200 | Ga0495585_0002200_9021_9803 | 260 |
| 427 | 3300046492 | Ga0495585_0003818 | Ga0495585_0003818_5171_5953 | 260 |
| 428 | 3300046501 | Ga0495607_0000122 | Ga0495607_0000122_54615_55397 | 260 |
| 429 | 3300046501 | Ga0495607_0000837 | Ga0495607_0000837_15593_16375 | 260 |
| 430 | 3300046501 | Ga0495607_0005180 | Ga0495607_0005180_6949_7731 | 260 |
| 431 | 3300046506 | Ga0495583_0038301 | Ga0495583_0038301_48_830 | 260 |
| 432 | 3300046507 | Ga0495606_0000298 | Ga0495606_0000298_81043_81825 | 260 |
| 433 | 3300046507 | Ga0495606_0006272 | Ga0495606_0006272_2499_3281 | 260 |
| 434 | 3300046507 | Ga0495606_0018751 | Ga0495606_0018751_1005_1787 | 260 |
| 435 | 3300046512 | Ga0495610_0054923 | Ga0495610_0054923_113_895 | 260 |
| 436 | 3300046513 | Ga0495616_0000565 | Ga0495616_0000565_20033_20815 | 260 |
| 437 | 3300046515 | Ga0495620_0003610 | Ga0495620_0003610_6086_6868 | 260 |
| 438 | 3300046515 | Ga0495620_0007544 | Ga0495620_0007544_1890_2672 | 260 |
| 439 | 3300046518 | Ga0495631_0000808 | Ga0495631_0000808_6893_7675 | 260 |
| 440 | 3300046518 | Ga0495631_0001788 | Ga0495631_0001788_4720_5502 | 260 |
| 441 | 3300046519 | Ga0495632_0000004 | Ga0495632_0000004_282991_283809 | 260 |
| 442 | 3300046519 | Ga0495632_0015386 | Ga0495632_0015386_1857_2639 | 260 |
| 443 | 3300046519 | Ga0495632_0033993 | Ga0495632_0033993_333_1115 | 260 |
| 444 | 3300046519 | Ga0495632_0192441 | Ga0495632_0192441_97_879 | 260 |
| 445 | 3300046520 | Ga0495637_0003747 | Ga0495637_0003747_2367_3149 | 260 |
| 446 | 3300046522 | Ga0495643_0061790 | Ga0495643_0061790_545_1327 | 260 |
| 447 | 3300046524 | Ga0495648_0002534 | Ga0495648_0002534_8900_9682 | 260 |
| 448 | 3300046524 | Ga0495648_0004865 | Ga0495648_0004865_6819_7601 | 260 |
| 449 | 3300046538 | Ga0495609_0003075 | Ga0495609_0003075_525_1307 | 260 |
| 450 | 3300046616 | Ga0495668_0003466 | Ga0495668_0003466_6362_7144 | 260 |
| 451 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2038386_2039168 | 260 |
| 452 | 3300046648 | Ga0495611_0000952 | Ga0495611_0000952_7509_8291 | 260 |
| 453 | 3300046660 | Ga0495625_0000022 | Ga0495625_0000022_217631_218413 | 260 |
| 454 | 3300046660 | Ga0495625_0017937 | Ga0495625_0017937_3940_4722 | 260 |
| 455 | 3300046660 | Ga0495625_0018982 | Ga0495625_0018982_1965_2747 | 260 |
| 456 | 3300046665 | Ga0495661_0006772 | Ga0495661_0006772_917_1699 | 260 |
| 457 | 3300046691 | Ga0495670_0005343 | Ga0495670_0005343_4146_4928 | 260 |
| 458 | 3300046691 | Ga0495670_0021443 | Ga0495670_0021443_1494_2276 | 260 |
| 459 | 3300046692 | Ga0495671_0002998 | Ga0495671_0002998_4285_5067 | 260 |
| 460 | 3300046694 | Ga0495649_0032443 | Ga0495649_0032443_1223_2005 | 260 |
| 461 | 3300046794 | Ga0495589_0000137 | Ga0495589_0000137_28352_29134 | 260 |
| 462 | 3300046810 | Ga0495660_0000728 | Ga0495660_0000728_20334_21116 | 260 |
| 463 | 3300046810 | Ga0495660_0001915 | Ga0495660_0001915_3961_4743 | 260 |
| 464 | 3300047323 | Ga0495683_0001586 | Ga0495683_0001586_7480_8262 | 260 |
| 465 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_149136_149918 | 260 |
| 466 | 3300047469 | Ga0495673_0000202 | Ga0495673_0000202_19257_20039 | 260 |
| 467 | 3300047469 | Ga0495673_0000749 | Ga0495673_0000749_26170_26952 | 260 |
| 468 | 3300047469 | Ga0495673_0003957 | Ga0495673_0003957_4743_5525 | 260 |
| 469 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_66377_67159 | 260 |
| 470 | 3300047472 | Ga0495686_0012978 | Ga0495686_0012978_3915_4697 | 260 |
| 471 | 3300047472 | Ga0495686_0026186 | Ga0495686_0026186_1938_2720 | 260 |
| 472 | 3300047472 | Ga0495686_0046373 | Ga0495686_0046373_1184_1966 | 260 |
| 473 | 3300048905 | Ga0496102_0143100 | Ga0496102_0143100_477_1259 | 260 |
| 474 | 3300048909 | Ga0496106_0001864 | Ga0496106_0001864_7228_8010 | 260 |
| 475 | 3300048911 | Ga0496108_0375265 | Ga0496108_0375265_301_1083 | 260 |
| 476 | 3300048919 | Ga0496116_0079572 | Ga0496116_0079572_1173_1955 | 260 |
| 477 | 3300048920 | Ga0496117_0081132 | Ga0496117_0081132_1129_1911 | 260 |
| 478 | 3300048921 | Ga0496118_0002418 | Ga0496118_0002418_9847_10629 | 260 |
| 479 | 3300048921 | Ga0496118_0002476 | Ga0496118_0002476_5163_5945 | 260 |
