F483576

General Info

Members Datasets Scaffolds Average Seq Length
854 358 854 81

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101037434|Ga0070696_1010374342
Length 90
Sequence MAQRPDDTESMEGIFIDIEVSAAIADDAEMAAKLEEVCPVDIFDVREGDGSVAINRENLDECVLCNLCVEAAPPGGVVVKKLYDGTELRR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
169 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
208 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
346 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
352 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
354 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 8.31
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000100 3300001977 Bacteria 9779
2 JGI24740J21852_10026088 3300001979 Bacteria 1961
3 JGI25407J50210_10026922 3300003373 Bacteria 1491
4 Ga0058860_11913064 3300004801 Bacteria 1180
5 Ga0070658_10096516 3300005327 Bacteria 2440
6 Ga0070683_100013452 3300005329 Bacteria 7136
7 Ga0070683_100018313 3300005329 Bacteria 6200
8 Ga0070683_100097877 3300005329 Bacteria 2760
9 Ga0070683_100529723 3300005329 Bacteria 1126
10 Ga0070683_101194638 3300005329 Bacteria 731
11 Ga0070683_101290749 3300005329 Bacteria 702
12 Ga0070670_100071744 3300005331 Bacteria 2974
13 Ga0070677_10000620 3300005333 Bacteria 11947
14 Ga0070666_10021476 3300005335 Bacteria 4185
15 Ga0070666_10024284 3300005335 Bacteria 3947
16 Ga0070666_10182897 3300005335 Bacteria 1471
17 Ga0070682_100000013 3300005337 Bacteria 254641
18 Ga0070682_100000117 3300005337 Bacteria 69662
19 Ga0070682_100230344 3300005337 Bacteria 1324
20 Ga0070660_100856029 3300005339 Bacteria 766
21 Ga0070689_100225577 3300005340 Bacteria 1538
22 Ga0070691_10000344 3300005341 Bacteria 16531
23 Ga0070661_100001375 3300005344 Bacteria 16996
24 Ga0070692_10076888 3300005345 Bacteria 1790
25 Ga0070668_100046204 3300005347 Bacteria 3342
26 Ga0070668_100384052 3300005347 Bacteria 1196
27 Ga0070669_100847803 3300005353 Bacteria 779
28 Ga0070675_100000111 3300005354 Bacteria 47699
29 Ga0070674_100436769 3300005356 Bacteria 1077
30 Ga0070688_100003353 3300005365 Bacteria 8214
31 Ga0070688_100031251 3300005365 Bacteria 3202
32 Ga0070659_100064556 3300005366 Bacteria 2898
33 Ga0070659_100081482 3300005366 Bacteria 2585
34 Ga0070667_100019394 3300005367 Bacteria 5642
35 Ga0070667_100420744 3300005367 Bacteria 1218
36 Ga0070667_100473010 3300005367 Bacteria 1147
37 Ga0070667_100717556 3300005367 Bacteria 926
38 Ga0070667_101056363 3300005367 Bacteria 758
39 Ga0070714_100369857 3300005435 Bacteria 1349
40 Ga0070714_101403465 3300005435 Unclassified 682
41 Ga0070713_100000390 3300005436 Bacteria 28149
42 Ga0070713_100076960 3300005436 Bacteria 2835
43 Ga0070701_10798054 3300005438 Bacteria 644
44 Ga0070711_100002341 3300005439 Bacteria 10769
45 Ga0070711_100079580 3300005439 Bacteria 2331
46 Ga0070711_100342071 3300005439 Unclassified 1200
47 Ga0070711_101991869 3300005439 Bacteria 511
48 Ga0070700_101004836 3300005441 Unclassified 686
49 Ga0070700_101296323 3300005441 Bacteria 612
50 Ga0070694_101211204 3300005444 Bacteria 633
51 Ga0070708_101006087 3300005445 Bacteria 782
52 Ga0070663_100000728 3300005455 Bacteria 17736
53 Ga0070663_100450556 3300005455 Bacteria 1061
54 Ga0070663_100559632 3300005455 Bacteria 957
55 Ga0070663_101181470 3300005455 Bacteria 672
56 Ga0070678_100230631 3300005456 Bacteria 1543
57 Ga0070678_100675274 3300005456 Bacteria 929
58 Ga0070681_10010667 3300005458 Bacteria 9081
59 Ga0070681_10195528 3300005458 Bacteria 1941
60 Ga0070685_10004176 3300005466 Bacteria 7284
61 Ga0070685_10014878 3300005466 Bacteria 4127
62 Ga0070706_101024855 3300005467 Bacteria 761
63 Ga0070707_100721365 3300005468 Bacteria 960
64 Ga0070679_100000068 3300005530 Bacteria 77184
65 Ga0070679_100007698 3300005530 Bacteria 10085
66 Ga0070684_100003702 3300005535 Bacteria 11535
67 Ga0070684_100053567 3300005535 Bacteria 3513
68 Ga0070684_100082890 3300005535 Bacteria 2841
69 Ga0070684_100564524 3300005535 Bacteria 1057
70 Ga0070684_100862732 3300005535 Bacteria 847
71 Ga0070684_102205542 3300005535 Bacteria 520
72 Ga0070697_100811940 3300005536 Bacteria 828
73 Ga0068853_100044951 3300005539 Bacteria 3782
74 Ga0068853_100082050 3300005539 Bacteria 2824
75 Ga0070672_100000015 3300005543 Bacteria 72591
76 Ga0070672_101251265 3300005543 Bacteria 662
77 Ga0070696_101037434 3300005546 Bacteria 687
78 Ga0070696_101221178 3300005546 Bacteria 636
79 Ga0070696_101693585 3300005546 Bacteria 545
80 Ga0070693_100898613 3300005547 Bacteria 663
81 Ga0070665_100000106 3300005548 Bacteria 157315
82 Ga0070665_100040036 3300005548 Bacteria 4711
83 Ga0070665_100047803 3300005548 Bacteria 4294
84 Ga0070665_100460600 3300005548 Bacteria 1282
85 Ga0070704_100094245 3300005549 Bacteria 2240
86 Ga0070704_100663332 3300005549 Bacteria 922
87 Ga0070704_100791172 3300005549 Bacteria 847
88 Ga0070704_101943735 3300005549 Bacteria 545
89 Ga0068855_100124857 3300005563 Bacteria 2944
90 Ga0068855_100656674 3300005563 Bacteria 1126
91 Ga0068855_101740796 3300005563 Bacteria 635
92 Ga0070664_100183538 3300005564 Bacteria 1861
93 Ga0070664_101095459 3300005564 Bacteria 750
94 Ga0068857_100156475 3300005577 Bacteria 2067
95 Ga0068854_100000183 3300005578 Bacteria 42525
96 Ga0068854_100042340 3300005578 Bacteria 3223
97 Ga0068854_101593829 3300005578 Bacteria 595
98 Ga0068856_100022587 3300005614 Bacteria 6116
99 Ga0068856_100030339 3300005614 Bacteria 5285
100 Ga0070702_100187618 3300005615 Bacteria 1358
101 Ga0070702_101671809 3300005615 Bacteria 528
102 Ga0068852_100000093 3300005616 Bacteria 60834
103 Ga0068852_100963039 3300005616 Bacteria 872
104 Ga0068852_102670860 3300005616 Bacteria 519
105 Ga0068866_10171194 3300005718 Bacteria 1275
106 Ga0068861_100032704 3300005719 Bacteria 3832
107 Ga0068851_10028087 3300005834 Bacteria 2777
108 Ga0068863_100006700 3300005841 Bacteria 11301
109 Ga0068863_100019353 3300005841 Bacteria 6512
110 Ga0068858_100000009 3300005842 Bacteria 237748
111 Ga0081455_10045239 3300005937 Bacteria 3831
112 Ga0081455_10121379 3300005937 Bacteria 2059
113 Ga0081455_10136300 3300005937 Bacteria 1912
114 Ga0081455_10215081 3300005937 Bacteria 1429
115 Ga0081538_10000097 3300005981 Bacteria 85125
116 Ga0081538_10246795 3300005981 Bacteria 684
117 Ga0081540_1014499 3300005983 Bacteria 5043
118 Ga0081540_1091337 3300005983 Bacteria 1339
119 Ga0081539_10143125 3300005985 Bacteria 1159
120 Ga0075365_10155050 3300006038 Bacteria 1594
121 Ga0075365_11043423 3300006038 Bacteria 576
122 Ga0075368_10140279 3300006042 Bacteria 1007
123 Ga0075368_10286339 3300006042 Bacteria 709
124 Ga0075364_10277745 3300006051 Bacteria 1140
125 Ga0075364_10559197 3300006051 Bacteria 782
126 Ga0070716_100624117 3300006173 Bacteria 814
127 Ga0070716_100676090 3300006173 Bacteria 786
128 Ga0070712_100230412 3300006175 Unclassified 1471
129 Ga0070712_100983131 3300006175 Bacteria 730
130 Ga0097621_100695002 3300006237 Unclassified 936
131 Ga0068871_100050353 3300006358 Bacteria 3369
132 Ga0068871_101323746 3300006358 Bacteria 678
133 Ga0068871_102383090 3300006358 Bacteria 505
134 Ga0075428_100089317 3300006844 Bacteria 3361
135 Ga0075428_100225192 3300006844 Bacteria 2024
136 Ga0075428_102585298 3300006844 Bacteria 519
137 Ga0075430_100025554 3300006846 Bacteria 5026
138 Ga0075431_100002597 3300006847 Bacteria 17458
139 Ga0075431_100011637 3300006847 Bacteria 8874
140 Ga0075431_100132397 3300006847 Bacteria 2571
141 Ga0075431_100463537 3300006847 Bacteria 1261
142 Ga0075433_11517781 3300006852 Bacteria 579
143 Ga0075434_100024708 3300006871 Bacteria 5876
144 Ga0075434_102007283 3300006871 Bacteria 584
145 Ga0075429_100233609 3300006880 Bacteria 1611
146 Ga0068865_100001085 3300006881 Bacteria 15698
147 Ga0068865_100634882 3300006881 Bacteria 906
148 Ga0068865_100756905 3300006881 Bacteria 835
149 Ga0075436_100999997 3300006914 Bacteria 628
150 Ga0075435_100241696 3300007076 Bacteria 1536
151 Ga0099794_10446346 3300007265 Bacteria 678
152 Ga0105240_10556503 3300009093 Bacteria 1268
153 Ga0105240_11899925 3300009093 Bacteria 619
154 Ga0111539_10255438 3300009094 Bacteria 2041
155 Ga0111539_10660301 3300009094 Bacteria 1217
156 Ga0111539_11996364 3300009094 Bacteria 673
157 Ga0111539_12210871 3300009094 Bacteria 638
158 Ga0105245_10001150 3300009098 Bacteria 23924
159 Ga0105245_10001895 3300009098 Bacteria 18997
160 Ga0105245_10006500 3300009098 Bacteria 10270
161 Ga0105245_10137771 3300009098 Bacteria 2295
162 Ga0105245_10141124 3300009098 Bacteria 2269
163 Ga0105245_12791580 3300009098 Bacteria 541
164 Ga0105247_10000628 3300009101 Bacteria 28197
165 Ga0105247_10209538 3300009101 Bacteria 1314
166 Ga0105247_10286177 3300009101 Unclassified 1138
167 Ga0105247_11619562 3300009101 Unclassified 532
168 Ga0105247_11738989 3300009101 Unclassified 517
169 Ga0114129_10082951 3300009147 Bacteria 4454
170 Ga0114129_10231345 3300009147 Bacteria 2489
171 Ga0114129_10743987 3300009147 Bacteria 1256
172 Ga0114129_11648002 3300009147 Bacteria 784
173 Ga0114129_12048868 3300009147 Bacteria 691
174 Ga0114129_12586336 3300009147 Bacteria 606
175 Ga0105243_10222191 3300009148 Bacteria 1670
176 Ga0105241_11890639 3300009174 Bacteria 585
177 Ga0105242_10002291 3300009176 Bacteria 15125
178 Ga0105242_10002368 3300009176 Bacteria 14878
179 Ga0105242_11327429 3300009176 Bacteria 744
180 Ga0105242_11532152 3300009176 Bacteria 698
181 Ga0105242_12419626 3300009176 Bacteria 573
182 Ga0105248_10000008 3300009177 Bacteria 403910
183 Ga0105248_12912780 3300009177 Unclassified 545
184 Ga0105237_12569542 3300009545 Unclassified 520
185 Ga0105238_10000011 3300009551 Bacteria 261080
186 Ga0105238_11002085 3300009551 Bacteria 856
187 Ga0105249_10000203 3300009553 Bacteria 67783
188 Ga0105249_10146424 3300009553 Bacteria 2270
189 Ga0105249_10429558 3300009553 Bacteria 1356
190 Ga0105249_10580978 3300009553 Bacteria 1174
191 Ga0105249_11780049 3300009553 Bacteria 689
192 Ga0105239_10082846 3300010375 Bacteria 3532
193 Ga0105239_10282146 3300010375 Bacteria 1870
194 Ga0105239_10948264 3300010375 Bacteria 988
195 Ga0105239_11079529 3300010375 Bacteria 924
196 Ga0105239_12490731 3300010375 Bacteria 603
197 Ga0105246_10424481 3300011119 Bacteria 1111
198 Ga0157373_10695412 3300013100 Bacteria 745
199 Ga0157371_10035878 3300013102 Bacteria 3552
200 Ga0157371_10753955 3300013102 Bacteria 731
201 Ga0157371_11336492 3300013102 Bacteria 555
202 Ga0157370_10042255 3300013104 Bacteria 4394
203 Ga0157370_10170974 3300013104 Bacteria 2020
204 Ga0157370_10734257 3300013104 Bacteria 900
205 Ga0157370_10756295 3300013104 Bacteria 885
206 Ga0157369_10780165 3300013105 Bacteria 982
207 Ga0157369_11451761 3300013105 Bacteria 698
208 Ga0157374_10022748 3300013296 Bacteria 5596
209 Ga0157374_10797340 3300013296 Bacteria 960
210 Ga0157374_12381030 3300013296 Bacteria 557
211 Ga0157378_10023161 3300013297 Bacteria 5466
212 Ga0157378_10024233 3300013297 Bacteria 5337
213 Ga0157378_10044147 3300013297 Bacteria 3957
214 Ga0157378_10124098 3300013297 Bacteria 2384
215 Ga0157378_11245106 3300013297 Bacteria 784
216 Ga0157372_10001384 3300013307 Bacteria 26176
217 Ga0157372_12502700 3300013307 Bacteria 593
218 Ga0157375_10416509 3300013308 Bacteria 1510
219 Ga0157375_11413114 3300013308 Bacteria 820
220 Ga0157375_11760536 3300013308 Bacteria 734
221 Ga0157375_11946718 3300013308 Bacteria 698
222 Ga0157375_12650677 3300013308 Unclassified 599
223 Ga0163163_10388792 3300014325 Bacteria 1453
224 Ga0163163_10513059 3300014325 Bacteria 1261
225 Ga0157380_10000253 3300014326 Bacteria 32008
226 Ga0157380_10012178 3300014326 Bacteria 6231
227 Ga0157380_12516360 3300014326 Bacteria 580
228 Ga0157377_10861657 3300014745 Bacteria 674
229 Ga0157379_10072565 3300014968 Bacteria 3080
230 Ga0157379_10660883 3300014968 Bacteria 979
231 Ga0157379_11168556 3300014968 Bacteria 739
232 Ga0157376_10015687 3300014969 Bacteria 5730
233 Ga0157376_10141147 3300014969 Bacteria 2161
