F483552

General Info

Members Datasets Scaffolds Average Seq Length
853 500 643 644

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_001497|Ga0439438_001497_2320_4431
Length 703
Sequence MHRVWSGQVTVYWKKYSTIKIYGKNIDYCRSLVLVCIHQSVGVGSGVKRRLIKITGASMGQTRFASGRQLDVICLGRLGVDLYAQQVGARLEDVSSFAKYLGGSSANIAFGTARLGLRSAMLSRVGDDHMGRFLVESLMREGCDVSGIKVDPERLTAMVLLGIKDRETFPLVFYRENCADMALRAEDIDEAFIASSKALLITGTHFSTDSVYQASIQALDYAQTHQVKRILDIDYRPVLWGLAPKADGETRFVADRKVSQHVQGILARFDLIVGTEEEFLIAGGSEDLLTALRTVRSLTAATLVVKLGPQGCTVIHGDIPNRLEDGAIYPGVRVEVLNVLGAGDAFMSGFLAGWLEDASDERCCQLANACGGLVVSRHACAPAMPTRAELDYLFASPVPITRPDQDVVLQRLHQVSVPRRVWKQLFIFAFDHRWQLVELAQRGGRGLDSIGELKQLFIQAVERVEADLQRQGIEADVGLLADQRFGQDSLNAATGRGWWIARPVEVQGSRPLAFEHGRSIGSNLIAWPQEQIIKCLVQFHPDDEPLLRLEQEAQLLGLYKASQVSGHELLLEVIPPKDHPSAHPDVLYRALKRLYNLGIFPAWWKIEAQTCDEWKQLDELIQQRDPYCRGVVLLGLNAPAAALAEGFRQASQSSTCRGFAVGRTIFQEPSRAWLAGEIDDETLIRDVQGRFVELIEAWRAARS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231019 Pseudomonas sp. GM67 Isolate Nodule
12 2511231021 Pseudomonas sp. GM78 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
15 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
18 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
19 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
20 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
21 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
22 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
23 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
24 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
25 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
26 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
27 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
28 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
29 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
30 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
31 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
32 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
33 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
34 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
35 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
36 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
37 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
38 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
39 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
40 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
41 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
42 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
43 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
44 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
45 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
46 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
47 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
48 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
49 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
50 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
51 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
52 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
53 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
54 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
55 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
56 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
57 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
58 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
59 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
60 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
61 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
62 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
63 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
64 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
65 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
66 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
67 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
68 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
69 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
70 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
71 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
72 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
73 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
74 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
75 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
76 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
77 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
78 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
79 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
80 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
81 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
82 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
83 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
84 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
87 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
88 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
89 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
90 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
91 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
92 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
93 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
94 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
95 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
96 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
97 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
98 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
99 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
100 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
101 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
102 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
103 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
104 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
105 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
106 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
107 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
108 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
109 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
110 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
111 2773857670 Pseudomonas sp. 478 Isolate Unclassified
112 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
113 2784132072 Pseudomonas sp. 460 Isolate Unclassified
114 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
115 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
116 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
117 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
118 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
119 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
120 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
121 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
122 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
123 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
124 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
125 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
126 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
127 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
128 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
129 2818991436 Collimonas arenae 515 Isolate Unclassified
130 2818991452 Burkholderia cepacia 561 Isolate Unclassified
131 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
132 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
133 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
134 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
135 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
136 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
137 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
138 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
139 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
140 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
141 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
142 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
143 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
144 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
145 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
146 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
147 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
148 2904564687 Burkholderia sp. 571 Isolate Unclassified
149 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
150 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
151 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
152 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
153 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
154 2919085039 Luteibacter sp. 1214 Isolate Unclassified
155 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
156 2919404418 Luteibacter sp. 3190 Isolate Unclassified
157 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
158 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
159 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
160 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
161 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
162 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
163 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
164 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
165 2928163908 Burkholderia sp. 567 Isolate Unclassified
166 2928170801 Burkholderia sp. 572 Isolate Unclassified
167 2928536128 Burkholderia sola 565 Isolate Unclassified
168 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
169 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
170 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
171 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
172 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
173 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
174 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
175 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
176 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
177 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
178 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
179 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
180 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
181 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
182 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
183 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
184 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
185 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
186 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
187 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
188 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
189 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
190 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
191 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
192 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
193 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
196 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
197 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
198 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
199 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
200 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
201 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
202 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
203 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
204 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
205 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
206 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
207 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
208 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
209 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
210 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
211 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
212 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
213 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
214 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
215 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
216 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
217 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
218 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
219 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
220 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
221 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
222 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
223 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
224 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
227 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
228 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
229 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
230 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
231 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
232 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
233 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
234 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
235 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
236 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
237 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
238 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
239 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
240 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
241 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
242 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
243 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
244 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
245 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
246 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
247 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
248 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
249 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
250 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
251 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
252 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
253 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
254 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
255 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
256 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
257 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
258 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
259 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