| 480 | 3300048921 | Ga0496118_0304649 | Ga0496118_0304649_22_843 | 260 |
| 481 | 3300048924 | Ga0496121_0000045 | Ga0496121_0000045_223985_224767 | 260 |
| 482 | 3300048924 | Ga0496121_0002752 | Ga0496121_0002752_3950_4732 | 260 |
| 483 | 3300048924 | Ga0496121_0007030 | Ga0496121_0007030_8971_9753 | 260 |
| 484 | 3300048925 | Ga0496122_0025121 | Ga0496122_0025121_789_1571 | 260 |
| 485 | 3300048925 | Ga0496122_0125885 | Ga0496122_0125885_776_1558 | 260 |
| 486 | 3300048925 | Ga0496122_0178467 | Ga0496122_0178467_120_941 | 260 |
| 487 | 3300048926 | Ga0496123_0010916 | Ga0496123_0010916_3629_4411 | 260 |
| 488 | 3300048926 | Ga0496123_0040635 | Ga0496123_0040635_31_813 | 260 |
| 489 | 3300048926 | Ga0496123_0045771 | Ga0496123_0045771_18_800 | 260 |
| 490 | 3300048926 | Ga0496123_0061677 | Ga0496123_0061677_850_1632 | 260 |
| 491 | 3300048927 | Ga0496124_0000482 | Ga0496124_0000482_59423_60205 | 260 |
| 492 | 3300048927 | Ga0496124_0002985 | Ga0496124_0002985_16116_16898 | 260 |
| 493 | 3300048928 | Ga0496125_0039288 | Ga0496125_0039288_1984_2766 | 260 |
| 494 | 3300048929 | Ga0496126_0175956 | Ga0496126_0175956_24_806 | 260 |
| 495 | 3300049459 | Ga0495678_000099 | Ga0495678_000099_79424_80206 | 260 |
| 496 | 3300049460 | Ga0495682_0006476 | Ga0495682_0006476_1089_1871 | 260 |
| 497 | 3300049741 | Ga0501079_0096867 | Ga0501079_0096867_1348_2157 | 260 |
| 498 | 3300053093 | Ga0500651_0168738 | Ga0500651_0168738_30_812 | 260 |
| 499 | 3300053103 | Ga0500555_000715 | Ga0500555_000715_5104_5886 | 260 |
| 500 | 3300053160 | Ga0500633_0002326 | Ga0500633_0002326_1959_2741 | 260 |
| 501 | 3300025294 | Ga0209025_1027178 | Ga0209025_10271784 | 261 |
| 502 | 3300041413 | Ga0439465_0003155 | Ga0439465_0003155_844_1635 | 261 |
| 503 | 3300042007 | Ga0439449_0020304 | Ga0439449_0020304_1324_2115 | 261 |
| 504 | 3300049586 | Ga0501070_0008013 | Ga0501070_0008013_1109_1894 | 261 |
| 505 | 3300002067 | JGI24735J21928_10027374 | JGI24735J21928_100273742 | 262 |
| 506 | 3300002705 | JGI25156J39149_1007127 | JGI25156J39149_10071272 | 262 |
| 507 | 3300002741 | JGI25157J39369_1003714 | JGI25157J39369_10037143 | 262 |
| 508 | 3300003187 | JGI25151J46595_10037886 | JGI25151J46595_100378863 | 262 |
| 509 | 3300003322 | rootL2_10010522 | rootL2_100105222 | 262 |
| 510 | 3300003759 | Ga0055525_1000122 | Ga0055525_100012242 | 262 |
| 511 | 3300003759 | Ga0055525_1000149 | Ga0055525_100014921 | 262 |
| 512 | 3300003760 | Ga0055527_1000204 | Ga0055527_100020415 | 262 |
| 513 | 3300003761 | Ga0055535_1000755 | Ga0055535_100075515 | 262 |
| 514 | 3300003762 | Ga0055542_1000451 | Ga0055542_100045115 | 262 |
| 515 | 3300003763 | Ga0055529_1000940 | Ga0055529_100094017 | 262 |
| 516 | 3300003781 | Ga0055536_1002998 | Ga0055536_10029989 | 262 |
| 517 | 3300003791 | Ga0055530_10003803 | Ga0055530_100038037 | 262 |
| 518 | 3300005337 | Ga0070682_100017192 | Ga0070682_1000171924 | 262 |
| 519 | 3300005339 | Ga0070660_100164595 | Ga0070660_1001645952 | 262 |
| 520 | 3300005366 | Ga0070659_100010476 | Ga0070659_1000104764 | 262 |
| 521 | 3300005539 | Ga0068853_100003901 | Ga0068853_1000039013 | 262 |
| 522 | 3300005546 | Ga0070696_100047519 | Ga0070696_1000475194 | 262 |
| 523 | 3300005547 | Ga0070693_100038898 | Ga0070693_1000388982 | 262 |
| 524 | 3300005563 | Ga0068855_100028430 | Ga0068855_1000284308 | 262 |
| 525 | 3300005563 | Ga0068855_100103669 | Ga0068855_1001036692 | 262 |
| 526 | 3300005614 | Ga0068856_100001468 | Ga0068856_10000146816 | 262 |
| 527 | 3300009545 | Ga0105237_10000202 | Ga0105237_1000020274 | 262 |
| 528 | 3300009551 | Ga0105238_10016361 | Ga0105238_100163618 | 262 |
| 529 | 3300009551 | Ga0105238_10093354 | Ga0105238_100933541 | 262 |
| 530 | 3300013100 | Ga0157373_10020859 | Ga0157373_100208594 | 262 |
| 531 | 3300013102 | Ga0157371_10005748 | Ga0157371_100057488 | 262 |
| 532 | 3300013104 | Ga0157370_10013751 | Ga0157370_100137514 | 262 |
| 533 | 3300013104 | Ga0157370_10039182 | Ga0157370_100391822 | 262 |
| 534 | 3300013104 | Ga0157370_10350525 | Ga0157370_103505251 | 262 |
| 535 | 3300013307 | Ga0157372_10007227 | Ga0157372_100072278 | 262 |
| 536 | 3300014497 | Ga0182008_10034286 | Ga0182008_100342862 | 262 |