234 Ga0157376_11987518 3300014969 Bacteria 619
235 Ga0163161_10000035 3300017792 Bacteria 155979
236 Ga0163161_10239993 3300017792 Bacteria 1409
237 Ga0154015_1268440 3300020610 Bacteria 693
238 Ga0213873_10095258 3300021358 Bacteria 850
239 Ga0213874_10021508 3300021377 Bacteria 1780
240 Ga0213874_10060808 3300021377 Bacteria 1183
241 Ga0213874_10097858 3300021377 Bacteria 972
242 Ga0213876_10028058 3300021384 Bacteria 2968
243 Ga0213876_10043186 3300021384 Bacteria 2383
244 Ga0213876_10127026 3300021384 Bacteria 1354
245 Ga0213875_10113524 3300021388 Bacteria 1266
246 Ga0213875_10448132 3300021388 Bacteria 618
247 Ga0207656_10014349 3300025321 Bacteria 3050
248 Ga0207653_10023647 3300025885 Bacteria 1958
249 Ga0207682_10001227 3300025893 Bacteria 11851
250 Ga0207692_10218943 3300025898 Bacteria 1127
251 Ga0207692_10231248 3300025898 Bacteria 1100
252 Ga0207642_10082984 3300025899 Bacteria 1561
253 Ga0207710_10000239 3300025900 Bacteria 46663
254 Ga0207710_10077022 3300025900 Bacteria 1540
255 Ga0207710_10201150 3300025900 Bacteria 984
256 Ga0207710_10599375 3300025900 Bacteria 575
257 Ga0207680_10015856 3300025903 Bacteria 3943
258 Ga0207680_10016106 3300025903 Bacteria 3917
259 Ga0207647_10320248 3300025904 Bacteria 881
260 Ga0207699_10806234 3300025906 Bacteria 690
261 Ga0207699_10816862 3300025906 Unclassified 686
262 Ga0207643_10099817 3300025908 Bacteria 1701
263 Ga0207705_10398904 3300025909 Bacteria 1064
264 Ga0207654_10137478 3300025911 Bacteria 1554
265 Ga0207707_10016440 3300025912 Bacteria 6453
266 Ga0207707_11361582 3300025912 Bacteria 568
267 Ga0207693_10038183 3300025915 Bacteria 3782
268 Ga0207693_10176374 3300025915 Bacteria 1682
269 Ga0207693_10740153 3300025915 Bacteria 760
270 Ga0207663_10001197 3300025916 Bacteria 11982
271 Ga0207663_10126645 3300025916 Bacteria 1758
272 Ga0207663_10414441 3300025916 Bacteria 1033
273 Ga0207663_10466144 3300025916 Unclassified 976
274 Ga0207660_10091942 3300025917 Bacteria 2251
275 Ga0207649_10000009 3300025920 Bacteria 295544
276 Ga0207652_10000044 3300025921 Bacteria 127779
277 Ga0207652_10000378 3300025921 Bacteria 46237
278 Ga0207694_10000004 3300025924 Bacteria 967075
279 Ga0207694_10740424 3300025924 Bacteria 830
280 Ga0207650_10085403 3300025925 Bacteria 2401
281 Ga0207659_10000010 3300025926 Bacteria 286639
282 Ga0207687_10000013 3300025927 Bacteria 299826
283 Ga0207687_10001023 3300025927 Bacteria 18981
284 Ga0207687_10010273 3300025927 Bacteria 6116
285 Ga0207687_10130977 3300025927 Bacteria 1890
286 Ga0207700_10000027 3300025928 Bacteria 137708
287 Ga0207700_10996931 3300025928 Bacteria 750
288 Ga0207664_10528248 3300025929 Bacteria 1058
289 Ga0207690_10046888 3300025932 Bacteria 2865
290 Ga0207690_10081792 3300025932 Bacteria 2258
291 Ga0207706_11663729 3300025933 Unclassified 515
292 Ga0207686_10000048 3300025934 Bacteria 115595
293 Ga0207686_10001182 3300025934 Bacteria 15101
294 Ga0207686_10833005 3300025934 Bacteria 741
295 Ga0207709_10007242 3300025935 Bacteria 6188
296 Ga0207670_10126582 3300025936 Bacteria 1865
297 Ga0207704_10000157 3300025938 Bacteria 36439
298 Ga0207704_10265530 3300025938 Bacteria 1296
299 Ga0207704_10463152 3300025938 Bacteria 1014
300 Ga0207704_11711323 3300025938 Bacteria 541
301 Ga0207665_10062535 3300025939 Bacteria 2526
302 Ga0207665_10095576 3300025939 Bacteria 2065
303 Ga0207665_10992819 3300025939 Bacteria 668
304 Ga0207691_10000044 3300025940 Bacteria 100027
305 Ga0207711_10000006 3300025941 Bacteria 792692
306 Ga0207711_10822340 3300025941 Bacteria 865
307 Ga0207711_11238715 3300025941 Bacteria 688
308 Ga0207661_10003433 3300025944 Bacteria 10996
309 Ga0207661_10065562 3300025944 Bacteria 2948
310 Ga0207661_10073128 3300025944 Bacteria 2806
311 Ga0207661_10113250 3300025944 Bacteria 2298
312 Ga0207661_10139465 3300025944 Bacteria 2085
313 Ga0207661_10911878 3300025944 Bacteria 809
314 Ga0207679_10100465 3300025945 Bacteria 2261
315 Ga0207679_10209709 3300025945 Bacteria 1633
316 Ga0207667_10233850 3300025949 Bacteria 1881
317 Ga0207667_10234816 3300025949 Bacteria 1877
318 Ga0207712_10000007 3300025961 Bacteria 539589
319 Ga0207712_10324630 3300025961 Bacteria 1271
320 Ga0207712_10774708 3300025961 Bacteria 842
321 Ga0207712_10956409 3300025961 Bacteria 759
322 Ga0207668_10139436 3300025972 Bacteria 1862
323 Ga0207668_10554347 3300025972 Bacteria 996
324 Ga0207668_11142055 3300025972 Bacteria 699
325 Ga0207640_10000200 3300025981 Bacteria 42738
326 Ga0207640_10029132 3300025981 Bacteria 3384
327 Ga0207658_10018315 3300025986 Bacteria 4835
328 Ga0207658_10334450 3300025986 Bacteria 1315
329 Ga0207658_10341840 3300025986 Bacteria 1301
330 Ga0207658_10739420 3300025986 Bacteria 890
331 Ga0207677_10157951 3300026023 Bacteria 1758
332 Ga0207703_10000023 3300026035 Bacteria 222018
333 Ga0207703_11813576 3300026035 Bacteria 586
334 Ga0207639_10023285 3300026041 Bacteria 4471
335 Ga0207639_10098967 3300026041 Bacteria 2352
336 Ga0207639_10242103 3300026041 Bacteria 1569
337 Ga0207639_10303282 3300026041 Bacteria 1413
338 Ga0207678_10017647 3300026067 Bacteria 6265
339 Ga0207678_10140820 3300026067 Bacteria 2058
340 Ga0207678_11983391 3300026067 Unclassified 507
341 Ga0207678_12032590 3300026067 Bacteria 500
342 Ga0207702_10000060 3300026078 Bacteria 125473
343 Ga0207702_10009975 3300026078 Bacteria 7963
344 Ga0207702_10156205 3300026078 Bacteria 2079
345 Ga0207702_11468283 3300026078 Bacteria 675
346 Ga0207702_12443152 3300026078 Bacteria 509
347 Ga0207641_10000405 3300026088 Bacteria 50517
348 Ga0207641_10013802 3300026088 Bacteria 6623
349 Ga0207641_11570488 3300026088 Bacteria 660
350 Ga0207674_10144261 3300026116 Bacteria 2340
351 Ga0207675_100036712 3300026118 Bacteria 4570
352 Ga0207675_100443897 3300026118 Bacteria 1285
353 Ga0207675_101238418 3300026118 Bacteria 767
354 Ga0207683_10010970 3300026121 Bacteria 7727
355 Ga0207683_10396512 3300026121 Bacteria 1269
356 Ga0207683_10467340 3300026121 Bacteria 1164
357 Ga0207698_10000440 3300026142 Bacteria 23916
358 Ga0207698_11523386 3300026142 Bacteria 684
359 Ga0209813_10452878 3300027866 Bacteria 525
360 Ga0207428_10368037 3300027907 Bacteria 1056
361 Ga0207428_10395457 3300027907 Bacteria 1012
362 Ga0207428_10871828 3300027907 Bacteria 637
363 Ga0268266_10000047 3300028379 Bacteria 310996
364 Ga0268266_10000527 3300028379 Bacteria 53367
365 Ga0268266_10039181 3300028379 Bacteria 4035
366 Ga0268266_10132888 3300028379 Bacteria 2227
367 Ga0268266_10322959 3300028379 Bacteria 1445
368 Ga0268266_11918541 3300028379 Bacteria 566
369 Ga0265337_1000584 3300028556 Bacteria 19168
370 Ga0265326_10000749 3300028558 Bacteria 12020
371 Ga0265319_1000122 3300028563 Bacteria 58869
372 Ga0265318_10100417 3300028577 Bacteria 1065
373 Ga0265323_10039981 3300028653 Bacteria 1708
374 Ga0265322_10000001 3300028654 Bacteria 543854
375 Ga0265322_10050574 3300028654 Bacteria 1180
376 Ga0265336_10011583 3300028666 Bacteria 2991
377 Ga0265338_10000706 3300028800 Bacteria 56988
378 Ga0265338_10449124 3300028800 Bacteria 913
379 Ga0265324_10000498 3300029957 Bacteria 27248
380 Ga0265332_10015191 3300031238 Bacteria 3401
381 Ga0265328_10000580 3300031239 Bacteria 16947
382 Ga0265320_10000002 3300031240 Bacteria 542875
383 Ga0265329_10004058 3300031242 Bacteria 6221
384 Ga0265331_10001492 3300031250 Bacteria 17280
385 Ga0265331_10067495 3300031250 Bacteria 1678
386 Ga0265327_10000011 3300031251 Bacteria 543807
387 Ga0265316_10005389 3300031344 Bacteria 12443
388 Ga0265314_10000062 3300031711 Bacteria 159496
389 Ga0265342_10148722 3300031712 Bacteria 1302
390 Ga0316576_10310576 3300031727 Bacteria 1177
391 Ga0307414_11727596 3300032004 Bacteria 584
392 Ga0373945_0197675 3300035116 Bacteria 834
393 Ga0373953_0216770 3300035117 Bacteria 829
394 Ga0373956_0605558 3300035119 Bacteria 523
395 Ga0373955_0336992 3300035172 Bacteria 912
396 Ga0316574_0119436 3300035398 Bacteria 1692
397 Ga0373933_0366099 3300035724 Bacteria 938
398 Ga0373937_0016501 3300036401 Bacteria 6561
399 Ga0373937_0020559 3300036401 Bacteria 5918
400 Ga0373937_0061433 3300036401 Bacteria 3454
401 Ga0373937_0393160 3300036401 Bacteria 1315
402 Ga0373937_0496949 3300036401 Bacteria 1159
403 Ga0373937_0579182 3300036401 Bacteria 1066
404 Ga0316584_0003480 3300036712 Bacteria 10244
405 Ga0395899_0031761 3300037312 Bacteria 3968
406 Ga0395899_0292053 3300037312 Bacteria 1106
407 Ga0395899_0608752 3300037312 Bacteria 695
408 Ga0395900_0121469 3300037418 Bacteria 2680
409 Ga0395900_0238247 3300037418 Bacteria 1826
410 Ga0395898_0022321 3300037466 Bacteria 6409
411 Ga0395898_0440057 3300037466 Bacteria 1242
412 Ga0395898_0629917 3300037466 Bacteria 1015
413 Ga0395898_1257819 3300037466 Bacteria 670
414 Ga0395905_0011529 3300037471 Bacteria 8541
415 Ga0395905_1215943 3300037471 Bacteria 657
416 Ga0395905_1609114 3300037471 Bacteria 554
417 Ga0436364_1456585 3300037853 Bacteria 2557
418 Ga0436364_1543506 3300037853 Bacteria 10359
419 Ga0395901_0042100 3300038443 Bacteria 4734
420 Ga0395901_0189842 3300038443 Unclassified 2155
421 Ga0395901_0607361 3300038443 Bacteria 1102
422 Ga0395901_0891884 3300038443 Bacteria 872
423 Ga0395901_1384925 3300038443 Unclassified 662
424 Ga0395901_1822611 3300038443 Bacteria 557
425 Ga0436365_0701598 3300039437 Bacteria 4776
426 Ga0436365_0851257 3300039437 Bacteria 18616
427 Ga0436365_0861691 3300039437 Bacteria 19086
428 Ga0436365_1024354 3300039437 Bacteria 7729
429 Ga0436360_0920718 3300039438 Bacteria 1201
430 Ga0436363_0385095 3300039450 Bacteria 3103
431 Ga0436363_0624775 3300039450 Bacteria 22345
432 Ga0436363_1444359 3300039450 Bacteria 4849
433 Ga0436363_1499909 3300039450 Bacteria 915
434 Ga0436363_1521243 3300039450 Bacteria 1545
435 Ga0436363_1525923 3300039450 Bacteria 1567
436 Ga0436362_0773470 3300039453 Bacteria 2827
437 Ga0451798_0005205 3300041458 Bacteria 589
438 Ga0451800_1222739 3300041459 Bacteria 729
439 Ga0451802_1560443 3300041460 Bacteria 582
440 Ga0451804_0693844 3300041463 Bacteria 783
441 Ga0451807_2044318 3300041486 Bacteria 678
442 Ga0451833_0427862 3300041491 Bacteria 894
443 Ga0451835_0618987 3300041492 Bacteria 620
444 Ga0451837_1034507 3300041494 Bacteria 734
445 Ga0451845_0953814 3300041501 Bacteria 572
446 Ga0451847_0350639 3300041503 Unclassified 603
447 Ga0451849_0155720 3300041505 Bacteria 836
448 Ga0451853_1624115 3300041512 Bacteria 1984
449 Ga0451853_2416189 3300041512 Bacteria 871
450 Ga0451853_2712544 3300041512 Bacteria 587
451 Ga0451853_3909198 3300041512 Unclassified 537
452 Ga0466969_0146416 3300044656 Bacteria 1090
453 Ga0466961_0314314 3300044693 Bacteria 956
454 Ga0466963_0000001 3300044694 Bacteria 110556
455 Ga0466963_0190332 3300044694 Bacteria 1433
456 Ga0466963_0253323 3300044694 Bacteria 1235
457 Ga0466964_0567514 3300044706 Bacteria 618
458 Ga0466964_0677211 3300044706 Bacteria 573
459 Ga0466964_0752571 3300044706 Bacteria 547
460 Ga0466957_0082258 3300044842 Unclassified 2007
461 Ga0466957_0167907 3300044842 Bacteria 1428
462 Ga0466957_0779349 3300044842 Unclassified 678
463 Ga0466959_0087897 3300045049 Bacteria 2235
464 Ga0466959_0716297 3300045049 Bacteria 670
465 Ga0466958_0016555 3300045836 Bacteria 4247
466 Ga0466958_0027332 3300045836 Bacteria 3378
467 Ga0466958_0894251 3300045836 Bacteria 579
468 Ga0466967_0000009 3300045976 Bacteria 122610
469 Ga0466967_0004934 3300045976 Bacteria 9123
470 Ga0466967_0111803 3300045976 Bacteria 2511
471 Ga0466967_0444218 3300045976 Bacteria 1267
472 Ga0466967_1452615 3300045976 Bacteria 683
473 Ga0466967_1660012 3300045976 Bacteria 636
474 Ga0466967_2314802 3300045976 Bacteria 533
475 Ga0495592_0000141 3300046454 Bacteria 63776
476 Ga0495592_0065649 3300046454 Bacteria 2656
477 Ga0495592_0094617 3300046454 Bacteria 2138
478 Ga0495592_0558042 3300046454 Bacteria 703
479 Ga0495603_0000016 3300046455 Bacteria 67399
480 Ga0495603_0002427 3300046455 Bacteria 10956
481 Ga0495629_0002683 3300046459 Bacteria 13624
482 Ga0495629_0005201 3300046459 Bacteria 9743