260 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
261 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
262 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
269 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
270 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
272 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
281 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
310 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
311 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
313 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
314 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
315 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
316 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
317 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
318 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
319 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
320 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
321 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
322 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
323 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
324 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
325 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
326 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
327 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
328 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
329 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
333 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
334 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
335 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
336 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
337 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
338 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
339 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
340 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
341 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
342 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
343 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
344 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
345 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
346 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
347 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
348 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
349 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
350 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
351 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
352 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
353 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
354 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
355 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
356 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
357 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
358 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
359 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
360 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
361 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
362 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
363 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
364 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
365 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
366 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
370 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
377 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
378 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
382 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
383 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
387 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
388 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
389 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
390 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
394 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
395 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
399 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
400 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
401 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
402 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
403 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
404 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
405 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
406 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
407 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
408 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
409 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
410 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
411 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
412 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
413 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
414 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
415 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
418 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
419 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
420 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
421 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
422 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
423 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
424 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
425 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
426 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
429 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
434 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
439 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
440 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
448 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
449 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
452 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
453 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
454 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
460 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
461 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
462 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
463 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
464 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
467 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
468 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
469 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
470 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
471 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
472 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
473 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
477 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
478 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
479 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
480 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
481 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
482 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
483 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
484 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
485 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
486 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
487 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
488 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
489 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
490 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
491 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
492 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
493 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
494 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
495 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
496 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
497 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
498 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
499 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
500 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.15
Metatranscriptomes 0.23
Isolates 24.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 13.72
Nodule 1.52
Rhizoplane 8.68
Rhizosphere 62.37
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_11 2124908027 Bacteria 54720
2 SwRhRL2b_contig_2082775 2162886007 Bacteria 8626
3 JGI24736J21556_1000922 3300001904 Bacteria 5414
4 JGI24738J21930_10001672 3300002075 Bacteria 6069
5 JGI25162J39368_1000014 3300002737 Bacteria 328873
6 JGI25162J39368_1000015 3300002737 Bacteria 316381
7 JGI25163J39215_1001215 3300002771 Bacteria 4851
8 JGI25163J39215_1002286 3300002771 Bacteria 2082
9 JGI25164J39214_1000037 3300002772 Bacteria 137530
10 JGI25164J39214_1000059 3300002772 Bacteria 111483
11 JGI25165J46597_1000001 3300003214 Bacteria 1111887
12 JGI25165J46597_1000027 3300003214 Bacteria 328873
13 JGI25165J46597_1000118 3300003214 Bacteria 137530
14 JGI25153J46596_10000149 3300003215 Bacteria 70796
15 Ga0006562J51391_1046111 3300003578 Bacteria 7190
16 Ga0006562J51391_1046112 3300003578 Bacteria 5770
17 Ga0055538_1000001 3300003751 Bacteria 1111887
18 Ga0055538_1000057 3300003751 Bacteria 112934
19 Ga0055538_1000158 3300003751 Bacteria 45679
20 Ga0055539_1000001 3300003752 Bacteria 1111887
21 Ga0055539_1000088 3300003752 Bacteria 112934
22 Ga0055539_1000208 3300003752 Bacteria 45679
23 Ga0055533_1000003 3300003756 Bacteria 1111887
24 Ga0055533_1000096 3300003756 Bacteria 112934
25 Ga0055533_1000209 3300003756 Bacteria 45679
26 Ga0055532_1000214 3300003758 Bacteria 45671
27 Ga0055525_1000087 3300003759 Bacteria 149803
28 Ga0055525_1000129 3300003759 Bacteria 112934
29 Ga0055525_1000287 3300003759 Bacteria 45679
30 Ga0055527_1000781 3300003760 Bacteria 8694
31 Ga0055535_1001921 3300003761 Bacteria 8705
32 Ga0055535_1001925 3300003761 Bacteria 8694
33 Ga0055542_1001738 3300003762 Bacteria 9314
34 Ga0055542_1003477 3300003762 Bacteria 4243
35 Ga0055529_1000493 3300003763 Bacteria 35995
36 Ga0055536_1000046 3300003781 Bacteria 118284
37 Ga0055530_10000133 3300003791 Bacteria 65211
38 Ga0055530_10000136 3300003791 Bacteria 64931
39 Ga0055530_10006501 3300003791 Bacteria 5202
40 Ga0055540_1000070 3300003792 Bacteria 118483
41 Ga0055540_1000168 3300003792 Bacteria 65211
42 Ga0055540_1000303 3300003792 Bacteria 43632
43 Ga0055531_10002895 3300003794 Bacteria 11174
44 Ga0055531_10004152 3300003794 Bacteria 8937
45 Ga0055541_1000001 3300003841 Bacteria 1111887
46 Ga0055541_1000059 3300003841 Bacteria 112934
47 Ga0055541_1000067 3300003841 Bacteria 99013
48 Ga0065165_1004047 3300005262 Bacteria 9526
49 Ga0065714_10011647 3300005288 Bacteria 2173
50 Ga0065714_10064673 3300005288 Bacteria 24513
51 Ga0065714_10084986 3300005288 Bacteria 2166
52 Ga0065704_10070740 3300005289 Bacteria 16834
53 Ga0065712_10067765 3300005290 Bacteria 47045
54 Ga0065712_10079941 3300005290 Bacteria 3162
55 Ga0070658_10007195 3300005327 Bacteria 8989
56 Ga0070670_100043450 3300005331 Bacteria 3863
57 Ga0070660_100000080 3300005339 Bacteria 57858
58 Ga0070661_100000399 3300005344 Bacteria 33668
59 Ga0070661_100033882 3300005344 Bacteria 3702
60 Ga0070668_100048034 3300005347 Bacteria 3282
61 Ga0070659_100000068 3300005366 Bacteria 81455
62 Ga0070708_100048922 3300005445 Bacteria 3740
63 Ga0070678_100009561 3300005456 Bacteria 5882
64 Ga0070662_100000595 3300005457 Bacteria 22020
65 Ga0070662_100006829 3300005457 Bacteria 7379
66 Ga0070662_100013868 3300005457 Bacteria 5368
67 Ga0070685_10000935 3300005466 Bacteria 15709
68 Ga0068853_100030852 3300005539 Bacteria 4529
69 Ga0070665_100000786 3300005548 Bacteria 41741
70 Ga0070665_100045492 3300005548 Bacteria 4408
71 Ga0068855_100000112 3300005563 Bacteria 100923
72 Ga0070664_100000824 3300005564 Bacteria 23877
73 Ga0068854_100002880 3300005578 Bacteria 10705
74 Ga0068851_10000857 3300005834 Bacteria 13097
75 Ga0068851_10009790 3300005834 Bacteria 4465
76 Ga0068858_100005634 3300005842 Bacteria 12247
77 Ga0068862_100005745 3300005844 Bacteria 10350
78 Ga0081538_10012237 3300005981 Bacteria 6891
79 Ga0081540_1009283 3300005983 Bacteria 6784
80 Ga0081539_10001562 3300005985 Bacteria 37987
81 Ga0079104_1000823 3300006946 Bacteria 25811
82 Ga0099826_10025336 3300006948 Bacteria 4399
83 Ga0105251_10000215 3300009011 Bacteria 58675
84 Ga0105251_10000924 3300009011 Bacteria 26310
85 Ga0105251_10012316 3300009011 Bacteria 4844
86 Ga0105251_10017057 3300009011 Bacteria 3902
87 Ga0105244_10000564 3300009036 Bacteria 33108
88 Ga0105244_10001338 3300009036 Bacteria 20125
89 Ga0105244_10002323 3300009036 Bacteria 14461
90 Ga0105244_10009100 3300009036 Bacteria 6134
91 Ga0105244_10013244 3300009036 Bacteria 4830
92 Ga0105244_10016000 3300009036 Bacteria 4287
93 Ga0105244_10024178 3300009036 Bacteria 3319
94 Ga0105244_10044264 3300009036 Bacteria 2294
95 Ga0105250_10000370 3300009092 Bacteria 33590
96 Ga0105250_10001079 3300009092 Bacteria 15444
97 Ga0105250_10003522 3300009092 Bacteria 7381
98 Ga0105240_10002080 3300009093 Bacteria 32802
99 Ga0105240_10005298 3300009093 Bacteria 19245
100 Ga0105240_10006245 3300009093 Bacteria 17532
101 Ga0105240_10006631 3300009093 Bacteria 16992
102 Ga0105240_10022023 3300009093 Bacteria 8462
103 Ga0105240_10027693 3300009093 Bacteria 7417
104 Ga0105247_10000745 3300009101 Bacteria 25126
105 Ga0105243_10000045 3300009148 Bacteria 156620
106 Ga0105242_10004232 3300009176 Bacteria 11189
107 Ga0105248_10001036 3300009177 Bacteria 30759
108 Ga0105237_10001264 3300009545 Bacteria 33746
109 Ga0105237_10008385 3300009545 Bacteria 11199
110 Ga0105238_10001781 3300009551 Bacteria 21549
111 Ga0105238_10007435 3300009551 Bacteria 10971
112 Ga0105238_10014906 3300009551 Bacteria 7866
113 Ga0105238_10043229 3300009551 Bacteria 4559
114 Ga0105249_10005339 3300009553 Bacteria 11084
115 Ga0105239_10004940 3300010375 Bacteria 15740
116 Ga0105239_10013785 3300010375 Bacteria 8972
117 Ga0105246_10005991 3300011119 Bacteria 7423
118 Ga0157373_10000819 3300013100 Bacteria 24092
119 Ga0157373_10008189 3300013100 Bacteria 7774
120 Ga0157373_10011579 3300013100 Bacteria 6479
121 Ga0157371_10000359 3300013102 Bacteria 57981
122 Ga0157371_10002766 3300013102 Bacteria 16483
123 Ga0157370_10000127 3300013104 Bacteria 90772
124 Ga0157370_10070231 3300013104 Bacteria 3306
125 Ga0157370_10101181 3300013104 Bacteria 2699
126 Ga0157369_10026879 3300013105 Bacteria 6382
127 Ga0157369_10040412 3300013105 Bacteria 5091
128 Ga0157372_10097213 3300013307 Bacteria 3358
129 Ga0182008_10021402 3300014497 Bacteria 3320
130 Ga0182008_10031554 3300014497 Bacteria 2667
131 Ga0157376_10016268 3300014969 Bacteria 5641
132 Ga0182006_1000034 3300015261 Bacteria 232484