| 537 | 3300015262 | Ga0182007_10026602 | Ga0182007_100266022 | 262 |
| 538 | 3300015687 | Ga0183368_1004 | Ga0183368_1004277 | 262 |
| 539 | 3300020070 | Ga0206356_11572506 | Ga0206356_115725062 | 262 |
| 540 | 3300025226 | Ga0209674_100016 | Ga0209674_100016359 | 262 |
| 541 | 3300025228 | Ga0209672_100056 | Ga0209672_100056119 | 262 |
| 542 | 3300025230 | Ga0209563_100077 | Ga0209563_10007776 | 262 |
| 543 | 3300025242 | Ga0209258_100096 | Ga0209258_100096119 | 262 |
| 544 | 3300025242 | Ga0209258_101191 | Ga0209258_1011918 | 262 |
| 545 | 3300025246 | Ga0209646_1004458 | Ga0209646_10044582 | 262 |
| 546 | 3300025250 | Ga0209026_1000397 | Ga0209026_100039738 | 262 |
| 547 | 3300025254 | Ga0209148_1000101 | Ga0209148_1000101119 | 262 |
| 548 | 3300025256 | Ga0209759_1002250 | Ga0209759_10022504 | 262 |
| 549 | 3300025272 | Ga0209455_1000094 | Ga0209455_1000094119 | 262 |
| 550 | 3300025272 | Ga0209455_1000496 | Ga0209455_10004968 | 262 |
| 551 | 3300025273 | Ga0209673_1003194 | Ga0209673_10031949 | 262 |
| 552 | 3300025291 | Ga0209675_1024911 | Ga0209675_10249112 | 262 |
| 553 | 3300025292 | Ga0209676_1001428 | Ga0209676_10014289 | 262 |
| 554 | 3300025292 | Ga0209676_1002923 | Ga0209676_100292310 | 262 |
| 555 | 3300025292 | Ga0209676_1006416 | Ga0209676_10064169 | 262 |
| 556 | 3300025292 | Ga0209676_1007181 | Ga0209676_10071818 | 262 |
| 557 | 3300025294 | Ga0209025_1022336 | Ga0209025_10223361 | 262 |
| 558 | 3300025297 | Ga0209758_1033390 | Ga0209758_10333902 | 262 |
| 559 | 3300025298 | Ga0209050_1000653 | Ga0209050_100065311 | 262 |
| 560 | 3300025299 | Ga0209256_1005272 | Ga0209256_10052729 | 262 |
| 561 | 3300025303 | Ga0209051_1004130 | Ga0209051_10041309 | 262 |
| 562 | 3300025304 | Ga0209257_1000349 | Ga0209257_100034979 | 262 |
| 563 | 3300025304 | Ga0209257_1008881 | Ga0209257_10088812 | 262 |
| 564 | 3300025304 | Ga0209257_1030862 | Ga0209257_10308622 | 262 |
| 565 | 3300025914 | Ga0207671_10000726 | Ga0207671_1000072645 | 262 |
| 566 | 3300025919 | Ga0207657_10173036 | Ga0207657_101730362 | 262 |
| 567 | 3300025924 | Ga0207694_10035601 | Ga0207694_100356014 | 262 |
| 568 | 3300025932 | Ga0207690_10013241 | Ga0207690_100132415 | 262 |
| 569 | 3300025949 | Ga0207667_10043422 | Ga0207667_100434223 | 262 |
| 570 | 3300025949 | Ga0207667_10094525 | Ga0207667_100945254 | 262 |
| 571 | 3300025981 | Ga0207640_10028015 | Ga0207640_100280154 | 262 |
| 572 | 3300026041 | Ga0207639_10015296 | Ga0207639_100152966 | 262 |
| 573 | 3300026067 | Ga0207678_10002479 | Ga0207678_100024798 | 262 |
| 574 | 3300026078 | Ga0207702_10000456 | Ga0207702_100004568 | 262 |
| 575 | 3300031901 | Ga0307406_10003052 | Ga0307406_100030523 | 262 |
| 576 | 3300032004 | Ga0307414_10021965 | Ga0307414_100219653 | 262 |
| 577 | 3300032004 | Ga0307414_10453379 | Ga0307414_104533792 | 262 |
| 578 | 3300041404 | Ga0439436_0008203 | Ga0439436_0008203_181_984 | 262 |
| 579 | 3300045976 | Ga0466967_0086091 | Ga0466967_0086091_1411_2202 | 262 |
| 580 | 3300048907 | Ga0496104_0255592 | Ga0496104_0255592_170_961 | 262 |
| 581 | 3300048916 | Ga0496113_0007102 | Ga0496113_0007102_4553_5344 | 262 |
| 582 | 3300048918 | Ga0496115_0000024 | Ga0496115_0000024_148432_149223 | 262 |
| 583 | 3300049568 | Ga0501031_0078488 | Ga0501031_0078488_27_824 | 262 |
| 584 | 3300049568 | Ga0501031_0086544 | Ga0501031_0086544_266_1108 | 262 |
| 585 | 3300049569 | Ga0501032_0205933 | Ga0501032_0205933_300_1112 | 262 |
| 586 | 3300049570 | Ga0501033_0013188 | Ga0501033_0013188_798_1586 | 262 |
| 587 | 3300049570 | Ga0501033_0015054 | Ga0501033_0015054_4494_5336 | 262 |
| 588 | 3300049570 | Ga0501033_0445824 | Ga0501033_0445824_87_881 | 262 |
| 589 | 3300049571 | Ga0501034_0005361 | Ga0501034_0005361_5405_6199 | 262 |
| 590 | 3300049571 | Ga0501034_0114586 | Ga0501034_0114586_1162_1974 | 262 |
| 591 | 3300049572 | Ga0501036_0100147 | Ga0501036_0100147_1403_2215 | 262 |
| 592 | 3300049572 | Ga0501036_0174120 | Ga0501036_0174120_463_1305 | 262 |
| 593 | 3300049573 | Ga0501037_0045944 | Ga0501037_0045944_703_1545 | 262 |
| 594 | 3300049573 | Ga0501037_0049817 | Ga0501037_0049817_2041_2835 | 262 |