483 Ga0495629_0037535 3300046459 Bacteria 3415
484 Ga0495629_0050385 3300046459 Bacteria 2916
485 Ga0495629_0376733 3300046459 Bacteria 966
486 Ga0495638_0056479 3300046460 Bacteria 2436
487 Ga0495641_0000874 3300046461 Bacteria 25824
488 Ga0495641_0091358 3300046461 Bacteria 1360
489 Ga0495641_0229880 3300046461 Unclassified 832
490 Ga0495641_0274649 3300046461 Bacteria 758
491 Ga0495641_0415929 3300046461 Bacteria 610
492 Ga0495651_0080298 3300046462 Bacteria 2464
493 Ga0495651_0127135 3300046462 Bacteria 1865
494 Ga0495653_0029967 3300046463 Bacteria 4337
495 Ga0495653_0258187 3300046463 Bacteria 1153
496 Ga0495653_0386684 3300046463 Bacteria 892
497 Ga0495653_0678988 3300046463 Bacteria 627
498 Ga0495582_0011642 3300046473 Bacteria 4848
499 Ga0495605_0490074 3300046474 Unclassified 503
500 Ga0495639_0112717 3300046475 Bacteria 1292
501 Ga0495662_0002209 3300046476 Bacteria 9808
502 Ga0495662_0012662 3300046476 Bacteria 4113
503 Ga0495664_0111071 3300046477 Bacteria 1655
504 Ga0495664_0533901 3300046477 Bacteria 700
505 Ga0495594_0302721 3300046499 Bacteria 911
506 Ga0495606_0000565 3300046507 Bacteria 58752
507 Ga0495608_0008716 3300046511 Bacteria 7095
508 Ga0495608_0404885 3300046511 Bacteria 834
509 Ga0495610_0154651 3300046512 Bacteria 975
510 Ga0495618_0000129 3300046514 Bacteria 54912
511 Ga0495618_0159651 3300046514 Bacteria 1438
512 Ga0495620_0000436 3300046515 Bacteria 27894
513 Ga0495628_0000190 3300046516 Bacteria 53586
514 Ga0495628_0002436 3300046516 Bacteria 16776
515 Ga0495628_0036680 3300046516 Bacteria 3933
516 Ga0495628_0102784 3300046516 Bacteria 2204
517 Ga0495628_0156773 3300046516 Bacteria 1731
518 Ga0495628_0163316 3300046516 Bacteria 1692
519 Ga0495630_0000056 3300046517 Bacteria 91477
520 Ga0495630_0012401 3300046517 Bacteria 6189
521 Ga0495630_0101275 3300046517 Bacteria 2179
522 Ga0495630_0204112 3300046517 Bacteria 1508
523 Ga0495644_0009477 3300046523 Bacteria 3753
524 Ga0495652_0000546 3300046529 Bacteria 44003
525 Ga0495652_0004685 3300046529 Bacteria 13047
526 Ga0495652_0386447 3300046529 Bacteria 994
527 Ga0495652_0386738 3300046529 Bacteria 994
528 Ga0495640_0015403 3300046533 Bacteria 5755
529 Ga0495640_0195063 3300046533 Bacteria 1286
530 Ga0495640_0345321 3300046533 Unclassified 919
531 Ga0495640_0851158 3300046533 Bacteria 542
532 Ga0495586_0008925 3300046535 Bacteria 5337
533 Ga0495587_0003427 3300046536 Bacteria 10576
534 Ga0495587_0120489 3300046536 Bacteria 1503
535 Ga0495587_0444064 3300046536 Bacteria 719
536 Ga0495598_0004686 3300046537 Bacteria 2979
537 Ga0495609_0263778 3300046538 Bacteria 707
538 Ga0495621_0015075 3300046539 Bacteria 2459
539 Ga0495645_0019514 3300046543 Bacteria 4880
540 Ga0495645_0126912 3300046543 Bacteria 1792
541 Ga0495645_0228847 3300046543 Bacteria 1246
542 Ga0495645_0232945 3300046543 Bacteria 1233
543 Ga0495667_0000018 3300046559 Bacteria 188610
544 Ga0495667_0351376 3300046559 Bacteria 931
545 Ga0495634_0006771 3300046642 Bacteria 8681
546 Ga0495634_0007615 3300046642 Bacteria 8114
547 Ga0495634_0072099 3300046642 Bacteria 2272
548 Ga0495634_0143753 3300046642 Bacteria 1513
549 Ga0495634_0348299 3300046642 Bacteria 887
550 Ga0495625_0734157 3300046660 Bacteria 580
551 Ga0495635_0000044 3300046663 Bacteria 83945
552 Ga0495635_0069299 3300046663 Bacteria 2418
553 Ga0495588_0000165 3300046674 Bacteria 85841
554 Ga0495588_0354864 3300046674 Bacteria 770
555 Ga0495657_0000004 3300046675 Bacteria 266465
556 Ga0495657_0140482 3300046675 Bacteria 1505
557 Ga0495599_0113154 3300046678 Bacteria 1689
558 Ga0495623_0073854 3300046679 Bacteria 2120
559 Ga0495647_0000018 3300046681 Bacteria 81701
560 Ga0495647_0000904 3300046681 Bacteria 8893
561 Ga0495647_0015755 3300046681 Bacteria 2652
562 Ga0495647_0114642 3300046681 Bacteria 1128
563 Ga0495658_0001635 3300046683 Bacteria 11651
564 Ga0495669_0000033 3300046684 Bacteria 98629
565 Ga0495613_0000179 3300046689 Bacteria 62109
566 Ga0495613_0000200 3300046689 Bacteria 58821
567 Ga0495613_0432972 3300046689 Bacteria 893
568 Ga0495624_0000073 3300046690 Bacteria 65582
569 Ga0495624_0000097 3300046690 Bacteria 58715
570 Ga0495624_0004587 3300046690 Bacteria 10086
571 Ga0495624_0110992 3300046690 Bacteria 1686
572 Ga0495649_0000751 3300046694 Bacteria 26125
573 Ga0495649_0361792 3300046694 Unclassified 732
574 Ga0495589_0578970 3300046794 Bacteria 511
575 Ga0495600_0001315 3300046809 Bacteria 13711
576 Ga0495600_0026988 3300046809 Bacteria 3710
577 Ga0495600_0116660 3300046809 Bacteria 1738
578 Ga0495600_0515267 3300046809 Bacteria 734
579 Ga0495600_0900957 3300046809 Bacteria 522
580 Ga0495604_0000055 3300047317 Bacteria 100430
581 Ga0495604_0000357 3300047317 Bacteria 40931
582 Ga0495604_0030874 3300047317 Bacteria 4252
583 Ga0495674_0065539 3300047319 Bacteria 3155
584 Ga0495672_0480684 3300047320 Bacteria 555
585 Ga0495676_0025439 3300047321 Bacteria 5110
586 Ga0495676_0063988 3300047321 Bacteria 2864
587 Ga0495676_0097203 3300047321 Bacteria 2187
588 Ga0495676_0301607 3300047321 Bacteria 1080
589 Ga0495676_0438834 3300047321 Bacteria 862
590 Ga0495680_0000496 3300047322 Bacteria 44440
591 Ga0495680_0001969 3300047322 Bacteria 21587
592 Ga0495680_0015856 3300047322 Bacteria 6486
593 Ga0495680_0019801 3300047322 Bacteria 5673
594 Ga0495680_0020281 3300047322 Bacteria 5596
595 Ga0495675_0000175 3300047444 Bacteria 46609
596 Ga0495675_0223734 3300047444 Bacteria 1138
597 Ga0495685_135880 3300047447 Bacteria 802
598 Ga0495673_0169152 3300047469 Bacteria 834
599 Ga0495684_0584487 3300047471 Bacteria 756
600 Ga0495684_0758649 3300047471 Bacteria 638
601 Ga0495686_0331133 3300047472 Bacteria 832
602 Ga0495593_0150512 3300047673 Bacteria 1177
603 Ga0495593_0188696 3300047673 Bacteria 1037
604 Ga0495602_0000041 3300048088 Bacteria 126954
605 Ga0495602_0005883 3300048088 Bacteria 12880
606 Ga0495602_0208584 3300048088 Bacteria 1485
607 Ga0495602_0295952 3300048088 Bacteria 1186
608 Ga0495602_0953008 3300048088 Bacteria 568
609 Ga0495614_0200947 3300048089 Bacteria 902
610 Ga0496100_0000002 3300048903 Bacteria 489057
611 Ga0496100_0000018 3300048903 Bacteria 162451
612 Ga0496100_0030273 3300048903 Bacteria 3356
613 Ga0496101_0000001 3300048904 Bacteria 489057
614 Ga0496101_0000062 3300048904 Bacteria 126595
615 Ga0496101_0013193 3300048904 Bacteria 5532
616 Ga0496101_0037762 3300048904 Bacteria 3428
617 Ga0496102_0000039 3300048905 Bacteria 198306
618 Ga0496102_0210291 3300048905 Bacteria 1834
619 Ga0496102_0652607 3300048905 Bacteria 975
620 Ga0496103_0000008 3300048906 Bacteria 340474
621 Ga0496103_0008690 3300048906 Bacteria 6029
622 Ga0496103_0118686 3300048906 Bacteria 1684
623 Ga0496104_0000004 3300048907 Bacteria 641830
624 Ga0496104_0000009 3300048907 Bacteria 488055
625 Ga0496104_0000650 3300048907 Bacteria 29817
626 Ga0496104_0002254 3300048907 Bacteria 16633
627 Ga0496104_0143943 3300048907 Bacteria 2289
628 Ga0496105_0000001 3300048908 Bacteria 1328178
629 Ga0496105_0000007 3300048908 Bacteria 339658
630 Ga0496105_0000347 3300048908 Bacteria 30490
631 Ga0496105_0006887 3300048908 Bacteria 8749
632 Ga0496105_0377651 3300048908 Bacteria 1128
633 Ga0496105_0717106 3300048908 Bacteria 766
634 Ga0496106_0000061 3300048909 Bacteria 86524
635 Ga0496106_0000122 3300048909 Bacteria 59816
636 Ga0496106_0000312 3300048909 Bacteria 34208
637 Ga0496106_0003774 3300048909 Bacteria 11293
638 Ga0496106_0260212 3300048909 Unclassified 1388
639 Ga0496106_1127764 3300048909 Bacteria 614
640 Ga0496107_0000006 3300048910 Bacteria 258746
641 Ga0496107_0000013 3300048910 Bacteria 178284
642 Ga0496107_0015373 3300048910 Bacteria 5363
643 Ga0496107_0067988 3300048910 Bacteria 2585
644 Ga0496107_0884196 3300048910 Bacteria 652
645 Ga0496108_0000001 3300048911 Bacteria 919044
646 Ga0496108_0000062 3300048911 Bacteria 122391
647 Ga0496108_0033537 3300048911 Bacteria 4265
648 Ga0496109_0000003 3300048912 Bacteria 420862
649 Ga0496109_0000121 3300048912 Bacteria 81487
650 Ga0496109_0000129 3300048912 Bacteria 77469
651 Ga0496109_0235820 3300048912 Bacteria 1721
652 Ga0496109_0257313 3300048912 Bacteria 1644
653 Ga0496109_0717293 3300048912 Bacteria 938
654 Ga0496109_0931933 3300048912 Bacteria 806
655 Ga0496109_1010661 3300048912 Bacteria 769
656 Ga0496110_0000089 3300048913 Bacteria 48723
657 Ga0496110_0040973 3300048913 Bacteria 4038
658 Ga0496110_0138590 3300048913 Bacteria 2199
659 Ga0496110_0392136 3300048913 Bacteria 1266
660 Ga0496110_0623855 3300048913 Bacteria 977
661 Ga0496111_0003847 3300048914 Bacteria 9377
662 Ga0496111_0411166 3300048914 Bacteria 999
663 Ga0496112_0001770 3300048915 Bacteria 16950
664 Ga0496112_0012374 3300048915 Bacteria 7840
665 Ga0496113_0000628 3300048916 Bacteria 17756
666 Ga0496113_0158832 3300048916 Bacteria 1786
667 Ga0496113_0297946 3300048916 Bacteria 1291
668 Ga0496114_0000014 3300048917 Bacteria 297902
669 Ga0496114_0006959 3300048917 Bacteria 8910
670 Ga0496114_0011449 3300048917 Bacteria 7087
671 Ga0496114_0338929 3300048917 Bacteria 1329
672 Ga0496114_1632719 3300048917 Unclassified 533
673 Ga0496115_0000003 3300048918 Bacteria 354994
674 Ga0496115_0004217 3300048918 Bacteria 10391
675 Ga0496115_0021854 3300048918 Bacteria 4947
676 Ga0496116_0001565 3300048919 Bacteria 25265
677 Ga0496118_0000818 3300048921 Bacteria 49518
678 Ga0496118_0065926 3300048921 Bacteria 2646
679 Ga0496119_0005786 3300048922 Bacteria 11703
680 Ga0496119_0013028 3300048922 Bacteria 6674
681 Ga0496119_0023319 3300048922 Bacteria 4396
682 Ga0496120_0005134 3300048923 Bacteria 10578
683 Ga0496120_0163355 3300048923 Bacteria 1108
684 Ga0496121_0006714 3300048924 Bacteria 14134
685 Ga0496121_0064471 3300048924 Bacteria 2987
686 Ga0496121_0605527 3300048924 Bacteria 675
687 Ga0496124_0054064 3300048927 Bacteria 3400
688 Ga0496124_0121825 3300048927 Bacteria 2083
689 Ga0496124_0354749 3300048927 Bacteria 1036
690 Ga0496125_0082480 3300048928 Bacteria 2451
691 Ga0496125_0132735 3300048928 Bacteria 1749
692 Ga0496126_0125448 3300048929 Bacteria 2222
693 Ga0496126_0139139 3300048929 Bacteria 2091
694 Ga0496126_0249606 3300048929 Bacteria 1479
695 Ga0496126_0559172 3300048929 Bacteria 907
696 Ga0501031_0006434 3300049568 Bacteria 7657
697 Ga0501031_0032539 3300049568 Bacteria 3400
698 Ga0501031_0229071 3300049568 Bacteria 1209
699 Ga0501031_1025853 3300049568 Bacteria 527
700 Ga0501032_0001678 3300049569 Bacteria 17583
701 Ga0501032_0556594 3300049569 Bacteria 731
702 Ga0501033_0003865 3300049570 Bacteria 12176
703 Ga0501036_0003053 3300049572 Bacteria 13344
704 Ga0501036_0270235 3300049572 Bacteria 1423
705 Ga0501036_0450681 3300049572 Bacteria 1072
706 Ga0501037_0006405 3300049573 Bacteria 8616
707 Ga0501037_0162734 3300049573 Bacteria 1590
708 Ga0501037_0213765 3300049573 Bacteria 1359
709 Ga0501037_1068089 3300049573 Bacteria 524
710 Ga0501038_0006019 3300049574 Bacteria 11225
711 Ga0501039_0060637 3300049575 Bacteria 2930
712 Ga0501039_0853631 3300049575 Bacteria 709
713 Ga0501039_0968021 3300049575 Bacteria 662
714 Ga0501040_0136864 3300049576 Bacteria 1725
715 Ga0501040_0140045 3300049576 Bacteria 1704
716 Ga0501040_0181450 3300049576 Bacteria 1492
717 Ga0501041_0029844 3300049577 Bacteria 3291
718 Ga0501042_0020168 3300049578 Bacteria 4637
719 Ga0501042_0101007 3300049578 Bacteria 2074
720 Ga0501042_0233327 3300049578 Bacteria 1327
721 Ga0501042_0670526 3300049578 Bacteria 754
722 Ga0501043_0005761 3300049579 Bacteria 9981
723 Ga0501043_0324280 3300049579 Bacteria 1174
724 Ga0501046_0004837 3300049580 Bacteria 12135
725 Ga0501047_0003503 3300049581 Bacteria 14828
726 Ga0501047_0075325 3300049581 Bacteria 3247
727 Ga0501047_0190208 3300049581 Bacteria 1916
728 Ga0501047_0205408 3300049581 Bacteria 1829
729 Ga0501047_0308141 3300049581 Bacteria 1424
730 Ga0501047_0753796 3300049581 Bacteria 789
731 Ga0501048_0002374 3300049582 Bacteria 14372
732 Ga0501048_0189752 3300049582 Bacteria 1456
733 Ga0501048_0749800 3300049582 Bacteria 701