133 Ga0182006_1000342 3300015261 Bacteria 39675
134 Ga0182006_1005976 3300015261 Bacteria 5714
135 Ga0182006_1009981 3300015261 Bacteria 4240
136 Ga0182006_1011544 3300015261 Bacteria 3884
137 Ga0182007_10000177 3300015262 Bacteria 43427
138 Ga0182007_10005023 3300015262 Bacteria 5877
139 Ga0182005_1000045 3300015265 Bacteria 138175
140 Ga0182005_1000613 3300015265 Bacteria 17239
141 Ga0182005_1001311 3300015265 Bacteria 10192
142 Ga0182005_1004405 3300015265 Bacteria 4558
143 Ga0182005_1004528 3300015265 Bacteria 4477
144 Ga0163161_10004619 3300017792 Bacteria 9585
145 Ga0209760_100023 3300025207 Bacteria 159144
146 Ga0209760_100025 3300025207 Bacteria 156628
147 Ga0209760_100710 3300025207 Bacteria 5059
148 Ga0209784_100004 3300025224 Bacteria 1378156
149 Ga0209784_100009 3300025224 Bacteria 688031
150 Ga0209784_100058 3300025224 Bacteria 167327
151 Ga0209566_100004 3300025225 Bacteria 1531866
152 Ga0209566_100007 3300025225 Bacteria 688031
153 Ga0209566_100045 3300025225 Bacteria 258557
154 Ga0209566_101309 3300025225 Bacteria 8054
155 Ga0209674_100006 3300025226 Bacteria 1531866
156 Ga0209674_100018 3300025226 Bacteria 688031
157 Ga0209674_100096 3300025226 Bacteria 167418
158 Ga0209674_100443 3300025226 Bacteria 19098
159 Ga0209674_103427 3300025226 Bacteria 2916
160 Ga0209672_100019 3300025228 Bacteria 432215
161 Ga0209672_100065 3300025228 Bacteria 198168
162 Ga0209147_100026 3300025229 Bacteria 421622
163 Ga0209147_100056 3300025229 Bacteria 258557
164 Ga0209147_100180 3300025229 Bacteria 78654
165 Ga0209563_100009 3300025230 Bacteria 1378156
166 Ga0209563_100020 3300025230 Bacteria 688031
167 Ga0209563_100064 3300025230 Bacteria 258557
168 Ga0207427_100003 3300025231 Bacteria 1035004
169 Ga0207427_100018 3300025231 Bacteria 530735
170 Ga0207427_102581 3300025231 Bacteria 4688
171 Ga0209437_100002 3300025233 Bacteria 1574801
172 Ga0209437_100004 3300025233 Bacteria 1378156
173 Ga0209437_100031 3300025233 Bacteria 530871
174 Ga0209437_105108 3300025233 Bacteria 2255
175 Ga0209258_100031 3300025242 Bacteria 463572
176 Ga0209258_100079 3300025242 Bacteria 263132
177 Ga0209258_100446 3300025242 Bacteria 45941
178 Ga0209646_1000147 3300025246 Bacteria 103287
179 Ga0209677_100005 3300025253 Bacteria 1378156
180 Ga0209677_100010 3300025253 Bacteria 688031
181 Ga0209677_100053 3300025253 Bacteria 167537
182 Ga0209148_1000027 3300025254 Bacteria 616374
183 Ga0209148_1001323 3300025254 Bacteria 13159
184 Ga0209148_1001500 3300025254 Bacteria 11567
185 Ga0209129_1001032 3300025258 Bacteria 16561
186 Ga0209233_1000004 3300025261 Bacteria 1574798
187 Ga0209233_1000005 3300025261 Bacteria 1531866
188 Ga0209233_1000012 3300025261 Bacteria 1019519
189 Ga0209455_1000058 3300025272 Bacteria 342028
190 Ga0209455_1001897 3300025272 Bacteria 8690
191 Ga0209673_1000420 3300025273 Bacteria 74545
192 Ga0209676_1000003 3300025292 Bacteria 1454178
193 Ga0209676_1000055 3300025292 Bacteria 361565
194 Ga0209564_1011024 3300025295 Bacteria 4091
195 Ga0209758_1000060 3300025297 Bacteria 324326
196 Ga0209050_1000004 3300025298 Bacteria 1600040
197 Ga0209050_1000043 3300025298 Bacteria 398654
198 Ga0209050_1000231 3300025298 Bacteria 122373
199 Ga0209050_1002798 3300025298 Bacteria 13965
200 Ga0209051_1000030 3300025303 Bacteria 398654
201 Ga0209051_1000052 3300025303 Bacteria 283346
202 Ga0209051_1000165 3300025303 Bacteria 122373
203 Ga0209257_1000297 3300025304 Bacteria 109481
204 Ga0209257_1000767 3300025304 Bacteria 47879
205 Ga0209257_1001804 3300025304 Bacteria 23486
206 Ga0209257_1012816 3300025304 Bacteria 3813
207 Ga0207656_10002350 3300025321 Bacteria 6352
208 Ga0207656_10005547 3300025321 Bacteria 4468
209 Ga0207696_1000011 3300025711 Bacteria 530614
210 Ga0207696_1000041 3300025711 Bacteria 311695
211 Ga0207696_1000628 3300025711 Bacteria 25903
212 Ga0207655_1000085 3300025728 Bacteria 206425
213 Ga0207655_1000137 3300025728 Bacteria 140084
214 Ga0207655_1000141 3300025728 Bacteria 138956
215 Ga0207655_1001565 3300025728 Bacteria 20579
216 Ga0207655_1009316 3300025728 Bacteria 6111
217 Ga0207655_1031660 3300025728 Bacteria 2432
218 Ga0207713_1000042 3300025735 Bacteria 242199
219 Ga0207713_1000162 3300025735 Bacteria 98630
220 Ga0207713_1001279 3300025735 Bacteria 20735
221 Ga0207713_1003516 3300025735 Bacteria 10623
222 Ga0207713_1012405 3300025735 Bacteria 4561
223 Ga0207713_1016476 3300025735 Bacteria 3749
224 Ga0207713_1035283 3300025735 Bacteria 2160
225 Ga0207647_10002292 3300025904 Bacteria 14570
226 Ga0207647_10009895 3300025904 Bacteria 6753
227 Ga0207695_10000033 3300025913 Bacteria 507477
228 Ga0207695_10000961 3300025913 Bacteria 51376
229 Ga0207695_10001626 3300025913 Bacteria 36374
230 Ga0207695_10018930 3300025913 Bacteria 7943
231 Ga0207695_10103482 3300025913 Bacteria 2838
232 Ga0207671_10000394 3300025914 Bacteria 61087
233 Ga0207671_10004277 3300025914 Bacteria 13738
234 Ga0207657_10000494 3300025919 Bacteria 41647
235 Ga0207649_10000251 3300025920 Bacteria 43152
236 Ga0207681_10003143 3300025923 Bacteria 10379
237 Ga0207694_10001986 3300025924 Bacteria 16920
238 Ga0207694_10015424 3300025924 Bacteria 5762
239 Ga0207650_10000384 3300025925 Bacteria 40899
240 Ga0207650_10023751 3300025925 Bacteria 4353
241 Ga0207650_10040682 3300025925 Bacteria 3403
242 Ga0207690_10000026 3300025932 Bacteria 175904
243 Ga0207706_10003456 3300025933 Bacteria 15081
244 Ga0207706_10011479 3300025933 Bacteria 8067
245 Ga0207706_10031620 3300025933 Bacteria 4714
246 Ga0207709_10000011 3300025935 Bacteria 552881
247 Ga0207711_10000819 3300025941 Bacteria 30356
248 Ga0207679_10000016 3300025945 Bacteria 253494
249 Ga0207667_10000032 3300025949 Bacteria 322253
250 Ga0207667_10025283 3300025949 Bacteria 6502
251 Ga0207712_10000288 3300025961 Bacteria 47902
252 Ga0207658_10010889 3300025986 Bacteria 6190
253 Ga0207703_10001081 3300026035 Bacteria 25944
254 Ga0207639_10000448 3300026041 Bacteria 28377
255 Ga0207639_10089134 3300026041 Bacteria 2464
256 Ga0207639_10109651 3300026041 Bacteria 2246
257 Ga0207678_10001257 3300026067 Bacteria 23391
258 Ga0207678_10014945 3300026067 Bacteria 6829
259 Ga0207648_10012176 3300026089 Bacteria 8058
260 Ga0207648_10077781 3300026089 Bacteria 2893
261 Ga0207683_10036062 3300026121 Bacteria 4304
262 Ga0209281_1000009 3300027111 Bacteria 771717
263 Ga0209371_1000858 3300027312 Bacteria 24618
264 Ga0268266_10000006 3300028379 Bacteria 1410021
265 Ga0307517_10001421 3300028786 Bacteria 40285
266 Ga0307515_10006095 3300028794 Bacteria 24239
267 Ga0307515_10023797 3300028794 Bacteria 10710
268 Ga0307515_10025906 3300028794 Bacteria 10118
269 Ga0268256_1000477 3300030500 Bacteria 34416
270 Ga0307513_10005067 3300031456 Bacteria 17439
271 Ga0307408_100015782 3300031548 Bacteria 5032
272 Ga0307408_100046021 3300031548 Bacteria 3119
273 Ga0307508_10000096 3300031616 Bacteria 103730
274 Ga0307508_10063396 3300031616 Bacteria 3261
275 Ga0307508_10067003 3300031616 Bacteria 3159
276 Ga0307514_10001862 3300031649 Bacteria 23281
277 Ga0307516_10002913 3300031730 Bacteria 22413
278 Ga0307405_10000390 3300031731 Bacteria 16413
279 Ga0307405_10004963 3300031731 Bacteria 6355
280 Ga0307405_10014951 3300031731 Bacteria 4190
281 Ga0307405_10026124 3300031731 Bacteria 3364
282 Ga0307413_10000009 3300031824 Bacteria 62408
283 Ga0307413_10000598 3300031824 Bacteria 12121
284 Ga0307413_10011428 3300031824 Bacteria 4365
285 Ga0307413_10016640 3300031824 Bacteria 3806
286 Ga0307413_10025758 3300031824 Bacteria 3230
287 Ga0307410_10000430 3300031852 Bacteria 16734
288 Ga0307410_10034585 3300031852 Bacteria 3274
289 Ga0307406_10020193 3300031901 Bacteria 3919
290 Ga0307412_10000720 3300031911 Bacteria 19115
291 Ga0307409_100011807 3300031995 Bacteria 5530
292 Ga0307409_100090202 3300031995 Bacteria 2508
293 Ga0307414_10000718 3300032004 Bacteria 16955
294 Ga0307414_10037648 3300032004 Bacteria 3241
295 Ga0307411_10000058 3300032005 Bacteria 32882
296 Ga0307411_10007373 3300032005 Bacteria 5596
297 Ga0307411_10007688 3300032005 Bacteria 5517
298 Ga0307411_10025119 3300032005 Bacteria 3564
299 Ga0307411_10032964 3300032005 Bacteria 3207
300 Ga0307411_10040216 3300032005 Bacteria 2964
301 Ga0307415_100009328 3300032126 Bacteria 5493
302 Ga0307510_10000006 3300033180 Bacteria 566474
303 Ga0373937_0190751 3300036401 Bacteria 1926
304 Ga0395901_0030901 3300038443 Bacteria 5519
305 Ga0436361_0513552 3300039447 Bacteria 4331
306 Ga0439436_0000015 3300041404 Bacteria 85239
307 Ga0439438_001497 3300041405 Bacteria 10298
308 Ga0439438_001800 3300041405 Bacteria 9404
309 Ga0439447_002071 3300041407 Bacteria 7377
310 Ga0439466_0004012 3300041411 Bacteria 5680
311 Ga0439466_0010241 3300041411 Bacteria 3487
312 Ga0439465_0000091 3300041413 Bacteria 20149
313 Ga0451853_0587720 3300041512 Bacteria 2357
314 Ga0439432_001119 3300042006 Bacteria 10187
315 Ga0439432_022622 3300042006 Bacteria 2075
316 Ga0439451_003923 3300042009 Bacteria 3025
317 Ga0439452_006659 3300042010 Bacteria 3601
318 Ga0439456_008021 3300042013 Bacteria 2178
319 Ga0450907_000010 3300042146 Bacteria 95376
320 Ga0450908_000273 3300042184 Bacteria 10186
321 Ga0450909_000696 3300042185 Bacteria 4503
322 Ga0451577_0027187 3300042876 Bacteria 5178
323 Ga0466972_0000754 3300044658 Bacteria 15432
324 Ga0453683_0025830 3300044673 Bacteria 3729
325 Ga0453684_0009221 3300044712 Bacteria 17333
326 Ga0466968_0002276 3300044735 Bacteria 7020
327 Ga0451576_0001244 3300045051 Bacteria 44809
328 Ga0495617_000024 3300046452 Bacteria 174402
329 Ga0495617_000054 3300046452 Bacteria 102256
330 Ga0495617_000144 3300046452 Bacteria 46606
331 Ga0495617_000476 3300046452 Bacteria 21320
332 Ga0495627_000120 3300046453 Bacteria 97375
333 Ga0495627_000308 3300046453 Bacteria 48367
334 Ga0495627_012417 3300046453 Bacteria 3023
335 Ga0495592_0011881 3300046454 Bacteria 6599
336 Ga0495603_0001986 3300046455 Bacteria 12045
337 Ga0495590_0000364 3300046457 Bacteria 23127
338 Ga0495590_0001495 3300046457 Bacteria 10040
339 Ga0495590_0005545 3300046457 Bacteria 4994
340 Ga0495591_000064 3300046458 Bacteria 123820
341 Ga0495591_000315 3300046458 Bacteria 43798
342 Ga0495591_001261 3300046458 Bacteria 16235
343 Ga0495591_003301 3300046458 Bacteria 8429
344 Ga0495638_0000363 3300046460 Bacteria 56118
345 Ga0495638_0017737 3300046460 Bacteria 4740
346 Ga0495638_0020356 3300046460 Bacteria 4384
347 Ga0495638_0026643 3300046460 Bacteria 3746
348 Ga0495638_0038691 3300046460 Bacteria 3029
349 Ga0495651_0007096 3300046462 Bacteria 8562
350 Ga0495653_0001170 3300046463 Bacteria 20256
351 Ga0495653_0009203 3300046463 Bacteria 8078
352 Ga0495650_0000557 3300046471 Bacteria 52926
353 Ga0495650_0000881 3300046471 Bacteria 35559
354 Ga0495650_0001501 3300046471 Bacteria 22235
355 Ga0495650_0003204 3300046471 Bacteria 12176
356 Ga0495650_0008186 3300046471 Bacteria 6144
357 Ga0495605_0000057 3300046474 Bacteria 150333
358 Ga0495605_0000191 3300046474 Bacteria 76513
359 Ga0495605_0000794 3300046474 Bacteria 22656
360 Ga0495605_0003323 3300046474 Bacteria 9622
361 Ga0495605_0032845 3300046474 Bacteria 2639
362 Ga0495639_0000032 3300046475 Bacteria 64548
363 Ga0495584_0000409 3300046491 Bacteria 29687
364 Ga0495584_0000547 3300046491 Bacteria 25497
365 Ga0495584_0002662 3300046491 Bacteria 10055
366 Ga0495584_0014174 3300046491 Bacteria 4062
367 Ga0495585_0000082 3300046492 Bacteria 99210
368 Ga0495585_0013643 3300046492 Bacteria 4751
369 Ga0495594_0044447 3300046499 Bacteria 2436
370 Ga0495607_0000008 3300046501 Bacteria 265274
371 Ga0495607_0000058 3300046501 Bacteria 109864
372 Ga0495607_0000185 3300046501 Bacteria 66759
373 Ga0495607_0000266 3300046501 Bacteria 56114
374 Ga0495607_0000290 3300046501 Bacteria 53251
375 Ga0495607_0000617 3300046501 Bacteria 34500
376 Ga0495607_0003284 3300046501 Bacteria 12430
377 Ga0495607_0011010 3300046501 Bacteria 6043
378 Ga0495607_0016974 3300046501 Bacteria 4686
379 Ga0495607_0027186 3300046501 Bacteria 3542
380 Ga0495607_0071375 3300046501 Bacteria 1936
381 Ga0495583_0000483 3300046506 Bacteria 58302
382 Ga0495583_0001110 3300046506 Bacteria 29768
383 Ga0495583_0003663 3300046506 Bacteria 11448
384 Ga0495583_0004945 3300046506 Bacteria 9256
385 Ga0495583_0010911 3300046506 Bacteria 5249
386 Ga0495583_0014279 3300046506 Bacteria 4389
387 Ga0495606_0000136 3300046507 Bacteria 125611
388 Ga0495606_0000633 3300046507 Bacteria 55270
389 Ga0495606_0001206 3300046507 Bacteria 36344
390 Ga0495606_0001286 3300046507 Bacteria 34779
391 Ga0495606_0001714 3300046507 Bacteria 28242
392 Ga0495606_0003155 3300046507 Bacteria 17833
393 Ga0495608_0018050 3300046511 Bacteria 4874
394 Ga0495608_0040254 3300046511 Bacteria 3131
395 Ga0495610_0002898 3300046512 Bacteria 13883
396 Ga0495610_0004604 3300046512 Bacteria 10105
397 Ga0495610_0040400 3300046512 Bacteria 2351
398 Ga0495616_0000003 3300046513 Bacteria 290178
399 Ga0495616_0000226 3300046513 Bacteria 46396
400 Ga0495616_0000661 3300046513 Bacteria 25616
401 Ga0495616_0003952 3300046513 Bacteria 9441
402 Ga0495616_0004101 3300046513 Bacteria 9238
403 Ga0495616_0004782 3300046513 Bacteria 8483
404 Ga0495618_0002091 3300046514 Bacteria 13092
405 Ga0495618_0071780 3300046514 Bacteria 2203
406 Ga0495620_0000102 3300046515 Bacteria 68028
407 Ga0495620_0000166 3300046515 Bacteria 52419
408 Ga0495620_0000537 3300046515 Bacteria 24263
409 Ga0495620_0003457 3300046515 Bacteria 9035
410 Ga0495620_0011683 3300046515 Bacteria 4569
411 Ga0495620_0014405 3300046515 Bacteria 4019
412 Ga0495628_0001001 3300046516 Bacteria 25857
413 Ga0495628_0004631 3300046516 Bacteria 12146
414 Ga0495631_0000267 3300046518 Bacteria 36464
415 Ga0495631_0000489 3300046518 Bacteria 26545
416 Ga0495631_0001295 3300046518 Bacteria 15349
417 Ga0495631_0006742 3300046518 Bacteria 5895
418 Ga0495631_0015307 3300046518 Bacteria 3677
419 Ga0495632_0000008 3300046519 Bacteria 294056
420 Ga0495632_0000754 3300046519 Bacteria 29135
421 Ga0495632_0001740 3300046519 Bacteria 17652
422 Ga0495632_0002380 3300046519 Bacteria 14374
423 Ga0495632_0028117 3300046519 Bacteria 2937
424 Ga0495632_0028591 3300046519 Bacteria 2908
425 Ga0495632_0035967 3300046519 Bacteria 2522
426 Ga0495637_0000037 3300046520 Bacteria 120732
427 Ga0495637_0000977 3300046520 Bacteria 18146
428 Ga0495637_0001374 3300046520 Bacteria 14567
429 Ga0495637_0003424 3300046520 Bacteria 8427
430 Ga0495637_0017095 3300046520 Bacteria 3386
431 Ga0495643_0024936 3300046522 Bacteria 3388
432 Ga0495643_0030373 3300046522 Bacteria 3017
433 Ga0495643_0045146 3300046522 Bacteria 2393
434 Ga0495648_0000194 3300046524 Bacteria 69964
435 Ga0495648_0000377 3300046524 Bacteria 48820
436 Ga0495648_0001717 3300046524 Bacteria 21157
437 Ga0495648_0010178 3300046524 Bacteria 7188
438 Ga0495642_0000316 3300046528 Bacteria 26656
439 Ga0495652_0012335 3300046529 Bacteria 7714
440 Ga0495652_0026645 3300046529 Bacteria 5104
441 Ga0495654_0000211 3300046530 Bacteria 55188
442 Ga0495654_0000288 3300046530 Bacteria 45799
443 Ga0495654_0000306 3300046530 Bacteria 43427
444 Ga0495654_0001477 3300046530 Bacteria 16099
445 Ga0495654_0001887 3300046530 Bacteria 13935
446 Ga0495654_0002069 3300046530 Bacteria 13171
447 Ga0495654_0006785 3300046530 Bacteria 6465
448 Ga0495587_0014470 3300046536 Bacteria 4946
449 Ga0495609_0000011 3300046538 Bacteria 334377
450 Ga0495609_0000075 3300046538 Bacteria 121584
451 Ga0495609_0001756 3300046538 Bacteria 13921
452 Ga0495645_0008523 3300046543 Bacteria 7159
453 Ga0495645_0025652 3300046543 Bacteria 4280
454 Ga0495622_0000590 3300046557 Bacteria 21268
455 Ga0495622_0001201 3300046557 Bacteria 13369
456 Ga0495622_0001396 3300046557 Bacteria 12267
457 Ga0495668_0005182 3300046616 Bacteria 8950
458 Ga0495634_0000025 3300046642 Bacteria 115964
459 Ga0495611_0000004 3300046648 Bacteria 308149
460 Ga0495611_0000113 3300046648 Bacteria 56814
461 Ga0495611_0000349 3300046648 Bacteria 30120
462 Ga0495625_0000024 3300046660 Bacteria 271126
463 Ga0495625_0000089 3300046660 Bacteria 147075
464 Ga0495625_0000847 3300046660 Bacteria 41784
465 Ga0495625_0009172 3300046660 Bacteria 8313
466 Ga0495635_0000298 3300046663 Bacteria 31939
467 Ga0495659_0000123 3300046664 Bacteria 33987
468 Ga0495661_0000018 3300046665 Bacteria 200787
469 Ga0495661_0000028 3300046665 Bacteria 182191
470 Ga0495661_0000083 3300046665 Bacteria 116027
471 Ga0495661_0000101 3300046665 Bacteria 104928
472 Ga0495661_0001798 3300046665 Bacteria 17218
473 Ga0495661_0004052 3300046665 Bacteria 10673
474 Ga0495661_0031298 3300046665 Bacteria 3379
475 Ga0495588_0007463 3300046674 Bacteria 4978
476 Ga0495623_0006329 3300046679 Bacteria 7697
477 Ga0495623_0014890 3300046679 Bacteria 5029
478 Ga0495646_0001211 3300046680 Bacteria 15107
479 Ga0495646_0003303 3300046680 Bacteria 10042
480 Ga0495669_0003084 3300046684 Bacteria 6850
481 Ga0495670_0000168 3300046691 Bacteria 28846
482 Ga0495670_0000332 3300046691 Bacteria 22511
483 Ga0495670_0014042 3300046691 Bacteria 3940
484 Ga0495671_0000295 3300046692 Bacteria 41756
485 Ga0495671_0000960 3300046692 Bacteria 20228
486 Ga0495671_0001060 3300046692 Bacteria 19054
487 Ga0495671_0001565 3300046692 Bacteria 15188
488 Ga0495671_0004195 3300046692 Bacteria 8681
489 Ga0495671_0029739 3300046692 Bacteria 2802
490 Ga0495649_0000013 3300046694 Bacteria 316013
491 Ga0495649_0000909 3300046694 Bacteria 23449
492 Ga0495649_0027968 3300046694 Bacteria 3126
493 Ga0495589_0000038 3300046794 Bacteria 149381
494 Ga0495589_0000141 3300046794 Bacteria 66457
495 Ga0495589_0000846 3300046794 Bacteria 19210
496 Ga0495660_0000052 3300046810 Bacteria 137821
497 Ga0495660_0000064 3300046810 Bacteria 124968
498 Ga0495660_0003252 3300046810 Bacteria 10096
499 Ga0495581_0013045 3300047315 Bacteria 4816
500 Ga0495604_0002087 3300047317 Bacteria 16085
501 Ga0495604_0002922 3300047317 Bacteria 13682
502 Ga0495636_0002282 3300047318 Bacteria 7363
503 Ga0495674_0054405 3300047319 Bacteria 3515
504 Ga0495672_0000419 3300047320 Bacteria 51114
505 Ga0495672_0001510 3300047320 Bacteria 22783
506 Ga0495672_0003661 3300047320 Bacteria 13008
507 Ga0495672_0013150 3300047320 Bacteria 5723
508 Ga0495676_0000020 3300047321 Bacteria 166813
509 Ga0495680_0047968 3300047322 Bacteria 3356
510 Ga0495683_0000482 3300047323 Bacteria 30948
511 Ga0495683_0031829 3300047323 Bacteria 2687
512 Ga0495687_000715 3300047443 Bacteria 36786
513 Ga0495687_001973 3300047443 Bacteria 17494
514 Ga0495687_004068 3300047443 Bacteria 10135
515 Ga0495687_009189 3300047443 Bacteria 5558
516 Ga0495675_0019279 3300047444 Bacteria 4333
517 Ga0495679_000011 3300047446 Bacteria 324498
518 Ga0495679_000079 3300047446 Bacteria 90806
519 Ga0495679_000711 3300047446 Bacteria 21533
520 Ga0495679_004366 3300047446 Bacteria 6553
521 Ga0495673_0000036 3300047469 Bacteria 311035
522 Ga0495673_0000101 3300047469 Bacteria 173409
523 Ga0495673_0000190 3300047469 Bacteria 97539
524 Ga0495673_0000421 3300047469 Bacteria 48148
525 Ga0495673_0000833 3300047469 Bacteria 28784
526 Ga0495673_0002842 3300047469 Bacteria 11791
527 Ga0495673_0004301 3300047469 Bacteria 8971
528 Ga0495673_0012840 3300047469 Bacteria 4419
529 Ga0495673_0017156 3300047469 Bacteria 3684
530 Ga0495673_0018027 3300047469 Bacteria 3570
531 Ga0495673_0031214 3300047469 Bacteria 2496
532 Ga0495681_0000027 3300047470 Bacteria 141884
533 Ga0495681_0000237 3300047470 Bacteria 45823
534 Ga0495686_0001651 3300047472 Bacteria 23245
535 Ga0495593_0000310 3300047673 Bacteria 26732
536 Ga0495593_0008619 3300047673 Bacteria 5928
537 Ga0495626_0000041 3300048091 Bacteria 172663
538 Ga0495626_0000352 3300048091 Bacteria 48007
539 Ga0495626_0000583 3300048091 Bacteria 36143
540 Ga0496101_0015206 3300048904 Bacteria 5180
541 Ga0496102_0000038 3300048905 Bacteria 198844
542 Ga0496102_0001378 3300048905 Bacteria 21651
543 Ga0496102_0006765 3300048905 Bacteria 9786
544 Ga0496104_0018269 3300048907 Bacteria 6397
545 Ga0496106_0000402 3300048909 Bacteria 30717
546 Ga0496109_0077812 3300048912 Bacteria 3053
547 Ga0496110_0012406 3300048913 Bacteria 7006
548 Ga0496114_0080632 3300048917 Bacteria 2749
549 Ga0496116_0000221 3300048919 Bacteria 106314
550 Ga0496116_0000984 3300048919 Bacteria 34981
551 Ga0496116_0010423 3300048919 Bacteria 7787
552 Ga0496116_0031228 3300048919 Bacteria 3817
553 Ga0496116_0043318 3300048919 Bacteria 3068
554 Ga0496117_0000090 3300048920 Bacteria 206388
555 Ga0496117_0001257 3300048920 Bacteria 37760
556 Ga0496117_0007657 3300048920 Bacteria 10465
557 Ga0496117_0046008 3300048920 Bacteria 3144
558 Ga0496118_0000032 3300048921 Bacteria 330072
559 Ga0496118_0001081 3300048921 Bacteria 42396
560 Ga0496118_0008451 3300048921 Bacteria 10640
561 Ga0496118_0019747 3300048921 Bacteria 6009
562 Ga0496118_0028393 3300048921 Bacteria 4712
563 Ga0496119_0012436 3300048922 Bacteria 6912
564 Ga0496119_0018617 3300048922 Bacteria 5159
565 Ga0496119_0047360 3300048922 Bacteria 2675
566 Ga0496120_0005377 3300048923 Bacteria 10235
567 Ga0496121_0000071 3300048924 Bacteria 247039
568 Ga0496121_0000307 3300048924 Bacteria 101849
569 Ga0496121_0004753 3300048924 Bacteria 17930
570 Ga0496121_0005910 3300048924 Bacteria 15484
571 Ga0496121_0015170 3300048924 Bacteria 8102
572 Ga0496121_0018989 3300048924 Bacteria 6897
573 Ga0496121_0044422 3300048924 Bacteria 3832
574 Ga0496122_0000285 3300048925 Bacteria 113073
575 Ga0496122_0001763 3300048925 Bacteria 33210
576 Ga0496122_0010175 3300048925 Bacteria 9746
577 Ga0496123_0000232 3300048926 Bacteria 113073
578 Ga0496124_0001091 3300048927 Bacteria 42641
579 Ga0496124_0003813 3300048927 Bacteria 18088
580 Ga0496124_0003909 3300048927 Bacteria 17810
581 Ga0496124_0045951 3300048927 Bacteria 3741
582 Ga0496124_0058092 3300048927 Bacteria 3255
583 Ga0496125_0003672 3300048928 Bacteria 18339
584 Ga0496125_0007498 3300048928 Bacteria 11600
585 Ga0496125_0011347 3300048928 Bacteria 8921
586 Ga0496125_0056129 3300048928 Bacteria 3201
587 Ga0496126_0082985 3300048929 Bacteria 2829
588 Ga0495678_000062 3300049459 Bacteria 140706
589 Ga0495678_000724 3300049459 Bacteria 29966
590 Ga0495678_001110 3300049459 Bacteria 22429
591 Ga0495678_002200 3300049459 Bacteria 13669
592 Ga0495678_003441 3300049459 Bacteria 9806
593 Ga0495678_007111 3300049459 Bacteria 5850
594 Ga0495678_035745 3300049459 Bacteria 2033
595 Ga0495682_0000020 3300049460 Bacteria 210849
596 Ga0495682_0000065 3300049460 Bacteria 98530
597 Ga0495682_0001332 3300049460 Bacteria 13685
598 Ga0495682_0001951 3300049460 Bacteria 10223
599 Ga0501033_0001677 3300049570 Bacteria 19371
600 Ga0501037_0001520 3300049573 Bacteria 16925
601 Ga0501038_0013715 3300049574 Bacteria 7388
602 Ga0501038_0038734 3300049574 Bacteria 4172
603 Ga0501043_0006058 3300049579 Bacteria 9717
604 Ga0501043_0018299 3300049579 Bacteria 5494
605 Ga0501046_0000935 3300049580 Bacteria 28596
606 Ga0501047_0015518 3300049581 Bacteria 7257
607 Ga0501048_0020942 3300049582 Bacteria 4790
608 Ga0501067_0014551 3300049583 Bacteria 4356
609 Ga0501070_0139977 3300049586 Bacteria 1998
610 Ga0501073_0003385 3300049589 Bacteria 11988
611 Ga0501074_0030331 3300049590 Bacteria 3919
612 Ga0501077_0004582 3300049593 Bacteria 8398
613 Ga0501079_0009603 3300049741 Bacteria 7336
614 Ga0501080_0011968 3300049742 Bacteria 7947
615 Ga0501080_0042311 3300049742 Bacteria 4242
616 Ga0501081_0007747 3300049743 Bacteria 6962
617 Ga0501083_0001250 3300049744 Bacteria 17258
618 Ga0501083_0029113 3300049744 Bacteria 3802
619 Ga0501083_0068523 3300049744 Bacteria 2361
620 Ga0501083_0074209 3300049744 Bacteria 2260
621 Ga0501035_0024051 3300049822 Bacteria 5589
622 Ga0501035_0024682 3300049822 Bacteria 5511
623 Ga0501035_0105841 3300049822 Bacteria 2466
624 Ga0501044_0044309 3300049823 Bacteria 4616
625 nmdc:mga0qj67_12876_c1 3300050509 Bacteria 6312
626 nmdc:mga0n895_138900_c1 3300050512 Bacteria 2457
627 Ga0495601_0008699 3300053077 Bacteria 5991
628 Ga0500643_000012 3300053087 Bacteria 369839
629 Ga0500646_0009564 3300053090 Bacteria 2482
630 Ga0500651_0016231 3300053093 Bacteria 4579
631 Ga0500555_000233 3300053103 Bacteria 24816
632 Ga0500595_014824 3300053119 Bacteria 2946
633 Ga0500595_023197 3300053119 Bacteria 2184
634 Ga0500642_0006822 3300053130 Bacteria 3792
635 Ga0500658_0005620 3300053134 Bacteria 4665
636 Ga0500574_001090 3300053141 Bacteria 3852
637 Ga0500616_0000708 3300053153 Bacteria 38639
638 Ga0500619_000066 3300053154 Bacteria 31862
639 Ga0500633_0001497 3300053160 Bacteria 4432
640 Ga0500645_000884 3300053730 Bacteria 17419
641 Ga0500609_000357 3300053731 Bacteria 6761
642 Ga0501084_0070918 3300054114 Bacteria 2917
643 Ga0501082_0008394 3300060353 Bacteria 8909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0139977 Ga0501070_0139977_24_1622 518
2 3300049744 Ga0501083_0074209 Ga0501083_0074209_29_1627 518
3 3300031548 Ga0307408_100046021 Ga0307408_1000460212 562
4 3300032004 Ga0307414_10037648 Ga0307414_100376482 562
5 3300032005 Ga0307411_10032964 Ga0307411_100329642 562
6 3300046665 Ga0495661_0004052 Ga0495661_0004052_20_1744 563
7 3300032126 Ga0307415_100009328 Ga0307415_1000093282 564
8 3300046514 Ga0495618_0071780 Ga0495618_0071780_444_2177 566
9 3300049744 Ga0501083_0068523 Ga0501083_0068523_586_2328 567
10 3300048929 Ga0496126_0082985 Ga0496126_0082985_1051_2799 570
11 3300048922 Ga0496119_0047360 Ga0496119_0047360_904_2655 571
12 3300042013 Ga0439456_008021 Ga0439456_008021_402_2153 575
13 3300036401 Ga0373937_0190751 Ga0373937_0190751_168_1913 579
14 3300046680 Ga0495646_0001211 Ga0495646_0001211_13306_15078 579
15 3300046501 Ga0495607_0071375 Ga0495607_0071375_127_1908 580
16 3300031824 Ga0307413_10016640 Ga0307413_100166403 597
17 3300046453 Ga0495627_000120 Ga0495627_000120_10150_12033 600
18 3300032005 Ga0307411_10040216 Ga0307411_100402162 603
19 3300048905 Ga0496102_0006765 Ga0496102_0006765_3990_5885 603
20 3300048917 Ga0496114_0080632 Ga0496114_0080632_502_2397 603
21 3300048919 Ga0496116_0031228 Ga0496116_0031228_29_1924 603
22 3300048920 Ga0496117_0000090 Ga0496117_0000090_108530_110425 603
23 3300048921 Ga0496118_0000032 Ga0496118_0000032_94612_96507 603
24 3300048923 Ga0496120_0005377 Ga0496120_0005377_3524_5419 603
25 3300049743 Ga0501081_0007747 Ga0501081_0007747_820_2742 605
26 3300031824 Ga0307413_10000598 Ga0307413_100005989 607
27 3300031852 Ga0307410_10034585 Ga0307410_100345852 607
28 3300031995 Ga0307409_100011807 Ga0307409_1000118074 607
29 3300032004 Ga0307414_10000718 Ga0307414_100007187 607
30 3300050509 nmdc:mga0qj67_12876_c1 nmdc:mga0qj67_12876_c1_2040_3953 608
31 3300031731 Ga0307405_10014951 Ga0307405_100149512 610
32 3300033180 Ga0307510_10000006 Ga0307510_10000006206 610
33 3300046501 Ga0495607_0027186 Ga0495607_0027186_638_2509 610
34 3300046557 Ga0495622_0001396 Ga0495622_0001396_1035_2906 611
35 3300046674 Ga0495588_0007463 Ga0495588_0007463_1387_3258 611
36 3300047469 Ga0495673_0004301 Ga0495673_0004301_4780_6651 611
37 3300048922 Ga0496119_0012436 Ga0496119_0012436_581_2476 611
38 3300048928 Ga0496125_0007498 Ga0496125_0007498_4794_6689 611
39 3300046452 Ga0495617_000024 Ga0495617_000024_87255_89159 613
40 3300046515 Ga0495620_0000102 Ga0495620_0000102_65945_67849 613
41 3300046518 Ga0495631_0000489 Ga0495631_0000489_15330_17270 618
42 3300046530 Ga0495654_0001477 Ga0495654_0001477_5037_6977 618
43 3300047320 Ga0495672_0003661 Ga0495672_0003661_9940_11880 618
44 3300050512 nmdc:mga0n895_138900_c1 nmdc:mga0n895_138900_c1_215_2128 618
45 3300015261 Ga0182006_1000034 Ga0182006_10000342 621
46 3300046616 Ga0495668_0005182 Ga0495668_0005182_2901_4829 621
47 3300046692 Ga0495671_0001565 Ga0495671_0001565_6170_8110 621
48 3300046810 Ga0495660_0000052 Ga0495660_0000052_14335_16263 621
49 3300047469 Ga0495673_0000036 Ga0495673_0000036_173779_175707 621
50 3300032005 Ga0307411_10007373 Ga0307411_100073733 623
51 3300047446 Ga0495679_004366 Ga0495679_004366_4635_6539 623
52 3300005985 Ga0081539_10001562 Ga0081539_1000156218 625
53 3300031824 Ga0307413_10025758 Ga0307413_100257583 625
54 3300032005 Ga0307411_10025119 Ga0307411_100251192 625
55 3300005548 Ga0070665_100045492 Ga0070665_1000454922 626
56 3300005981 Ga0081538_10012237 Ga0081538_100122376 626
57 3300009093 Ga0105240_10006631 Ga0105240_100066317 627
58 3300025304 Ga0209257_1001804 Ga0209257_10018047 627
59 3300025913 Ga0207695_10000961 Ga0207695_1000096148 627
60 3300049574 Ga0501038_0038734 Ga0501038_0038734_1160_3106 627
61 3300049822 Ga0501035_0024682 Ga0501035_0024682_729_2675 627
62 3300049822 Ga0501035_0105841 Ga0501035_0105841_435_2381 627
63 3300005262 Ga0065165_1004047 Ga0065165_10040472 628
64 3300009177 Ga0105248_10001036 Ga0105248_1000103620 628
65 3300025941 Ga0207711_10000819 Ga0207711_1000081920 628
66 3300044735 Ga0466968_0002276 Ga0466968_0002276_4091_6016 628
67 iso_pu_bacteria 2928157003 2928163785 628
68 iso_pu_bacteria 2928163908 2928164783 628
69 3300015261 Ga0182006_1005976 Ga0182006_10059762 629
70 3300015265 Ga0182005_1000613 Ga0182005_10006139 629
71 3300041404 Ga0439436_0000015 Ga0439436_0000015_30079_32004 629
72 3300042184 Ga0450908_000273 Ga0450908_000273_7069_8997 629
73 3300046512 Ga0495610_0004604 Ga0495610_0004604_5337_7262 629
74 3300046519 Ga0495632_0000008 Ga0495632_0000008_49583_51511 629
75 3300046691 Ga0495670_0000168 Ga0495670_0000168_8263_10188 629
76 3300047444 Ga0495675_0019279 Ga0495675_0019279_758_2689 630
77 3300047673 Ga0495593_0000310 Ga0495593_0000310_13454_15385 630
78 3300053090 Ga0500646_0009564 Ga0500646_0009564_306_2258 630
79 iso_pu_bacteria 2919534386 2919537665 630
80 3300005290 Ga0065712_10079941 Ga0065712_100799412 631
81 3300025913 Ga0207695_10018930 Ga0207695_100189303 631
82 3300046530 Ga0495654_0000211 Ga0495654_0000211_198_2093 631
83 iso_pu_bacteria 2519103095 2519458507 631
84 iso_pu_bacteria 2582581311 2585292913 631
85 iso_pu_bacteria 2816332253 2817260731 631
86 iso_pu_bacteria 2816332256 2817278369 631
87 iso_pu_bacteria 2816332286 2817456345 631
88 iso_pu_bacteria 2863421361 2863427689 631
89 iso_pu_bacteria 2904564687 2904571166 631
90 iso_pu_bacteria 2904571731 2904578259 631
91 iso_pu_bacteria 2928536128 2928540947 631
92 iso_pu_bacteria 2981990288 2981996350 631
93 iso_pu_bacteria 641736154 642417896 631
94 iso_pu_bacteria 8020807995 8020813696 631
95 iso_pu_bacteria 8020938398 8020942295 631
96 iso_pu_bacteria 8020953355 8020958152 631
97 iso_pu_bacteria 8039098773 8039104026 631
98 iso_pu_bacteria 8040167225 8040171624 631
99 iso_pu_bacteria 8040173305 8040177825 631
100 3300046530 Ga0495654_0002069 Ga0495654_0002069_11256_13154 632
101 3300046665 Ga0495661_0000028 Ga0495661_0000028_105644_107545 632
102 iso_pu_bacteria 2599185239 2599737440 632
103 iso_pu_bacteria 2599185240 2599748709 632
104 iso_pu_bacteria 2599185355 2600210620 632
105 iso_pu_bacteria 2675903129 2676746870 632
106 iso_pu_bacteria 2818991452 2819637154 632
107 iso_pu_bacteria 2870068957 2870071797 632
108 iso_pu_bacteria 2928170801 2928172973 632
109 iso_pu_bacteria 8018845410 8018845715 632
110 iso_pu_bacteria 8020945358 8020947519 632
111 iso_pu_bacteria 8021120328 8021124133 632
112 3300005844 Ga0068862_100005745 Ga0068862_10000574510 633
113 3300009093 Ga0105240_10027693 Ga0105240_100276933 633
114 3300025258 Ga0209129_1001032 Ga0209129_10010328 633
115 3300025913 Ga0207695_10103482 Ga0207695_101034822 633
116 3300031824 Ga0307413_10000009 Ga0307413_1000000935 633
117 3300031852 Ga0307410_10000430 Ga0307410_100004304 633
118 3300032005 Ga0307411_10000058 Ga0307411_1000005821 633
119 3300048904 Ga0496101_0015206 Ga0496101_0015206_1112_3121 633
120 3300049570 Ga0501033_0001677 Ga0501033_0001677_3379_5289 633
121 3300049573 Ga0501037_0001520 Ga0501037_0001520_4310_6220 633
122 3300049574 Ga0501038_0013715 Ga0501038_0013715_801_2711 633
123 3300049579 Ga0501043_0006058 Ga0501043_0006058_4556_6466 633
124 3300049580 Ga0501046_0000935 Ga0501046_0000935_16915_18825 633
125 3300049582 Ga0501048_0020942 Ga0501048_0020942_2318_4228 633
126 3300049583 Ga0501067_0014551 Ga0501067_0014551_646_2556 633
127 3300049589 Ga0501073_0003385 Ga0501073_0003385_5075_7018 633
128 3300049590 Ga0501074_0030331 Ga0501074_0030331_256_2166 633
129 3300049593 Ga0501077_0004582 Ga0501077_0004582_3748_5691 633
130 3300049741 Ga0501079_0009603 Ga0501079_0009603_3162_5105 633
131 3300049742 Ga0501080_0011968 Ga0501080_0011968_391_2334 633
132 3300049744 Ga0501083_0001250 Ga0501083_0001250_5776_7686 633
133 3300049822 Ga0501035_0024051 Ga0501035_0024051_2194_4104 633
134 3300049823 Ga0501044_0044309 Ga0501044_0044309_2656_4566 633
135 3300053134 Ga0500658_0005620 Ga0500658_0005620_2520_4430 633
136 3300053153 Ga0500616_0000708 Ga0500616_0000708_36654_38564 633
137 3300054114 Ga0501084_0070918 Ga0501084_0070918_664_2607 633
138 3300060353 Ga0501082_0008394 Ga0501082_0008394_4570_6480 633
139 iso_pu_bacteria 2585428062 2587756688 633
140 3300003215 JGI25153J46596_10000149 JGI25153J46596_1000014954 634
141 3300003760 Ga0055527_1000781 Ga0055527_10007816 634
142 3300003761 Ga0055535_1001921 Ga0055535_10019216 634
143 3300003761 Ga0055535_1001925 Ga0055535_10019256 634
144 3300003762 Ga0055542_1001738 Ga0055542_10017386 634
145 3300003762 Ga0055542_1003477 Ga0055542_10034772 634
146 3300003763 Ga0055529_1000493 Ga0055529_100049316 634
147 3300005327 Ga0070658_10007195 Ga0070658_100071955 634
148 3300005339 Ga0070660_100000080 Ga0070660_10000008042 634
149 3300005344 Ga0070661_100000399 Ga0070661_10000039924 634
150 3300005347 Ga0070668_100048034 Ga0070668_1000480341 634
151 3300005366 Ga0070659_100000068 Ga0070659_10000006830 634
152 3300005564 Ga0070664_100000824 Ga0070664_10000082412 634
153 3300009036 Ga0105244_10002323 Ga0105244_100023232 634
154 3300009093 Ga0105240_10022023 Ga0105240_100220231 634
155 3300009101 Ga0105247_10000745 Ga0105247_100007454 634
156 3300009176 Ga0105242_10004232 Ga0105242_100042326 634
157 3300009545 Ga0105237_10001264 Ga0105237_1000126424 634
158 3300009551 Ga0105238_10001781 Ga0105238_1000178111 634
159 3300010375 Ga0105239_10013785 Ga0105239_100137852 634
160 3300013100 Ga0157373_10011579 Ga0157373_100115795 634
161 3300013104 Ga0157370_10101181 Ga0157370_101011812 634
162 3300013105 Ga0157369_10040412 Ga0157369_100404123 634
163 3300015262 Ga0182007_10005023 Ga0182007_100050233 634
164 3300015265 Ga0182005_1004528 Ga0182005_10045284 634
165 3300025228 Ga0209672_100019 Ga0209672_10001945 634
166 3300025228 Ga0209672_100065 Ga0209672_10006561 634
167 3300025229 Ga0209147_100026 Ga0209147_10002645 634
168 3300025229 Ga0209147_100180 Ga0209147_10018016 634
169 3300025242 Ga0209258_100031 Ga0209258_10003161 634
170 3300025242 Ga0209258_100079 Ga0209258_100079193 634
171 3300025254 Ga0209148_1000027 Ga0209148_100002761 634
172 3300025254 Ga0209148_1001323 Ga0209148_10013236 634
173 3300025272 Ga0209455_1000058 Ga0209455_100005819 634
174 3300025272 Ga0209455_1001897 Ga0209455_10018976 634
175 3300025273 Ga0209673_1000420 Ga0209673_100042026 634
176 3300025295 Ga0209564_1011024 Ga0209564_10110243 634
177 3300025297 Ga0209758_1000060 Ga0209758_1000060323 634
178 3300025728 Ga0207655_1000137 Ga0207655_1000137109 634
179 3300025904 Ga0207647_10009895 Ga0207647_100098953 634
180 3300025914 Ga0207671_10000394 Ga0207671_1000039424 634
181 3300025919 Ga0207657_10000494 Ga0207657_1000049430 634
182 3300025920 Ga0207649_10000251 Ga0207649_1000025124 634
183 3300025932 Ga0207690_10000026 Ga0207690_10000026133 634
184 3300025945 Ga0207679_10000016 Ga0207679_1000001624 634
185 3300025949 Ga0207667_10025283 Ga0207667_100252834 634
186 3300026067 Ga0207678_10001257 Ga0207678_100012572 634
187 3300026089 Ga0207648_10077781 Ga0207648_100777812 634
188 3300026121 Ga0207683_10036062 Ga0207683_100360623 634
189 3300027312 Ga0209371_1000858 Ga0209371_10008586 634
190 3300030500 Ga0268256_1000477 Ga0268256_100047726 634
191 3300042006 Ga0439432_001119 Ga0439432_001119_5980_7917 634
192 3300042876 Ga0451577_0027187 Ga0451577_0027187_234_2174 634
193 3300044673 Ga0453683_0025830 Ga0453683_0025830_434_2374 634
194 3300044712 Ga0453684_0009221 Ga0453684_0009221_8475_10415 634
195 3300045051 Ga0451576_0001244 Ga0451576_0001244_22553_24493 634
196 3300046452 Ga0495617_000476 Ga0495617_000476_3390_5360 634
197 3300046460 Ga0495638_0000363 Ga0495638_0000363_28240_30210 634
198 3300046460 Ga0495638_0020356 Ga0495638_0020356_1919_3889 634
199 3300046471 Ga0495650_0008186 Ga0495650_0008186_2266_4236 634
200 3300046492 Ga0495585_0000082 Ga0495585_0000082_7314_9284 634
201 3300046507 Ga0495606_0000136 Ga0495606_0000136_55837_57807 634
202 3300046507 Ga0495606_0001286 Ga0495606_0001286_1113_3083 634
203 3300046512 Ga0495610_0002898 Ga0495610_0002898_8400_10337 634
204 3300046512 Ga0495610_0040400 Ga0495610_0040400_245_2215 634
205 3300046513 Ga0495616_0000003 Ga0495616_0000003_125252_127222 634
206 3300046513 Ga0495616_0004101 Ga0495616_0004101_3029_4999 634
207 3300046515 Ga0495620_0003457 Ga0495620_0003457_3329_5299 634
208 3300046518 Ga0495631_0000267 Ga0495631_0000267_27334_29304 634
209 3300046518 Ga0495631_0001295 Ga0495631_0001295_7192_9162 634
210 3300046519 Ga0495632_0028591 Ga0495632_0028591_817_2787 634
211 3300046519 Ga0495632_0035967 Ga0495632_0035967_52_2022 634
212 3300046522 Ga0495643_0045146 Ga0495643_0045146_214_2184 634
213 3300046524 Ga0495648_0000194 Ga0495648_0000194_60761_62731 634
214 3300046648 Ga0495611_0000004 Ga0495611_0000004_142470_144440 634
215 3300046648 Ga0495611_0000113 Ga0495611_0000113_27429_29399 634
216 3300046660 Ga0495625_0000024 Ga0495625_0000024_105469_107439 634
217 3300046665 Ga0495661_0001798 Ga0495661_0001798_894_2864 634
218 3300046691 Ga0495670_0014042 Ga0495670_0014042_789_2759 634
219 3300046692 Ga0495671_0004195 Ga0495671_0004195_2448_4418 634
220 3300046794 Ga0495589_0000038 Ga0495589_0000038_16384_18354 634
221 3300046810 Ga0495660_0000064 Ga0495660_0000064_14340_16310 634
222 3300047323 Ga0495683_0000482 Ga0495683_0000482_10894_12864 634
223 3300047446 Ga0495679_000011 Ga0495679_000011_165522_167492 634
224 3300047469 Ga0495673_0000101 Ga0495673_0000101_27556_29526 634
225 3300047469 Ga0495673_0018027 Ga0495673_0018027_1233_3203 634
226 3300047673 Ga0495593_0008619 Ga0495593_0008619_24_1928 634
227 3300048907 Ga0496104_0018269 Ga0496104_0018269_2972_4945 634
228 3300048909 Ga0496106_0000402 Ga0496106_0000402_10165_12135 634
229 3300048924 Ga0496121_0015170 Ga0496121_0015170_19_1989 634
230 3300048924 Ga0496121_0044422 Ga0496121_0044422_66_2036 634
231 3300048928 Ga0496125_0011347 Ga0496125_0011347_914_2818 634
232 3300048928 Ga0496125_0056129 Ga0496125_0056129_400_2337 634
233 3300049459 Ga0495678_000062 Ga0495678_000062_130583_132553 634
234 3300049460 Ga0495682_0001332 Ga0495682_0001332_6954_8924 634
235 3300053087 Ga0500643_000012 Ga0500643_000012_142276_144246 634
236 3300053103 Ga0500555_000233 Ga0500555_000233_6742_8712 634
237 3300053160 Ga0500633_0001497 Ga0500633_0001497_1679_3649 634
238 3300053730 Ga0500645_000884 Ga0500645_000884_6456_8426 634
239 3300005344 Ga0070661_100033882 Ga0070661_1000338822 635
240 3300005456 Ga0070678_100009561 Ga0070678_1000095612 635
241 3300009093 Ga0105240_10005298 Ga0105240_1000529812 635
242 3300009093 Ga0105240_10006245 Ga0105240_100062453 635
243 3300009545 Ga0105237_10008385 Ga0105237_100083854 635
244 3300009551 Ga0105238_10014906 Ga0105238_100149062 635
245 3300010375 Ga0105239_10004940 Ga0105239_100049408 635
246 3300025225 Ga0209566_101309 Ga0209566_1013092 635
247 3300025226 Ga0209674_103427 Ga0209674_1034271 635
248 3300025913 Ga0207695_10001626 Ga0207695_1000162615 635
249 3300025914 Ga0207671_10004277 Ga0207671_100042775 635
250 3300025924 Ga0207694_10015424 Ga0207694_100154242 635
251 3300026041 Ga0207639_10109651 Ga0207639_101096512 635
252 3300028786 Ga0307517_10001421 Ga0307517_100014212 635
253 3300028794 Ga0307515_10023797 Ga0307515_100237974 635
254 3300031616 Ga0307508_10063396 Ga0307508_100633962 635
255 3300047472 Ga0495686_0001651 Ga0495686_0001651_6885_8855 635
256 3300048905 Ga0496102_0001378 Ga0496102_0001378_12385_14340 635
257 3300048920 Ga0496117_0046008 Ga0496117_0046008_1140_3113 635
258 3300048921 Ga0496118_0008451 Ga0496118_0008451_1344_3317 635
259 3300048924 Ga0496121_0000071 Ga0496121_0000071_46311_48284 635
260 3300049581 Ga0501047_0015518 Ga0501047_0015518_5095_7023 635
261 3300049742 Ga0501080_0042311 Ga0501080_0042311_1987_3915 635
262 3300049744 Ga0501083_0029113 Ga0501083_0029113_11_1939 635
263 3300028794 Ga0307515_10006095 Ga0307515_100060958 636
264 3300028794 Ga0307515_10025906 Ga0307515_100259064 636
265 3300031456 Ga0307513_10005067 Ga0307513_1000506713 636
266 3300031616 Ga0307508_10000096 Ga0307508_1000009651 636
267 3300031649 Ga0307514_10001862 Ga0307514_1000186217 636
268 3300031730 Ga0307516_10002913 Ga0307516_100029132 636
269 3300038443 Ga0395901_0030901 Ga0395901_0030901_1568_3514 636
270 3300046460 Ga0495638_0026643 Ga0495638_0026643_564_2519 636
271 3300046529 Ga0495652_0012335 Ga0495652_0012335_527_2476 636
272 3300046530 Ga0495654_0001887 Ga0495654_0001887_7281_9233 636
273 3300046660 Ga0495625_0009172 Ga0495625_0009172_3295_5262 636
274 3300048912 Ga0496109_0077812 Ga0496109_0077812_268_2295 636
275 3300005457 Ga0070662_100000595 Ga0070662_10000059516 637
276 3300006946 Ga0079104_1000823 Ga0079104_10008235 637
277 3300006948 Ga0099826_10025336 Ga0099826_100253365 637
278 3300013100 Ga0157373_10000819 Ga0157373_1000081911 637
279 3300025933 Ga0207706_10003456 Ga0207706_100034565 637
280 3300027111 Ga0209281_1000009 Ga0209281_1000009637 637
281 3300031616 Ga0307508_10067003 Ga0307508_100670031 637
282 3300044658 Ga0466972_0000754 Ga0466972_0000754_9231_11189 637
283 3300025298 Ga0209050_1002798 Ga0209050_10027982 638
284 3300025304 Ga0209257_1000297 Ga0209257_1000297108 638
285 3300049579 Ga0501043_0018299 Ga0501043_0018299_2630_4555 638
286 3300053093 Ga0500651_0016231 Ga0500651_0016231_810_2735 638
287 3300053119 Ga0500595_023197 Ga0500595_023197_194_2119 638
288 3300053130 Ga0500642_0006822 Ga0500642_0006822_859_2784 638
289 3300053731 Ga0500609_000357 Ga0500609_000357_535_2460 638
290 3300005288 Ga0065714_10064673 Ga0065714_1006467314 639
291 iso_pu_bacteria 2593339238 2595447386 639
292 iso_pu_bacteria 2593339239 2595450158 639
293 iso_pu_bacteria 2718218334 2721028871 639
294 iso_pu_bacteria 2818991436 2819544991 639
295 iso_pu_bacteria 2842918807 2842920467 639
296 iso_pu_bacteria 2919085039 2919087110 639
297 iso_pu_bacteria 2919404418 2919406707 639
298 iso_pu_bacteria 2928130867 2928131601 639
299 iso_pu_bacteria 2953994433 2953995748 639
300 2162886007 SwRhRL2b_contig_2082775 SwRhRL2b_0453.00007520 640
301 3300005289 Ga0065704_10070740 Ga0065704_1007074011 640
302 3300005445 Ga0070708_100048922 Ga0070708_1000489223 640
303 3300015261 Ga0182006_1009981 Ga0182006_10099811 640
304 3300046501 Ga0495607_0000290 Ga0495607_0000290_23929_25869 640
305 3300002737 JGI25162J39368_1000015 JGI25162J39368_1000015301 641
306 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001978 641
307 3300003751 Ga0055538_1000001 Ga0055538_100000156 641
308 3300003751 Ga0055538_1000057 Ga0055538_100005746 641
309 3300003752 Ga0055539_1000001 Ga0055539_100000156 641
310 3300003752 Ga0055539_1000088 Ga0055539_100008846 641
311 3300003756 Ga0055533_1000003 Ga0055533_1000003978 641
312 3300003756 Ga0055533_1000096 Ga0055533_100009646 641
313 3300003759 Ga0055525_1000087 Ga0055525_100008789 641
314 3300003759 Ga0055525_1000129 Ga0055525_100012946 641
315 3300003841 Ga0055541_1000001 Ga0055541_1000001978 641
316 3300003841 Ga0055541_1000059 Ga0055541_100005946 641
317 3300005457 Ga0070662_100013868 Ga0070662_1000138684 641
318 3300005466 Ga0070685_10000935 Ga0070685_100009356 641
319 3300005548 Ga0070665_100000786 Ga0070665_10000078630 641
320 3300005563 Ga0068855_100000112 Ga0068855_10000011222 641
321 3300005578 Ga0068854_100002880 Ga0068854_1000028808 641
322 3300005834 Ga0068851_10000857 Ga0068851_100008575 641
323 3300005842 Ga0068858_100005634 Ga0068858_1000056345 641
324 3300005983 Ga0081540_1009283 Ga0081540_10092833 641
325 3300009093 Ga0105240_10002080 Ga0105240_1000208020 641
326 3300009551 Ga0105238_10007435 Ga0105238_100074356 641
327 3300009553 Ga0105249_10005339 Ga0105249_100053393 641
328 3300014969 Ga0157376_10016268 Ga0157376_100162683 641
329 3300015265 Ga0182005_1001311 Ga0182005_10013118 641
330 3300025207 Ga0209760_100710 Ga0209760_1007102 641
331 3300025224 Ga0209784_100004 Ga0209784_100004972 641
332 3300025224 Ga0209784_100009 Ga0209784_100009438 641
333 3300025225 Ga0209566_100004 Ga0209566_1000041129 641
334 3300025225 Ga0209566_100007 Ga0209566_100007438 641
335 3300025226 Ga0209674_100006 Ga0209674_1000061129 641
336 3300025226 Ga0209674_100018 Ga0209674_100018438 641
337 3300025230 Ga0209563_100009 Ga0209563_100009972 641
338 3300025230 Ga0209563_100020 Ga0209563_100020438 641
339 3300025231 Ga0207427_102581 Ga0207427_1025812 641
340 3300025233 Ga0209437_100004 Ga0209437_100004972 641
341 3300025253 Ga0209677_100005 Ga0209677_100005972 641
342 3300025253 Ga0209677_100010 Ga0209677_100010438 641
343 3300025261 Ga0209233_1000005 Ga0209233_10000051129 641
344 3300025321 Ga0207656_10002350 Ga0207656_100023504 641
345 3300025904 Ga0207647_10002292 Ga0207647_100022926 641
346 3300025913 Ga0207695_10000033 Ga0207695_10000033213 641
347 3300025924 Ga0207694_10001986 Ga0207694_100019865 641
348 3300025925 Ga0207650_10023751 Ga0207650_100237512 641
349 3300025933 Ga0207706_10011479 Ga0207706_100114794 641
350 3300025949 Ga0207667_10000032 Ga0207667_10000032217 641
351 3300025961 Ga0207712_10000288 Ga0207712_1000028813 641
352 3300025986 Ga0207658_10010889 Ga0207658_100108893 641
353 3300026035 Ga0207703_10001081 Ga0207703_1000108115 641
354 3300026041 Ga0207639_10000448 Ga0207639_1000044810 641
355 3300026067 Ga0207678_10014945 Ga0207678_100149452 641
356 3300026089 Ga0207648_10012176 Ga0207648_100121766 641
357 3300028379 Ga0268266_10000006 Ga0268266_10000006105 641
358 3300039447 Ga0436361_0513552 Ga0436361_0513552_165_2135 641
359 3300046454 Ga0495592_0011881 Ga0495592_0011881_3814_5781 641
360 3300046462 Ga0495651_0007096 Ga0495651_0007096_2442_4406 641
361 3300046463 Ga0495653_0009203 Ga0495653_0009203_5293_7260 641
362 3300046511 Ga0495608_0018050 Ga0495608_0018050_64_2028 641
363 3300046511 Ga0495608_0040254 Ga0495608_0040254_134_2101 641
364 3300046514 Ga0495618_0002091 Ga0495618_0002091_2383_4350 641
365 3300046516 Ga0495628_0001001 Ga0495628_0001001_91_2055 641
366 3300046516 Ga0495628_0004631 Ga0495628_0004631_4670_6637 641
367 3300046529 Ga0495652_0026645 Ga0495652_0026645_671_2635 641
368 3300046543 Ga0495645_0008523 Ga0495645_0008523_1927_3891 641
369 3300046543 Ga0495645_0025652 Ga0495645_0025652_2114_4081 641
370 3300046679 Ga0495623_0014890 Ga0495623_0014890_2577_4544 641
371 3300046680 Ga0495646_0003303 Ga0495646_0003303_935_2902 641
372 3300047317 Ga0495604_0002922 Ga0495604_0002922_5888_7855 641
373 3300048921 Ga0496118_0019747 Ga0496118_0019747_1201_3267 641
374 3300053077 Ga0495601_0008699 Ga0495601_0008699_1874_3841 641
375 3300053119 Ga0500595_014824 Ga0500595_014824_70_2037 641
376 3300053141 Ga0500574_001090 Ga0500574_001090_977_2944 641
377 3300053154 Ga0500619_000066 Ga0500619_000066_21593_23560 641
378 iso_pu_bacteria 2510065053 2510284531 641
379 iso_pu_bacteria 2510065055 2510295981 641
380 iso_pu_bacteria 2510065058 2510311909 641
381 iso_pu_bacteria 2511231007 2511272552 641
382 iso_pu_bacteria 2511231010 2511290767 641
383 iso_pu_bacteria 2511231014 2511313841 641
384 iso_pu_bacteria 2511231015 2511323324 641
385 iso_pu_bacteria 2511231016 2511327785 641
386 iso_pu_bacteria 2511231019 2511343841 641
387 iso_pu_bacteria 2511231021 2511359761 641
388 iso_pu_bacteria 2511231022 2511362420 641
389 iso_pu_bacteria 2511231156 2511824363 641
390 iso_pu_bacteria 2512047018 2512328373 641
391 iso_pu_bacteria 2554235341 2555669594 641
392 iso_pu_bacteria 2582580891 2583792845 641
393 iso_pu_bacteria 2597489887 2597857598 641
394 iso_pu_bacteria 2597489888 2597864251 641
395 iso_pu_bacteria 2597489889 2597869496 641
396 iso_pu_bacteria 2599185155 2599330601 641
397 iso_pu_bacteria 2599185160 2599353409 641
398 iso_pu_bacteria 2599185161 2599363802 641
399 iso_pu_bacteria 2599185162 2599370122 641
400 iso_pu_bacteria 2599185163 2599372429 641
401 iso_pu_bacteria 2599185164 2599378517 641
402 iso_pu_bacteria 2599185165 2599384106 641
403 iso_pu_bacteria 2599185166 2599391288 641
404 iso_pu_bacteria 2599185167 2599399238 641
405 iso_pu_bacteria 2599185168 2599407533 641
406 iso_pu_bacteria 2599185179 2599453661 641
407 iso_pu_bacteria 2599185181 2599460243 641
408 iso_pu_bacteria 2599185182 2599470635 641
409 iso_pu_bacteria 2599185185 2599484467 641
410 iso_pu_bacteria 2599185186 2599489264 641
411 iso_pu_bacteria 2599185188 2599502196 641
412 iso_pu_bacteria 2599185189 2599509107 641
413 iso_pu_bacteria 2599185190 2599513730 641
414 iso_pu_bacteria 2599185191 2599518910 641
415 iso_pu_bacteria 2599185212 2599616061 641
416 iso_pu_bacteria 2599185248 2599772664 641
417 iso_pu_bacteria 2599185257 2599802261 641
418 iso_pu_bacteria 2599185288 2599881037 641
419 iso_pu_bacteria 2599185289 2599885074 641
420 iso_pu_bacteria 2599185290 2599892787 641
421 iso_pu_bacteria 2599185291 2599899799 641
422 iso_pu_bacteria 2599185300 2599932744 641
423 iso_pu_bacteria 2599185302 2599945259 641
424 iso_pu_bacteria 2599185303 2599949681 641
425 iso_pu_bacteria 2599185304 2599955389 641
426 iso_pu_bacteria 2599185305 2599960890 641
427 iso_pu_bacteria 2599185306 2599965495 641
428 iso_pu_bacteria 2599185308 2599976610 641
429 iso_pu_bacteria 2599185309 2599984434 641
430 iso_pu_bacteria 2599185310 2599990395 641
431 iso_pu_bacteria 2599185311 2599992836 641
432 iso_pu_bacteria 2599185312 2600001663 641
433 iso_pu_bacteria 2599185313 2600008918 641
434 iso_pu_bacteria 2599185314 2600010645 641
435 iso_pu_bacteria 2599185315 2600018384 641
436 iso_pu_bacteria 2599185316 2600023314 641
437 iso_pu_bacteria 2599185317 2600028227 641
438 iso_pu_bacteria 2599185318 2600034165 641
439 iso_pu_bacteria 2599185319 2600040323 641
440 iso_pu_bacteria 2599185320 2600049243 641
441 iso_pu_bacteria 2599185321 2600052904 641
442 iso_pu_bacteria 2599185322 2600056986 641
443 iso_pu_bacteria 2599185323 2600066812 641
444 iso_pu_bacteria 2599185324 2600074064 641
445 iso_pu_bacteria 2599185325 2600077529 641
446 iso_pu_bacteria 2599185356 2600212852 641
447 iso_pu_bacteria 2600254930 2600357324 641
448 iso_pu_bacteria 2600254931 2600366916 641
449 iso_pu_bacteria 2600255283 2601625303 641
450 iso_pu_bacteria 2600255296 2601690397 641
451 iso_pu_bacteria 2600255313 2601773020 641
452 iso_pu_bacteria 2619619299 2621300200 641
453 iso_pu_bacteria 2623620446 2624491482 641
454 iso_pu_bacteria 2643221571 2643871073 641
455 iso_pu_bacteria 2643221633 2644190355 641
456 iso_pu_bacteria 2643221650 2644284926 641
457 iso_pu_bacteria 2643221713 2644622514 641
458 iso_pu_bacteria 2651869719 2652548246 641
459 iso_pu_bacteria 2667528170 2671094662 641
460 iso_pu_bacteria 2667528171 2671095024 641
461 iso_pu_bacteria 2667528176 2671124815 641
462 iso_pu_bacteria 2671180172 2671770120 641
463 iso_pu_bacteria 2675903420 2677901169 641
464 iso_pu_bacteria 2675903515 2678263891 641
465 iso_pu_bacteria 2721755607 2723249078 641
466 iso_pu_bacteria 2738541265 2738675104 641
467 iso_pu_bacteria 2738541271 2738690750 641
468 iso_pu_bacteria 2738541282 2738753394 641
469 iso_pu_bacteria 2738541294 2738810544 641
470 iso_pu_bacteria 2738541303 2738862306 641
471 iso_pu_bacteria 2738541309 2738897904 641
472 iso_pu_bacteria 2738543015 2739257992 641
473 iso_pu_bacteria 2738543016 2739266524 641
474 iso_pu_bacteria 2740892503 2743737033 641
475 iso_pu_bacteria 2744054620 2745004344 641
476 iso_pu_bacteria 2773857670 2774123117 641
477 iso_pu_bacteria 2773857672 2774130788 641
478 iso_pu_bacteria 2784132072 2784315477 641
479 iso_pu_bacteria 2791355520 2794594719 641
480 iso_pu_bacteria 2808606361 2808854888 641
481 iso_pu_bacteria 2808606376 2808926330 641
482 iso_pu_bacteria 2808606377 2808932744 641
483 iso_pu_bacteria 2808606378 2808934917 641
484 iso_pu_bacteria 2808606380 2808948431 641
485 iso_pu_bacteria 2808606381 2808954866 641
486 iso_pu_bacteria 2808606383 2808963314 641
487 iso_pu_bacteria 2808606385 2808978547 641
488 iso_pu_bacteria 2808606388 2808993926 641
489 iso_pu_bacteria 2808606389 2808998281 641
490 iso_pu_bacteria 2816332298 2817491545 641
491 iso_pu_bacteria 2818991464 2819705621 641
492 iso_pu_bacteria 2825651385 2825657323 641
493 iso_pu_bacteria 2826581358 2826585164 641
494 iso_pu_bacteria 2834028612 2834030248 641
495 iso_pu_bacteria 2842815866 2842818698 641
496 iso_pu_bacteria 2842826826 2842831861 641
497 iso_pu_bacteria 2842837860 2842840208 641
498 iso_pu_bacteria 2842849001 2842853637 641
499 iso_pu_bacteria 2842854478 2842858376 641
500 iso_pu_bacteria 2844665904 2844670096 641
501 iso_pu_bacteria 2852612431 2852617423 641
502 iso_pu_bacteria 2852667396 2852672458 641
503 iso_pu_bacteria 2860339153 2860342516 641
504 iso_pu_bacteria 2860867994 2860870370 641
505 iso_pu_bacteria 2908446538 2908450193 641
506 iso_pu_bacteria 2913036834 2913039284 641
507 iso_pu_bacteria 2917070673 2917073407 641
508 iso_pu_bacteria 2917832318 2917833662 641
509 iso_pu_bacteria 2919125081 2919128061 641
510 iso_pu_bacteria 2919456309 2919456646 641
511 iso_pu_bacteria 2919481497 2919485284 641
512 iso_pu_bacteria 2919697872 2919700959 641
513 iso_pu_bacteria 2923153595 2923156065 641
514 iso_pu_bacteria 2923586266 2923586589 641
515 iso_pu_bacteria 2929144301 2929147889 641
516 iso_pu_bacteria 2929189879 2929192841 641
517 iso_pu_bacteria 2931369376 2931369753 641
518 iso_pu_bacteria 2931390751 2931394365 641
519 iso_pu_bacteria 2931396565 2931402600 641
520 iso_pu_bacteria 2935353572 2935357595 641
521 iso_pu_bacteria 2945928738 2945933881 641
522 iso_pu_bacteria 2945961074 2945964229 641
523 iso_pu_bacteria 2946006987 2946010312 641
524 iso_pu_bacteria 2946027586 2946030619 641
525 iso_pu_bacteria 2947233263 2947237415 641
526 iso_pu_bacteria 2974298342 2974298358 641
527 iso_pu_bacteria 2984286254 2984289959 641
528 iso_pu_bacteria 2984499530 2984504264 641
529 iso_pu_bacteria 2984504281 2984505959 641
530 iso_pu_bacteria 2988728565 2988729470 641
531 iso_pu_bacteria 3007395558 3007401595 641
532 iso_pu_bacteria 3007866637 3007869751 641
533 iso_pu_bacteria 637000220 637319925 641
534 iso_pu_bacteria 8015687852 8015690282 641
535 iso_pu_bacteria 8019769354 8019772539 641
536 iso_pu_bacteria 8019775933 8019778375 641
537 iso_pu_bacteria 8054285046 8054286281 641
538 iso_pu_bacteria 8054347763 8054348239 641
539 iso_pu_bacteria 8054503363 8054505797 641
540 iso_pu_bacteria 8055770955 8055773411 641
541 iso_pu_bacteria 8055817908 8055820410 641
542 iso_pu_bacteria 8056131705 8056134363 641
543 iso_pu_bacteria 8056143049 8056145529 641
544 iso_pu_bacteria 8056148874 8056149806 641
545 iso_pu_bacteria 8056155041 8056156905 641
546 iso_pu_bacteria 8056161164 8056166490 641
547 iso_pu_bacteria 8057798959 8057800885 641
548 3300001904 JGI24736J21556_1000922 JGI24736J21556_10009222 642
549 3300002075 JGI24738J21930_10001672 JGI24738J21930_100016723 642
550 3300003578 Ga0006562J51391_1046111 Ga0006562J51391_10461113 642
551 3300003578 Ga0006562J51391_1046112 Ga0006562J51391_10461123 642
552 3300009551 Ga0105238_10043229 Ga0105238_100432292 642
553 3300013104 Ga0157370_10000127 Ga0157370_1000012743 642
554 3300015265 Ga0182005_1000045 Ga0182005_100004564 642
555 3300025226 Ga0209674_100443 Ga0209674_10044313 642
556 3300025233 Ga0209437_105108 Ga0209437_1051082 642
557 3300025254 Ga0209148_1001500 Ga0209148_10015009 642
558 3300031911 Ga0307412_10000720 Ga0307412_100007205 642
559 3300041413 Ga0439465_0000091 Ga0439465_0000091_16346_18313 642
560 3300046501 Ga0495607_0000008 Ga0495607_0000008_14242_16212 642
561 3300048919 Ga0496116_0043318 Ga0496116_0043318_487_2457 642
562 2124908027 MRS2a_Contig_11 MRS2a_00011800 645
563 3300002737 JGI25162J39368_1000014 JGI25162J39368_1000014266 645
564 3300002771 JGI25163J39215_1001215 JGI25163J39215_10012154 645
565 3300002771 JGI25163J39215_1002286 JGI25163J39215_10022861 645
566 3300002772 JGI25164J39214_1000037 JGI25164J39214_100003735 645
567 3300002772 JGI25164J39214_1000059 JGI25164J39214_100005954 645
568 3300003214 JGI25165J46597_1000027 JGI25165J46597_100002754 645
569 3300003214 JGI25165J46597_1000118 JGI25165J46597_100011836 645
570 3300003751 Ga0055538_1000158 Ga0055538_100015824 645
571 3300003752 Ga0055539_1000208 Ga0055539_100020824 645
572 3300003756 Ga0055533_1000209 Ga0055533_100020924 645
573 3300003758 Ga0055532_1000214 Ga0055532_100021418 645
574 3300003759 Ga0055525_1000287 Ga0055525_100028724 645
575 3300003781 Ga0055536_1000046 Ga0055536_1000046104 645
576 3300003791 Ga0055530_10000133 Ga0055530_1000013318 645
577 3300003791 Ga0055530_10000136 Ga0055530_1000013616 645
578 3300003791 Ga0055530_10006501 Ga0055530_100065011 645
579 3300003792 Ga0055540_1000070 Ga0055540_1000070104 645
580 3300003792 Ga0055540_1000168 Ga0055540_100016818 645
581 3300003792 Ga0055540_1000303 Ga0055540_10003037 645
582 3300003794 Ga0055531_10002895 Ga0055531_1000289511 645
583 3300003794 Ga0055531_10004152 Ga0055531_100041525 645
584 3300003841 Ga0055541_1000067 Ga0055541_100006724 645
585 3300005288 Ga0065714_10011647 Ga0065714_100116471 645
586 3300005288 Ga0065714_10084986 Ga0065714_100849861 645
587 3300005290 Ga0065712_10067765 Ga0065712_1006776541 645
588 3300005331 Ga0070670_100043450 Ga0070670_1000434503 645
589 3300005457 Ga0070662_100006829 Ga0070662_1000068292 645
590 3300005539 Ga0068853_100030852 Ga0068853_1000308522 645
591 3300005834 Ga0068851_10009790 Ga0068851_100097902 645
592 3300009011 Ga0105251_10000215 Ga0105251_100002156 645
593 3300009011 Ga0105251_10000924 Ga0105251_1000092410 645
594 3300009011 Ga0105251_10012316 Ga0105251_100123163 645
595 3300009011 Ga0105251_10017057 Ga0105251_100170572 645
596 3300009036 Ga0105244_10000564 Ga0105244_1000056416 645
597 3300009036 Ga0105244_10001338 Ga0105244_100013388 645
598 3300009036 Ga0105244_10009100 Ga0105244_100091003 645
599 3300009036 Ga0105244_10013244 Ga0105244_100132444 645
600 3300009036 Ga0105244_10016000 Ga0105244_100160002 645
601 3300009036 Ga0105244_10024178 Ga0105244_100241781 645
602 3300009036 Ga0105244_10044264 Ga0105244_100442641 645
603 3300009092 Ga0105250_10000370 Ga0105250_1000037015 645
604 3300009092 Ga0105250_10001079 Ga0105250_100010792 645
605 3300009092 Ga0105250_10003522 Ga0105250_100035226 645
606 3300009148 Ga0105243_10000045 Ga0105243_100000458 645
607 3300011119 Ga0105246_10005991 Ga0105246_100059912 645
608 3300013100 Ga0157373_10008189 Ga0157373_100081895 645
609 3300013102 Ga0157371_10000359 Ga0157371_1000035948 645
610 3300013102 Ga0157371_10002766 Ga0157371_100027663 645
611 3300013104 Ga0157370_10070231 Ga0157370_100702311 645
612 3300013105 Ga0157369_10026879 Ga0157369_100268793 645
613 3300013307 Ga0157372_10097213 Ga0157372_100972132 645
614 3300014497 Ga0182008_10021402 Ga0182008_100214023 645
615 3300014497 Ga0182008_10031554 Ga0182008_100315542 645
616 3300015261 Ga0182006_1000342 Ga0182006_100034233 645
617 3300015261 Ga0182006_1011544 Ga0182006_10115443 645
618 3300015262 Ga0182007_10000177 Ga0182007_1000017712 645
619 3300015265 Ga0182005_1004405 Ga0182005_10044054 645
620 3300017792 Ga0163161_10004619 Ga0163161_100046197 645
621 3300025207 Ga0209760_100023 Ga0209760_100023122 645
622 3300025207 Ga0209760_100025 Ga0209760_10002559 645
623 3300025224 Ga0209784_100058 Ga0209784_100058125 645
624 3300025225 Ga0209566_100045 Ga0209566_100045125 645
625 3300025226 Ga0209674_100096 Ga0209674_100096125 645
626 3300025229 Ga0209147_100056 Ga0209147_100056125 645
627 3300025230 Ga0209563_100064 Ga0209563_100064125 645
628 3300025231 Ga0207427_100003 Ga0207427_100003532 645
629 3300025231 Ga0207427_100018 Ga0207427_100018121 645
630 3300025233 Ga0209437_100002 Ga0209437_100002481 645
631 3300025233 Ga0209437_100031 Ga0209437_100031121 645
632 3300025242 Ga0209258_100446 Ga0209258_10044619 645
633 3300025246 Ga0209646_1000147 Ga0209646_100014757 645
634 3300025253 Ga0209677_100053 Ga0209677_100053125 645
635 3300025261 Ga0209233_1000004 Ga0209233_1000004944 645
636 3300025261 Ga0209233_1000012 Ga0209233_1000012120 645
637 3300025292 Ga0209676_1000003 Ga0209676_10000031258 645
638 3300025292 Ga0209676_1000055 Ga0209676_1000055201 645
639 3300025298 Ga0209050_1000004 Ga0209050_10000041240 645
640 3300025298 Ga0209050_1000043 Ga0209050_1000043269 645
641 3300025298 Ga0209050_1000231 Ga0209050_10002319 645
642 3300025303 Ga0209051_1000030 Ga0209051_100003081 645
643 3300025303 Ga0209051_1000052 Ga0209051_100005216 645
644 3300025303 Ga0209051_1000165 Ga0209051_10001659 645
645 3300025304 Ga0209257_1000767 Ga0209257_10007679 645
646 3300025304 Ga0209257_1012816 Ga0209257_10128162 645
647 3300025321 Ga0207656_10005547 Ga0207656_100055472 645
648 3300025711 Ga0207696_1000011 Ga0207696_1000011236 645
649 3300025711 Ga0207696_1000041 Ga0207696_1000041215 645
650 3300025711 Ga0207696_1000628 Ga0207696_100062814 645
651 3300025728 Ga0207655_1000085 Ga0207655_100008556 645
652 3300025728 Ga0207655_1000141 Ga0207655_100014154 645
653 3300025728 Ga0207655_1001565 Ga0207655_100156515 645
654 3300025728 Ga0207655_1009316 Ga0207655_10093164 645
655 3300025728 Ga0207655_1031660 Ga0207655_10316601 645
656 3300025735 Ga0207713_1000042 Ga0207713_100004271 645
657 3300025735 Ga0207713_1000162 Ga0207713_100016244 645
658 3300025735 Ga0207713_1001279 Ga0207713_100127919 645
659 3300025735 Ga0207713_1003516 Ga0207713_10035161 645
660 3300025735 Ga0207713_1012405 Ga0207713_10124052 645
661 3300025735 Ga0207713_1016476 Ga0207713_10164762 645
662 3300025735 Ga0207713_1035283 Ga0207713_10352831 645
663 3300025923 Ga0207681_10003143 Ga0207681_100031436 645
664 3300025925 Ga0207650_10000384 Ga0207650_100003847 645
665 3300025925 Ga0207650_10040682 Ga0207650_100406823 645
666 3300025933 Ga0207706_10031620 Ga0207706_100316203 645
667 3300025935 Ga0207709_10000011 Ga0207709_10000011341 645
668 3300026041 Ga0207639_10089134 Ga0207639_100891342 645
669 3300031548 Ga0307408_100015782 Ga0307408_1000157822 645
670 3300031731 Ga0307405_10000390 Ga0307405_1000039015 645
671 3300031731 Ga0307405_10004963 Ga0307405_100049635 645
672 3300031731 Ga0307405_10026124 Ga0307405_100261242 645
673 3300031824 Ga0307413_10011428 Ga0307413_100114284 645
674 3300031901 Ga0307406_10020193 Ga0307406_100201932 645
675 3300031995 Ga0307409_100090202 Ga0307409_1000902021 645
676 3300032005 Ga0307411_10007688 Ga0307411_100076884 645
677 3300041405 Ga0439438_001497 Ga0439438_001497_2320_4431 645
678 3300041405 Ga0439438_001800 Ga0439438_001800_5553_7664 645
679 3300041407 Ga0439447_002071 Ga0439447_002071_684_2621 645
680 3300041411 Ga0439466_0004012 Ga0439466_0004012_96_2033 645
681 3300041411 Ga0439466_0010241 Ga0439466_0010241_872_2809 645
682 3300041512 Ga0451853_0587720 Ga0451853_0587720_121_2058 645
683 3300042006 Ga0439432_022622 Ga0439432_022622_37_1974 645
684 3300042009 Ga0439451_003923 Ga0439451_003923_916_2853 645
685 3300042010 Ga0439452_006659 Ga0439452_006659_781_2892 645
686 3300042146 Ga0450907_000010 Ga0450907_000010_11533_13470 645
687 3300042185 Ga0450909_000696 Ga0450909_000696_2524_4461 645
688 3300046452 Ga0495617_000054 Ga0495617_000054_49077_51014 645
689 3300046452 Ga0495617_000144 Ga0495617_000144_39_1976 645
690 3300046453 Ga0495627_000308 Ga0495627_000308_44727_46664 645
691 3300046453 Ga0495627_012417 Ga0495627_012417_673_2610 645
692 3300046455 Ga0495603_0001986 Ga0495603_0001986_7819_9756 645
693 3300046457 Ga0495590_0000364 Ga0495590_0000364_15261_17198 645
694 3300046457 Ga0495590_0001495 Ga0495590_0001495_5776_7713 645
695 3300046457 Ga0495590_0005545 Ga0495590_0005545_717_2654 645
696 3300046458 Ga0495591_000064 Ga0495591_000064_67515_69452 645
697 3300046458 Ga0495591_000315 Ga0495591_000315_26105_28042 645
698 3300046458 Ga0495591_001261 Ga0495591_001261_631_2568 645
699 3300046458 Ga0495591_003301 Ga0495591_003301_1302_3239 645
700 3300046460 Ga0495638_0017737 Ga0495638_0017737_424_2361 645
701 3300046460 Ga0495638_0038691 Ga0495638_0038691_536_2473 645
702 3300046463 Ga0495653_0001170 Ga0495653_0001170_11532_13472 645
703 3300046471 Ga0495650_0000557 Ga0495650_0000557_654_2591 645
704 3300046471 Ga0495650_0000881 Ga0495650_0000881_21101_23038 645
705 3300046471 Ga0495650_0001501 Ga0495650_0001501_459_2396 645
706 3300046471 Ga0495650_0003204 Ga0495650_0003204_2403_4340 645
707 3300046474 Ga0495605_0000057 Ga0495605_0000057_58065_60002 645
708 3300046474 Ga0495605_0000191 Ga0495605_0000191_899_2836 645
709 3300046474 Ga0495605_0000794 Ga0495605_0000794_1993_3930 645
710 3300046474 Ga0495605_0003323 Ga0495605_0003323_4542_6479 645
711 3300046474 Ga0495605_0032845 Ga0495605_0032845_135_2072 645
712 3300046475 Ga0495639_0000032 Ga0495639_0000032_13822_15759 645
713 3300046491 Ga0495584_0000409 Ga0495584_0000409_14331_16268 645
714 3300046491 Ga0495584_0000547 Ga0495584_0000547_13173_15110 645
715 3300046491 Ga0495584_0002662 Ga0495584_0002662_157_2094 645
716 3300046491 Ga0495584_0014174 Ga0495584_0014174_768_2705 645
717 3300046492 Ga0495585_0013643 Ga0495585_0013643_2020_3957 645
718 3300046499 Ga0495594_0044447 Ga0495594_0044447_424_2361 645
719 3300046501 Ga0495607_0000058 Ga0495607_0000058_61780_63717 645
720 3300046501 Ga0495607_0000185 Ga0495607_0000185_42522_44459 645
721 3300046501 Ga0495607_0000266 Ga0495607_0000266_22720_24657 645
722 3300046501 Ga0495607_0000617 Ga0495607_0000617_18153_20090 645
723 3300046501 Ga0495607_0003284 Ga0495607_0003284_4593_6530 645
724 3300046501 Ga0495607_0011010 Ga0495607_0011010_1747_3684 645
725 3300046501 Ga0495607_0016974 Ga0495607_0016974_643_2580 645
726 3300046506 Ga0495583_0000483 Ga0495583_0000483_11243_13180 645
727 3300046506 Ga0495583_0001110 Ga0495583_0001110_8763_10700 645
728 3300046506 Ga0495583_0003663 Ga0495583_0003663_9209_11146 645
729 3300046506 Ga0495583_0004945 Ga0495583_0004945_3468_5405 645
730 3300046506 Ga0495583_0010911 Ga0495583_0010911_2303_4240 645
731 3300046506 Ga0495583_0014279 Ga0495583_0014279_2043_3980 645
732 3300046507 Ga0495606_0000633 Ga0495606_0000633_41904_43844 645
733 3300046507 Ga0495606_0001206 Ga0495606_0001206_7706_9643 645
734 3300046507 Ga0495606_0001714 Ga0495606_0001714_23862_25799 645
735 3300046507 Ga0495606_0003155 Ga0495606_0003155_2441_4378 645
736 3300046513 Ga0495616_0000226 Ga0495616_0000226_26103_28040 645
737 3300046513 Ga0495616_0000661 Ga0495616_0000661_2496_4433 645
738 3300046513 Ga0495616_0003952 Ga0495616_0003952_1960_3897 645
739 3300046513 Ga0495616_0004782 Ga0495616_0004782_5083_7020 645
740 3300046515 Ga0495620_0000166 Ga0495620_0000166_16550_18487 645
741 3300046515 Ga0495620_0000537 Ga0495620_0000537_588_2525 645
742 3300046515 Ga0495620_0011683 Ga0495620_0011683_601_2538 645
743 3300046515 Ga0495620_0014405 Ga0495620_0014405_347_2284 645
744 3300046518 Ga0495631_0006742 Ga0495631_0006742_3229_5166 645
745 3300046518 Ga0495631_0015307 Ga0495631_0015307_1110_3047 645
746 3300046519 Ga0495632_0000754 Ga0495632_0000754_11861_13798 645
747 3300046519 Ga0495632_0001740 Ga0495632_0001740_14094_16031 645
748 3300046519 Ga0495632_0002380 Ga0495632_0002380_6544_8481 645
749 3300046519 Ga0495632_0028117 Ga0495632_0028117_539_2476 645
750 3300046520 Ga0495637_0000037 Ga0495637_0000037_70916_72853 645
751 3300046520 Ga0495637_0000977 Ga0495637_0000977_3671_5608 645
752 3300046520 Ga0495637_0001374 Ga0495637_0001374_11128_13065 645
753 3300046520 Ga0495637_0003424 Ga0495637_0003424_4040_5977 645
754 3300046520 Ga0495637_0017095 Ga0495637_0017095_815_2752 645
755 3300046522 Ga0495643_0024936 Ga0495643_0024936_1326_3263 645
756 3300046522 Ga0495643_0030373 Ga0495643_0030373_393_2330 645
757 3300046524 Ga0495648_0000377 Ga0495648_0000377_7234_9171 645
758 3300046524 Ga0495648_0001717 Ga0495648_0001717_12764_14701 645
759 3300046524 Ga0495648_0010178 Ga0495648_0010178_1318_3255 645
760 3300046528 Ga0495642_0000316 Ga0495642_0000316_12842_14779 645
761 3300046530 Ga0495654_0000288 Ga0495654_0000288_11762_13699 645
762 3300046530 Ga0495654_0000306 Ga0495654_0000306_15390_17327 645
763 3300046530 Ga0495654_0006785 Ga0495654_0006785_1359_3296 645
764 3300046536 Ga0495587_0014470 Ga0495587_0014470_2971_4908 645
765 3300046538 Ga0495609_0000011 Ga0495609_0000011_69406_71343 645
766 3300046538 Ga0495609_0000075 Ga0495609_0000075_65473_67410 645
767 3300046538 Ga0495609_0001756 Ga0495609_0001756_6375_8312 645
768 3300046557 Ga0495622_0000590 Ga0495622_0000590_10594_12531 645
769 3300046557 Ga0495622_0001201 Ga0495622_0001201_6437_8374 645
770 3300046642 Ga0495634_0000025 Ga0495634_0000025_91107_93044 645
771 3300046648 Ga0495611_0000349 Ga0495611_0000349_3620_5557 645
772 3300046660 Ga0495625_0000089 Ga0495625_0000089_83007_84944 645
773 3300046660 Ga0495625_0000847 Ga0495625_0000847_13755_15692 645
774 3300046663 Ga0495635_0000298 Ga0495635_0000298_403_2340 645
775 3300046664 Ga0495659_0000123 Ga0495659_0000123_29812_31749 645
776 3300046665 Ga0495661_0000018 Ga0495661_0000018_78650_80587 645
777 3300046665 Ga0495661_0000083 Ga0495661_0000083_100364_102301 645
778 3300046665 Ga0495661_0000101 Ga0495661_0000101_18708_20645 645
779 3300046665 Ga0495661_0031298 Ga0495661_0031298_804_2741 645
780 3300046679 Ga0495623_0006329 Ga0495623_0006329_5643_7580 645
781 3300046684 Ga0495669_0003084 Ga0495669_0003084_3958_5895 645
782 3300046691 Ga0495670_0000332 Ga0495670_0000332_1639_3576 645
783 3300046692 Ga0495671_0000295 Ga0495671_0000295_14345_16282 645
784 3300046692 Ga0495671_0000960 Ga0495671_0000960_12486_14423 645
785 3300046692 Ga0495671_0001060 Ga0495671_0001060_1695_3632 645
786 3300046692 Ga0495671_0029739 Ga0495671_0029739_518_2455 645
787 3300046694 Ga0495649_0000013 Ga0495649_0000013_134106_136043 645
788 3300046694 Ga0495649_0000909 Ga0495649_0000909_19587_21524 645
789 3300046694 Ga0495649_0027968 Ga0495649_0027968_594_2531 645
790 3300046794 Ga0495589_0000141 Ga0495589_0000141_12792_14729 645
791 3300046794 Ga0495589_0000846 Ga0495589_0000846_10034_11971 645
792 3300046810 Ga0495660_0003252 Ga0495660_0003252_6850_8787 645
793 3300047315 Ga0495581_0013045 Ga0495581_0013045_2773_4710 645
794 3300047317 Ga0495604_0002087 Ga0495604_0002087_9807_11744 645
795 3300047318 Ga0495636_0002282 Ga0495636_0002282_4950_6887 645
796 3300047319 Ga0495674_0054405 Ga0495674_0054405_859_2796 645
797 3300047320 Ga0495672_0000419 Ga0495672_0000419_2322_4259 645
798 3300047320 Ga0495672_0001510 Ga0495672_0001510_18922_20859 645
799 3300047320 Ga0495672_0013150 Ga0495672_0013150_78_2015 645
800 3300047321 Ga0495676_0000020 Ga0495676_0000020_78073_80010 645
801 3300047322 Ga0495680_0047968 Ga0495680_0047968_101_2038 645
802 3300047323 Ga0495683_0031829 Ga0495683_0031829_698_2635 645
803 3300047443 Ga0495687_000715 Ga0495687_000715_11845_13782 645
804 3300047443 Ga0495687_001973 Ga0495687_001973_2196_4133 645
805 3300047443 Ga0495687_004068 Ga0495687_004068_2298_4235 645
806 3300047443 Ga0495687_009189 Ga0495687_009189_2887_4824 645
807 3300047446 Ga0495679_000079 Ga0495679_000079_17496_19433 645
808 3300047446 Ga0495679_000711 Ga0495679_000711_17605_19542 645
809 3300047469 Ga0495673_0000190 Ga0495673_0000190_44093_46030 645
810 3300047469 Ga0495673_0000421 Ga0495673_0000421_555_2492 645
811 3300047469 Ga0495673_0000833 Ga0495673_0000833_18729_20666 645
812 3300047469 Ga0495673_0002842 Ga0495673_0002842_8068_10005 645
813 3300047469 Ga0495673_0012840 Ga0495673_0012840_711_2648 645
814 3300047469 Ga0495673_0017156 Ga0495673_0017156_798_2735 645
815 3300047469 Ga0495673_0031214 Ga0495673_0031214_365_2302 645
816 3300047470 Ga0495681_0000027 Ga0495681_0000027_90522_92459 645
817 3300047470 Ga0495681_0000237 Ga0495681_0000237_18664_20601 645
818 3300048091 Ga0495626_0000041 Ga0495626_0000041_87499_89436 645
819 3300048091 Ga0495626_0000352 Ga0495626_0000352_25407_27344 645
820 3300048091 Ga0495626_0000583 Ga0495626_0000583_4381_6318 645
821 3300048905 Ga0496102_0000038 Ga0496102_0000038_161674_163611 645
822 3300048913 Ga0496110_0012406 Ga0496110_0012406_2738_4675 645
823 3300048919 Ga0496116_0000221 Ga0496116_0000221_40272_42212 645
824 3300048919 Ga0496116_0000984 Ga0496116_0000984_1533_3470 645
825 3300048919 Ga0496116_0010423 Ga0496116_0010423_275_2212 645
826 3300048920 Ga0496117_0001257 Ga0496117_0001257_22172_24109 645
827 3300048920 Ga0496117_0007657 Ga0496117_0007657_2744_4681 645
828 3300048921 Ga0496118_0001081 Ga0496118_0001081_40365_42302 645
829 3300048921 Ga0496118_0028393 Ga0496118_0028393_95_2032 645
830 3300048922 Ga0496119_0018617 Ga0496119_0018617_1203_3140 645
831 3300048924 Ga0496121_0000307 Ga0496121_0000307_40280_42220 645
832 3300048924 Ga0496121_0004753 Ga0496121_0004753_11446_13383 645
833 3300048924 Ga0496121_0005910 Ga0496121_0005910_3079_5016 645
834 3300048924 Ga0496121_0018989 Ga0496121_0018989_3496_5433 645
835 3300048925 Ga0496122_0000285 Ga0496122_0000285_73538_75475 645
836 3300048925 Ga0496122_0001763 Ga0496122_0001763_25844_27784 645
837 3300048925 Ga0496122_0010175 Ga0496122_0010175_2275_4212 645
838 3300048926 Ga0496123_0000232 Ga0496123_0000232_37599_39536 645
839 3300048927 Ga0496124_0001091 Ga0496124_0001091_29130_31067 645
840 3300048927 Ga0496124_0003813 Ga0496124_0003813_13701_15638 645
841 3300048927 Ga0496124_0003909 Ga0496124_0003909_2745_4682 645
842 3300048927 Ga0496124_0045951 Ga0496124_0045951_171_2108 645
843 3300048927 Ga0496124_0058092 Ga0496124_0058092_464_2401 645
844 3300048928 Ga0496125_0003672 Ga0496125_0003672_13703_15640 645
845 3300049459 Ga0495678_000724 Ga0495678_000724_1943_3880 645
846 3300049459 Ga0495678_001110 Ga0495678_001110_18978_20915 645
847 3300049459 Ga0495678_002200 Ga0495678_002200_5785_7722 645
848 3300049459 Ga0495678_003441 Ga0495678_003441_2965_4902 645
849 3300049459 Ga0495678_007111 Ga0495678_007111_427_2364 645
850 3300049459 Ga0495678_035745 Ga0495678_035745_56_1993 645
851 3300049460 Ga0495682_0000020 Ga0495682_0000020_203944_205887 645
852 3300049460 Ga0495682_0000065 Ga0495682_0000065_56628_58565 645
853 3300049460 Ga0495682_0001951 Ga0495682_0001951_6020_7957 645

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09863

DUF2090

Uncharacterized protein conserved in bacteria (DUF2090)

389

702

0.98

PF00294

PfkB

pfkB family carbohydrate kinase

69

387

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v19-assembly1.cif.gz_A 2-keto-3-deoxygluconate kinase from thermus thermophilus 0.9208 11 334
3iq0-assembly1.cif.gz_B crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.coli 0.9201 12 334
3k9e-assembly1.cif.gz_B crystal structure of a putative ribokinase ii (apo form) from e.coli 0.9196 12 334
2qcv-assembly1.cif.gz_A crystal structure of a putative 5-dehydro-2-deoxygluconokinase (iolc) from bacillus halodurans c-125 at 1.90 a resolution 0.9181 4 332
3pl2-assembly2.cif.gz_D crystal structure of a 5-keto-2-deoxygluconokinase (ncgl0155, cgl0158) from corynebacterium glutamicum atcc 13032 kitasato at 1.89 a resolution 0.9177 12 334
ID Description Score Start End Superfamily
1v1aA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9344 11 333 3.40.1190.20
1v1aA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9225 11 333 3.40.1190.20
3iq0B00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9146 12 334 3.40.1190.20
3pl2D01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9028 11 334 3.40.1190.20
4du5C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8998 12 332 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A656K0A8-F1-model_v4 IolC protein 0.9929 84 240 GO:0006796
GO:0016301
AF-A0A6N6XG16-F1-model_v4 deleted 0.9922 10 257
AF-A0A5C6RNF6-F1-model_v4 5-dehydro-2-deoxygluconokinase 0.9915 9 107 GO:0016301
AF-F3C2G5-F1-model_v4 IolC protein 0.9867 1 362 GO:0006796
GO:0016301
AF-A0A2X2TAV0-F1-model_v4 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92) 0.9847 63 312 GO:0006796
GO:0047590

Feature Viewer

pLDDT pTM Quality
94.62 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map