| 595 | 3300049575 | Ga0501039_0065333 | Ga0501039_0065333_1181_2023 | 262 |
| 596 | 3300049578 | Ga0501042_0158396 | Ga0501042_0158396_60_902 | 262 |
| 597 | 3300049579 | Ga0501043_0002627 | Ga0501043_0002627_9412_10215 | 262 |
| 598 | 3300049579 | Ga0501043_0012216 | Ga0501043_0012216_3728_4516 | 262 |
| 599 | 3300049579 | Ga0501043_0056868 | Ga0501043_0056868_719_1561 | 262 |
| 600 | 3300049580 | Ga0501046_0043282 | Ga0501046_0043282_2148_2990 | 262 |
| 601 | 3300049581 | Ga0501047_0018151 | Ga0501047_0018151_3559_4347 | 262 |
| 602 | 3300049582 | Ga0501048_0048236 | Ga0501048_0048236_627_1469 | 262 |
| 603 | 3300049586 | Ga0501070_0049330 | Ga0501070_0049330_1909_2703 | 262 |
| 604 | 3300049593 | Ga0501077_0185606 | Ga0501077_0185606_470_1264 | 262 |
| 605 | 3300049822 | Ga0501035_0029374 | Ga0501035_0029374_1857_2645 | 262 |
| 606 | 3300049822 | Ga0501035_0044167 | Ga0501035_0044167_2084_2878 | 262 |
| 607 | 3300049822 | Ga0501035_0124664 | Ga0501035_0124664_924_1712 | 262 |
| 608 | 3300049822 | Ga0501035_0325564 | Ga0501035_0325564_424_1236 | 262 |
| 609 | 3300049823 | Ga0501044_0024669 | Ga0501044_0024669_3195_3983 | 262 |
| 610 | 3300049823 | Ga0501044_0073227 | Ga0501044_0073227_1902_2696 | 262 |
| 611 | 3300049823 | Ga0501044_0130531 | Ga0501044_0130531_736_1524 | 262 |
| 612 | 3300049823 | Ga0501044_0282966 | Ga0501044_0282966_758_1570 | 262 |
| 613 | 3300049823 | Ga0501044_0290150 | Ga0501044_0290150_35_877 | 262 |
| 614 | 3300001979 | JGI24740J21852_10016336 | JGI24740J21852_100163361 | 263 |
| 615 | 3300001989 | JGI24739J22299_10000040 | JGI24739J22299_1000004031 | 263 |
| 616 | 3300001990 | JGI24737J22298_10012814 | JGI24737J22298_100128144 | 263 |
| 617 | 3300002067 | JGI24735J21928_10014781 | JGI24735J21928_100147812 | 263 |
| 618 | 3300002705 | JGI25156J39149_1000714 | JGI25156J39149_10007143 | 263 |
| 619 | 3300002705 | JGI25156J39149_1006236 | JGI25156J39149_10062363 | 263 |
| 620 | 3300002737 | JGI25162J39368_1000551 | JGI25162J39368_100055118 | 263 |
| 621 | 3300002737 | JGI25162J39368_1000783 | JGI25162J39368_100078326 | 263 |
| 622 | 3300002737 | JGI25162J39368_1001115 | JGI25162J39368_100111515 | 263 |
| 623 | 3300002737 | JGI25162J39368_1003412 | JGI25162J39368_10034121 | 263 |
| 624 | 3300002737 | JGI25162J39368_1003477 | JGI25162J39368_10034777 | 263 |
| 625 | 3300002738 | JGI25154J39366_1004788 | JGI25154J39366_10047882 | 263 |
| 626 | 3300002741 | JGI25157J39369_1000485 | JGI25157J39369_10004853 | 263 |
| 627 | 3300002741 | JGI25157J39369_1000595 | JGI25157J39369_100059526 | 263 |
| 628 | 3300002741 | JGI25157J39369_1000847 | JGI25157J39369_100084716 | 263 |
| 629 | 3300002741 | JGI25157J39369_1001468 | JGI25157J39369_100146813 | 263 |
| 630 | 3300002771 | JGI25163J39215_1001294 | JGI25163J39215_10012944 | 263 |
| 631 | 3300002772 | JGI25164J39214_1000046 | JGI25164J39214_100004634 | 263 |
| 632 | 3300002772 | JGI25164J39214_1000191 | JGI25164J39214_100019136 | 263 |
| 633 | 3300002772 | JGI25164J39214_1000453 | JGI25164J39214_100045326 | 263 |
| 634 | 3300002772 | JGI25164J39214_1000842 | JGI25164J39214_10008425 | 263 |
| 635 | 3300002772 | JGI25164J39214_1000905 | JGI25164J39214_10009059 | 263 |
| 636 | 3300003214 | JGI25165J46597_1000096 | JGI25165J46597_100009631 | 263 |
| 637 | 3300003214 | JGI25165J46597_1000877 | JGI25165J46597_100087726 | 263 |
| 638 | 3300003214 | JGI25165J46597_1001702 | JGI25165J46597_10017027 | 263 |
| 639 | 3300003214 | JGI25165J46597_1003783 | JGI25165J46597_10037833 | 263 |
| 640 | 3300003215 | JGI25153J46596_10005437 | JGI25153J46596_100054374 | 263 |
| 641 | 3300003578 | Ga0006562J51391_1021318 | Ga0006562J51391_10213181 | 263 |
| 642 | 3300003751 | Ga0055538_1001663 | Ga0055538_10016633 | 263 |
| 643 | 3300003752 | Ga0055539_1000569 | Ga0055539_100056910 | 263 |
| 644 | 3300003756 | Ga0055533_1002346 | Ga0055533_10023464 | 263 |
| 645 | 3300003760 | Ga0055527_1000265 | Ga0055527_100026529 | 263 |
| 646 | 3300003760 | Ga0055527_1001913 | Ga0055527_10019132 | 263 |
| 647 | 3300003761 | Ga0055535_1000561 | Ga0055535_100056129 | 263 |
| 648 | 3300003761 | Ga0055535_1000866 | Ga0055535_100086626 | 263 |
| 649 | 3300003761 | Ga0055535_1001951 | Ga0055535_10019515 | 263 |