734 Ga0501048_0836383 3300049582 Bacteria 662
735 Ga0501068_0026058 3300049584 Bacteria 3442
736 Ga0501068_0095507 3300049584 Bacteria 1838
737 Ga0501068_0366614 3300049584 Bacteria 927
738 Ga0501069_0047323 3300049585 Unclassified 2387
739 Ga0501069_0055315 3300049585 Bacteria 2210
740 Ga0501070_0000494 3300049586 Bacteria 35842
741 Ga0501070_0026871 3300049586 Bacteria 4828
742 Ga0501070_0082400 3300049586 Bacteria 2662
743 Ga0501070_0370807 3300049586 Bacteria 1160
744 Ga0501070_1529547 3300049586 Unclassified 504
745 Ga0501071_0024056 3300049587 Bacteria 4258
746 Ga0501071_0039228 3300049587 Bacteria 3388
747 Ga0501071_0049503 3300049587 Bacteria 3025
748 Ga0501072_0067529 3300049588 Bacteria 2821
749 Ga0501072_0401493 3300049588 Bacteria 1087
750 Ga0501072_0419551 3300049588 Bacteria 1061
751 Ga0501072_1324803 3300049588 Bacteria 558
752 Ga0501072_1418510 3300049588 Bacteria 537
753 Ga0501073_0006754 3300049589 Bacteria 8541
754 Ga0501074_0015390 3300049590 Bacteria 5560
755 Ga0501074_0045664 3300049590 Bacteria 3168
756 Ga0501074_0165069 3300049590 Bacteria 1581
757 Ga0501074_0457771 3300049590 Bacteria 904
758 Ga0501075_0000990 3300049591 Bacteria 18117
759 Ga0501075_0054065 3300049591 Bacteria 3020
760 Ga0501075_0155053 3300049591 Bacteria 1746
761 Ga0501075_0435521 3300049591 Bacteria 1000
762 Ga0501075_1020268 3300049591 Bacteria 629
763 Ga0501075_1206083 3300049591 Bacteria 574
764 Ga0501077_0125313 3300049593 Bacteria 1628
765 Ga0501077_0527056 3300049593 Bacteria 758
766 Ga0501079_0016140 3300049741 Bacteria 5707
767 Ga0501079_0043241 3300049741 Bacteria 3477
768 Ga0501079_0059289 3300049741 Bacteria 2952
769 Ga0501079_0434555 3300049741 Bacteria 1031
770 Ga0501079_1287747 3300049741 Bacteria 576
771 Ga0501079_1652202 3300049741 Bacteria 504
772 Ga0501080_0101268 3300049742 Bacteria 2672
773 Ga0501080_0122471 3300049742 Bacteria 2409
774 Ga0501081_0120289 3300049743 Bacteria 1870
775 Ga0501081_0305789 3300049743 Bacteria 1167
776 Ga0501081_0627125 3300049743 Bacteria 805
777 Ga0501081_0969419 3300049743 Unclassified 642
778 Ga0501083_0025710 3300049744 Bacteria 4075
779 Ga0501083_0047096 3300049744 Bacteria 2914
780 Ga0501083_0146811 3300049744 Bacteria 1544
781 Ga0501083_0308285 3300049744 Bacteria 1030
782 Ga0501035_0000718 3300049822 Bacteria 35799
783 Ga0501035_0612319 3300049822 Unclassified 886
784 Ga0501035_0942078 3300049822 Bacteria 682
785 Ga0501044_0012374 3300049823 Bacteria 9236
786 Ga0501044_0082888 3300049823 Bacteria 3243
787 Ga0501044_0177281 3300049823 Bacteria 2100
788 Ga0501045_0080388 3300049824 Bacteria 2403
789 Ga0501045_0417652 3300049824 Bacteria 998
790 Ga0501045_0622456 3300049824 Bacteria 799
791 Ga0501045_0719910 3300049824 Bacteria 736
792 Ga0501045_1362587 3300049824 Bacteria 516
793 nmdc:mga03n38_210351_c1 3300050490 Bacteria 1011
794 nmdc:mga04h51_166687_c1 3300050495 Bacteria 850
795 nmdc:mga04h51_432516_c1 3300050495 Bacteria 555
796 nmdc:mga05p37_1135471_c1 3300050507 Bacteria 814
797 nmdc:mga05p37_303733_c1 3300050507 Bacteria 1895
798 nmdc:mga05p37_616143_c1 3300050507 Bacteria 1222
799 nmdc:mga09592_228396_c1 3300050508 Bacteria 1612
800 nmdc:mga0qj67_277829_c1 3300050509 Bacteria 1358
801 nmdc:mga06r32_1218100_c1 3300050510 Bacteria 699
802 nmdc:mga06r32_18690_c1 3300050510 Bacteria 6350
803 nmdc:mga06r32_522948_c1 3300050510 Bacteria 1162
804 nmdc:mga06r32_663143_c1 3300050510 Bacteria 1011
805 nmdc:mga08y16_120556_c1 3300050511 Bacteria 2729
806 nmdc:mga08y16_652238_c1 3300050511 Bacteria 1057
807 nmdc:mga0n895_15112_c1 3300050512 Bacteria 7034
808 nmdc:mga0n895_1625532_c1 3300050512 Bacteria 610
809 nmdc:mga0rr50_232321_c1 3300050513 Bacteria 1526
810 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
811 nmdc:mga0a205_923984_c1 3300050515 Bacteria 719
812 Ga0495601_0000013 3300053077 Bacteria 226476
813 Ga0495601_0000264 3300053077 Bacteria 28275
814 Ga0495601_0030912 3300053077 Bacteria 3327
815 Ga0495601_0055497 3300053077 Bacteria 2508
816 Ga0495601_0057341 3300053077 Bacteria 2468
817 Ga0495601_0632326 3300053077 Bacteria 685
818 Ga0495601_0791215 3300053077 Bacteria 602
819 Ga0495601_1016644 3300053077 Bacteria 521
820 Ga0495612_0000060 3300053078 Bacteria 49047
821 Ga0495612_0001051 3300053078 Bacteria 11297
822 Ga0495612_0027520 3300053078 Bacteria 2287
823 Ga0495612_0032800 3300053078 Bacteria 2099
824 Ga0500635_0153442 3300053080 Bacteria 880
825 Ga0495655_0003139 3300053083 Bacteria 2695
826 Ga0495655_0199928 3300053083 Bacteria 653
827 Ga0495595_0000003 3300053084 Bacteria 266465
828 Ga0495595_0000053 3300053084 Bacteria 59851
829 Ga0495595_0222926 3300053084 Bacteria 941
830 Ga0495595_0421500 3300053084 Bacteria 677
831 Ga0495619_0000031 3300053085 Bacteria 145508
832 Ga0495619_0000257 3300053085 Bacteria 38653
833 Ga0495619_0001230 3300053085 Bacteria 16755
834 Ga0495619_0003227 3300053085 Bacteria 10557
835 Ga0495619_0022451 3300053085 Bacteria 4039
836 Ga0500566_0194541 3300053094 Bacteria 1029
837 Ga0500554_191526 3300053102 Bacteria 686
838 Ga0500572_072649 3300053111 Bacteria 1066
839 Ga0500595_011934 3300053119 Bacteria 3379
840 Ga0500595_052522 3300053119 Unclassified 1258
841 Ga0500614_001576 3300053123 Bacteria 5389
842 Ga0500658_0191770 3300053134 Bacteria 933
843 Ga0501084_0036933 3300054114 Bacteria 4082
844 Ga0501084_0151099 3300054114 Bacteria 1957
845 Ga0501084_1020121 3300054114 Bacteria 695
846 Ga0501084_1196071 3300054114 Bacteria 638
847 Ga0501082_0020789 3300060353 Bacteria 5660
848 Ga0501082_0853851 3300060353 Bacteria 796
849 Ga0501082_0864393 3300060353 Bacteria 791
850 Ga0501082_1693646 3300060353 Bacteria 552
851 Ga0530510_0004432 3300061734 Bacteria 9722
852 Ga0530510_0024130 3300061734 Bacteria 4338
853 Ga0530510_0446045 3300061734 Bacteria 978
854 Ga0530510_1455564 3300061734 Unclassified 526

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10000253 Ga0157380_1000025312 66
2 3300005937 Ga0081455_10215081 Ga0081455_102150812 70
3 3300046674 Ga0495588_0354864 Ga0495588_0354864_313_549 70
4 3300049591 Ga0501075_0435521 Ga0501075_0435521_55_276 70
5 3300049743 Ga0501081_0627125 Ga0501081_0627125_325_546 70
6 3300049822 Ga0501035_0942078 Ga0501035_0942078_307_528 70
7 3300049824 Ga0501045_0417652 Ga0501045_0417652_578_799 70
8 3300061734 Ga0530510_0446045 Ga0530510_0446045_406_627 70
9 3300005439 Ga0070711_101991869 Ga0070711_1019918692 71
10 3300028556 Ga0265337_1000584 Ga0265337_100058414 71
11 3300028558 Ga0265326_10000749 Ga0265326_100007495 71
12 3300028577 Ga0265318_10100417 Ga0265318_101004172 71
13 3300028653 Ga0265323_10039981 Ga0265323_100399812 71
14 3300028654 Ga0265322_10000001 Ga0265322_10000001350 71
15 3300028666 Ga0265336_10011583 Ga0265336_100115833 71
16 3300029957 Ga0265324_10000498 Ga0265324_1000049824 71
17 3300031238 Ga0265332_10015191 Ga0265332_100151913 71
18 3300031239 Ga0265328_10000580 Ga0265328_100005808 71
19 3300031240 Ga0265320_10000002 Ga0265320_10000002349 71
20 3300031242 Ga0265329_10004058 Ga0265329_100040585 71
21 3300031250 Ga0265331_10001492 Ga0265331_1000149213 71
22 3300031251 Ga0265327_10000011 Ga0265327_10000011349 71
23 3300031344 Ga0265316_10005389 Ga0265316_1000538911 71
24 3300031711 Ga0265314_10000062 Ga0265314_1000006283 71
25 3300046455 Ga0495603_0000016 Ga0495603_0000016_30479_30700 71
26 3300046559 Ga0495667_0000018 Ga0495667_0000018_149895_150116 71
27 3300047322 Ga0495680_0001969 Ga0495680_0001969_11122_11343 71
28 3300048917 Ga0496114_0338929 Ga0496114_0338929_554_775 71
29 3300048918 Ga0496115_0021854 Ga0496115_0021854_3981_4202 71
30 3300049576 Ga0501040_0136864 Ga0501040_0136864_278_502 71
31 3300047471 Ga0495684_0758649 Ga0495684_0758649_48_272 72
32 3300006881 Ga0068865_100756905 Ga0068865_1007569052 73
33 3300009094 Ga0111539_11996364 Ga0111539_119963641 73
34 3300013104 Ga0157370_10734257 Ga0157370_107342572 73
35 3300025938 Ga0207704_11711323 Ga0207704_117113232 73
36 3300046462 Ga0495651_0080298 Ga0495651_0080298_2025_2255 73
37 3300046463 Ga0495653_0029967 Ga0495653_0029967_3865_4095 73
38 3300046515 Ga0495620_0000436 Ga0495620_0000436_24607_24837 73
39 3300048903 Ga0496100_0000002 Ga0496100_0000002_346201_346431 73
40 3300048904 Ga0496101_0000001 Ga0496101_0000001_346201_346431 73
41 3300048909 Ga0496106_0000061 Ga0496106_0000061_4811_5041 73
42 3300048910 Ga0496107_0000013 Ga0496107_0000013_173245_173475 73
43 3300005329 Ga0070683_101194638 Ga0070683_1011946382 74
44 3300005339 Ga0070660_100856029 Ga0070660_1008560292 74
45 3300005340 Ga0070689_100225577 Ga0070689_1002255772 74
46 3300005366 Ga0070659_100081482 Ga0070659_1000814823 74
47 3300005435 Ga0070714_101403465 Ga0070714_1014034652 74
48 3300005455 Ga0070663_100559632 Ga0070663_1005596322 74
49 3300005456 Ga0070678_100675274 Ga0070678_1006752742 74
50 3300005535 Ga0070684_100564524 Ga0070684_1005645242 74
51 3300005539 Ga0068853_100082050 Ga0068853_1000820502 74
52 3300005546 Ga0070696_101221178 Ga0070696_1012211782 74
53 3300005841 Ga0068863_100006700 Ga0068863_1000067002 74
54 3300006173 Ga0070716_100624117 Ga0070716_1006241172 74
55 3300006173 Ga0070716_100676090 Ga0070716_1006760902 74
56 3300006871 Ga0075434_102007283 Ga0075434_1020072832 74
57 3300009098 Ga0105245_10001895 Ga0105245_100018952 74
58 3300009176 Ga0105242_12419626 Ga0105242_124196262 74
59 3300009551 Ga0105238_10000011 Ga0105238_10000011170 74
60 3300010375 Ga0105239_12490731 Ga0105239_124907312 74
61 3300011119 Ga0105246_10424481 Ga0105246_104244812 74
62 3300013102 Ga0157371_11336492 Ga0157371_113364921 74
63 3300013105 Ga0157369_11451761 Ga0157369_114517612 74
64 3300013296 Ga0157374_10022748 Ga0157374_100227485 74
65 3300013308 Ga0157375_11413114 Ga0157375_114131142 74
66 3300013308 Ga0157375_11760536 Ga0157375_117605362 74
67 3300014969 Ga0157376_11987518 Ga0157376_119875182 74
68 3300017792 Ga0163161_10000035 Ga0163161_10000035141 74
69 3300025924 Ga0207694_10000004 Ga0207694_10000004452 74
70 3300025927 Ga0207687_10001023 Ga0207687_1000102315 74
71 3300025932 Ga0207690_10081792 Ga0207690_100817923 74
72 3300025936 Ga0207670_10126582 Ga0207670_101265822 74
73 3300025939 Ga0207665_10095576 Ga0207665_100955762 74
74 3300025939 Ga0207665_10992819 Ga0207665_109928192 74
75 3300026041 Ga0207639_10098967 Ga0207639_100989673 74
76 3300026067 Ga0207678_10140820 Ga0207678_101408203 74
77 3300026078 Ga0207702_11468283 Ga0207702_114682832 74
78 3300026088 Ga0207641_10000405 Ga0207641_1000040521 74
79 3300026118 Ga0207675_101238418 Ga0207675_1012384182 74
80 3300026121 Ga0207683_10467340 Ga0207683_104673403 74
81 3300031727 Ga0316576_10310576 Ga0316576_103105761 74
82 3300035117 Ga0373953_0216770 Ga0373953_0216770_159_392 74
83 3300035119 Ga0373956_0605558 Ga0373956_0605558_103_336 74
84 3300035172 Ga0373955_0336992 Ga0373955_0336992_38_271 74
85 3300035398 Ga0316574_0119436 Ga0316574_0119436_784_1023 74
86 3300035724 Ga0373933_0366099 Ga0373933_0366099_626_859 74
87 3300036401 Ga0373937_0016501 Ga0373937_0016501_6231_6464 74
88 3300036401 Ga0373937_0020559 Ga0373937_0020559_178_411 74
89 3300036401 Ga0373937_0496949 Ga0373937_0496949_764_997 74
90 3300036712 Ga0316584_0003480 Ga0316584_0003480_3323_3562 74
91 3300041512 Ga0451853_1624115 Ga0451853_1624115_1395_1628 74
92 3300046454 Ga0495592_0000141 Ga0495592_0000141_37386_37619 74
93 3300046454 Ga0495592_0558042 Ga0495592_0558042_338_571 74
94 3300046459 Ga0495629_0376733 Ga0495629_0376733_200_433 74
95 3300046461 Ga0495641_0000874 Ga0495641_0000874_23389_23622 74
96 3300046461 Ga0495641_0229880 Ga0495641_0229880_53_286 74
97 3300046462 Ga0495651_0127135 Ga0495651_0127135_694_927 74
98 3300046463 Ga0495653_0258187 Ga0495653_0258187_651_884 74
99 3300046463 Ga0495653_0386684 Ga0495653_0386684_279_512 74
100 3300046476 Ga0495662_0002209 Ga0495662_0002209_3282_3515 74
101 3300046511 Ga0495608_0008716 Ga0495608_0008716_4637_4870 74
102 3300046516 Ga0495628_0002436 Ga0495628_0002436_10114_10347 74
103 3300046516 Ga0495628_0102784 Ga0495628_0102784_283_516 74