| 650 | 3300003761 | Ga0055535_1003042 | Ga0055535_10030424 | 263 |
| 651 | 3300003762 | Ga0055542_1000306 | Ga0055542_100030623 | 263 |
| 652 | 3300003762 | Ga0055542_1000582 | Ga0055542_10005827 | 263 |
| 653 | 3300003762 | Ga0055542_1000855 | Ga0055542_100085526 | 263 |
| 654 | 3300003762 | Ga0055542_1001843 | Ga0055542_10018435 | 263 |
| 655 | 3300003762 | Ga0055542_1002057 | Ga0055542_10020577 | 263 |
| 656 | 3300003763 | Ga0055529_1000309 | Ga0055529_10003096 | 263 |
| 657 | 3300003763 | Ga0055529_1000551 | Ga0055529_10005517 | 263 |
| 658 | 3300003763 | Ga0055529_1000733 | Ga0055529_100073326 | 263 |
| 659 | 3300005262 | Ga0065165_1008763 | Ga0065165_10087636 | 263 |
| 660 | 3300005336 | Ga0070680_100146217 | Ga0070680_1001462172 | 263 |
| 661 | 3300005337 | Ga0070682_100001003 | Ga0070682_10000100316 | 263 |
| 662 | 3300005340 | Ga0070689_100023584 | Ga0070689_1000235844 | 263 |
| 663 | 3300005344 | Ga0070661_100078301 | Ga0070661_1000783012 | 263 |
| 664 | 3300005344 | Ga0070661_100100966 | Ga0070661_1001009662 | 263 |
| 665 | 3300005345 | Ga0070692_10002864 | Ga0070692_100028648 | 263 |
| 666 | 3300005366 | Ga0070659_100003413 | Ga0070659_1000034132 | 263 |
| 667 | 3300005435 | Ga0070714_100000034 | Ga0070714_100000034124 | 263 |
| 668 | 3300005435 | Ga0070714_100029320 | Ga0070714_1000293207 | 263 |
| 669 | 3300005436 | Ga0070713_100000353 | Ga0070713_1000003533 | 263 |
| 670 | 3300005455 | Ga0070663_100089281 | Ga0070663_1000892812 | 263 |
| 671 | 3300005458 | Ga0070681_10000344 | Ga0070681_1000034413 | 263 |
| 672 | 3300005458 | Ga0070681_10002489 | Ga0070681_100024898 | 263 |
| 673 | 3300005458 | Ga0070681_10025865 | Ga0070681_100258651 | 263 |
| 674 | 3300005530 | Ga0070679_100008801 | Ga0070679_10000880110 | 263 |
| 675 | 3300005530 | Ga0070679_100042854 | Ga0070679_1000428544 | 263 |
| 676 | 3300005546 | Ga0070696_100002465 | Ga0070696_1000024658 | 263 |
| 677 | 3300005546 | Ga0070696_100003766 | Ga0070696_1000037664 | 263 |
| 678 | 3300005547 | Ga0070693_100010283 | Ga0070693_1000102832 | 263 |
| 679 | 3300005563 | Ga0068855_100095757 | Ga0068855_1000957572 | 263 |
| 680 | 3300005577 | Ga0068857_100001580 | Ga0068857_10000158010 | 263 |
| 681 | 3300005577 | Ga0068857_100069236 | Ga0068857_1000692362 | 263 |
| 682 | 3300005577 | Ga0068857_100376957 | Ga0068857_1003769572 | 263 |
| 683 | 3300005578 | Ga0068854_100004721 | Ga0068854_1000047214 | 263 |
| 684 | 3300005578 | Ga0068854_100014481 | Ga0068854_1000144815 | 263 |
| 685 | 3300005578 | Ga0068854_100038122 | Ga0068854_1000381222 | 263 |
| 686 | 3300005614 | Ga0068856_100005447 | Ga0068856_1000054478 | 263 |
| 687 | 3300005842 | Ga0068858_100008948 | Ga0068858_10000894815 | 263 |
| 688 | 3300009093 | Ga0105240_10008512 | Ga0105240_1000851214 | 263 |
| 689 | 3300009093 | Ga0105240_10027090 | Ga0105240_100270907 | 263 |
| 690 | 3300009093 | Ga0105240_10030925 | Ga0105240_100309258 | 263 |
| 691 | 3300009545 | Ga0105237_10000023 | Ga0105237_1000002339 | 263 |
| 692 | 3300009545 | Ga0105237_10025889 | Ga0105237_100258897 | 263 |
| 693 | 3300009551 | Ga0105238_10315596 | Ga0105238_103155962 | 263 |
| 694 | 3300009551 | Ga0105238_10338446 | Ga0105238_103384462 | 263 |
| 695 | 3300010375 | Ga0105239_10000022 | Ga0105239_1000002274 | 263 |
| 696 | 3300010375 | Ga0105239_10086061 | Ga0105239_100860613 | 263 |
| 697 | 3300012502 | Ga0157347_1005723 | Ga0157347_10057231 | 263 |
| 698 | 3300013100 | Ga0157373_10019910 | Ga0157373_100199106 | 263 |
| 699 | 3300013100 | Ga0157373_10411225 | Ga0157373_104112251 | 263 |
| 700 | 3300013102 | Ga0157371_10015964 | Ga0157371_100159647 | 263 |
| 701 | 3300013104 | Ga0157370_10007947 | Ga0157370_100079478 | 263 |
| 702 | 3300013105 | Ga0157369_10024098 | Ga0157369_100240988 | 263 |
| 703 | 3300013307 | Ga0157372_10539578 | Ga0157372_105395781 | 263 |
| 704 | 3300014325 | Ga0163163_10429229 | Ga0163163_104292292 | 263 |
| 705 | 3300025224 | Ga0209784_100047 | Ga0209784_100047155 | 263 |
| 706 | 3300025226 | Ga0209674_100053 | Ga0209674_100053122 | 263 |
| 707 | 3300025226 | Ga0209674_101380 | Ga0209674_1013808 | 263 |
| 708 | 3300025228 | Ga0209672_100009 | Ga0209672_100009257 | 263 |
| 709 | 3300025228 | Ga0209672_100160 | Ga0209672_10016050 | 263 |
| 710 | 3300025228 | Ga0209672_102153 | Ga0209672_1021538 | 263 |
| 711 | 3300025231 | Ga0207427_100023 | Ga0207427_100023339 | 263 |
| 712 | 3300025231 | Ga0207427_100040 | Ga0207427_10004089 | 263 |
| 713 | 3300025231 | Ga0207427_100050 | Ga0207427_100050308 | 263 |
| 714 | 3300025231 | Ga0207427_100166 | Ga0207427_10016610 | 263 |
| 715 | 3300025233 | Ga0209437_100015 | Ga0209437_100015577 | 263 |
| 716 | 3300025233 | Ga0209437_100120 | Ga0209437_10012033 | 263 |
| 717 | 3300025233 | Ga0209437_100172 | Ga0209437_10017289 | 263 |
| 718 | 3300025233 | Ga0209437_100276 | Ga0209437_10027630 | 263 |
| 719 | 3300025233 | Ga0209437_100288 | Ga0209437_10028875 | 263 |
| 720 | 3300025242 | Ga0209258_100011 | Ga0209258_100011386 | 263 |
| 721 | 3300025242 | Ga0209258_100043 | Ga0209258_10004358 | 263 |
| 722 | 3300025242 | Ga0209258_100246 | Ga0209258_10024649 | 263 |
| 723 | 3300025242 | Ga0209258_100598 | Ga0209258_1005985 | 263 |
| 724 | 3300025246 | Ga0209646_1001741 | Ga0209646_10017415 | 263 |
| 725 | 3300025246 | Ga0209646_1002174 | Ga0209646_10021744 | 263 |
| 726 | 3300025250 | Ga0209026_1000047 | Ga0209026_100004758 | 263 |
| 727 | 3300025250 | Ga0209026_1000101 | Ga0209026_100010179 | 263 |
| 728 | 3300025250 | Ga0209026_1000157 | Ga0209026_100015728 | 263 |
| 729 | 3300025250 | Ga0209026_1002418 | Ga0209026_10024188 | 263 |
| 730 | 3300025250 | Ga0209026_1006975 | Ga0209026_10069751 | 263 |
| 731 | 3300025253 | Ga0209677_111351 | Ga0209677_1113512 | 263 |
| 732 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021978 | 263 |
| 733 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010338 | 263 |
| 734 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013386 | 263 |
| 735 | 3300025254 | Ga0209148_1000024 | Ga0209148_1000024483 | 263 |
| 736 | 3300025254 | Ga0209148_1000052 | Ga0209148_1000052298 | 263 |
| 737 | 3300025256 | Ga0209759_1000287 | Ga0209759_100028721 | 263 |
| 738 | 3300025256 | Ga0209759_1000453 | Ga0209759_100045312 | 263 |
| 739 | 3300025256 | Ga0209759_1000807 | Ga0209759_100080718 | 263 |
| 740 | 3300025256 | Ga0209759_1001871 | Ga0209759_100187114 | 263 |
| 741 | 3300025256 | Ga0209759_1010351 | Ga0209759_10103513 | 263 |
| 742 | 3300025258 | Ga0209129_1001629 | Ga0209129_10016297 | 263 |
| 743 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009834 | 263 |
| 744 | 3300025261 | Ga0209233_1000108 | Ga0209233_1000108137 | 263 |
| 745 | 3300025261 | Ga0209233_1000174 | Ga0209233_1000174137 | 263 |
| 746 | 3300025261 | Ga0209233_1000184 | Ga0209233_1000184129 | 263 |
| 747 | 3300025261 | Ga0209233_1000284 | Ga0209233_100028471 | 263 |
| 748 | 3300025261 | Ga0209233_1018207 | Ga0209233_10182072 | 263 |
| 749 | 3300025272 | Ga0209455_1000012 | Ga0209455_1000012386 | 263 |
| 750 | 3300025272 | Ga0209455_1000020 | Ga0209455_1000020266 | 263 |
| 751 | 3300025272 | Ga0209455_1000025 | Ga0209455_1000025483 | 263 |
| 752 | 3300025297 | Ga0209758_1001571 | Ga0209758_100157110 | 263 |
| 753 | 3300025904 | Ga0207647_10032018 | Ga0207647_100320182 | 263 |
| 754 | 3300025909 | Ga0207705_10210904 | Ga0207705_102109042 | 263 |
| 755 | 3300025911 | Ga0207654_10129537 | Ga0207654_101295372 | 263 |
| 756 | 3300025912 | Ga0207707_10000128 | Ga0207707_1000012843 | 263 |
| 757 | 3300025912 | Ga0207707_10000933 | Ga0207707_1000093310 | 263 |
| 758 | 3300025912 | Ga0207707_10007534 | Ga0207707_100075348 | 263 |
| 759 | 3300025912 | Ga0207707_10117900 | Ga0207707_101179002 | 263 |
| 760 | 3300025913 | Ga0207695_10000654 | Ga0207695_100006549 | 263 |
| 761 | 3300025913 | Ga0207695_10001068 | Ga0207695_1000106845 | 263 |
| 762 | 3300025913 | Ga0207695_10064629 | Ga0207695_100646294 | 263 |
| 763 | 3300025914 | Ga0207671_10000020 | Ga0207671_10000020196 | 263 |
| 764 | 3300025914 | Ga0207671_10000033 | Ga0207671_1000003359 | 263 |
| 765 | 3300025914 | Ga0207671_10039957 | Ga0207671_100399574 | 263 |
| 766 | 3300025920 | Ga0207649_10072779 | Ga0207649_100727792 | 263 |
| 767 | 3300025921 | Ga0207652_10002665 | Ga0207652_1000266510 | 263 |
| 768 | 3300025921 | Ga0207652_10090774 | Ga0207652_100907743 | 263 |