104 3300046516 Ga0495628_0163316 Ga0495628_0163316_401_634 74
105 3300046517 Ga0495630_0012401 Ga0495630_0012401_3090_3323 74
106 3300046517 Ga0495630_0204112 Ga0495630_0204112_720_953 74
107 3300046523 Ga0495644_0009477 Ga0495644_0009477_2807_3040 74
108 3300046533 Ga0495640_0015403 Ga0495640_0015403_2599_2832 74
109 3300046533 Ga0495640_0851158 Ga0495640_0851158_18_251 74
110 3300046535 Ga0495586_0008925 Ga0495586_0008925_140_373 74
111 3300046536 Ga0495587_0444064 Ga0495587_0444064_360_593 74
112 3300046537 Ga0495598_0004686 Ga0495598_0004686_1645_1878 74
113 3300046538 Ga0495609_0263778 Ga0495609_0263778_367_600 74
114 3300046559 Ga0495667_0351376 Ga0495667_0351376_502_735 74
115 3300046642 Ga0495634_0143753 Ga0495634_0143753_129_362 74
116 3300046642 Ga0495634_0348299 Ga0495634_0348299_379_612 74
117 3300046663 Ga0495635_0000044 Ga0495635_0000044_22224_22457 74
118 3300046678 Ga0495599_0113154 Ga0495599_0113154_1365_1598 74
119 3300046679 Ga0495623_0073854 Ga0495623_0073854_171_404 74
120 3300046681 Ga0495647_0000018 Ga0495647_0000018_23054_23287 74
121 3300046681 Ga0495647_0015755 Ga0495647_0015755_266_499 74
122 3300046689 Ga0495613_0000200 Ga0495613_0000200_10864_11097 74
123 3300046689 Ga0495613_0432972 Ga0495613_0432972_11_235 74
124 3300046690 Ga0495624_0004587 Ga0495624_0004587_6084_6317 74
125 3300046694 Ga0495649_0000751 Ga0495649_0000751_9857_10090 74
126 3300046809 Ga0495600_0116660 Ga0495600_0116660_574_807 74
127 3300046809 Ga0495600_0515267 Ga0495600_0515267_247_480 74
128 3300047317 Ga0495604_0000055 Ga0495604_0000055_14703_14936 74
129 3300047317 Ga0495604_0030874 Ga0495604_0030874_3431_3664 74
130 3300047321 Ga0495676_0301607 Ga0495676_0301607_304_537 74
131 3300047322 Ga0495680_0000496 Ga0495680_0000496_15597_15830 74
132 3300047322 Ga0495680_0019801 Ga0495680_0019801_2467_2700 74
133 3300047322 Ga0495680_0020281 Ga0495680_0020281_3800_4033 74
134 3300047444 Ga0495675_0223734 Ga0495675_0223734_834_1067 74
135 3300047447 Ga0495685_135880 Ga0495685_135880_294_527 74
136 3300047469 Ga0495673_0169152 Ga0495673_0169152_245_478 74
137 3300048088 Ga0495602_0208584 Ga0495602_0208584_681_914 74
138 3300048909 Ga0496106_0000312 Ga0496106_0000312_10945_11178 74
139 3300048910 Ga0496107_0015373 Ga0496107_0015373_446_679 74
140 3300048912 Ga0496109_0717293 Ga0496109_0717293_306_539 74
141 3300048917 Ga0496114_0011449 Ga0496114_0011449_3835_4068 74
142 3300049568 Ga0501031_1025853 Ga0501031_1025853_261_494 74
143 3300049591 Ga0501075_0000990 Ga0501075_0000990_7058_7291 74
144 3300049743 Ga0501081_0969419 Ga0501081_0969419_255_488 74
145 3300050512 nmdc:mga0n895_1625532_c1 nmdc:mga0n895_1625532_c1_177_410 74
146 3300053077 Ga0495601_0000264 Ga0495601_0000264_2951_3184 74
147 3300053077 Ga0495601_1016644 Ga0495601_1016644_223_456 74
148 3300053084 Ga0495595_0000053 Ga0495595_0000053_50251_50484 74
149 3300053084 Ga0495595_0421500 Ga0495595_0421500_51_284 74
150 3300053085 Ga0495619_0022451 Ga0495619_0022451_3763_3996 74
151 3300053123 Ga0500614_001576 Ga0500614_001576_2101_2334 74
152 3300005563 Ga0068855_101740796 Ga0068855_1017407962 75
153 3300005615 Ga0070702_101671809 Ga0070702_1016718091 75
154 3300006844 Ga0075428_100225192 Ga0075428_1002251922 75
155 3300006846 Ga0075430_100025554 Ga0075430_1000255543 75
156 3300006847 Ga0075431_100011637 Ga0075431_1000116375 75
157 3300006880 Ga0075429_100233609 Ga0075429_1002336091 75
158 3300009147 Ga0114129_12586336 Ga0114129_125863362 75
159 3300013308 Ga0157375_11946718 Ga0157375_119467182 75
160 3300026118 Ga0207675_100443897 Ga0207675_1004438972 75
161 3300032004 Ga0307414_11727596 Ga0307414_117275962 75
162 3300041458 Ga0451798_0005205 Ga0451798_0005205_164_397 75
163 3300046463 Ga0495653_0678988 Ga0495653_0678988_316_552 75
164 3300046475 Ga0495639_0112717 Ga0495639_0112717_802_1038 75
165 3300046499 Ga0495594_0302721 Ga0495594_0302721_16_258 75
166 3300046514 Ga0495618_0000129 Ga0495618_0000129_36321_36557 75
167 3300046516 Ga0495628_0036680 Ga0495628_0036680_1997_2233 75
168 3300046529 Ga0495652_0000546 Ga0495652_0000546_24290_24523 75
169 3300046543 Ga0495645_0126912 Ga0495645_0126912_196_432 75
170 3300046543 Ga0495645_0232945 Ga0495645_0232945_466_702 75
171 3300046675 Ga0495657_0140482 Ga0495657_0140482_36_272 75
172 3300046690 Ga0495624_0000097 Ga0495624_0000097_3201_3437 75
173 3300046809 Ga0495600_0001315 Ga0495600_0001315_3392_3628 75
174 3300047319 Ga0495674_0065539 Ga0495674_0065539_619_855 75
175 3300048910 Ga0496107_0884196 Ga0496107_0884196_278_514 75
176 3300048913 Ga0496110_0138590 Ga0496110_0138590_1758_1994 75
177 3300049573 Ga0501037_1068089 Ga0501037_1068089_72_311 75
178 3300049575 Ga0501039_0968021 Ga0501039_0968021_133_372 75
179 3300049588 Ga0501072_1324803 Ga0501072_1324803_168_404 75
180 3300049824 Ga0501045_0622456 Ga0501045_0622456_491_730 75
181 3300050508 nmdc:mga09592_228396_c1 nmdc:mga09592_228396_c1_162_410 75
182 3300050509 nmdc:mga0qj67_277829_c1 nmdc:mga0qj67_277829_c1_1085_1333 75
183 3300050510 nmdc:mga06r32_18690_c1 nmdc:mga06r32_18690_c1_4754_5002 75
184 3300053077 Ga0495601_0057341 Ga0495601_0057341_973_1206 75
185 3300053078 Ga0495612_0000060 Ga0495612_0000060_2021_2257 75
186 3300053084 Ga0495595_0222926 Ga0495595_0222926_537_773 75
187 3300054114 Ga0501084_1020121 Ga0501084_1020121_389_634 75
188 3300005546 Ga0070696_101693585 Ga0070696_1016935851 76
189 3300045836 Ga0466958_0894251 Ga0466958_0894251_18_254 76
190 3300005563 Ga0068855_100656674 Ga0068855_1006566742 77
191 3300013105 Ga0157369_10780165 Ga0157369_107801651 77
192 3300025949 Ga0207667_10233850 Ga0207667_102338503 77
193 3300037471 Ga0395905_1609114 Ga0395905_1609114_282_533 77
194 3300038443 Ga0395901_0891884 Ga0395901_0891884_20_271 77
195 3300041492 Ga0451835_0618987 Ga0451835_0618987_270_521 77
196 3300041505 Ga0451849_0155720 Ga0451849_0155720_162_404 77
197 3300041512 Ga0451853_3909198 Ga0451853_3909198_163_417 77
198 3300001979 JGI24740J21852_10026088 JGI24740J21852_100260883 78
199 3300003373 JGI25407J50210_10026922 JGI25407J50210_100269221 78
200 3300004801 Ga0058860_11913064 Ga0058860_119130643 78
201 3300005329 Ga0070683_100013452 Ga0070683_1000134523 78
202 3300005329 Ga0070683_100018313 Ga0070683_1000183133 78
203 3300005329 Ga0070683_100097877 Ga0070683_1000978774 78
204 3300005329 Ga0070683_101290749 Ga0070683_1012907492 78
205 3300005331 Ga0070670_100071744 Ga0070670_1000717445 78
206 3300005333 Ga0070677_10000620 Ga0070677_100006205 78
207 3300005335 Ga0070666_10024284 Ga0070666_100242844 78
208 3300005337 Ga0070682_100000013 Ga0070682_10000001338 78
209 3300005337 Ga0070682_100230344 Ga0070682_1002303442 78
210 3300005341 Ga0070691_10000344 Ga0070691_100003448 78
211 3300005344 Ga0070661_100001375 Ga0070661_1000013753 78
212 3300005345 Ga0070692_10076888 Ga0070692_100768882 78
213 3300005347 Ga0070668_100046204 Ga0070668_1000462043 78
214 3300005347 Ga0070668_100384052 Ga0070668_1003840522 78
215 3300005353 Ga0070669_100847803 Ga0070669_1008478032 78
216 3300005354 Ga0070675_100000111 Ga0070675_1000001115 78
217 3300005356 Ga0070674_100436769 Ga0070674_1004367692 78
218 3300005365 Ga0070688_100003353 Ga0070688_1000033538 78
219 3300005365 Ga0070688_100031251 Ga0070688_1000312512 78
220 3300005367 Ga0070667_100420744 Ga0070667_1004207442 78
221 3300005367 Ga0070667_100717556 Ga0070667_1007175562 78
222 3300005435 Ga0070714_100369857 Ga0070714_1003698571 78
223 3300005436 Ga0070713_100000390 Ga0070713_1000003902 78
224 3300005436 Ga0070713_100076960 Ga0070713_1000769604 78
225 3300005438 Ga0070701_10798054 Ga0070701_107980542 78
226 3300005439 Ga0070711_100002341 Ga0070711_1000023419 78
227 3300005439 Ga0070711_100079580 Ga0070711_1000795803 78
228 3300005439 Ga0070711_100342071 Ga0070711_1003420713 78
229 3300005441 Ga0070700_101296323 Ga0070700_1012963232 78
230 3300005444 Ga0070694_101211204 Ga0070694_1012112042 78
231 3300005445 Ga0070708_101006087 Ga0070708_1010060872 78
232 3300005455 Ga0070663_101181470 Ga0070663_1011814702 78
233 3300005456 Ga0070678_100230631 Ga0070678_1002306313 78
234 3300005458 Ga0070681_10010667 Ga0070681_100106673 78
235 3300005466 Ga0070685_10004176 Ga0070685_100041768 78
236 3300005466 Ga0070685_10014878 Ga0070685_100148784 78
237 3300005467 Ga0070706_101024855 Ga0070706_1010248552 78
238 3300005468 Ga0070707_100721365 Ga0070707_1007213652 78
239 3300005530 Ga0070679_100000068 Ga0070679_10000006834 78
240 3300005535 Ga0070684_100003702 Ga0070684_10000370210 78
241 3300005535 Ga0070684_100053567 Ga0070684_1000535673 78
242 3300005535 Ga0070684_100082890 Ga0070684_1000828903 78
243 3300005535 Ga0070684_100862732 Ga0070684_1008627322 78
244 3300005535 Ga0070684_102205542 Ga0070684_1022055421 78
245 3300005536 Ga0070697_100811940 Ga0070697_1008119402 78
246 3300005539 Ga0068853_100044951 Ga0068853_1000449513 78
247 3300005543 Ga0070672_100000015 Ga0070672_10000001513 78
248 3300005543 Ga0070672_101251265 Ga0070672_1012512652 78
249 3300005546 Ga0070696_101037434 Ga0070696_1010374342 78
250 3300005547 Ga0070693_100898613 Ga0070693_1008986131 78
251 3300005548 Ga0070665_100000106 Ga0070665_10000010672 78
252 3300005548 Ga0070665_100040036 Ga0070665_1000400363 78
253 3300005548 Ga0070665_100460600 Ga0070665_1004606002 78
254 3300005549 Ga0070704_100094245 Ga0070704_1000942452 78
255 3300005549 Ga0070704_100663332 Ga0070704_1006633323 78
256 3300005549 Ga0070704_100791172 Ga0070704_1007911722 78
257 3300005549 Ga0070704_101943735 Ga0070704_1019437351 78
258 3300005563 Ga0068855_100124857 Ga0068855_1001248573 78
259 3300005564 Ga0070664_100183538 Ga0070664_1001835383 78
260 3300005564 Ga0070664_101095459 Ga0070664_1010954592 78
261 3300005577 Ga0068857_100156475 Ga0068857_1001564752 78
262 3300005578 Ga0068854_100000183 Ga0068854_10000018333 78
263 3300005578 Ga0068854_100042340 Ga0068854_1000423402 78
264 3300005578 Ga0068854_101593829 Ga0068854_1015938291 78
265 3300005614 Ga0068856_100030339 Ga0068856_1000303396 78
266 3300005616 Ga0068852_100000093 Ga0068852_10000009316 78
267 3300005616 Ga0068852_102670860 Ga0068852_1026708602 78
268 3300005718 Ga0068866_10171194 Ga0068866_101711943 78
269 3300005719 Ga0068861_100032704 Ga0068861_1000327043 78
270 3300005834 Ga0068851_10028087 Ga0068851_100280872 78
271 3300005841 Ga0068863_100019353 Ga0068863_1000193535 78
272 3300005842 Ga0068858_100000009 Ga0068858_100000009229 78
273 3300005937 Ga0081455_10045239 Ga0081455_100452394 78
274 3300005937 Ga0081455_10121379 Ga0081455_101213793 78
275 3300005981 Ga0081538_10000097 Ga0081538_1000009795 78
276 3300005981 Ga0081538_10246795 Ga0081538_102467951 78
277 3300005983 Ga0081540_1014499 Ga0081540_10144995 78
278 3300005983 Ga0081540_1091337 Ga0081540_10913372 78
279 3300005985 Ga0081539_10143125 Ga0081539_101431252 78
280 3300006038 Ga0075365_10155050 Ga0075365_101550502 78
281 3300006042 Ga0075368_10140279 Ga0075368_101402792 78
282 3300006042 Ga0075368_10286339 Ga0075368_102863392 78
283 3300006051 Ga0075364_10277745 Ga0075364_102777451 78
284 3300006051 Ga0075364_10559197 Ga0075364_105591971 78
285 3300006175 Ga0070712_100230412 Ga0070712_1002304122 78
286 3300006175 Ga0070712_100983131 Ga0070712_1009831312 78
287 3300006237 Ga0097621_100695002 Ga0097621_1006950022 78
288 3300006358 Ga0068871_100050353 Ga0068871_1000503533 78
289 3300006358 Ga0068871_101323746 Ga0068871_1013237462 78
290 3300006358 Ga0068871_102383090 Ga0068871_1023830902 78
291 3300006844 Ga0075428_100089317 Ga0075428_1000893174 78
292 3300006844 Ga0075428_102585298 Ga0075428_1025852982 78
293 3300006847 Ga0075431_100002597 Ga0075431_1000025973 78
294 3300006847 Ga0075431_100463537 Ga0075431_1004635374 78
295 3300006852 Ga0075433_11517781 Ga0075433_115177812 78
296 3300006871 Ga0075434_100024708 Ga0075434_1000247086 78
297 3300006881 Ga0068865_100634882 Ga0068865_1006348821 78
298 3300006914 Ga0075436_100999997 Ga0075436_1009999971 78
299 3300007076 Ga0075435_100241696 Ga0075435_1002416963 78
300 3300007265 Ga0099794_10446346 Ga0099794_104463462 78
301 3300009093 Ga0105240_10556503 Ga0105240_105565032 78
302 3300009094 Ga0111539_10255438 Ga0111539_102554382 78
303 3300009094 Ga0111539_10660301 Ga0111539_106603012 78
304 3300009094 Ga0111539_12210871 Ga0111539_122108712 78
305 3300009098 Ga0105245_10001150 Ga0105245_100011503 78
306 3300009098 Ga0105245_10006500 Ga0105245_100065004 78
307 3300009098 Ga0105245_10137771 Ga0105245_101377712 78
308 3300009098 Ga0105245_10141124 Ga0105245_101411243 78
309 3300009098 Ga0105245_12791580 Ga0105245_127915802 78
310 3300009101 Ga0105247_10000628 Ga0105247_1000062825 78
311 3300009101 Ga0105247_10286177 Ga0105247_102861772 78
312 3300009101 Ga0105247_11619562 Ga0105247_116195621 78
313 3300009147 Ga0114129_10082951 Ga0114129_100829513 78
314 3300009147 Ga0114129_10231345 Ga0114129_102313454 78
315 3300009147 Ga0114129_10743987 Ga0114129_107439872 78
316 3300009147 Ga0114129_11648002 Ga0114129_116480022 78
317 3300009147 Ga0114129_12048868 Ga0114129_120488682 78
318 3300009148 Ga0105243_10222191 Ga0105243_102221912 78
319 3300009174 Ga0105241_11890639 Ga0105241_118906392 78
320 3300009176 Ga0105242_10002291 Ga0105242_100022913 78
321 3300009176 Ga0105242_10002368 Ga0105242_100023682 78
322 3300009176 Ga0105242_11327429 Ga0105242_113274292 78
323 3300009176 Ga0105242_11532152 Ga0105242_115321522 78
324 3300009177 Ga0105248_10000008 Ga0105248_10000008354 78
325 3300009553 Ga0105249_10000203 Ga0105249_1000020318 78
326 3300009553 Ga0105249_10146424 Ga0105249_101464242 78
327 3300009553 Ga0105249_10429558 Ga0105249_104295581 78
328 3300009553 Ga0105249_11780049 Ga0105249_117800492 78
329 3300010375 Ga0105239_10082846 Ga0105239_100828464 78
330 3300010375 Ga0105239_10282146 Ga0105239_102821462 78
331 3300010375 Ga0105239_10948264 Ga0105239_109482642 78
332 3300013102 Ga0157371_10753955 Ga0157371_107539552 78
333 3300013104 Ga0157370_10042255 Ga0157370_100422556 78
334 3300013104 Ga0157370_10170974 Ga0157370_101709743 78
335 3300013296 Ga0157374_10797340 Ga0157374_107973402 78
336 3300013296 Ga0157374_12381030 Ga0157374_123810301 78
337 3300013297 Ga0157378_10023161 Ga0157378_100231612 78
338 3300013297 Ga0157378_10024233 Ga0157378_100242334 78
339 3300013297 Ga0157378_10044147 Ga0157378_100441472 78
340 3300013297 Ga0157378_10124098 Ga0157378_101240982 78
341 3300013297 Ga0157378_11245106 Ga0157378_112451062 78
342 3300013307 Ga0157372_10001384 Ga0157372_1000138412 78
343 3300013308 Ga0157375_12650677 Ga0157375_126506772 78
344 3300014325 Ga0163163_10388792 Ga0163163_103887922 78
345 3300014325 Ga0163163_10513059 Ga0163163_105130592 78
346 3300014326 Ga0157380_10012178 Ga0157380_100121786 78
347 3300014745 Ga0157377_10861657 Ga0157377_108616572 78
348 3300014968 Ga0157379_10072565 Ga0157379_100725653 78
349 3300014969 Ga0157376_10015687 Ga0157376_100156872 78
350 3300017792 Ga0163161_10239993 Ga0163161_102399933 78
351 3300020610 Ga0154015_1268440 Ga0154015_12684402 78
352 3300021358 Ga0213873_10095258 Ga0213873_100952582 78
353 3300021377 Ga0213874_10021508 Ga0213874_100215082 78
354 3300021377 Ga0213874_10060808 Ga0213874_100608082 78
355 3300021377 Ga0213874_10097858 Ga0213874_100978582 78
356 3300021384 Ga0213876_10028058 Ga0213876_100280582 78
357 3300021384 Ga0213876_10127026 Ga0213876_101270262 78
358 3300021388 Ga0213875_10113524 Ga0213875_101135242 78
359 3300021388 Ga0213875_10448132 Ga0213875_104481322 78
360 3300025321 Ga0207656_10014349 Ga0207656_100143492 78
361 3300025885 Ga0207653_10023647 Ga0207653_100236473 78
362 3300025893 Ga0207682_10001227 Ga0207682_100012277 78
363 3300025898 Ga0207692_10218943 Ga0207692_102189433 78
364 3300025898 Ga0207692_10231248 Ga0207692_102312482 78
365 3300025899 Ga0207642_10082984 Ga0207642_100829843 78
366 3300025900 Ga0207710_10000239 Ga0207710_1000023933 78
367 3300025900 Ga0207710_10201150 Ga0207710_102011502 78
368 3300025904 Ga0207647_10320248 Ga0207647_103202482 78
369 3300025906 Ga0207699_10816862 Ga0207699_108168622 78
370 3300025908 Ga0207643_10099817 Ga0207643_100998173 78
371 3300025911 Ga0207654_10137478 Ga0207654_101374783 78
372 3300025912 Ga0207707_10016440 Ga0207707_100164405 78
373 3300025915 Ga0207693_10038183 Ga0207693_100381834 78
374 3300025915 Ga0207693_10176374 Ga0207693_101763742 78
375 3300025915 Ga0207693_10740153 Ga0207693_107401532 78
376 3300025916 Ga0207663_10001197 Ga0207663_100011979 78
377 3300025916 Ga0207663_10126645 Ga0207663_101266453 78
378 3300025916 Ga0207663_10414441 Ga0207663_104144412 78
379 3300025916 Ga0207663_10466144 Ga0207663_104661442 78
380 3300025917 Ga0207660_10091942 Ga0207660_100919422 78
381 3300025920 Ga0207649_10000009 Ga0207649_10000009280 78
382 3300025921 Ga0207652_10000044 Ga0207652_1000004436 78
383 3300025925 Ga0207650_10085403 Ga0207650_100854035 78
384 3300025926 Ga0207659_10000010 Ga0207659_10000010102 78
385 3300025927 Ga0207687_10000013 Ga0207687_1000001321 78
386 3300025927 Ga0207687_10010273 Ga0207687_100102733 78
387 3300025927 Ga0207687_10130977 Ga0207687_101309772 78
388 3300025928 Ga0207700_10000027 Ga0207700_1000002797 78
389 3300025928 Ga0207700_10996931 Ga0207700_109969312 78
390 3300025933 Ga0207706_11663729 Ga0207706_116637292 78
391 3300025934 Ga0207686_10000048 Ga0207686_1000004892 78
392 3300025934 Ga0207686_10001182 Ga0207686_100011822 78
393 3300025934 Ga0207686_10833005 Ga0207686_108330052 78
394 3300025935 Ga0207709_10007242 Ga0207709_100072426 78
395 3300025938 Ga0207704_10265530 Ga0207704_102655302 78
396 3300025938 Ga0207704_10463152 Ga0207704_104631522 78
397 3300025939 Ga0207665_10062535 Ga0207665_100625354 78
398 3300025940 Ga0207691_10000044 Ga0207691_1000004438 78
399 3300025941 Ga0207711_10000006 Ga0207711_10000006748 78
400 3300025941 Ga0207711_10822340 Ga0207711_108223402 78
401 3300025944 Ga0207661_10003433 Ga0207661_100034333 78
402 3300025944 Ga0207661_10065562 Ga0207661_100655623 78
403 3300025944 Ga0207661_10073128 Ga0207661_100731283 78
404 3300025944 Ga0207661_10113250 Ga0207661_101132503 78
405 3300025944 Ga0207661_10139465 Ga0207661_101394652 78
406 3300025944 Ga0207661_10911878 Ga0207661_109118782 78
407 3300025945 Ga0207679_10100465 Ga0207679_101004653 78
408 3300025945 Ga0207679_10209709 Ga0207679_102097092 78
409 3300025949 Ga0207667_10234816 Ga0207667_102348162 78
410 3300025961 Ga0207712_10000007 Ga0207712_10000007357 78
411 3300025961 Ga0207712_10324630 Ga0207712_103246302 78
412 3300025961 Ga0207712_10956409 Ga0207712_109564092 78
413 3300025972 Ga0207668_10139436 Ga0207668_101394362 78
414 3300025972 Ga0207668_10554347 Ga0207668_105543472 78
415 3300025972 Ga0207668_11142055 Ga0207668_111420551 78
416 3300025981 Ga0207640_10000200 Ga0207640_100002005 78
417 3300025981 Ga0207640_10029132 Ga0207640_100291323 78
418 3300025986 Ga0207658_10334450 Ga0207658_103344503 78
419 3300025986 Ga0207658_10739420 Ga0207658_107394202 78
420 3300026023 Ga0207677_10157951 Ga0207677_101579513 78
421 3300026035 Ga0207703_10000023 Ga0207703_10000023134 78
422 3300026041 Ga0207639_10023285 Ga0207639_100232853 78
423 3300026041 Ga0207639_10242103 Ga0207639_102421032 78
424 3300026067 Ga0207678_11983391 Ga0207678_119833911 78
425 3300026067 Ga0207678_12032590 Ga0207678_120325902 78
426 3300026078 Ga0207702_10009975 Ga0207702_100099757 78
427 3300026078 Ga0207702_12443152 Ga0207702_124431522 78
428 3300026088 Ga0207641_10013802 Ga0207641_100138025 78
429 3300026088 Ga0207641_11570488 Ga0207641_115704882 78
430 3300026116 Ga0207674_10144261 Ga0207674_101442613 78
431 3300026118 Ga0207675_100036712 Ga0207675_1000367124 78
432 3300026121 Ga0207683_10010970 Ga0207683_100109702 78
433 3300026121 Ga0207683_10396512 Ga0207683_103965122 78
434 3300026142 Ga0207698_10000440 Ga0207698_100004408 78
435 3300026142 Ga0207698_11523386 Ga0207698_115233861 78
436 3300027866 Ga0209813_10452878 Ga0209813_104528781 78
437 3300027907 Ga0207428_10368037 Ga0207428_103680372 78
438 3300027907 Ga0207428_10395457 Ga0207428_103954572 78
439 3300027907 Ga0207428_10871828 Ga0207428_108718282 78
440 3300028379 Ga0268266_10000047 Ga0268266_10000047224 78
441 3300028379 Ga0268266_10039181 Ga0268266_100391813 78
442 3300028379 Ga0268266_10132888 Ga0268266_101328882 78
443 3300028379 Ga0268266_10322959 Ga0268266_103229592 78
444 3300028379 Ga0268266_11918541 Ga0268266_119185412 78
445 3300028563 Ga0265319_1000122 Ga0265319_100012235 78
446 3300028654 Ga0265322_10050574 Ga0265322_100505742 78
447 3300028800 Ga0265338_10000706 Ga0265338_1000070635 78
448 3300031250 Ga0265331_10067495 Ga0265331_100674953 78
449 3300031712 Ga0265342_10148722 Ga0265342_101487223 78
450 3300035116 Ga0373945_0197675 Ga0373945_0197675_355_612 78
451 3300036401 Ga0373937_0061433 Ga0373937_0061433_2061_2306 78
452 3300036401 Ga0373937_0393160 Ga0373937_0393160_705_950 78
453 3300036401 Ga0373937_0579182 Ga0373937_0579182_610_855 78
454 3300037312 Ga0395899_0031761 Ga0395899_0031761_1617_1874 78
455 3300037312 Ga0395899_0292053 Ga0395899_0292053_41_292 78
456 3300037312 Ga0395899_0608752 Ga0395899_0608752_59_316 78
457 3300037418 Ga0395900_0121469 Ga0395900_0121469_1140_1394 78
458 3300037418 Ga0395900_0238247 Ga0395900_0238247_757_1014 78
459 3300037466 Ga0395898_0022321 Ga0395898_0022321_5967_6224 78
460 3300037466 Ga0395898_0440057 Ga0395898_0440057_655_909 78
461 3300037466 Ga0395898_0629917 Ga0395898_0629917_83_337 78
462 3300037466 Ga0395898_1257819 Ga0395898_1257819_235_489 78
463 3300037471 Ga0395905_0011529 Ga0395905_0011529_4461_4718 78
464 3300037471 Ga0395905_1215943 Ga0395905_1215943_280_531 78
465 3300037853 Ga0436364_1456585 Ga0436364_1456585_2274_2525 78
466 3300037853 Ga0436364_1543506 Ga0436364_1543506_8583_8822 78
467 3300038443 Ga0395901_0042100 Ga0395901_0042100_3315_3572 78
468 3300038443 Ga0395901_0189842 Ga0395901_0189842_88_342 78
469 3300038443 Ga0395901_0607361 Ga0395901_0607361_263_517 78
470 3300038443 Ga0395901_1384925 Ga0395901_1384925_334_588 78
471 3300038443 Ga0395901_1822611 Ga0395901_1822611_188_442 78
472 3300039437 Ga0436365_0701598 Ga0436365_0701598_276_542 78
473 3300039437 Ga0436365_0851257 Ga0436365_0851257_6745_6993 78
474 3300039437 Ga0436365_0861691 Ga0436365_0861691_9256_9495 78
475 3300039438 Ga0436360_0920718 Ga0436360_0920718_616_861 78
476 3300039450 Ga0436363_0385095 Ga0436363_0385095_793_1041 78
477 3300039450 Ga0436363_0624775 Ga0436363_0624775_4703_4942 78
478 3300039450 Ga0436363_1444359 Ga0436363_1444359_3606_3854 78
479 3300039450 Ga0436363_1499909 Ga0436363_1499909_282_521 78
480 3300039450 Ga0436363_1521243 Ga0436363_1521243_1158_1397 78
481 3300039450 Ga0436363_1525923 Ga0436363_1525923_279_530 78
482 3300039453 Ga0436362_0773470 Ga0436362_0773470_1994_2233 78
483 3300041459 Ga0451800_1222739 Ga0451800_1222739_129_374 78
484 3300041460 Ga0451802_1560443 Ga0451802_1560443_244_489 78
485 3300041463 Ga0451804_0693844 Ga0451804_0693844_121_366 78
486 3300041486 Ga0451807_2044318 Ga0451807_2044318_41_286 78
487 3300041491 Ga0451833_0427862 Ga0451833_0427862_529_774 78
488 3300041494 Ga0451837_1034507 Ga0451837_1034507_431_676 78
489 3300041501 Ga0451845_0953814 Ga0451845_0953814_23_268 78
490 3300041503 Ga0451847_0350639 Ga0451847_0350639_335_580 78
491 3300041512 Ga0451853_2416189 Ga0451853_2416189_465_710 78
492 3300041512 Ga0451853_2712544 Ga0451853_2712544_218_463 78
493 3300044656 Ga0466969_0146416 Ga0466969_0146416_726_965 78
494 3300044693 Ga0466961_0314314 Ga0466961_0314314_204_443 78
495 3300044694 Ga0466963_0000001 Ga0466963_0000001_23808_24053 78
496 3300044694 Ga0466963_0190332 Ga0466963_0190332_530_775 78
497 3300044694 Ga0466963_0253323 Ga0466963_0253323_423_662 78
498 3300044706 Ga0466964_0567514 Ga0466964_0567514_227_466 78
499 3300044706 Ga0466964_0677211 Ga0466964_0677211_74_319 78
500 3300044706 Ga0466964_0752571 Ga0466964_0752571_170_427 78
501 3300044842 Ga0466957_0082258 Ga0466957_0082258_1737_1982 78
502 3300044842 Ga0466957_0167907 Ga0466957_0167907_687_926 78
503 3300044842 Ga0466957_0779349 Ga0466957_0779349_408_653 78
504 3300045049 Ga0466959_0087897 Ga0466959_0087897_834_1073 78
505 3300045049 Ga0466959_0716297 Ga0466959_0716297_365_607 78
506 3300045836 Ga0466958_0016555 Ga0466958_0016555_1654_1893 78
507 3300045836 Ga0466958_0027332 Ga0466958_0027332_3030_3290 78
508 3300045976 Ga0466967_0000009 Ga0466967_0000009_56724_56984 78
509 3300045976 Ga0466967_0004934 Ga0466967_0004934_2315_2554 78
510 3300045976 Ga0466967_0444218 Ga0466967_0444218_942_1190 78
511 3300045976 Ga0466967_1452615 Ga0466967_1452615_178_417 78
512 3300045976 Ga0466967_1660012 Ga0466967_1660012_129_371 78
513 3300045976 Ga0466967_2314802 Ga0466967_2314802_120_362 78
514 3300046454 Ga0495592_0065649 Ga0495592_0065649_305_550 78
515 3300046454 Ga0495592_0094617 Ga0495592_0094617_50_295 78
516 3300046455 Ga0495603_0002427 Ga0495603_0002427_10023_10268 78
517 3300046459 Ga0495629_0002683 Ga0495629_0002683_9982_10227 78
518 3300046459 Ga0495629_0005201 Ga0495629_0005201_7290_7535 78
519 3300046459 Ga0495629_0037535 Ga0495629_0037535_1231_1476 78
520 3300046459 Ga0495629_0050385 Ga0495629_0050385_2466_2711 78
521 3300046460 Ga0495638_0056479 Ga0495638_0056479_1535_1780 78
522 3300046461 Ga0495641_0091358 Ga0495641_0091358_717_962 78
523 3300046461 Ga0495641_0274649 Ga0495641_0274649_19_276 78
524 3300046461 Ga0495641_0415929 Ga0495641_0415929_229_474 78
525 3300046473 Ga0495582_0011642 Ga0495582_0011642_87_344 78
526 3300046474 Ga0495605_0490074 Ga0495605_0490074_97_357 78
527 3300046476 Ga0495662_0012662 Ga0495662_0012662_1564_1809 78
528 3300046477 Ga0495664_0111071 Ga0495664_0111071_981_1226 78
529 3300046477 Ga0495664_0533901 Ga0495664_0533901_145_390 78
530 3300046507 Ga0495606_0000565 Ga0495606_0000565_37287_37532 78
531 3300046512 Ga0495610_0154651 Ga0495610_0154651_671_916 78
532 3300046514 Ga0495618_0159651 Ga0495618_0159651_337_582 78
533 3300046516 Ga0495628_0156773 Ga0495628_0156773_671_916 78
534 3300046517 Ga0495630_0000056 Ga0495630_0000056_88717_88962 78
535 3300046517 Ga0495630_0101275 Ga0495630_0101275_1416_1661 78
536 3300046529 Ga0495652_0004685 Ga0495652_0004685_4245_4490 78
537 3300046529 Ga0495652_0386447 Ga0495652_0386447_471_716 78
538 3300046529 Ga0495652_0386738 Ga0495652_0386738_619_864 78
539 3300046533 Ga0495640_0195063 Ga0495640_0195063_739_984 78
540 3300046533 Ga0495640_0345321 Ga0495640_0345321_560_805 78
541 3300046536 Ga0495587_0003427 Ga0495587_0003427_2856_3101 78
542 3300046539 Ga0495621_0015075 Ga0495621_0015075_287_532 78
543 3300046543 Ga0495645_0019514 Ga0495645_0019514_3069_3314 78
544 3300046543 Ga0495645_0228847 Ga0495645_0228847_987_1232 78
545 3300046642 Ga0495634_0006771 Ga0495634_0006771_1144_1389 78
546 3300046642 Ga0495634_0007615 Ga0495634_0007615_7584_7829 78
547 3300046642 Ga0495634_0072099 Ga0495634_0072099_1532_1777 78
548 3300046663 Ga0495635_0069299 Ga0495635_0069299_728_973 78
549 3300046674 Ga0495588_0000165 Ga0495588_0000165_2446_2691 78
550 3300046681 Ga0495647_0000904 Ga0495647_0000904_1194_1439 78
551 3300046681 Ga0495647_0114642 Ga0495647_0114642_229_474 78
552 3300046684 Ga0495669_0000033 Ga0495669_0000033_9864_10109 78
553 3300046690 Ga0495624_0000073 Ga0495624_0000073_39898_40143 78
554 3300046690 Ga0495624_0110992 Ga0495624_0110992_704_949 78
555 3300046794 Ga0495589_0578970 Ga0495589_0578970_62_316 78
556 3300046809 Ga0495600_0900957 Ga0495600_0900957_241_489 78
557 3300047317 Ga0495604_0000357 Ga0495604_0000357_796_1041 78
558 3300047320 Ga0495672_0480684 Ga0495672_0480684_263_499 78
559 3300047321 Ga0495676_0025439 Ga0495676_0025439_768_1013 78
560 3300047321 Ga0495676_0063988 Ga0495676_0063988_2212_2457 78
561 3300047321 Ga0495676_0097203 Ga0495676_0097203_105_350 78
562 3300047321 Ga0495676_0438834 Ga0495676_0438834_55_300 78
563 3300047322 Ga0495680_0015856 Ga0495680_0015856_191_436 78
564 3300047471 Ga0495684_0584487 Ga0495684_0584487_179_424 78
565 3300047673 Ga0495593_0150512 Ga0495593_0150512_36_281 78
566 3300047673 Ga0495593_0188696 Ga0495593_0188696_622_867 78
567 3300048088 Ga0495602_0295952 Ga0495602_0295952_11_256 78
568 3300048088 Ga0495602_0953008 Ga0495602_0953008_41_286 78
569 3300048089 Ga0495614_0200947 Ga0495614_0200947_286_531 78
570 3300048903 Ga0496100_0000018 Ga0496100_0000018_151125_151370 78
571 3300048903 Ga0496100_0030273 Ga0496100_0030273_808_1065 78
572 3300048904 Ga0496101_0000062 Ga0496101_0000062_41857_42102 78
573 3300048904 Ga0496101_0013193 Ga0496101_0013193_4985_5242 78
574 3300048905 Ga0496102_0000039 Ga0496102_0000039_73281_73526 78
575 3300048905 Ga0496102_0210291 Ga0496102_0210291_145_381 78
576 3300048905 Ga0496102_0652607 Ga0496102_0652607_18_254 78
577 3300048906 Ga0496103_0000008 Ga0496103_0000008_194536_194781 78
578 3300048906 Ga0496103_0008690 Ga0496103_0008690_1133_1369 78
579 3300048906 Ga0496103_0118686 Ga0496103_0118686_877_1113 78
580 3300048907 Ga0496104_0000004 Ga0496104_0000004_301119_301364 78
581 3300048907 Ga0496104_0000009 Ga0496104_0000009_232730_232975 78
582 3300048907 Ga0496104_0000650 Ga0496104_0000650_27065_27310 78
583 3300048907 Ga0496104_0143943 Ga0496104_0143943_1760_2017 78
584 3300048908 Ga0496105_0000001 Ga0496105_0000001_340467_340712 78
585 3300048908 Ga0496105_0000007 Ga0496105_0000007_255081_255326 78
586 3300048908 Ga0496105_0000347 Ga0496105_0000347_4417_4662 78
587 3300048908 Ga0496105_0006887 Ga0496105_0006887_2897_3154 78
588 3300048908 Ga0496105_0377651 Ga0496105_0377651_781_1026 78
589 3300048909 Ga0496106_0000122 Ga0496106_0000122_47831_48076 78
590 3300048909 Ga0496106_0003774 Ga0496106_0003774_1159_1416 78
591 3300048910 Ga0496107_0000006 Ga0496107_0000006_220048_220293 78
592 3300048911 Ga0496108_0000001 Ga0496108_0000001_687088_687333 78
593 3300048911 Ga0496108_0000062 Ga0496108_0000062_121577_121822 78
594 3300048911 Ga0496108_0033537 Ga0496108_0033537_3508_3753 78
595 3300048912 Ga0496109_0000003 Ga0496109_0000003_361634_361879 78
596 3300048912 Ga0496109_0000121 Ga0496109_0000121_61623_61868 78
597 3300048912 Ga0496109_0000129 Ga0496109_0000129_74970_75215 78
598 3300048912 Ga0496109_0235820 Ga0496109_0235820_303_560 78
599 3300048912 Ga0496109_0257313 Ga0496109_0257313_1127_1372 78
600 3300048912 Ga0496109_0931933 Ga0496109_0931933_109_354 78
601 3300048912 Ga0496109_1010661 Ga0496109_1010661_44_292 78
602 3300048913 Ga0496110_0000089 Ga0496110_0000089_8603_8848 78
603 3300048913 Ga0496110_0040973 Ga0496110_0040973_1922_2179 78
604 3300048914 Ga0496111_0003847 Ga0496111_0003847_7504_7749 78
605 3300048915 Ga0496112_0001770 Ga0496112_0001770_3279_3524 78
606 3300048915 Ga0496112_0012374 Ga0496112_0012374_3949_4206 78
607 3300048916 Ga0496113_0000628 Ga0496113_0000628_14237_14482 78
608 3300048916 Ga0496113_0158832 Ga0496113_0158832_1439_1696 78
609 3300048916 Ga0496113_0297946 Ga0496113_0297946_727_972 78
610 3300048917 Ga0496114_0000014 Ga0496114_0000014_267416_267661 78
611 3300048917 Ga0496114_0006959 Ga0496114_0006959_4582_4839 78
612 3300048918 Ga0496115_0000003 Ga0496115_0000003_175793_176038 78
613 3300048918 Ga0496115_0004217 Ga0496115_0004217_5611_5856 78
614 3300048921 Ga0496118_0000818 Ga0496118_0000818_43863_44099 78
615 3300048922 Ga0496119_0023319 Ga0496119_0023319_1077_1322 78
616 3300048923 Ga0496120_0005134 Ga0496120_0005134_3608_3844 78
617 3300048923 Ga0496120_0163355 Ga0496120_0163355_43_279 78
618 3300048924 Ga0496121_0064471 Ga0496121_0064471_2637_2873 78
619 3300048928 Ga0496125_0082480 Ga0496125_0082480_2036_2281 78
620 3300048929 Ga0496126_0249606 Ga0496126_0249606_1029_1265 78
621 3300049568 Ga0501031_0032539 Ga0501031_0032539_243_494 78
622 3300049568 Ga0501031_0229071 Ga0501031_0229071_181_453 78
623 3300049569 Ga0501032_0556594 Ga0501032_0556594_146_382 78
624 3300049572 Ga0501036_0270235 Ga0501036_0270235_1055_1327 78
625 3300049572 Ga0501036_0450681 Ga0501036_0450681_278_535 78
626 3300049573 Ga0501037_0162734 Ga0501037_0162734_1292_1543 78
627 3300049573 Ga0501037_0213765 Ga0501037_0213765_16_285 78
628 3300049575 Ga0501039_0853631 Ga0501039_0853631_301_546 78
629 3300049576 Ga0501040_0140045 Ga0501040_0140045_787_1044 78
630 3300049577 Ga0501041_0029844 Ga0501041_0029844_538_810 78
631 3300049578 Ga0501042_0020168 Ga0501042_0020168_1485_1736 78
632 3300049578 Ga0501042_0233327 Ga0501042_0233327_725_970 78
633 3300049578 Ga0501042_0670526 Ga0501042_0670526_79_336 78
634 3300049579 Ga0501043_0324280 Ga0501043_0324280_582_854 78
635 3300049581 Ga0501047_0308141 Ga0501047_0308141_90_326 78
636 3300049581 Ga0501047_0753796 Ga0501047_0753796_279_530 78
637 3300049582 Ga0501048_0189752 Ga0501048_0189752_196_447 78
638 3300049582 Ga0501048_0749800 Ga0501048_0749800_155_427 78
639 3300049582 Ga0501048_0836383 Ga0501048_0836383_372_629 78
640 3300049584 Ga0501068_0366614 Ga0501068_0366614_289_546 78
641 3300049586 Ga0501070_0026871 Ga0501070_0026871_2840_3076 78
642 3300049586 Ga0501070_0370807 Ga0501070_0370807_784_1029 78
643 3300049587 Ga0501071_0024056 Ga0501071_0024056_2703_2975 78
644 3300049587 Ga0501071_0039228 Ga0501071_0039228_3029_3286 78
645 3300049588 Ga0501072_0401493 Ga0501072_0401493_130_381 78
646 3300049588 Ga0501072_0419551 Ga0501072_0419551_232_489 78
647 3300049588 Ga0501072_1418510 Ga0501072_1418510_191_436 78
648 3300049590 Ga0501074_0165069 Ga0501074_0165069_1171_1407 78
649 3300049590 Ga0501074_0457771 Ga0501074_0457771_584_856 78
650 3300049591 Ga0501075_0054065 Ga0501075_0054065_1621_1893 78
651 3300049591 Ga0501075_0155053 Ga0501075_0155053_904_1161 78
652 3300049591 Ga0501075_1020268 Ga0501075_1020268_227_481 78
653 3300049591 Ga0501075_1206083 Ga0501075_1206083_88_345 78
654 3300049593 Ga0501077_0125313 Ga0501077_0125313_179_436 78
655 3300049593 Ga0501077_0527056 Ga0501077_0527056_163_408 78
656 3300049741 Ga0501079_0043241 Ga0501079_0043241_426_683 78
657 3300049741 Ga0501079_0434555 Ga0501079_0434555_362_607 78
658 3300049741 Ga0501079_1287747 Ga0501079_1287747_313_561 78
659 3300049741 Ga0501079_1652202 Ga0501079_1652202_56_298 78
660 3300049743 Ga0501081_0120289 Ga0501081_0120289_807_1052 78
661 3300049743 Ga0501081_0305789 Ga0501081_0305789_163_420 78
662 3300049744 Ga0501083_0308285 Ga0501083_0308285_232_489 78
663 3300049824 Ga0501045_0080388 Ga0501045_0080388_1729_2001 78
664 3300049824 Ga0501045_0719910 Ga0501045_0719910_412_657 78
665 3300049824 Ga0501045_1362587 Ga0501045_1362587_153_398 78
666 3300050490 nmdc:mga03n38_210351_c1 nmdc:mga03n38_210351_c1_667_915 78
667 3300050495 nmdc:mga04h51_166687_c1 nmdc:mga04h51_166687_c1_422_676 78
668 3300050495 nmdc:mga04h51_432516_c1 nmdc:mga04h51_432516_c1_214_471 78
669 3300050507 nmdc:mga05p37_1135471_c1 nmdc:mga05p37_1135471_c1_391_648 78
670 3300050507 nmdc:mga05p37_303733_c1 nmdc:mga05p37_303733_c1_1057_1311 78
671 3300050507 nmdc:mga05p37_616143_c1 nmdc:mga05p37_616143_c1_34_279 78
672 3300050510 nmdc:mga06r32_1218100_c1 nmdc:mga06r32_1218100_c1_344_598 78
673 3300050510 nmdc:mga06r32_522948_c1 nmdc:mga06r32_522948_c1_65_337 78
674 3300050511 nmdc:mga08y16_120556_c1 nmdc:mga08y16_120556_c1_1205_1462 78
675 3300050511 nmdc:mga08y16_652238_c1 nmdc:mga08y16_652238_c1_578_832 78
676 3300050512 nmdc:mga0n895_15112_c1 nmdc:mga0n895_15112_c1_427_681 78
677 3300050513 nmdc:mga0rr50_232321_c1 nmdc:mga0rr50_232321_c1_1062_1307 78
678 3300050515 nmdc:mga0a205_24_c2 nmdc:mga0a205_24_c2_50295_50540 78
679 3300050515 nmdc:mga0a205_923984_c1 nmdc:mga0a205_923984_c1_381_638 78
680 3300053077 Ga0495601_0000013 Ga0495601_0000013_85627_85872 78
681 3300053077 Ga0495601_0030912 Ga0495601_0030912_796_1041 78
682 3300053077 Ga0495601_0055497 Ga0495601_0055497_1909_2154 78
683 3300053077 Ga0495601_0632326 Ga0495601_0632326_141_386 78
684 3300053077 Ga0495601_0791215 Ga0495601_0791215_131_376 78
685 3300053078 Ga0495612_0001051 Ga0495612_0001051_9859_10104 78
686 3300053078 Ga0495612_0027520 Ga0495612_0027520_1149_1394 78
687 3300053078 Ga0495612_0032800 Ga0495612_0032800_627_872 78
688 3300053083 Ga0495655_0003139 Ga0495655_0003139_29_274 78
689 3300053083 Ga0495655_0199928 Ga0495655_0199928_164_409 78
690 3300053085 Ga0495619_0000031 Ga0495619_0000031_95553_95798 78
691 3300053085 Ga0495619_0001230 Ga0495619_0001230_9458_9703 78
692 3300053085 Ga0495619_0003227 Ga0495619_0003227_8656_8901 78
693 3300053094 Ga0500566_0194541 Ga0500566_0194541_446_691 78
694 3300053111 Ga0500572_072649 Ga0500572_072649_417_653 78
695 3300054114 Ga0501084_0036933 Ga0501084_0036933_3382_3654 78
696 3300054114 Ga0501084_1196071 Ga0501084_1196071_383_628 78
697 3300060353 Ga0501082_0853851 Ga0501082_0853851_200_472 78
698 3300060353 Ga0501082_0864393 Ga0501082_0864393_178_435 78
699 3300060353 Ga0501082_1693646 Ga0501082_1693646_209_466 78
700 3300061734 Ga0530510_0004432 Ga0530510_0004432_8922_9179 78
701 3300061734 Ga0530510_0024130 Ga0530510_0024130_2523_2795 78
702 3300061734 Ga0530510_1455564 Ga0530510_1455564_205_450 78
703 3300005335 Ga0070666_10021476 Ga0070666_100214763 79
704 3300005335 Ga0070666_10182897 Ga0070666_101828973 79
705 3300005367 Ga0070667_100019394 Ga0070667_1000193943 79
706 3300005367 Ga0070667_100473010 Ga0070667_1004730103 79
707 3300005367 Ga0070667_101056363 Ga0070667_1010563632 79
708 3300005455 Ga0070663_100450556 Ga0070663_1004505561 79
709 3300005548 Ga0070665_100047803 Ga0070665_1000478034 79
710 3300005937 Ga0081455_10136300 Ga0081455_101363002 79
711 3300009093 Ga0105240_11899925 Ga0105240_118999252 79
712 3300009101 Ga0105247_11738989 Ga0105247_117389892 79
713 3300009177 Ga0105248_12912780 Ga0105248_129127801 79
714 3300009551 Ga0105238_11002085 Ga0105238_110020852 79
715 3300009553 Ga0105249_10580978 Ga0105249_105809782 79
716 3300010375 Ga0105239_11079529 Ga0105239_110795292 79
717 3300013104 Ga0157370_10756295 Ga0157370_107562951 79
718 3300013308 Ga0157375_10416509 Ga0157375_104165092 79
719 3300014968 Ga0157379_10660883 Ga0157379_106608832 79
720 3300014968 Ga0157379_11168556 Ga0157379_111685561 79
721 3300014969 Ga0157376_10141147 Ga0157376_101411472 79
722 3300021384 Ga0213876_10043186 Ga0213876_100431863 79
723 3300025900 Ga0207710_10599375 Ga0207710_105993752 79
724 3300025903 Ga0207680_10015856 Ga0207680_100158563 79
725 3300025903 Ga0207680_10016106 Ga0207680_100161062 79
726 3300025924 Ga0207694_10740424 Ga0207694_107404242 79
727 3300025929 Ga0207664_10528248 Ga0207664_105282481 79
728 3300025941 Ga0207711_11238715 Ga0207711_112387151 79
729 3300025961 Ga0207712_10774708 Ga0207712_107747082 79
730 3300025986 Ga0207658_10018315 Ga0207658_100183156 79
731 3300025986 Ga0207658_10341840 Ga0207658_103418402 79
732 3300026035 Ga0207703_11813576 Ga0207703_118135762 79
733 3300028379 Ga0268266_10000527 Ga0268266_100005277 79
734 3300028800 Ga0265338_10449124 Ga0265338_104491241 79
735 3300039437 Ga0436365_1024354 Ga0436365_1024354_1425_1691 79
736 3300046694 Ga0495649_0361792 Ga0495649_0361792_212_451 79
737 3300048904 Ga0496101_0037762 Ga0496101_0037762_414_653 79
738 3300048907 Ga0496104_0002254 Ga0496104_0002254_16263_16502 79
739 3300048908 Ga0496105_0717106 Ga0496105_0717106_201_440 79
740 3300048909 Ga0496106_0260212 Ga0496106_0260212_64_303 79
741 3300048910 Ga0496107_0067988 Ga0496107_0067988_1465_1704 79
742 3300048913 Ga0496110_0623855 Ga0496110_0623855_421_660 79
743 3300048917 Ga0496114_1632719 Ga0496114_1632719_162_401 79
744 3300048919 Ga0496116_0001565 Ga0496116_0001565_20167_20406 79
745 3300048921 Ga0496118_0065926 Ga0496118_0065926_586_825 79
746 3300048922 Ga0496119_0005786 Ga0496119_0005786_4889_5128 79
747 3300048922 Ga0496119_0013028 Ga0496119_0013028_3538_3777 79
748 3300048924 Ga0496121_0006714 Ga0496121_0006714_1192_1431 79
749 3300048924 Ga0496121_0605527 Ga0496121_0605527_221_460 79
750 3300048927 Ga0496124_0054064 Ga0496124_0054064_1606_1845 79
751 3300048928 Ga0496125_0132735 Ga0496125_0132735_1125_1364 79
752 3300048929 Ga0496126_0125448 Ga0496126_0125448_613_852 79
753 3300048929 Ga0496126_0139139 Ga0496126_0139139_729_968 79
754 3300048929 Ga0496126_0559172 Ga0496126_0559172_425_664 79
755 3300049581 Ga0501047_0190208 Ga0501047_0190208_30_269 79
756 3300049581 Ga0501047_0205408 Ga0501047_0205408_236_475 79
757 3300049586 Ga0501070_1529547 Ga0501070_1529547_26_265 79
758 3300049744 Ga0501083_0025710 Ga0501083_0025710_1270_1509 79
759 3300049822 Ga0501035_0612319 Ga0501035_0612319_48_287 79
760 3300049823 Ga0501044_0177281 Ga0501044_0177281_1281_1520 79
761 3300053080 Ga0500635_0153442 Ga0500635_0153442_105_344 79
762 3300053119 Ga0500595_011934 Ga0500595_011934_827_1066 79
763 3300053119 Ga0500595_052522 Ga0500595_052522_935_1174 79
764 3300053134 Ga0500658_0191770 Ga0500658_0191770_533_772 79
765 3300001977 JGI24746J21847_1000100 JGI24746J21847_10001007 80
766 3300005327 Ga0070658_10096516 Ga0070658_100965163 80
767 3300005329 Ga0070683_100529723 Ga0070683_1005297232 80
768 3300005337 Ga0070682_100000117 Ga0070682_10000011747 80
769 3300005366 Ga0070659_100064556 Ga0070659_1000645565 80
770 3300005441 Ga0070700_101004836 Ga0070700_1010048361 80
771 3300005455 Ga0070663_100000728 Ga0070663_10000072810 80
772 3300005458 Ga0070681_10195528 Ga0070681_101955283 80
773 3300005530 Ga0070679_100007698 Ga0070679_1000076986 80
774 3300005614 Ga0068856_100022587 Ga0068856_1000225873 80
775 3300005615 Ga0070702_100187618 Ga0070702_1001876182 80
776 3300005616 Ga0068852_100963039 Ga0068852_1009630392 80
777 3300006038 Ga0075365_11043423 Ga0075365_110434232 80
778 3300006847 Ga0075431_100132397 Ga0075431_1001323973 80
779 3300006881 Ga0068865_100001085 Ga0068865_1000010854 80
780 3300009101 Ga0105247_10209538 Ga0105247_102095382 80
781 3300009545 Ga0105237_12569542 Ga0105237_125695422 80
782 3300013100 Ga0157373_10695412 Ga0157373_106954121 80
783 3300013102 Ga0157371_10035878 Ga0157371_100358783 80
784 3300013307 Ga0157372_12502700 Ga0157372_125027002 80
785 3300014326 Ga0157380_12516360 Ga0157380_125163602 80
786 3300025900 Ga0207710_10077022 Ga0207710_100770223 80
787 3300025906 Ga0207699_10806234 Ga0207699_108062342 80
788 3300025909 Ga0207705_10398904 Ga0207705_103989041 80
789 3300025912 Ga0207707_11361582 Ga0207707_113615821 80
790 3300025921 Ga0207652_10000378 Ga0207652_1000037833 80
791 3300025932 Ga0207690_10046888 Ga0207690_100468882 80
792 3300025938 Ga0207704_10000157 Ga0207704_100001573 80
793 3300026041 Ga0207639_10303282 Ga0207639_103032821 80
794 3300026067 Ga0207678_10017647 Ga0207678_100176475 80
795 3300026078 Ga0207702_10000060 Ga0207702_1000006021 80
796 3300026078 Ga0207702_10156205 Ga0207702_101562053 80
797 3300045976 Ga0466967_0111803 Ga0466967_0111803_1963_2229 80
798 3300046511 Ga0495608_0404885 Ga0495608_0404885_369_614 80
799 3300046516 Ga0495628_0000190 Ga0495628_0000190_44913_45158 80
800 3300046536 Ga0495587_0120489 Ga0495587_0120489_72_317 80
801 3300046660 Ga0495625_0734157 Ga0495625_0734157_274_534 80
802 3300046675 Ga0495657_0000004 Ga0495657_0000004_120978_121238 80
803 3300046683 Ga0495658_0001635 Ga0495658_0001635_1217_1477 80
804 3300046689 Ga0495613_0000179 Ga0495613_0000179_21968_22210 80
805 3300046809 Ga0495600_0026988 Ga0495600_0026988_948_1190 80
806 3300047444 Ga0495675_0000175 Ga0495675_0000175_38928_39188 80
807 3300047472 Ga0495686_0331133 Ga0495686_0331133_349_594 80
808 3300048088 Ga0495602_0000041 Ga0495602_0000041_123677_123919 80
809 3300048088 Ga0495602_0005883 Ga0495602_0005883_10939_11184 80
810 3300048909 Ga0496106_1127764 Ga0496106_1127764_154_396 80
811 3300048913 Ga0496110_0392136 Ga0496110_0392136_471_719 80
812 3300048914 Ga0496111_0411166 Ga0496111_0411166_619_879 80
813 3300048927 Ga0496124_0121825 Ga0496124_0121825_296_541 80
814 3300048927 Ga0496124_0354749 Ga0496124_0354749_667_927 80
815 3300049568 Ga0501031_0006434 Ga0501031_0006434_1226_1468 80
816 3300049569 Ga0501032_0001678 Ga0501032_0001678_2094_2336 80
817 3300049570 Ga0501033_0003865 Ga0501033_0003865_6594_6836 80
818 3300049572 Ga0501036_0003053 Ga0501036_0003053_6187_6429 80
819 3300049573 Ga0501037_0006405 Ga0501037_0006405_6607_6849 80
820 3300049574 Ga0501038_0006019 Ga0501038_0006019_4618_4860 80
821 3300049575 Ga0501039_0060637 Ga0501039_0060637_800_1042 80
822 3300049576 Ga0501040_0181450 Ga0501040_0181450_1021_1263 80
823 3300049578 Ga0501042_0101007 Ga0501042_0101007_1448_1690 80
824 3300049579 Ga0501043_0005761 Ga0501043_0005761_3129_3371 80
825 3300049580 Ga0501046_0004837 Ga0501046_0004837_6300_6542 80
826 3300049581 Ga0501047_0003503 Ga0501047_0003503_3135_3377 80
827 3300049581 Ga0501047_0075325 Ga0501047_0075325_1471_1713 80
828 3300049582 Ga0501048_0002374 Ga0501048_0002374_7649_7891 80
829 3300049584 Ga0501068_0026058 Ga0501068_0026058_1235_1477 80
830 3300049584 Ga0501068_0095507 Ga0501068_0095507_187_429 80
831 3300049585 Ga0501069_0047323 Ga0501069_0047323_2014_2256 80
832 3300049585 Ga0501069_0055315 Ga0501069_0055315_1488_1730 80
833 3300049586 Ga0501070_0000494 Ga0501070_0000494_29985_30227 80
834 3300049586 Ga0501070_0082400 Ga0501070_0082400_950_1192 80
835 3300049587 Ga0501071_0049503 Ga0501071_0049503_2377_2619 80
836 3300049588 Ga0501072_0067529 Ga0501072_0067529_2526_2768 80
837 3300049589 Ga0501073_0006754 Ga0501073_0006754_6331_6573 80
838 3300049590 Ga0501074_0015390 Ga0501074_0015390_3359_3601 80
839 3300049590 Ga0501074_0045664 Ga0501074_0045664_1629_1871 80
840 3300049741 Ga0501079_0016140 Ga0501079_0016140_1959_2201 80
841 3300049741 Ga0501079_0059289 Ga0501079_0059289_1464_1706 80
842 3300049742 Ga0501080_0101268 Ga0501080_0101268_1526_1768 80
843 3300049742 Ga0501080_0122471 Ga0501080_0122471_1751_1993 80
844 3300049744 Ga0501083_0047096 Ga0501083_0047096_1763_2005 80
845 3300049744 Ga0501083_0146811 Ga0501083_0146811_508_750 80
846 3300049822 Ga0501035_0000718 Ga0501035_0000718_29942_30184 80
847 3300049823 Ga0501044_0012374 Ga0501044_0012374_5341_5583 80
848 3300049823 Ga0501044_0082888 Ga0501044_0082888_1042_1284 80
849 3300050510 nmdc:mga06r32_663143_c1 nmdc:mga06r32_663143_c1_199_447 80
850 3300053084 Ga0495595_0000003 Ga0495595_0000003_120978_121238 80
851 3300053085 Ga0495619_0000257 Ga0495619_0000257_7393_7653 80
852 3300053102 Ga0500554_191526 Ga0500554_191526_180_425 80
853 3300054114 Ga0501084_0151099 Ga0501084_0151099_732_974 80
854 3300060353 Ga0501082_0020789 Ga0501082_0020789_1970_2212 80

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oq4-assembly1.cif.gz_D cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase 0.828 8 73
2y0s-assembly2.cif.gz_D crystal structure of sulfolobus shibatae rna polymerase in p21 space group 0.8247 8 73
8him-assembly1.cif.gz_C a cryo-em structure of b. oleracea rna polymerase v elongation complex at 2.73 angstrom 0.8188 9 72
7ok0-assembly1.cif.gz_D cryo-em structure of the sulfolobus acidocaldarius rna polymerase at 2.88 a 0.8105 8 73
8hil-assembly1.cif.gz_C a cryo-em structure of b. oleracea rna polymerase v at 3.57 angstrom 0.8089 8 72
ID Description Score Start End Superfamily
af_F1M1X0_1554_1671_2.60.60.20 Mainly Beta;Sandwich;Lipoxygenase-1;PLAT/LH2 domain 0.8857 68 79 2.60.60.20
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8397 8 71 3.30.70.20
af_F1QC84_516_627_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8145 68 79 2.60.40.10
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7889 8 71 3.30.70.20
af_Q8IHT3_226_284_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7803 24 64 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A6J4S654-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 1.006 7 79
AF-A0A6J4SB94-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 1.002 7 80
AF-A0A7V8WAV0-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9971 7 79
AF-A0A7V9EBU3-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9963 7 79
AF-A0A537Z830-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9938 7 79

Feature Viewer

pLDDT pTM Quality
93.89 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map