| 769 | 3300025924 | Ga0207694_10156168 | Ga0207694_101561682 | 263 |
| 770 | 3300025924 | Ga0207694_10293204 | Ga0207694_102932042 | 263 |
| 771 | 3300025928 | Ga0207700_10002664 | Ga0207700_100026649 | 263 |
| 772 | 3300025929 | Ga0207664_10000021 | Ga0207664_1000002199 | 263 |
| 773 | 3300025929 | Ga0207664_10016425 | Ga0207664_100164254 | 263 |
| 774 | 3300025932 | Ga0207690_10122194 | Ga0207690_101221943 | 263 |
| 775 | 3300025933 | Ga0207706_10148074 | Ga0207706_101480742 | 263 |
| 776 | 3300025936 | Ga0207670_10026070 | Ga0207670_100260703 | 263 |
| 777 | 3300025949 | Ga0207667_10000130 | Ga0207667_1000013084 | 263 |
| 778 | 3300025949 | Ga0207667_10000416 | Ga0207667_1000041661 | 263 |
| 779 | 3300025949 | Ga0207667_10132317 | Ga0207667_101323172 | 263 |
| 780 | 3300025981 | Ga0207640_10000103 | Ga0207640_1000010371 | 263 |
| 781 | 3300025981 | Ga0207640_10099336 | Ga0207640_100993362 | 263 |
| 782 | 3300026035 | Ga0207703_10061090 | Ga0207703_100610901 | 263 |
| 783 | 3300026041 | Ga0207639_10222282 | Ga0207639_102222821 | 263 |
| 784 | 3300026067 | Ga0207678_10020658 | Ga0207678_100206582 | 263 |
| 785 | 3300026078 | Ga0207702_10013037 | Ga0207702_100130373 | 263 |
| 786 | 3300026078 | Ga0207702_10324436 | Ga0207702_103244362 | 263 |
| 787 | 3300026116 | Ga0207674_10000971 | Ga0207674_1000097131 | 263 |
| 788 | 3300026116 | Ga0207674_10085992 | Ga0207674_100859924 | 263 |
| 789 | 3300026116 | Ga0207674_10202828 | Ga0207674_102028283 | 263 |
| 790 | 3300028380 | Ga0268265_10381496 | Ga0268265_103814962 | 263 |
| 791 | 3300037312 | Ga0395899_0000195 | Ga0395899_0000195_1526_2383 | 263 |
| 792 | 3300037418 | Ga0395900_0000018 | Ga0395900_0000018_206841_207698 | 263 |
| 793 | 3300037466 | Ga0395898_0000213 | Ga0395898_0000213_75214_76062 | 263 |
| 794 | 3300037466 | Ga0395898_0003959 | Ga0395898_0003959_13940_14797 | 263 |
| 795 | 3300038443 | Ga0395901_0196775 | Ga0395901_0196775_1273_2070 | 263 |
| 796 | 3300041452 | Ga0451793_0691818 | Ga0451793_0691818_1140_1940 | 263 |
| 797 | 3300042438 | Ga0439459_0004199 | Ga0439459_0004199_1460_2257 | 263 |
| 798 | 3300044656 | Ga0466969_0008996 | Ga0466969_0008996_160_954 | 263 |
| 799 | 3300044656 | Ga0466969_0012302 | Ga0466969_0012302_1430_2287 | 263 |
| 800 | 3300044672 | Ga0466982_0000020 | Ga0466982_0000020_52127_52972 | 263 |
| 801 | 3300044683 | Ga0466965_0018012 | Ga0466965_0018012_1468_2424 | 263 |
| 802 | 3300044683 | Ga0466965_0048771 | Ga0466965_0048771_532_1377 | 263 |
| 803 | 3300044684 | Ga0466966_0012209 | Ga0466966_0012209_72_917 | 263 |
| 804 | 3300044684 | Ga0466966_0053515 | Ga0466966_0053515_27_857 | 263 |
| 805 | 3300044693 | Ga0466961_0000944 | Ga0466961_0000944_1434_2390 | 263 |
| 806 | 3300044693 | Ga0466961_0003373 | Ga0466961_0003373_5075_5869 | 263 |
| 807 | 3300044693 | Ga0466961_0010106 | Ga0466961_0010106_1999_2829 | 263 |
| 808 | 3300044693 | Ga0466961_0018571 | Ga0466961_0018571_2314_3108 | 263 |
| 809 | 3300044693 | Ga0466961_0067987 | Ga0466961_0067987_803_1648 | 263 |
| 810 | 3300044694 | Ga0466963_0164429 | Ga0466963_0164429_340_1185 | 263 |
| 811 | 3300044694 | Ga0466963_0457744 | Ga0466963_0457744_70_864 | 263 |
| 812 | 3300044706 | Ga0466964_0016461 | Ga0466964_0016461_534_1331 | 263 |
| 813 | 3300044719 | Ga0466971_0002694 | Ga0466971_0002694_1694_2491 | 263 |
| 814 | 3300044735 | Ga0466968_0001238 | Ga0466968_0001238_447_1292 | 263 |
| 815 | 3300044735 | Ga0466968_0045493 | Ga0466968_0045493_901_1725 | 263 |
| 816 | 3300044765 | Ga0466970_0010599 | Ga0466970_0010599_3135_3959 | 263 |
| 817 | 3300044765 | Ga0466970_0012342 | Ga0466970_0012342_1808_2653 | 263 |
| 818 | 3300044842 | Ga0466957_0005144 | Ga0466957_0005144_1624_2448 | 263 |
| 819 | 3300044901 | Ga0466960_0036956 | Ga0466960_0036956_1209_2006 | 263 |
| 820 | 3300045049 | Ga0466959_0004692 | Ga0466959_0004692_1154_2110 | 263 |
| 821 | 3300045049 | Ga0466959_0007758 | Ga0466959_0007758_5587_6444 | 263 |
| 822 | 3300045049 | Ga0466959_0032260 | Ga0466959_0032260_1570_2394 | 263 |
| 823 | 3300045836 | Ga0466958_0007344 | Ga0466958_0007344_2201_2995 | 263 |
| 824 | 3300045836 | Ga0466958_0016157 | Ga0466958_0016157_846_1802 | 263 |
| 825 | 3300045976 | Ga0466967_0060040 | Ga0466967_0060040_943_1737 | 263 |
| 826 | 3300046460 | Ga0495638_0000063 | Ga0495638_0000063_85868_86665 | 263 |
| 827 | 3300046460 | Ga0495638_0002410 | Ga0495638_0002410_10196_11038 | 263 |
| 828 | 3300046460 | Ga0495638_0013756 | Ga0495638_0013756_3720_4514 | 263 |
| 829 | 3300046460 | Ga0495638_0063767 | Ga0495638_0063767_138_971 | 263 |
| 830 | 3300046471 | Ga0495650_0002180 | Ga0495650_0002180_10996_11838 | 263 |
| 831 | 3300046507 | Ga0495606_0002450 | Ga0495606_0002450_19788_20582 | 263 |
| 832 | 3300046542 | Ga0495597_0109933 | Ga0495597_0109933_19_813 | 263 |
| 833 | 3300046694 | Ga0495649_0008433 | Ga0495649_0008433_1319_2113 | 263 |
| 834 | 3300048907 | Ga0496104_0484599 | Ga0496104_0484599_134_928 | 263 |
| 835 | 3300048908 | Ga0496105_0042121 | Ga0496105_0042121_736_1530 | 263 |
| 836 | 3300048916 | Ga0496113_0141683 | Ga0496113_0141683_363_1160 | 263 |
| 837 | 3300048918 | Ga0496115_0024172 | Ga0496115_0024172_2636_3430 | 263 |
| 838 | 3300048918 | Ga0496115_0076325 | Ga0496115_0076325_1057_1899 | 263 |
| 839 | 3300048920 | Ga0496117_0071799 | Ga0496117_0071799_814_1608 | 263 |
| 840 | 3300048921 | Ga0496118_0004740 | Ga0496118_0004740_8632_9426 | 263 |
| 841 | 3300048922 | Ga0496119_0001058 | Ga0496119_0001058_18869_19663 | 263 |
| 842 | 3300048922 | Ga0496119_0011077 | Ga0496119_0011077_1988_2812 | 263 |
| 843 | 3300048923 | Ga0496120_0002531 | Ga0496120_0002531_6368_7192 | 263 |
| 844 | 3300048923 | Ga0496120_0005836 | Ga0496120_0005836_2102_2896 | 263 |
| 845 | 3300048924 | Ga0496121_0006364 | Ga0496121_0006364_8926_9726 | 263 |
| 846 | 3300048928 | Ga0496125_0000344 | Ga0496125_0000344_51537_52334 | 263 |
| 847 | 3300048929 | Ga0496126_0015164 | Ga0496126_0015164_1617_2441 | 263 |
| 848 | 3300048929 | Ga0496126_0190285 | Ga0496126_0190285_86_928 | 263 |
| 849 | 3300049569 | Ga0501032_0006980 | Ga0501032_0006980_5214_6011 | 263 |
| 850 | 3300049581 | Ga0501047_0038405 | Ga0501047_0038405_3069_3866 | 263 |
| 851 | 3300049586 | Ga0501070_0246544 | Ga0501070_0246544_210_1007 | 263 |
| 852 | 3300061719 | Ga0466962_0001160 | Ga0466962_0001160_9468_10424 | 263 |
| 853 | 3300061719 | Ga0466962_0003497 | Ga0466962_0003497_6382_7176 | 263 |
| 854 | 3300061719 | Ga0466962_0005665 | Ga0466962_0005665_4233_5030 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ty2-assembly1.cif.gz_B | structure of a 5'-nucleotidase (sure) from coxiella burnetii | 0.9488 | 1 | 250 |
| 3ty2-assembly1.cif.gz_B | structure of a 5'-nucleotidase (sure) from coxiella burnetii | 0.9343 | 1 | 250 |
| 4xh8-assembly1.cif.gz_B | crystal structure of e112a/d230a mutant of stationary phase survival protein (sure) from salmonella typhimurium | 0.9232 | 1 | 251 |
| 4zg5-assembly1.cif.gz_A | structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus | 0.9217 | 1 | 244 |
| 4zg5-assembly1.cif.gz_C | structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus | 0.9195 | 1 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qeaA00 | Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase | 0.9287 | 1 | 239 | 3.40.1210.10 |
| 4xgbA00 | Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase | 0.9127 | 1 | 251 | 3.40.1210.10 |
| 4qeaA00 | Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase | 0.8965 | 1 | 239 | 3.40.1210.10 |
| 2wqkB00 | Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase | 0.8788 | 1 | 247 | 3.40.1210.10 |
| 2wqkB00 | Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase | 0.8721 | 1 | 247 | 3.40.1210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2Z7A139-F1-model_v4 | Survival protein SurE-like phosphatase/nucleotidase domain-containing protein | 0.9779 | 1 | 242 |
GO:0000166
GO:0004309 GO:0004719 GO:0005737 GO:0008253 GO:0008254 GO:0036211 GO:0046872 |
| AF-A0A6P0ELH0-F1-model_v4 | deleted | 0.9745 | 107 | 223 |
|
| AF-A0A356U3L7-F1-model_v4 | deleted | 0.9723 | 1 | 119 |
|
| AF-A0A7C7HRH0-F1-model_v4 | 5'-nucleotidase (EC 3.1.3.5) | 0.9703 | 1 | 220 |
GO:0000166
GO:0004309 GO:0005737 GO:0008254 GO:0046872 GO:0106411 |
| AF-M5CXX0-F1-model_v4 | deleted | 0.9698 | 1 | 254 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar