F483552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 853 | 500 | 643 | 644 |
Family's Representative Sequence
| Representative Sequence | 3300041405|Ga0439438_001497|Ga0439438_001497_2320_4431 |
| Length | 703 |
| Sequence | MHRVWSGQVTVYWKKYSTIKIYGKNIDYCRSLVLVCIHQSVGVGSGVKRRLIKITGASMGQTRFASGRQLDVICLGRLGVDLYAQQVGARLEDVSSFAKYLGGSSANIAFGTARLGLRSAMLSRVGDDHMGRFLVESLMREGCDVSGIKVDPERLTAMVLLGIKDRETFPLVFYRENCADMALRAEDIDEAFIASSKALLITGTHFSTDSVYQASIQALDYAQTHQVKRILDIDYRPVLWGLAPKADGETRFVADRKVSQHVQGILARFDLIVGTEEEFLIAGGSEDLLTALRTVRSLTAATLVVKLGPQGCTVIHGDIPNRLEDGAIYPGVRVEVLNVLGAGDAFMSGFLAGWLEDASDERCCQLANACGGLVVSRHACAPAMPTRAELDYLFASPVPITRPDQDVVLQRLHQVSVPRRVWKQLFIFAFDHRWQLVELAQRGGRGLDSIGELKQLFIQAVERVEADLQRQGIEADVGLLADQRFGQDSLNAATGRGWWIARPVEVQGSRPLAFEHGRSIGSNLIAWPQEQIIKCLVQFHPDDEPLLRLEQEAQLLGLYKASQVSGHELLLEVIPPKDHPSAHPDVLYRALKRLYNLGIFPAWWKIEAQTCDEWKQLDELIQQRDPYCRGVVLLGLNAPAAALAEGFRQASQSSTCRGFAVGRTIFQEPSRAWLAGEIDDETLIRDVQGRFVELIEAWRAARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 4 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 5 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 6 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 7 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 8 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 12 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 13 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 14 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 15 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 16 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 17 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 18 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 19 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 20 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 21 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 22 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 23 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 24 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 25 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 26 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 27 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 28 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 29 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 30 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 31 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 32 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 33 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 34 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 35 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 36 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 37 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 38 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 39 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 40 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 41 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 42 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 43 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 44 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 45 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 46 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 47 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 48 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 49 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 50 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 51 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 52 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 53 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 54 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 55 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 56 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 57 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 58 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 59 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 60 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 61 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 62 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 63 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 64 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 65 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 66 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 67 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 68 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 69 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 70 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 71 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 72 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 73 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 74 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 75 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 76 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 77 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 78 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 79 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 80 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 81 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 82 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 83 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 84 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 85 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 86 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 87 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 88 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 89 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 90 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 91 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 92 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 93 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 94 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 95 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 96 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 97 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 98 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 99 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 100 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 101 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 102 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 103 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 104 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 105 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 106 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 107 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 108 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 109 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 110 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 111 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 112 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 113 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 114 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 115 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 116 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 117 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 118 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 119 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 120 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 121 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 122 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 123 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 124 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 125 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 126 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 127 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 128 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 129 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 130 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 131 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 132 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 133 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 134 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 135 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 136 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 137 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 138 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 139 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 140 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 141 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 142 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 143 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 144 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 145 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 146 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 147 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 148 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 149 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 150 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 151 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 152 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 153 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 154 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 155 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 156 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 157 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 158 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 159 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 160 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 161 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 162 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 163 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 164 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 165 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 166 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 167 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 168 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 169 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 170 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 171 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 172 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 173 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 174 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 175 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 176 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 177 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 178 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 179 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 180 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 181 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 182 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 183 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 184 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 185 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 186 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 187 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 188 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 189 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 190 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 191 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 192 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 193 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 194 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 195 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 196 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 197 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 199 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 200 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 201 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 202 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 203 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 204 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 205 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 206 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 207 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 208 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 209 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 210 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 211 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 212 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 213 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 214 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 225 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 227 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 229 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 230 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 231 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 232 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 233 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 234 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 235 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 236 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 237 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 256 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 258 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 259 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 260 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 272 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 275 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 278 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 280 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 310 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 313 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 314 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 315 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 316 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 317 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 318 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 319 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 320 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 321 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 322 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 323 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 324 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 325 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 326 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 327 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 328 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 329 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 330 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 332 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 333 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 334 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 335 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 336 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 337 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 338 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 339 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 340 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 341 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 342 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 343 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 344 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 345 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 346 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 347 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 348 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 349 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 350 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 351 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 352 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 422 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 426 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 429 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 432 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 433 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 434 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 435 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 436 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 437 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 438 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 462 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 463 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 464 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 465 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 466 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 467 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 469 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 470 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 471 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 472 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 473 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 474 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 477 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 478 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 479 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 480 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 481 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 482 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 483 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 484 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 485 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 486 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 487 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 488 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 489 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 490 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 491 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 492 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 493 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 494 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 495 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 496 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 497 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 498 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 499 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 500 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.15 |
| Metatranscriptomes | 0.23 |
| Isolates | 24.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 13.72 |
| Nodule | 1.52 |
| Rhizoplane | 8.68 |
| Rhizosphere | 62.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_11 | 2124908027 | Bacteria | 54720 |
| 2 | SwRhRL2b_contig_2082775 | 2162886007 | Bacteria | 8626 |
| 3 | JGI24736J21556_1000922 | 3300001904 | Bacteria | 5414 |
| 4 | JGI24738J21930_10001672 | 3300002075 | Bacteria | 6069 |
| 5 | JGI25162J39368_1000014 | 3300002737 | Bacteria | 328873 |
| 6 | JGI25162J39368_1000015 | 3300002737 | Bacteria | 316381 |
| 7 | JGI25163J39215_1001215 | 3300002771 | Bacteria | 4851 |
| 8 | JGI25163J39215_1002286 | 3300002771 | Bacteria | 2082 |
| 9 | JGI25164J39214_1000037 | 3300002772 | Bacteria | 137530 |
| 10 | JGI25164J39214_1000059 | 3300002772 | Bacteria | 111483 |
| 11 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 12 | JGI25165J46597_1000027 | 3300003214 | Bacteria | 328873 |
| 13 | JGI25165J46597_1000118 | 3300003214 | Bacteria | 137530 |
| 14 | JGI25153J46596_10000149 | 3300003215 | Bacteria | 70796 |
| 15 | Ga0006562J51391_1046111 | 3300003578 | Bacteria | 7190 |
| 16 | Ga0006562J51391_1046112 | 3300003578 | Bacteria | 5770 |
| 17 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 18 | Ga0055538_1000057 | 3300003751 | Bacteria | 112934 |
| 19 | Ga0055538_1000158 | 3300003751 | Bacteria | 45679 |
| 20 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 21 | Ga0055539_1000088 | 3300003752 | Bacteria | 112934 |
| 22 | Ga0055539_1000208 | 3300003752 | Bacteria | 45679 |
| 23 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 24 | Ga0055533_1000096 | 3300003756 | Bacteria | 112934 |
| 25 | Ga0055533_1000209 | 3300003756 | Bacteria | 45679 |
| 26 | Ga0055532_1000214 | 3300003758 | Bacteria | 45671 |
| 27 | Ga0055525_1000087 | 3300003759 | Bacteria | 149803 |
| 28 | Ga0055525_1000129 | 3300003759 | Bacteria | 112934 |
| 29 | Ga0055525_1000287 | 3300003759 | Bacteria | 45679 |
| 30 | Ga0055527_1000781 | 3300003760 | Bacteria | 8694 |
| 31 | Ga0055535_1001921 | 3300003761 | Bacteria | 8705 |
| 32 | Ga0055535_1001925 | 3300003761 | Bacteria | 8694 |
| 33 | Ga0055542_1001738 | 3300003762 | Bacteria | 9314 |
| 34 | Ga0055542_1003477 | 3300003762 | Bacteria | 4243 |
| 35 | Ga0055529_1000493 | 3300003763 | Bacteria | 35995 |
| 36 | Ga0055536_1000046 | 3300003781 | Bacteria | 118284 |
| 37 | Ga0055530_10000133 | 3300003791 | Bacteria | 65211 |
| 38 | Ga0055530_10000136 | 3300003791 | Bacteria | 64931 |
| 39 | Ga0055530_10006501 | 3300003791 | Bacteria | 5202 |
| 40 | Ga0055540_1000070 | 3300003792 | Bacteria | 118483 |
| 41 | Ga0055540_1000168 | 3300003792 | Bacteria | 65211 |
| 42 | Ga0055540_1000303 | 3300003792 | Bacteria | 43632 |
| 43 | Ga0055531_10002895 | 3300003794 | Bacteria | 11174 |
| 44 | Ga0055531_10004152 | 3300003794 | Bacteria | 8937 |
| 45 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 46 | Ga0055541_1000059 | 3300003841 | Bacteria | 112934 |
| 47 | Ga0055541_1000067 | 3300003841 | Bacteria | 99013 |
| 48 | Ga0065165_1004047 | 3300005262 | Bacteria | 9526 |
| 49 | Ga0065714_10011647 | 3300005288 | Bacteria | 2173 |
| 50 | Ga0065714_10064673 | 3300005288 | Bacteria | 24513 |
| 51 | Ga0065714_10084986 | 3300005288 | Bacteria | 2166 |
| 52 | Ga0065704_10070740 | 3300005289 | Bacteria | 16834 |
| 53 | Ga0065712_10067765 | 3300005290 | Bacteria | 47045 |
| 54 | Ga0065712_10079941 | 3300005290 | Bacteria | 3162 |
| 55 | Ga0070658_10007195 | 3300005327 | Bacteria | 8989 |
| 56 | Ga0070670_100043450 | 3300005331 | Bacteria | 3863 |
| 57 | Ga0070660_100000080 | 3300005339 | Bacteria | 57858 |
| 58 | Ga0070661_100000399 | 3300005344 | Bacteria | 33668 |
| 59 | Ga0070661_100033882 | 3300005344 | Bacteria | 3702 |
| 60 | Ga0070668_100048034 | 3300005347 | Bacteria | 3282 |
| 61 | Ga0070659_100000068 | 3300005366 | Bacteria | 81455 |
| 62 | Ga0070708_100048922 | 3300005445 | Bacteria | 3740 |
| 63 | Ga0070678_100009561 | 3300005456 | Bacteria | 5882 |
| 64 | Ga0070662_100000595 | 3300005457 | Bacteria | 22020 |
| 65 | Ga0070662_100006829 | 3300005457 | Bacteria | 7379 |
| 66 | Ga0070662_100013868 | 3300005457 | Bacteria | 5368 |
| 67 | Ga0070685_10000935 | 3300005466 | Bacteria | 15709 |
| 68 | Ga0068853_100030852 | 3300005539 | Bacteria | 4529 |
| 69 | Ga0070665_100000786 | 3300005548 | Bacteria | 41741 |
| 70 | Ga0070665_100045492 | 3300005548 | Bacteria | 4408 |
| 71 | Ga0068855_100000112 | 3300005563 | Bacteria | 100923 |
| 72 | Ga0070664_100000824 | 3300005564 | Bacteria | 23877 |
| 73 | Ga0068854_100002880 | 3300005578 | Bacteria | 10705 |
| 74 | Ga0068851_10000857 | 3300005834 | Bacteria | 13097 |
| 75 | Ga0068851_10009790 | 3300005834 | Bacteria | 4465 |
| 76 | Ga0068858_100005634 | 3300005842 | Bacteria | 12247 |
| 77 | Ga0068862_100005745 | 3300005844 | Bacteria | 10350 |
| 78 | Ga0081538_10012237 | 3300005981 | Bacteria | 6891 |
| 79 | Ga0081540_1009283 | 3300005983 | Bacteria | 6784 |
| 80 | Ga0081539_10001562 | 3300005985 | Bacteria | 37987 |
| 81 | Ga0079104_1000823 | 3300006946 | Bacteria | 25811 |
| 82 | Ga0099826_10025336 | 3300006948 | Bacteria | 4399 |
| 83 | Ga0105251_10000215 | 3300009011 | Bacteria | 58675 |
| 84 | Ga0105251_10000924 | 3300009011 | Bacteria | 26310 |
| 85 | Ga0105251_10012316 | 3300009011 | Bacteria | 4844 |
| 86 | Ga0105251_10017057 | 3300009011 | Bacteria | 3902 |
| 87 | Ga0105244_10000564 | 3300009036 | Bacteria | 33108 |
| 88 | Ga0105244_10001338 | 3300009036 | Bacteria | 20125 |
| 89 | Ga0105244_10002323 | 3300009036 | Bacteria | 14461 |
| 90 | Ga0105244_10009100 | 3300009036 | Bacteria | 6134 |
| 91 | Ga0105244_10013244 | 3300009036 | Bacteria | 4830 |
| 92 | Ga0105244_10016000 | 3300009036 | Bacteria | 4287 |
| 93 | Ga0105244_10024178 | 3300009036 | Bacteria | 3319 |
| 94 | Ga0105244_10044264 | 3300009036 | Bacteria | 2294 |
| 95 | Ga0105250_10000370 | 3300009092 | Bacteria | 33590 |
| 96 | Ga0105250_10001079 | 3300009092 | Bacteria | 15444 |
| 97 | Ga0105250_10003522 | 3300009092 | Bacteria | 7381 |
| 98 | Ga0105240_10002080 | 3300009093 | Bacteria | 32802 |
| 99 | Ga0105240_10005298 | 3300009093 | Bacteria | 19245 |
| 100 | Ga0105240_10006245 | 3300009093 | Bacteria | 17532 |
| 101 | Ga0105240_10006631 | 3300009093 | Bacteria | 16992 |
| 102 | Ga0105240_10022023 | 3300009093 | Bacteria | 8462 |
| 103 | Ga0105240_10027693 | 3300009093 | Bacteria | 7417 |
| 104 | Ga0105247_10000745 | 3300009101 | Bacteria | 25126 |
| 105 | Ga0105243_10000045 | 3300009148 | Bacteria | 156620 |
| 106 | Ga0105242_10004232 | 3300009176 | Bacteria | 11189 |
| 107 | Ga0105248_10001036 | 3300009177 | Bacteria | 30759 |
| 108 | Ga0105237_10001264 | 3300009545 | Bacteria | 33746 |
| 109 | Ga0105237_10008385 | 3300009545 | Bacteria | 11199 |
| 110 | Ga0105238_10001781 | 3300009551 | Bacteria | 21549 |
| 111 | Ga0105238_10007435 | 3300009551 | Bacteria | 10971 |
| 112 | Ga0105238_10014906 | 3300009551 | Bacteria | 7866 |
| 113 | Ga0105238_10043229 | 3300009551 | Bacteria | 4559 |
| 114 | Ga0105249_10005339 | 3300009553 | Bacteria | 11084 |
| 115 | Ga0105239_10004940 | 3300010375 | Bacteria | 15740 |
| 116 | Ga0105239_10013785 | 3300010375 | Bacteria | 8972 |
| 117 | Ga0105246_10005991 | 3300011119 | Bacteria | 7423 |
| 118 | Ga0157373_10000819 | 3300013100 | Bacteria | 24092 |
| 119 | Ga0157373_10008189 | 3300013100 | Bacteria | 7774 |
| 120 | Ga0157373_10011579 | 3300013100 | Bacteria | 6479 |
| 121 | Ga0157371_10000359 | 3300013102 | Bacteria | 57981 |
| 122 | Ga0157371_10002766 | 3300013102 | Bacteria | 16483 |
| 123 | Ga0157370_10000127 | 3300013104 | Bacteria | 90772 |
| 124 | Ga0157370_10070231 | 3300013104 | Bacteria | 3306 |
| 125 | Ga0157370_10101181 | 3300013104 | Bacteria | 2699 |
| 126 | Ga0157369_10026879 | 3300013105 | Bacteria | 6382 |
| 127 | Ga0157369_10040412 | 3300013105 | Bacteria | 5091 |
| 128 | Ga0157372_10097213 | 3300013307 | Bacteria | 3358 |
| 129 | Ga0182008_10021402 | 3300014497 | Bacteria | 3320 |
| 130 | Ga0182008_10031554 | 3300014497 | Bacteria | 2667 |
| 131 | Ga0157376_10016268 | 3300014969 | Bacteria | 5641 |
| 132 | Ga0182006_1000034 | 3300015261 | Bacteria | 232484 |
| 133 | Ga0182006_1000342 | 3300015261 | Bacteria | 39675 |
| 134 | Ga0182006_1005976 | 3300015261 | Bacteria | 5714 |
| 135 | Ga0182006_1009981 | 3300015261 | Bacteria | 4240 |
| 136 | Ga0182006_1011544 | 3300015261 | Bacteria | 3884 |
| 137 | Ga0182007_10000177 | 3300015262 | Bacteria | 43427 |
| 138 | Ga0182007_10005023 | 3300015262 | Bacteria | 5877 |
| 139 | Ga0182005_1000045 | 3300015265 | Bacteria | 138175 |
| 140 | Ga0182005_1000613 | 3300015265 | Bacteria | 17239 |
| 141 | Ga0182005_1001311 | 3300015265 | Bacteria | 10192 |
| 142 | Ga0182005_1004405 | 3300015265 | Bacteria | 4558 |
| 143 | Ga0182005_1004528 | 3300015265 | Bacteria | 4477 |
| 144 | Ga0163161_10004619 | 3300017792 | Bacteria | 9585 |
| 145 | Ga0209760_100023 | 3300025207 | Bacteria | 159144 |
| 146 | Ga0209760_100025 | 3300025207 | Bacteria | 156628 |
| 147 | Ga0209760_100710 | 3300025207 | Bacteria | 5059 |
| 148 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 149 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 150 | Ga0209784_100058 | 3300025224 | Bacteria | 167327 |
| 151 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 152 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 153 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 154 | Ga0209566_101309 | 3300025225 | Bacteria | 8054 |
| 155 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 156 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 157 | Ga0209674_100096 | 3300025226 | Bacteria | 167418 |
| 158 | Ga0209674_100443 | 3300025226 | Bacteria | 19098 |
| 159 | Ga0209674_103427 | 3300025226 | Bacteria | 2916 |
| 160 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 161 | Ga0209672_100065 | 3300025228 | Bacteria | 198168 |
| 162 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 163 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 164 | Ga0209147_100180 | 3300025229 | Bacteria | 78654 |
| 165 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 166 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 167 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 168 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 169 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 170 | Ga0207427_102581 | 3300025231 | Bacteria | 4688 |
| 171 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 172 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 173 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 174 | Ga0209437_105108 | 3300025233 | Bacteria | 2255 |
| 175 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 176 | Ga0209258_100079 | 3300025242 | Bacteria | 263132 |
| 177 | Ga0209258_100446 | 3300025242 | Bacteria | 45941 |
| 178 | Ga0209646_1000147 | 3300025246 | Bacteria | 103287 |
| 179 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 180 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 181 | Ga0209677_100053 | 3300025253 | Bacteria | 167537 |
| 182 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 183 | Ga0209148_1001323 | 3300025254 | Bacteria | 13159 |
| 184 | Ga0209148_1001500 | 3300025254 | Bacteria | 11567 |
| 185 | Ga0209129_1001032 | 3300025258 | Bacteria | 16561 |
| 186 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 187 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 188 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 189 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 190 | Ga0209455_1001897 | 3300025272 | Bacteria | 8690 |
| 191 | Ga0209673_1000420 | 3300025273 | Bacteria | 74545 |
| 192 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 193 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 194 | Ga0209564_1011024 | 3300025295 | Bacteria | 4091 |
| 195 | Ga0209758_1000060 | 3300025297 | Bacteria | 324326 |
| 196 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 197 | Ga0209050_1000043 | 3300025298 | Bacteria | 398654 |
| 198 | Ga0209050_1000231 | 3300025298 | Bacteria | 122373 |
| 199 | Ga0209050_1002798 | 3300025298 | Bacteria | 13965 |
| 200 | Ga0209051_1000030 | 3300025303 | Bacteria | 398654 |
| 201 | Ga0209051_1000052 | 3300025303 | Bacteria | 283346 |
| 202 | Ga0209051_1000165 | 3300025303 | Bacteria | 122373 |
| 203 | Ga0209257_1000297 | 3300025304 | Bacteria | 109481 |
| 204 | Ga0209257_1000767 | 3300025304 | Bacteria | 47879 |
| 205 | Ga0209257_1001804 | 3300025304 | Bacteria | 23486 |
| 206 | Ga0209257_1012816 | 3300025304 | Bacteria | 3813 |
| 207 | Ga0207656_10002350 | 3300025321 | Bacteria | 6352 |
| 208 | Ga0207656_10005547 | 3300025321 | Bacteria | 4468 |
| 209 | Ga0207696_1000011 | 3300025711 | Bacteria | 530614 |
| 210 | Ga0207696_1000041 | 3300025711 | Bacteria | 311695 |
| 211 | Ga0207696_1000628 | 3300025711 | Bacteria | 25903 |
| 212 | Ga0207655_1000085 | 3300025728 | Bacteria | 206425 |
| 213 | Ga0207655_1000137 | 3300025728 | Bacteria | 140084 |
| 214 | Ga0207655_1000141 | 3300025728 | Bacteria | 138956 |
| 215 | Ga0207655_1001565 | 3300025728 | Bacteria | 20579 |
| 216 | Ga0207655_1009316 | 3300025728 | Bacteria | 6111 |
| 217 | Ga0207655_1031660 | 3300025728 | Bacteria | 2432 |
| 218 | Ga0207713_1000042 | 3300025735 | Bacteria | 242199 |
| 219 | Ga0207713_1000162 | 3300025735 | Bacteria | 98630 |
| 220 | Ga0207713_1001279 | 3300025735 | Bacteria | 20735 |
| 221 | Ga0207713_1003516 | 3300025735 | Bacteria | 10623 |
| 222 | Ga0207713_1012405 | 3300025735 | Bacteria | 4561 |
| 223 | Ga0207713_1016476 | 3300025735 | Bacteria | 3749 |
| 224 | Ga0207713_1035283 | 3300025735 | Bacteria | 2160 |
| 225 | Ga0207647_10002292 | 3300025904 | Bacteria | 14570 |
| 226 | Ga0207647_10009895 | 3300025904 | Bacteria | 6753 |
| 227 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 228 | Ga0207695_10000961 | 3300025913 | Bacteria | 51376 |
| 229 | Ga0207695_10001626 | 3300025913 | Bacteria | 36374 |
| 230 | Ga0207695_10018930 | 3300025913 | Bacteria | 7943 |
| 231 | Ga0207695_10103482 | 3300025913 | Bacteria | 2838 |
| 232 | Ga0207671_10000394 | 3300025914 | Bacteria | 61087 |
| 233 | Ga0207671_10004277 | 3300025914 | Bacteria | 13738 |
| 234 | Ga0207657_10000494 | 3300025919 | Bacteria | 41647 |
| 235 | Ga0207649_10000251 | 3300025920 | Bacteria | 43152 |
| 236 | Ga0207681_10003143 | 3300025923 | Bacteria | 10379 |
| 237 | Ga0207694_10001986 | 3300025924 | Bacteria | 16920 |
| 238 | Ga0207694_10015424 | 3300025924 | Bacteria | 5762 |
| 239 | Ga0207650_10000384 | 3300025925 | Bacteria | 40899 |
| 240 | Ga0207650_10023751 | 3300025925 | Bacteria | 4353 |
| 241 | Ga0207650_10040682 | 3300025925 | Bacteria | 3403 |
| 242 | Ga0207690_10000026 | 3300025932 | Bacteria | 175904 |
| 243 | Ga0207706_10003456 | 3300025933 | Bacteria | 15081 |
| 244 | Ga0207706_10011479 | 3300025933 | Bacteria | 8067 |
| 245 | Ga0207706_10031620 | 3300025933 | Bacteria | 4714 |
| 246 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 247 | Ga0207711_10000819 | 3300025941 | Bacteria | 30356 |
| 248 | Ga0207679_10000016 | 3300025945 | Bacteria | 253494 |
| 249 | Ga0207667_10000032 | 3300025949 | Bacteria | 322253 |
| 250 | Ga0207667_10025283 | 3300025949 | Bacteria | 6502 |
| 251 | Ga0207712_10000288 | 3300025961 | Bacteria | 47902 |
| 252 | Ga0207658_10010889 | 3300025986 | Bacteria | 6190 |
| 253 | Ga0207703_10001081 | 3300026035 | Bacteria | 25944 |
| 254 | Ga0207639_10000448 | 3300026041 | Bacteria | 28377 |
| 255 | Ga0207639_10089134 | 3300026041 | Bacteria | 2464 |
| 256 | Ga0207639_10109651 | 3300026041 | Bacteria | 2246 |
| 257 | Ga0207678_10001257 | 3300026067 | Bacteria | 23391 |
| 258 | Ga0207678_10014945 | 3300026067 | Bacteria | 6829 |
| 259 | Ga0207648_10012176 | 3300026089 | Bacteria | 8058 |
| 260 | Ga0207648_10077781 | 3300026089 | Bacteria | 2893 |
| 261 | Ga0207683_10036062 | 3300026121 | Bacteria | 4304 |
| 262 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 263 | Ga0209371_1000858 | 3300027312 | Bacteria | 24618 |
| 264 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 265 | Ga0307517_10001421 | 3300028786 | Bacteria | 40285 |
| 266 | Ga0307515_10006095 | 3300028794 | Bacteria | 24239 |
| 267 | Ga0307515_10023797 | 3300028794 | Bacteria | 10710 |
| 268 | Ga0307515_10025906 | 3300028794 | Bacteria | 10118 |
| 269 | Ga0268256_1000477 | 3300030500 | Bacteria | 34416 |
| 270 | Ga0307513_10005067 | 3300031456 | Bacteria | 17439 |
| 271 | Ga0307408_100015782 | 3300031548 | Bacteria | 5032 |
| 272 | Ga0307408_100046021 | 3300031548 | Bacteria | 3119 |
| 273 | Ga0307508_10000096 | 3300031616 | Bacteria | 103730 |
| 274 | Ga0307508_10063396 | 3300031616 | Bacteria | 3261 |
| 275 | Ga0307508_10067003 | 3300031616 | Bacteria | 3159 |
| 276 | Ga0307514_10001862 | 3300031649 | Bacteria | 23281 |
| 277 | Ga0307516_10002913 | 3300031730 | Bacteria | 22413 |
| 278 | Ga0307405_10000390 | 3300031731 | Bacteria | 16413 |
| 279 | Ga0307405_10004963 | 3300031731 | Bacteria | 6355 |
| 280 | Ga0307405_10014951 | 3300031731 | Bacteria | 4190 |
| 281 | Ga0307405_10026124 | 3300031731 | Bacteria | 3364 |
| 282 | Ga0307413_10000009 | 3300031824 | Bacteria | 62408 |
| 283 | Ga0307413_10000598 | 3300031824 | Bacteria | 12121 |
| 284 | Ga0307413_10011428 | 3300031824 | Bacteria | 4365 |
| 285 | Ga0307413_10016640 | 3300031824 | Bacteria | 3806 |
| 286 | Ga0307413_10025758 | 3300031824 | Bacteria | 3230 |
| 287 | Ga0307410_10000430 | 3300031852 | Bacteria | 16734 |
| 288 | Ga0307410_10034585 | 3300031852 | Bacteria | 3274 |
| 289 | Ga0307406_10020193 | 3300031901 | Bacteria | 3919 |
| 290 | Ga0307412_10000720 | 3300031911 | Bacteria | 19115 |
| 291 | Ga0307409_100011807 | 3300031995 | Bacteria | 5530 |
| 292 | Ga0307409_100090202 | 3300031995 | Bacteria | 2508 |
| 293 | Ga0307414_10000718 | 3300032004 | Bacteria | 16955 |
| 294 | Ga0307414_10037648 | 3300032004 | Bacteria | 3241 |
| 295 | Ga0307411_10000058 | 3300032005 | Bacteria | 32882 |
| 296 | Ga0307411_10007373 | 3300032005 | Bacteria | 5596 |
| 297 | Ga0307411_10007688 | 3300032005 | Bacteria | 5517 |
| 298 | Ga0307411_10025119 | 3300032005 | Bacteria | 3564 |
| 299 | Ga0307411_10032964 | 3300032005 | Bacteria | 3207 |
| 300 | Ga0307411_10040216 | 3300032005 | Bacteria | 2964 |
| 301 | Ga0307415_100009328 | 3300032126 | Bacteria | 5493 |
| 302 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 303 | Ga0373937_0190751 | 3300036401 | Bacteria | 1926 |
| 304 | Ga0395901_0030901 | 3300038443 | Bacteria | 5519 |
| 305 | Ga0436361_0513552 | 3300039447 | Bacteria | 4331 |
| 306 | Ga0439436_0000015 | 3300041404 | Bacteria | 85239 |
| 307 | Ga0439438_001497 | 3300041405 | Bacteria | 10298 |
| 308 | Ga0439438_001800 | 3300041405 | Bacteria | 9404 |
| 309 | Ga0439447_002071 | 3300041407 | Bacteria | 7377 |
| 310 | Ga0439466_0004012 | 3300041411 | Bacteria | 5680 |
| 311 | Ga0439466_0010241 | 3300041411 | Bacteria | 3487 |
| 312 | Ga0439465_0000091 | 3300041413 | Bacteria | 20149 |
| 313 | Ga0451853_0587720 | 3300041512 | Bacteria | 2357 |
| 314 | Ga0439432_001119 | 3300042006 | Bacteria | 10187 |
| 315 | Ga0439432_022622 | 3300042006 | Bacteria | 2075 |
| 316 | Ga0439451_003923 | 3300042009 | Bacteria | 3025 |
| 317 | Ga0439452_006659 | 3300042010 | Bacteria | 3601 |
| 318 | Ga0439456_008021 | 3300042013 | Bacteria | 2178 |
| 319 | Ga0450907_000010 | 3300042146 | Bacteria | 95376 |
| 320 | Ga0450908_000273 | 3300042184 | Bacteria | 10186 |
| 321 | Ga0450909_000696 | 3300042185 | Bacteria | 4503 |
| 322 | Ga0451577_0027187 | 3300042876 | Bacteria | 5178 |
| 323 | Ga0466972_0000754 | 3300044658 | Bacteria | 15432 |
| 324 | Ga0453683_0025830 | 3300044673 | Bacteria | 3729 |
| 325 | Ga0453684_0009221 | 3300044712 | Bacteria | 17333 |
| 326 | Ga0466968_0002276 | 3300044735 | Bacteria | 7020 |
| 327 | Ga0451576_0001244 | 3300045051 | Bacteria | 44809 |
| 328 | Ga0495617_000024 | 3300046452 | Bacteria | 174402 |
| 329 | Ga0495617_000054 | 3300046452 | Bacteria | 102256 |
| 330 | Ga0495617_000144 | 3300046452 | Bacteria | 46606 |
| 331 | Ga0495617_000476 | 3300046452 | Bacteria | 21320 |
| 332 | Ga0495627_000120 | 3300046453 | Bacteria | 97375 |
| 333 | Ga0495627_000308 | 3300046453 | Bacteria | 48367 |
| 334 | Ga0495627_012417 | 3300046453 | Bacteria | 3023 |
| 335 | Ga0495592_0011881 | 3300046454 | Bacteria | 6599 |
| 336 | Ga0495603_0001986 | 3300046455 | Bacteria | 12045 |
| 337 | Ga0495590_0000364 | 3300046457 | Bacteria | 23127 |
| 338 | Ga0495590_0001495 | 3300046457 | Bacteria | 10040 |
| 339 | Ga0495590_0005545 | 3300046457 | Bacteria | 4994 |
| 340 | Ga0495591_000064 | 3300046458 | Bacteria | 123820 |
| 341 | Ga0495591_000315 | 3300046458 | Bacteria | 43798 |
| 342 | Ga0495591_001261 | 3300046458 | Bacteria | 16235 |
| 343 | Ga0495591_003301 | 3300046458 | Bacteria | 8429 |
| 344 | Ga0495638_0000363 | 3300046460 | Bacteria | 56118 |
| 345 | Ga0495638_0017737 | 3300046460 | Bacteria | 4740 |
| 346 | Ga0495638_0020356 | 3300046460 | Bacteria | 4384 |
| 347 | Ga0495638_0026643 | 3300046460 | Bacteria | 3746 |
| 348 | Ga0495638_0038691 | 3300046460 | Bacteria | 3029 |
| 349 | Ga0495651_0007096 | 3300046462 | Bacteria | 8562 |
| 350 | Ga0495653_0001170 | 3300046463 | Bacteria | 20256 |
| 351 | Ga0495653_0009203 | 3300046463 | Bacteria | 8078 |
| 352 | Ga0495650_0000557 | 3300046471 | Bacteria | 52926 |
| 353 | Ga0495650_0000881 | 3300046471 | Bacteria | 35559 |
| 354 | Ga0495650_0001501 | 3300046471 | Bacteria | 22235 |
| 355 | Ga0495650_0003204 | 3300046471 | Bacteria | 12176 |
| 356 | Ga0495650_0008186 | 3300046471 | Bacteria | 6144 |
| 357 | Ga0495605_0000057 | 3300046474 | Bacteria | 150333 |
| 358 | Ga0495605_0000191 | 3300046474 | Bacteria | 76513 |
| 359 | Ga0495605_0000794 | 3300046474 | Bacteria | 22656 |
| 360 | Ga0495605_0003323 | 3300046474 | Bacteria | 9622 |
| 361 | Ga0495605_0032845 | 3300046474 | Bacteria | 2639 |
| 362 | Ga0495639_0000032 | 3300046475 | Bacteria | 64548 |
| 363 | Ga0495584_0000409 | 3300046491 | Bacteria | 29687 |
| 364 | Ga0495584_0000547 | 3300046491 | Bacteria | 25497 |
| 365 | Ga0495584_0002662 | 3300046491 | Bacteria | 10055 |
| 366 | Ga0495584_0014174 | 3300046491 | Bacteria | 4062 |
| 367 | Ga0495585_0000082 | 3300046492 | Bacteria | 99210 |
| 368 | Ga0495585_0013643 | 3300046492 | Bacteria | 4751 |
| 369 | Ga0495594_0044447 | 3300046499 | Bacteria | 2436 |
| 370 | Ga0495607_0000008 | 3300046501 | Bacteria | 265274 |
| 371 | Ga0495607_0000058 | 3300046501 | Bacteria | 109864 |
| 372 | Ga0495607_0000185 | 3300046501 | Bacteria | 66759 |
| 373 | Ga0495607_0000266 | 3300046501 | Bacteria | 56114 |
| 374 | Ga0495607_0000290 | 3300046501 | Bacteria | 53251 |
| 375 | Ga0495607_0000617 | 3300046501 | Bacteria | 34500 |
| 376 | Ga0495607_0003284 | 3300046501 | Bacteria | 12430 |
| 377 | Ga0495607_0011010 | 3300046501 | Bacteria | 6043 |
| 378 | Ga0495607_0016974 | 3300046501 | Bacteria | 4686 |
| 379 | Ga0495607_0027186 | 3300046501 | Bacteria | 3542 |
| 380 | Ga0495607_0071375 | 3300046501 | Bacteria | 1936 |
| 381 | Ga0495583_0000483 | 3300046506 | Bacteria | 58302 |
| 382 | Ga0495583_0001110 | 3300046506 | Bacteria | 29768 |
| 383 | Ga0495583_0003663 | 3300046506 | Bacteria | 11448 |
| 384 | Ga0495583_0004945 | 3300046506 | Bacteria | 9256 |
| 385 | Ga0495583_0010911 | 3300046506 | Bacteria | 5249 |
| 386 | Ga0495583_0014279 | 3300046506 | Bacteria | 4389 |
| 387 | Ga0495606_0000136 | 3300046507 | Bacteria | 125611 |
| 388 | Ga0495606_0000633 | 3300046507 | Bacteria | 55270 |
| 389 | Ga0495606_0001206 | 3300046507 | Bacteria | 36344 |
| 390 | Ga0495606_0001286 | 3300046507 | Bacteria | 34779 |
| 391 | Ga0495606_0001714 | 3300046507 | Bacteria | 28242 |
| 392 | Ga0495606_0003155 | 3300046507 | Bacteria | 17833 |
| 393 | Ga0495608_0018050 | 3300046511 | Bacteria | 4874 |
| 394 | Ga0495608_0040254 | 3300046511 | Bacteria | 3131 |
| 395 | Ga0495610_0002898 | 3300046512 | Bacteria | 13883 |
| 396 | Ga0495610_0004604 | 3300046512 | Bacteria | 10105 |
| 397 | Ga0495610_0040400 | 3300046512 | Bacteria | 2351 |
| 398 | Ga0495616_0000003 | 3300046513 | Bacteria | 290178 |
| 399 | Ga0495616_0000226 | 3300046513 | Bacteria | 46396 |
| 400 | Ga0495616_0000661 | 3300046513 | Bacteria | 25616 |
| 401 | Ga0495616_0003952 | 3300046513 | Bacteria | 9441 |
| 402 | Ga0495616_0004101 | 3300046513 | Bacteria | 9238 |
| 403 | Ga0495616_0004782 | 3300046513 | Bacteria | 8483 |
| 404 | Ga0495618_0002091 | 3300046514 | Bacteria | 13092 |
| 405 | Ga0495618_0071780 | 3300046514 | Bacteria | 2203 |
| 406 | Ga0495620_0000102 | 3300046515 | Bacteria | 68028 |
| 407 | Ga0495620_0000166 | 3300046515 | Bacteria | 52419 |
| 408 | Ga0495620_0000537 | 3300046515 | Bacteria | 24263 |
| 409 | Ga0495620_0003457 | 3300046515 | Bacteria | 9035 |
| 410 | Ga0495620_0011683 | 3300046515 | Bacteria | 4569 |
| 411 | Ga0495620_0014405 | 3300046515 | Bacteria | 4019 |
| 412 | Ga0495628_0001001 | 3300046516 | Bacteria | 25857 |
| 413 | Ga0495628_0004631 | 3300046516 | Bacteria | 12146 |
| 414 | Ga0495631_0000267 | 3300046518 | Bacteria | 36464 |
| 415 | Ga0495631_0000489 | 3300046518 | Bacteria | 26545 |
| 416 | Ga0495631_0001295 | 3300046518 | Bacteria | 15349 |
| 417 | Ga0495631_0006742 | 3300046518 | Bacteria | 5895 |
| 418 | Ga0495631_0015307 | 3300046518 | Bacteria | 3677 |
| 419 | Ga0495632_0000008 | 3300046519 | Bacteria | 294056 |
| 420 | Ga0495632_0000754 | 3300046519 | Bacteria | 29135 |
| 421 | Ga0495632_0001740 | 3300046519 | Bacteria | 17652 |
| 422 | Ga0495632_0002380 | 3300046519 | Bacteria | 14374 |
| 423 | Ga0495632_0028117 | 3300046519 | Bacteria | 2937 |
| 424 | Ga0495632_0028591 | 3300046519 | Bacteria | 2908 |
| 425 | Ga0495632_0035967 | 3300046519 | Bacteria | 2522 |
| 426 | Ga0495637_0000037 | 3300046520 | Bacteria | 120732 |
| 427 | Ga0495637_0000977 | 3300046520 | Bacteria | 18146 |
| 428 | Ga0495637_0001374 | 3300046520 | Bacteria | 14567 |
| 429 | Ga0495637_0003424 | 3300046520 | Bacteria | 8427 |
| 430 | Ga0495637_0017095 | 3300046520 | Bacteria | 3386 |
| 431 | Ga0495643_0024936 | 3300046522 | Bacteria | 3388 |
| 432 | Ga0495643_0030373 | 3300046522 | Bacteria | 3017 |
| 433 | Ga0495643_0045146 | 3300046522 | Bacteria | 2393 |
| 434 | Ga0495648_0000194 | 3300046524 | Bacteria | 69964 |
| 435 | Ga0495648_0000377 | 3300046524 | Bacteria | 48820 |
| 436 | Ga0495648_0001717 | 3300046524 | Bacteria | 21157 |
| 437 | Ga0495648_0010178 | 3300046524 | Bacteria | 7188 |
| 438 | Ga0495642_0000316 | 3300046528 | Bacteria | 26656 |
| 439 | Ga0495652_0012335 | 3300046529 | Bacteria | 7714 |
| 440 | Ga0495652_0026645 | 3300046529 | Bacteria | 5104 |
| 441 | Ga0495654_0000211 | 3300046530 | Bacteria | 55188 |
| 442 | Ga0495654_0000288 | 3300046530 | Bacteria | 45799 |
| 443 | Ga0495654_0000306 | 3300046530 | Bacteria | 43427 |
| 444 | Ga0495654_0001477 | 3300046530 | Bacteria | 16099 |
| 445 | Ga0495654_0001887 | 3300046530 | Bacteria | 13935 |
| 446 | Ga0495654_0002069 | 3300046530 | Bacteria | 13171 |
| 447 | Ga0495654_0006785 | 3300046530 | Bacteria | 6465 |
| 448 | Ga0495587_0014470 | 3300046536 | Bacteria | 4946 |
| 449 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 450 | Ga0495609_0000075 | 3300046538 | Bacteria | 121584 |
| 451 | Ga0495609_0001756 | 3300046538 | Bacteria | 13921 |
| 452 | Ga0495645_0008523 | 3300046543 | Bacteria | 7159 |
| 453 | Ga0495645_0025652 | 3300046543 | Bacteria | 4280 |
| 454 | Ga0495622_0000590 | 3300046557 | Bacteria | 21268 |
| 455 | Ga0495622_0001201 | 3300046557 | Bacteria | 13369 |
| 456 | Ga0495622_0001396 | 3300046557 | Bacteria | 12267 |
| 457 | Ga0495668_0005182 | 3300046616 | Bacteria | 8950 |
| 458 | Ga0495634_0000025 | 3300046642 | Bacteria | 115964 |
| 459 | Ga0495611_0000004 | 3300046648 | Bacteria | 308149 |
| 460 | Ga0495611_0000113 | 3300046648 | Bacteria | 56814 |
| 461 | Ga0495611_0000349 | 3300046648 | Bacteria | 30120 |
| 462 | Ga0495625_0000024 | 3300046660 | Bacteria | 271126 |
| 463 | Ga0495625_0000089 | 3300046660 | Bacteria | 147075 |
| 464 | Ga0495625_0000847 | 3300046660 | Bacteria | 41784 |
| 465 | Ga0495625_0009172 | 3300046660 | Bacteria | 8313 |
| 466 | Ga0495635_0000298 | 3300046663 | Bacteria | 31939 |
| 467 | Ga0495659_0000123 | 3300046664 | Bacteria | 33987 |
| 468 | Ga0495661_0000018 | 3300046665 | Bacteria | 200787 |
| 469 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 470 | Ga0495661_0000083 | 3300046665 | Bacteria | 116027 |
| 471 | Ga0495661_0000101 | 3300046665 | Bacteria | 104928 |
| 472 | Ga0495661_0001798 | 3300046665 | Bacteria | 17218 |
| 473 | Ga0495661_0004052 | 3300046665 | Bacteria | 10673 |
| 474 | Ga0495661_0031298 | 3300046665 | Bacteria | 3379 |
| 475 | Ga0495588_0007463 | 3300046674 | Bacteria | 4978 |
| 476 | Ga0495623_0006329 | 3300046679 | Bacteria | 7697 |
| 477 | Ga0495623_0014890 | 3300046679 | Bacteria | 5029 |
| 478 | Ga0495646_0001211 | 3300046680 | Bacteria | 15107 |
| 479 | Ga0495646_0003303 | 3300046680 | Bacteria | 10042 |
| 480 | Ga0495669_0003084 | 3300046684 | Bacteria | 6850 |
| 481 | Ga0495670_0000168 | 3300046691 | Bacteria | 28846 |
| 482 | Ga0495670_0000332 | 3300046691 | Bacteria | 22511 |
| 483 | Ga0495670_0014042 | 3300046691 | Bacteria | 3940 |
| 484 | Ga0495671_0000295 | 3300046692 | Bacteria | 41756 |
| 485 | Ga0495671_0000960 | 3300046692 | Bacteria | 20228 |
| 486 | Ga0495671_0001060 | 3300046692 | Bacteria | 19054 |
| 487 | Ga0495671_0001565 | 3300046692 | Bacteria | 15188 |
| 488 | Ga0495671_0004195 | 3300046692 | Bacteria | 8681 |
| 489 | Ga0495671_0029739 | 3300046692 | Bacteria | 2802 |
| 490 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 491 | Ga0495649_0000909 | 3300046694 | Bacteria | 23449 |
| 492 | Ga0495649_0027968 | 3300046694 | Bacteria | 3126 |
| 493 | Ga0495589_0000038 | 3300046794 | Bacteria | 149381 |
| 494 | Ga0495589_0000141 | 3300046794 | Bacteria | 66457 |
| 495 | Ga0495589_0000846 | 3300046794 | Bacteria | 19210 |
| 496 | Ga0495660_0000052 | 3300046810 | Bacteria | 137821 |
| 497 | Ga0495660_0000064 | 3300046810 | Bacteria | 124968 |
| 498 | Ga0495660_0003252 | 3300046810 | Bacteria | 10096 |
| 499 | Ga0495581_0013045 | 3300047315 | Bacteria | 4816 |
| 500 | Ga0495604_0002087 | 3300047317 | Bacteria | 16085 |
| 501 | Ga0495604_0002922 | 3300047317 | Bacteria | 13682 |
| 502 | Ga0495636_0002282 | 3300047318 | Bacteria | 7363 |
| 503 | Ga0495674_0054405 | 3300047319 | Bacteria | 3515 |
| 504 | Ga0495672_0000419 | 3300047320 | Bacteria | 51114 |
| 505 | Ga0495672_0001510 | 3300047320 | Bacteria | 22783 |
| 506 | Ga0495672_0003661 | 3300047320 | Bacteria | 13008 |
| 507 | Ga0495672_0013150 | 3300047320 | Bacteria | 5723 |
| 508 | Ga0495676_0000020 | 3300047321 | Bacteria | 166813 |
| 509 | Ga0495680_0047968 | 3300047322 | Bacteria | 3356 |
| 510 | Ga0495683_0000482 | 3300047323 | Bacteria | 30948 |
| 511 | Ga0495683_0031829 | 3300047323 | Bacteria | 2687 |
| 512 | Ga0495687_000715 | 3300047443 | Bacteria | 36786 |
| 513 | Ga0495687_001973 | 3300047443 | Bacteria | 17494 |
| 514 | Ga0495687_004068 | 3300047443 | Bacteria | 10135 |
| 515 | Ga0495687_009189 | 3300047443 | Bacteria | 5558 |
| 516 | Ga0495675_0019279 | 3300047444 | Bacteria | 4333 |
| 517 | Ga0495679_000011 | 3300047446 | Bacteria | 324498 |
| 518 | Ga0495679_000079 | 3300047446 | Bacteria | 90806 |
| 519 | Ga0495679_000711 | 3300047446 | Bacteria | 21533 |
| 520 | Ga0495679_004366 | 3300047446 | Bacteria | 6553 |
| 521 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 522 | Ga0495673_0000101 | 3300047469 | Bacteria | 173409 |
| 523 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 524 | Ga0495673_0000421 | 3300047469 | Bacteria | 48148 |
| 525 | Ga0495673_0000833 | 3300047469 | Bacteria | 28784 |
| 526 | Ga0495673_0002842 | 3300047469 | Bacteria | 11791 |
| 527 | Ga0495673_0004301 | 3300047469 | Bacteria | 8971 |
| 528 | Ga0495673_0012840 | 3300047469 | Bacteria | 4419 |
| 529 | Ga0495673_0017156 | 3300047469 | Bacteria | 3684 |
| 530 | Ga0495673_0018027 | 3300047469 | Bacteria | 3570 |
| 531 | Ga0495673_0031214 | 3300047469 | Bacteria | 2496 |
| 532 | Ga0495681_0000027 | 3300047470 | Bacteria | 141884 |
| 533 | Ga0495681_0000237 | 3300047470 | Bacteria | 45823 |
| 534 | Ga0495686_0001651 | 3300047472 | Bacteria | 23245 |
| 535 | Ga0495593_0000310 | 3300047673 | Bacteria | 26732 |
| 536 | Ga0495593_0008619 | 3300047673 | Bacteria | 5928 |
| 537 | Ga0495626_0000041 | 3300048091 | Bacteria | 172663 |
| 538 | Ga0495626_0000352 | 3300048091 | Bacteria | 48007 |
| 539 | Ga0495626_0000583 | 3300048091 | Bacteria | 36143 |
| 540 | Ga0496101_0015206 | 3300048904 | Bacteria | 5180 |
| 541 | Ga0496102_0000038 | 3300048905 | Bacteria | 198844 |
| 542 | Ga0496102_0001378 | 3300048905 | Bacteria | 21651 |
| 543 | Ga0496102_0006765 | 3300048905 | Bacteria | 9786 |
| 544 | Ga0496104_0018269 | 3300048907 | Bacteria | 6397 |
| 545 | Ga0496106_0000402 | 3300048909 | Bacteria | 30717 |
| 546 | Ga0496109_0077812 | 3300048912 | Bacteria | 3053 |
| 547 | Ga0496110_0012406 | 3300048913 | Bacteria | 7006 |
| 548 | Ga0496114_0080632 | 3300048917 | Bacteria | 2749 |
| 549 | Ga0496116_0000221 | 3300048919 | Bacteria | 106314 |
| 550 | Ga0496116_0000984 | 3300048919 | Bacteria | 34981 |
| 551 | Ga0496116_0010423 | 3300048919 | Bacteria | 7787 |
| 552 | Ga0496116_0031228 | 3300048919 | Bacteria | 3817 |
| 553 | Ga0496116_0043318 | 3300048919 | Bacteria | 3068 |
| 554 | Ga0496117_0000090 | 3300048920 | Bacteria | 206388 |
| 555 | Ga0496117_0001257 | 3300048920 | Bacteria | 37760 |
| 556 | Ga0496117_0007657 | 3300048920 | Bacteria | 10465 |
| 557 | Ga0496117_0046008 | 3300048920 | Bacteria | 3144 |
| 558 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 559 | Ga0496118_0001081 | 3300048921 | Bacteria | 42396 |
| 560 | Ga0496118_0008451 | 3300048921 | Bacteria | 10640 |
| 561 | Ga0496118_0019747 | 3300048921 | Bacteria | 6009 |
| 562 | Ga0496118_0028393 | 3300048921 | Bacteria | 4712 |
| 563 | Ga0496119_0012436 | 3300048922 | Bacteria | 6912 |
| 564 | Ga0496119_0018617 | 3300048922 | Bacteria | 5159 |
| 565 | Ga0496119_0047360 | 3300048922 | Bacteria | 2675 |
| 566 | Ga0496120_0005377 | 3300048923 | Bacteria | 10235 |
| 567 | Ga0496121_0000071 | 3300048924 | Bacteria | 247039 |
| 568 | Ga0496121_0000307 | 3300048924 | Bacteria | 101849 |
| 569 | Ga0496121_0004753 | 3300048924 | Bacteria | 17930 |
| 570 | Ga0496121_0005910 | 3300048924 | Bacteria | 15484 |
| 571 | Ga0496121_0015170 | 3300048924 | Bacteria | 8102 |
| 572 | Ga0496121_0018989 | 3300048924 | Bacteria | 6897 |
| 573 | Ga0496121_0044422 | 3300048924 | Bacteria | 3832 |
| 574 | Ga0496122_0000285 | 3300048925 | Bacteria | 113073 |
| 575 | Ga0496122_0001763 | 3300048925 | Bacteria | 33210 |
| 576 | Ga0496122_0010175 | 3300048925 | Bacteria | 9746 |
| 577 | Ga0496123_0000232 | 3300048926 | Bacteria | 113073 |
| 578 | Ga0496124_0001091 | 3300048927 | Bacteria | 42641 |
| 579 | Ga0496124_0003813 | 3300048927 | Bacteria | 18088 |
| 580 | Ga0496124_0003909 | 3300048927 | Bacteria | 17810 |
| 581 | Ga0496124_0045951 | 3300048927 | Bacteria | 3741 |
| 582 | Ga0496124_0058092 | 3300048927 | Bacteria | 3255 |
| 583 | Ga0496125_0003672 | 3300048928 | Bacteria | 18339 |
| 584 | Ga0496125_0007498 | 3300048928 | Bacteria | 11600 |
| 585 | Ga0496125_0011347 | 3300048928 | Bacteria | 8921 |
| 586 | Ga0496125_0056129 | 3300048928 | Bacteria | 3201 |
| 587 | Ga0496126_0082985 | 3300048929 | Bacteria | 2829 |
| 588 | Ga0495678_000062 | 3300049459 | Bacteria | 140706 |
| 589 | Ga0495678_000724 | 3300049459 | Bacteria | 29966 |
| 590 | Ga0495678_001110 | 3300049459 | Bacteria | 22429 |
| 591 | Ga0495678_002200 | 3300049459 | Bacteria | 13669 |
| 592 | Ga0495678_003441 | 3300049459 | Bacteria | 9806 |
| 593 | Ga0495678_007111 | 3300049459 | Bacteria | 5850 |
| 594 | Ga0495678_035745 | 3300049459 | Bacteria | 2033 |
| 595 | Ga0495682_0000020 | 3300049460 | Bacteria | 210849 |
| 596 | Ga0495682_0000065 | 3300049460 | Bacteria | 98530 |
| 597 | Ga0495682_0001332 | 3300049460 | Bacteria | 13685 |
| 598 | Ga0495682_0001951 | 3300049460 | Bacteria | 10223 |
| 599 | Ga0501033_0001677 | 3300049570 | Bacteria | 19371 |
| 600 | Ga0501037_0001520 | 3300049573 | Bacteria | 16925 |
| 601 | Ga0501038_0013715 | 3300049574 | Bacteria | 7388 |
| 602 | Ga0501038_0038734 | 3300049574 | Bacteria | 4172 |
| 603 | Ga0501043_0006058 | 3300049579 | Bacteria | 9717 |
| 604 | Ga0501043_0018299 | 3300049579 | Bacteria | 5494 |
| 605 | Ga0501046_0000935 | 3300049580 | Bacteria | 28596 |
| 606 | Ga0501047_0015518 | 3300049581 | Bacteria | 7257 |
| 607 | Ga0501048_0020942 | 3300049582 | Bacteria | 4790 |
| 608 | Ga0501067_0014551 | 3300049583 | Bacteria | 4356 |
| 609 | Ga0501070_0139977 | 3300049586 | Bacteria | 1998 |
| 610 | Ga0501073_0003385 | 3300049589 | Bacteria | 11988 |
| 611 | Ga0501074_0030331 | 3300049590 | Bacteria | 3919 |
| 612 | Ga0501077_0004582 | 3300049593 | Bacteria | 8398 |
| 613 | Ga0501079_0009603 | 3300049741 | Bacteria | 7336 |
| 614 | Ga0501080_0011968 | 3300049742 | Bacteria | 7947 |
| 615 | Ga0501080_0042311 | 3300049742 | Bacteria | 4242 |
| 616 | Ga0501081_0007747 | 3300049743 | Bacteria | 6962 |
| 617 | Ga0501083_0001250 | 3300049744 | Bacteria | 17258 |
| 618 | Ga0501083_0029113 | 3300049744 | Bacteria | 3802 |
| 619 | Ga0501083_0068523 | 3300049744 | Bacteria | 2361 |
| 620 | Ga0501083_0074209 | 3300049744 | Bacteria | 2260 |
| 621 | Ga0501035_0024051 | 3300049822 | Bacteria | 5589 |
| 622 | Ga0501035_0024682 | 3300049822 | Bacteria | 5511 |
| 623 | Ga0501035_0105841 | 3300049822 | Bacteria | 2466 |
| 624 | Ga0501044_0044309 | 3300049823 | Bacteria | 4616 |
| 625 | nmdc:mga0qj67_12876_c1 | 3300050509 | Bacteria | 6312 |
| 626 | nmdc:mga0n895_138900_c1 | 3300050512 | Bacteria | 2457 |
| 627 | Ga0495601_0008699 | 3300053077 | Bacteria | 5991 |
| 628 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 629 | Ga0500646_0009564 | 3300053090 | Bacteria | 2482 |
| 630 | Ga0500651_0016231 | 3300053093 | Bacteria | 4579 |
| 631 | Ga0500555_000233 | 3300053103 | Bacteria | 24816 |
| 632 | Ga0500595_014824 | 3300053119 | Bacteria | 2946 |
| 633 | Ga0500595_023197 | 3300053119 | Bacteria | 2184 |
| 634 | Ga0500642_0006822 | 3300053130 | Bacteria | 3792 |
| 635 | Ga0500658_0005620 | 3300053134 | Bacteria | 4665 |
| 636 | Ga0500574_001090 | 3300053141 | Bacteria | 3852 |
| 637 | Ga0500616_0000708 | 3300053153 | Bacteria | 38639 |
| 638 | Ga0500619_000066 | 3300053154 | Bacteria | 31862 |
| 639 | Ga0500633_0001497 | 3300053160 | Bacteria | 4432 |
| 640 | Ga0500645_000884 | 3300053730 | Bacteria | 17419 |
| 641 | Ga0500609_000357 | 3300053731 | Bacteria | 6761 |
| 642 | Ga0501084_0070918 | 3300054114 | Bacteria | 2917 |
| 643 | Ga0501082_0008394 | 3300060353 | Bacteria | 8909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0139977 | Ga0501070_0139977_24_1622 | 518 |
| 2 | 3300049744 | Ga0501083_0074209 | Ga0501083_0074209_29_1627 | 518 |
| 3 | 3300031548 | Ga0307408_100046021 | Ga0307408_1000460212 | 562 |
| 4 | 3300032004 | Ga0307414_10037648 | Ga0307414_100376482 | 562 |
| 5 | 3300032005 | Ga0307411_10032964 | Ga0307411_100329642 | 562 |
| 6 | 3300046665 | Ga0495661_0004052 | Ga0495661_0004052_20_1744 | 563 |
| 7 | 3300032126 | Ga0307415_100009328 | Ga0307415_1000093282 | 564 |
| 8 | 3300046514 | Ga0495618_0071780 | Ga0495618_0071780_444_2177 | 566 |
| 9 | 3300049744 | Ga0501083_0068523 | Ga0501083_0068523_586_2328 | 567 |
| 10 | 3300048929 | Ga0496126_0082985 | Ga0496126_0082985_1051_2799 | 570 |
| 11 | 3300048922 | Ga0496119_0047360 | Ga0496119_0047360_904_2655 | 571 |
| 12 | 3300042013 | Ga0439456_008021 | Ga0439456_008021_402_2153 | 575 |
| 13 | 3300036401 | Ga0373937_0190751 | Ga0373937_0190751_168_1913 | 579 |
| 14 | 3300046680 | Ga0495646_0001211 | Ga0495646_0001211_13306_15078 | 579 |
| 15 | 3300046501 | Ga0495607_0071375 | Ga0495607_0071375_127_1908 | 580 |
| 16 | 3300031824 | Ga0307413_10016640 | Ga0307413_100166403 | 597 |
| 17 | 3300046453 | Ga0495627_000120 | Ga0495627_000120_10150_12033 | 600 |
| 18 | 3300032005 | Ga0307411_10040216 | Ga0307411_100402162 | 603 |
| 19 | 3300048905 | Ga0496102_0006765 | Ga0496102_0006765_3990_5885 | 603 |
| 20 | 3300048917 | Ga0496114_0080632 | Ga0496114_0080632_502_2397 | 603 |
| 21 | 3300048919 | Ga0496116_0031228 | Ga0496116_0031228_29_1924 | 603 |
| 22 | 3300048920 | Ga0496117_0000090 | Ga0496117_0000090_108530_110425 | 603 |
| 23 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_94612_96507 | 603 |
| 24 | 3300048923 | Ga0496120_0005377 | Ga0496120_0005377_3524_5419 | 603 |
| 25 | 3300049743 | Ga0501081_0007747 | Ga0501081_0007747_820_2742 | 605 |
| 26 | 3300031824 | Ga0307413_10000598 | Ga0307413_100005989 | 607 |
| 27 | 3300031852 | Ga0307410_10034585 | Ga0307410_100345852 | 607 |
| 28 | 3300031995 | Ga0307409_100011807 | Ga0307409_1000118074 | 607 |
| 29 | 3300032004 | Ga0307414_10000718 | Ga0307414_100007187 | 607 |
| 30 | 3300050509 | nmdc:mga0qj67_12876_c1 | nmdc:mga0qj67_12876_c1_2040_3953 | 608 |
| 31 | 3300031731 | Ga0307405_10014951 | Ga0307405_100149512 | 610 |
| 32 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006206 | 610 |
| 33 | 3300046501 | Ga0495607_0027186 | Ga0495607_0027186_638_2509 | 610 |
| 34 | 3300046557 | Ga0495622_0001396 | Ga0495622_0001396_1035_2906 | 611 |
| 35 | 3300046674 | Ga0495588_0007463 | Ga0495588_0007463_1387_3258 | 611 |
| 36 | 3300047469 | Ga0495673_0004301 | Ga0495673_0004301_4780_6651 | 611 |
| 37 | 3300048922 | Ga0496119_0012436 | Ga0496119_0012436_581_2476 | 611 |
| 38 | 3300048928 | Ga0496125_0007498 | Ga0496125_0007498_4794_6689 | 611 |
| 39 | 3300046452 | Ga0495617_000024 | Ga0495617_000024_87255_89159 | 613 |
| 40 | 3300046515 | Ga0495620_0000102 | Ga0495620_0000102_65945_67849 | 613 |
| 41 | 3300046518 | Ga0495631_0000489 | Ga0495631_0000489_15330_17270 | 618 |
| 42 | 3300046530 | Ga0495654_0001477 | Ga0495654_0001477_5037_6977 | 618 |
| 43 | 3300047320 | Ga0495672_0003661 | Ga0495672_0003661_9940_11880 | 618 |
| 44 | 3300050512 | nmdc:mga0n895_138900_c1 | nmdc:mga0n895_138900_c1_215_2128 | 618 |
| 45 | 3300015261 | Ga0182006_1000034 | Ga0182006_10000342 | 621 |
| 46 | 3300046616 | Ga0495668_0005182 | Ga0495668_0005182_2901_4829 | 621 |
| 47 | 3300046692 | Ga0495671_0001565 | Ga0495671_0001565_6170_8110 | 621 |
| 48 | 3300046810 | Ga0495660_0000052 | Ga0495660_0000052_14335_16263 | 621 |
| 49 | 3300047469 | Ga0495673_0000036 | Ga0495673_0000036_173779_175707 | 621 |
| 50 | 3300032005 | Ga0307411_10007373 | Ga0307411_100073733 | 623 |
| 51 | 3300047446 | Ga0495679_004366 | Ga0495679_004366_4635_6539 | 623 |
| 52 | 3300005985 | Ga0081539_10001562 | Ga0081539_1000156218 | 625 |
| 53 | 3300031824 | Ga0307413_10025758 | Ga0307413_100257583 | 625 |
| 54 | 3300032005 | Ga0307411_10025119 | Ga0307411_100251192 | 625 |
| 55 | 3300005548 | Ga0070665_100045492 | Ga0070665_1000454922 | 626 |
| 56 | 3300005981 | Ga0081538_10012237 | Ga0081538_100122376 | 626 |
| 57 | 3300009093 | Ga0105240_10006631 | Ga0105240_100066317 | 627 |
| 58 | 3300025304 | Ga0209257_1001804 | Ga0209257_10018047 | 627 |
| 59 | 3300025913 | Ga0207695_10000961 | Ga0207695_1000096148 | 627 |
| 60 | 3300049574 | Ga0501038_0038734 | Ga0501038_0038734_1160_3106 | 627 |
| 61 | 3300049822 | Ga0501035_0024682 | Ga0501035_0024682_729_2675 | 627 |
| 62 | 3300049822 | Ga0501035_0105841 | Ga0501035_0105841_435_2381 | 627 |
| 63 | 3300005262 | Ga0065165_1004047 | Ga0065165_10040472 | 628 |
| 64 | 3300009177 | Ga0105248_10001036 | Ga0105248_1000103620 | 628 |
| 65 | 3300025941 | Ga0207711_10000819 | Ga0207711_1000081920 | 628 |
| 66 | 3300044735 | Ga0466968_0002276 | Ga0466968_0002276_4091_6016 | 628 |
| 67 | iso_pu_bacteria | 2928157003 | 2928163785 | 628 |
| 68 | iso_pu_bacteria | 2928163908 | 2928164783 | 628 |
| 69 | 3300015261 | Ga0182006_1005976 | Ga0182006_10059762 | 629 |
| 70 | 3300015265 | Ga0182005_1000613 | Ga0182005_10006139 | 629 |
| 71 | 3300041404 | Ga0439436_0000015 | Ga0439436_0000015_30079_32004 | 629 |
| 72 | 3300042184 | Ga0450908_000273 | Ga0450908_000273_7069_8997 | 629 |
| 73 | 3300046512 | Ga0495610_0004604 | Ga0495610_0004604_5337_7262 | 629 |
| 74 | 3300046519 | Ga0495632_0000008 | Ga0495632_0000008_49583_51511 | 629 |
| 75 | 3300046691 | Ga0495670_0000168 | Ga0495670_0000168_8263_10188 | 629 |
| 76 | 3300047444 | Ga0495675_0019279 | Ga0495675_0019279_758_2689 | 630 |
| 77 | 3300047673 | Ga0495593_0000310 | Ga0495593_0000310_13454_15385 | 630 |
| 78 | 3300053090 | Ga0500646_0009564 | Ga0500646_0009564_306_2258 | 630 |
| 79 | iso_pu_bacteria | 2919534386 | 2919537665 | 630 |
| 80 | 3300005290 | Ga0065712_10079941 | Ga0065712_100799412 | 631 |
| 81 | 3300025913 | Ga0207695_10018930 | Ga0207695_100189303 | 631 |
| 82 | 3300046530 | Ga0495654_0000211 | Ga0495654_0000211_198_2093 | 631 |
| 83 | iso_pu_bacteria | 2519103095 | 2519458507 | 631 |
| 84 | iso_pu_bacteria | 2582581311 | 2585292913 | 631 |
| 85 | iso_pu_bacteria | 2816332253 | 2817260731 | 631 |
| 86 | iso_pu_bacteria | 2816332256 | 2817278369 | 631 |
| 87 | iso_pu_bacteria | 2816332286 | 2817456345 | 631 |
| 88 | iso_pu_bacteria | 2863421361 | 2863427689 | 631 |
| 89 | iso_pu_bacteria | 2904564687 | 2904571166 | 631 |
| 90 | iso_pu_bacteria | 2904571731 | 2904578259 | 631 |
| 91 | iso_pu_bacteria | 2928536128 | 2928540947 | 631 |
| 92 | iso_pu_bacteria | 2981990288 | 2981996350 | 631 |
| 93 | iso_pu_bacteria | 641736154 | 642417896 | 631 |
| 94 | iso_pu_bacteria | 8020807995 | 8020813696 | 631 |
| 95 | iso_pu_bacteria | 8020938398 | 8020942295 | 631 |
| 96 | iso_pu_bacteria | 8020953355 | 8020958152 | 631 |
| 97 | iso_pu_bacteria | 8039098773 | 8039104026 | 631 |
| 98 | iso_pu_bacteria | 8040167225 | 8040171624 | 631 |
| 99 | iso_pu_bacteria | 8040173305 | 8040177825 | 631 |
| 100 | 3300046530 | Ga0495654_0002069 | Ga0495654_0002069_11256_13154 | 632 |
| 101 | 3300046665 | Ga0495661_0000028 | Ga0495661_0000028_105644_107545 | 632 |
| 102 | iso_pu_bacteria | 2599185239 | 2599737440 | 632 |
| 103 | iso_pu_bacteria | 2599185240 | 2599748709 | 632 |
| 104 | iso_pu_bacteria | 2599185355 | 2600210620 | 632 |
| 105 | iso_pu_bacteria | 2675903129 | 2676746870 | 632 |
| 106 | iso_pu_bacteria | 2818991452 | 2819637154 | 632 |
| 107 | iso_pu_bacteria | 2870068957 | 2870071797 | 632 |
| 108 | iso_pu_bacteria | 2928170801 | 2928172973 | 632 |
| 109 | iso_pu_bacteria | 8018845410 | 8018845715 | 632 |
| 110 | iso_pu_bacteria | 8020945358 | 8020947519 | 632 |
| 111 | iso_pu_bacteria | 8021120328 | 8021124133 | 632 |
| 112 | 3300005844 | Ga0068862_100005745 | Ga0068862_10000574510 | 633 |
| 113 | 3300009093 | Ga0105240_10027693 | Ga0105240_100276933 | 633 |
| 114 | 3300025258 | Ga0209129_1001032 | Ga0209129_10010328 | 633 |
| 115 | 3300025913 | Ga0207695_10103482 | Ga0207695_101034822 | 633 |
| 116 | 3300031824 | Ga0307413_10000009 | Ga0307413_1000000935 | 633 |
| 117 | 3300031852 | Ga0307410_10000430 | Ga0307410_100004304 | 633 |
| 118 | 3300032005 | Ga0307411_10000058 | Ga0307411_1000005821 | 633 |
| 119 | 3300048904 | Ga0496101_0015206 | Ga0496101_0015206_1112_3121 | 633 |
| 120 | 3300049570 | Ga0501033_0001677 | Ga0501033_0001677_3379_5289 | 633 |
| 121 | 3300049573 | Ga0501037_0001520 | Ga0501037_0001520_4310_6220 | 633 |
| 122 | 3300049574 | Ga0501038_0013715 | Ga0501038_0013715_801_2711 | 633 |
| 123 | 3300049579 | Ga0501043_0006058 | Ga0501043_0006058_4556_6466 | 633 |
| 124 | 3300049580 | Ga0501046_0000935 | Ga0501046_0000935_16915_18825 | 633 |
| 125 | 3300049582 | Ga0501048_0020942 | Ga0501048_0020942_2318_4228 | 633 |
| 126 | 3300049583 | Ga0501067_0014551 | Ga0501067_0014551_646_2556 | 633 |
| 127 | 3300049589 | Ga0501073_0003385 | Ga0501073_0003385_5075_7018 | 633 |
| 128 | 3300049590 | Ga0501074_0030331 | Ga0501074_0030331_256_2166 | 633 |
| 129 | 3300049593 | Ga0501077_0004582 | Ga0501077_0004582_3748_5691 | 633 |
| 130 | 3300049741 | Ga0501079_0009603 | Ga0501079_0009603_3162_5105 | 633 |
| 131 | 3300049742 | Ga0501080_0011968 | Ga0501080_0011968_391_2334 | 633 |
| 132 | 3300049744 | Ga0501083_0001250 | Ga0501083_0001250_5776_7686 | 633 |
| 133 | 3300049822 | Ga0501035_0024051 | Ga0501035_0024051_2194_4104 | 633 |
| 134 | 3300049823 | Ga0501044_0044309 | Ga0501044_0044309_2656_4566 | 633 |
| 135 | 3300053134 | Ga0500658_0005620 | Ga0500658_0005620_2520_4430 | 633 |
| 136 | 3300053153 | Ga0500616_0000708 | Ga0500616_0000708_36654_38564 | 633 |
| 137 | 3300054114 | Ga0501084_0070918 | Ga0501084_0070918_664_2607 | 633 |
| 138 | 3300060353 | Ga0501082_0008394 | Ga0501082_0008394_4570_6480 | 633 |
| 139 | iso_pu_bacteria | 2585428062 | 2587756688 | 633 |
| 140 | 3300003215 | JGI25153J46596_10000149 | JGI25153J46596_1000014954 | 634 |
| 141 | 3300003760 | Ga0055527_1000781 | Ga0055527_10007816 | 634 |
| 142 | 3300003761 | Ga0055535_1001921 | Ga0055535_10019216 | 634 |
| 143 | 3300003761 | Ga0055535_1001925 | Ga0055535_10019256 | 634 |
| 144 | 3300003762 | Ga0055542_1001738 | Ga0055542_10017386 | 634 |
| 145 | 3300003762 | Ga0055542_1003477 | Ga0055542_10034772 | 634 |
| 146 | 3300003763 | Ga0055529_1000493 | Ga0055529_100049316 | 634 |
| 147 | 3300005327 | Ga0070658_10007195 | Ga0070658_100071955 | 634 |
| 148 | 3300005339 | Ga0070660_100000080 | Ga0070660_10000008042 | 634 |
| 149 | 3300005344 | Ga0070661_100000399 | Ga0070661_10000039924 | 634 |
| 150 | 3300005347 | Ga0070668_100048034 | Ga0070668_1000480341 | 634 |
| 151 | 3300005366 | Ga0070659_100000068 | Ga0070659_10000006830 | 634 |
| 152 | 3300005564 | Ga0070664_100000824 | Ga0070664_10000082412 | 634 |
| 153 | 3300009036 | Ga0105244_10002323 | Ga0105244_100023232 | 634 |
| 154 | 3300009093 | Ga0105240_10022023 | Ga0105240_100220231 | 634 |
| 155 | 3300009101 | Ga0105247_10000745 | Ga0105247_100007454 | 634 |
| 156 | 3300009176 | Ga0105242_10004232 | Ga0105242_100042326 | 634 |
| 157 | 3300009545 | Ga0105237_10001264 | Ga0105237_1000126424 | 634 |
| 158 | 3300009551 | Ga0105238_10001781 | Ga0105238_1000178111 | 634 |
| 159 | 3300010375 | Ga0105239_10013785 | Ga0105239_100137852 | 634 |
| 160 | 3300013100 | Ga0157373_10011579 | Ga0157373_100115795 | 634 |
| 161 | 3300013104 | Ga0157370_10101181 | Ga0157370_101011812 | 634 |
| 162 | 3300013105 | Ga0157369_10040412 | Ga0157369_100404123 | 634 |
| 163 | 3300015262 | Ga0182007_10005023 | Ga0182007_100050233 | 634 |
| 164 | 3300015265 | Ga0182005_1004528 | Ga0182005_10045284 | 634 |
| 165 | 3300025228 | Ga0209672_100019 | Ga0209672_10001945 | 634 |
| 166 | 3300025228 | Ga0209672_100065 | Ga0209672_10006561 | 634 |
| 167 | 3300025229 | Ga0209147_100026 | Ga0209147_10002645 | 634 |
| 168 | 3300025229 | Ga0209147_100180 | Ga0209147_10018016 | 634 |
| 169 | 3300025242 | Ga0209258_100031 | Ga0209258_10003161 | 634 |
| 170 | 3300025242 | Ga0209258_100079 | Ga0209258_100079193 | 634 |
| 171 | 3300025254 | Ga0209148_1000027 | Ga0209148_100002761 | 634 |
| 172 | 3300025254 | Ga0209148_1001323 | Ga0209148_10013236 | 634 |
| 173 | 3300025272 | Ga0209455_1000058 | Ga0209455_100005819 | 634 |
| 174 | 3300025272 | Ga0209455_1001897 | Ga0209455_10018976 | 634 |
| 175 | 3300025273 | Ga0209673_1000420 | Ga0209673_100042026 | 634 |
| 176 | 3300025295 | Ga0209564_1011024 | Ga0209564_10110243 | 634 |
| 177 | 3300025297 | Ga0209758_1000060 | Ga0209758_1000060323 | 634 |
| 178 | 3300025728 | Ga0207655_1000137 | Ga0207655_1000137109 | 634 |
| 179 | 3300025904 | Ga0207647_10009895 | Ga0207647_100098953 | 634 |
| 180 | 3300025914 | Ga0207671_10000394 | Ga0207671_1000039424 | 634 |
| 181 | 3300025919 | Ga0207657_10000494 | Ga0207657_1000049430 | 634 |
| 182 | 3300025920 | Ga0207649_10000251 | Ga0207649_1000025124 | 634 |
| 183 | 3300025932 | Ga0207690_10000026 | Ga0207690_10000026133 | 634 |
| 184 | 3300025945 | Ga0207679_10000016 | Ga0207679_1000001624 | 634 |
| 185 | 3300025949 | Ga0207667_10025283 | Ga0207667_100252834 | 634 |
| 186 | 3300026067 | Ga0207678_10001257 | Ga0207678_100012572 | 634 |
| 187 | 3300026089 | Ga0207648_10077781 | Ga0207648_100777812 | 634 |
| 188 | 3300026121 | Ga0207683_10036062 | Ga0207683_100360623 | 634 |
| 189 | 3300027312 | Ga0209371_1000858 | Ga0209371_10008586 | 634 |
| 190 | 3300030500 | Ga0268256_1000477 | Ga0268256_100047726 | 634 |
| 191 | 3300042006 | Ga0439432_001119 | Ga0439432_001119_5980_7917 | 634 |
| 192 | 3300042876 | Ga0451577_0027187 | Ga0451577_0027187_234_2174 | 634 |
| 193 | 3300044673 | Ga0453683_0025830 | Ga0453683_0025830_434_2374 | 634 |
| 194 | 3300044712 | Ga0453684_0009221 | Ga0453684_0009221_8475_10415 | 634 |
| 195 | 3300045051 | Ga0451576_0001244 | Ga0451576_0001244_22553_24493 | 634 |
| 196 | 3300046452 | Ga0495617_000476 | Ga0495617_000476_3390_5360 | 634 |
| 197 | 3300046460 | Ga0495638_0000363 | Ga0495638_0000363_28240_30210 | 634 |
| 198 | 3300046460 | Ga0495638_0020356 | Ga0495638_0020356_1919_3889 | 634 |
| 199 | 3300046471 | Ga0495650_0008186 | Ga0495650_0008186_2266_4236 | 634 |
| 200 | 3300046492 | Ga0495585_0000082 | Ga0495585_0000082_7314_9284 | 634 |
| 201 | 3300046507 | Ga0495606_0000136 | Ga0495606_0000136_55837_57807 | 634 |
| 202 | 3300046507 | Ga0495606_0001286 | Ga0495606_0001286_1113_3083 | 634 |
| 203 | 3300046512 | Ga0495610_0002898 | Ga0495610_0002898_8400_10337 | 634 |
| 204 | 3300046512 | Ga0495610_0040400 | Ga0495610_0040400_245_2215 | 634 |
| 205 | 3300046513 | Ga0495616_0000003 | Ga0495616_0000003_125252_127222 | 634 |
| 206 | 3300046513 | Ga0495616_0004101 | Ga0495616_0004101_3029_4999 | 634 |
| 207 | 3300046515 | Ga0495620_0003457 | Ga0495620_0003457_3329_5299 | 634 |
| 208 | 3300046518 | Ga0495631_0000267 | Ga0495631_0000267_27334_29304 | 634 |
| 209 | 3300046518 | Ga0495631_0001295 | Ga0495631_0001295_7192_9162 | 634 |
| 210 | 3300046519 | Ga0495632_0028591 | Ga0495632_0028591_817_2787 | 634 |
| 211 | 3300046519 | Ga0495632_0035967 | Ga0495632_0035967_52_2022 | 634 |
| 212 | 3300046522 | Ga0495643_0045146 | Ga0495643_0045146_214_2184 | 634 |
| 213 | 3300046524 | Ga0495648_0000194 | Ga0495648_0000194_60761_62731 | 634 |
| 214 | 3300046648 | Ga0495611_0000004 | Ga0495611_0000004_142470_144440 | 634 |
| 215 | 3300046648 | Ga0495611_0000113 | Ga0495611_0000113_27429_29399 | 634 |
| 216 | 3300046660 | Ga0495625_0000024 | Ga0495625_0000024_105469_107439 | 634 |
| 217 | 3300046665 | Ga0495661_0001798 | Ga0495661_0001798_894_2864 | 634 |
| 218 | 3300046691 | Ga0495670_0014042 | Ga0495670_0014042_789_2759 | 634 |
| 219 | 3300046692 | Ga0495671_0004195 | Ga0495671_0004195_2448_4418 | 634 |
| 220 | 3300046794 | Ga0495589_0000038 | Ga0495589_0000038_16384_18354 | 634 |
| 221 | 3300046810 | Ga0495660_0000064 | Ga0495660_0000064_14340_16310 | 634 |
| 222 | 3300047323 | Ga0495683_0000482 | Ga0495683_0000482_10894_12864 | 634 |
| 223 | 3300047446 | Ga0495679_000011 | Ga0495679_000011_165522_167492 | 634 |
| 224 | 3300047469 | Ga0495673_0000101 | Ga0495673_0000101_27556_29526 | 634 |
| 225 | 3300047469 | Ga0495673_0018027 | Ga0495673_0018027_1233_3203 | 634 |
| 226 | 3300047673 | Ga0495593_0008619 | Ga0495593_0008619_24_1928 | 634 |
| 227 | 3300048907 | Ga0496104_0018269 | Ga0496104_0018269_2972_4945 | 634 |
| 228 | 3300048909 | Ga0496106_0000402 | Ga0496106_0000402_10165_12135 | 634 |
| 229 | 3300048924 | Ga0496121_0015170 | Ga0496121_0015170_19_1989 | 634 |
| 230 | 3300048924 | Ga0496121_0044422 | Ga0496121_0044422_66_2036 | 634 |
| 231 | 3300048928 | Ga0496125_0011347 | Ga0496125_0011347_914_2818 | 634 |
| 232 | 3300048928 | Ga0496125_0056129 | Ga0496125_0056129_400_2337 | 634 |
| 233 | 3300049459 | Ga0495678_000062 | Ga0495678_000062_130583_132553 | 634 |
| 234 | 3300049460 | Ga0495682_0001332 | Ga0495682_0001332_6954_8924 | 634 |
| 235 | 3300053087 | Ga0500643_000012 | Ga0500643_000012_142276_144246 | 634 |
| 236 | 3300053103 | Ga0500555_000233 | Ga0500555_000233_6742_8712 | 634 |
| 237 | 3300053160 | Ga0500633_0001497 | Ga0500633_0001497_1679_3649 | 634 |
| 238 | 3300053730 | Ga0500645_000884 | Ga0500645_000884_6456_8426 | 634 |
| 239 | 3300005344 | Ga0070661_100033882 | Ga0070661_1000338822 | 635 |
| 240 | 3300005456 | Ga0070678_100009561 | Ga0070678_1000095612 | 635 |
| 241 | 3300009093 | Ga0105240_10005298 | Ga0105240_1000529812 | 635 |
| 242 | 3300009093 | Ga0105240_10006245 | Ga0105240_100062453 | 635 |
| 243 | 3300009545 | Ga0105237_10008385 | Ga0105237_100083854 | 635 |
| 244 | 3300009551 | Ga0105238_10014906 | Ga0105238_100149062 | 635 |
| 245 | 3300010375 | Ga0105239_10004940 | Ga0105239_100049408 | 635 |
| 246 | 3300025225 | Ga0209566_101309 | Ga0209566_1013092 | 635 |
| 247 | 3300025226 | Ga0209674_103427 | Ga0209674_1034271 | 635 |
| 248 | 3300025913 | Ga0207695_10001626 | Ga0207695_1000162615 | 635 |
| 249 | 3300025914 | Ga0207671_10004277 | Ga0207671_100042775 | 635 |
| 250 | 3300025924 | Ga0207694_10015424 | Ga0207694_100154242 | 635 |
| 251 | 3300026041 | Ga0207639_10109651 | Ga0207639_101096512 | 635 |
| 252 | 3300028786 | Ga0307517_10001421 | Ga0307517_100014212 | 635 |
| 253 | 3300028794 | Ga0307515_10023797 | Ga0307515_100237974 | 635 |
| 254 | 3300031616 | Ga0307508_10063396 | Ga0307508_100633962 | 635 |
| 255 | 3300047472 | Ga0495686_0001651 | Ga0495686_0001651_6885_8855 | 635 |
| 256 | 3300048905 | Ga0496102_0001378 | Ga0496102_0001378_12385_14340 | 635 |
| 257 | 3300048920 | Ga0496117_0046008 | Ga0496117_0046008_1140_3113 | 635 |
| 258 | 3300048921 | Ga0496118_0008451 | Ga0496118_0008451_1344_3317 | 635 |
| 259 | 3300048924 | Ga0496121_0000071 | Ga0496121_0000071_46311_48284 | 635 |
| 260 | 3300049581 | Ga0501047_0015518 | Ga0501047_0015518_5095_7023 | 635 |
| 261 | 3300049742 | Ga0501080_0042311 | Ga0501080_0042311_1987_3915 | 635 |
| 262 | 3300049744 | Ga0501083_0029113 | Ga0501083_0029113_11_1939 | 635 |
| 263 | 3300028794 | Ga0307515_10006095 | Ga0307515_100060958 | 636 |
| 264 | 3300028794 | Ga0307515_10025906 | Ga0307515_100259064 | 636 |
| 265 | 3300031456 | Ga0307513_10005067 | Ga0307513_1000506713 | 636 |
| 266 | 3300031616 | Ga0307508_10000096 | Ga0307508_1000009651 | 636 |
| 267 | 3300031649 | Ga0307514_10001862 | Ga0307514_1000186217 | 636 |
| 268 | 3300031730 | Ga0307516_10002913 | Ga0307516_100029132 | 636 |
| 269 | 3300038443 | Ga0395901_0030901 | Ga0395901_0030901_1568_3514 | 636 |
| 270 | 3300046460 | Ga0495638_0026643 | Ga0495638_0026643_564_2519 | 636 |
| 271 | 3300046529 | Ga0495652_0012335 | Ga0495652_0012335_527_2476 | 636 |
| 272 | 3300046530 | Ga0495654_0001887 | Ga0495654_0001887_7281_9233 | 636 |
| 273 | 3300046660 | Ga0495625_0009172 | Ga0495625_0009172_3295_5262 | 636 |
| 274 | 3300048912 | Ga0496109_0077812 | Ga0496109_0077812_268_2295 | 636 |
| 275 | 3300005457 | Ga0070662_100000595 | Ga0070662_10000059516 | 637 |
| 276 | 3300006946 | Ga0079104_1000823 | Ga0079104_10008235 | 637 |
| 277 | 3300006948 | Ga0099826_10025336 | Ga0099826_100253365 | 637 |
| 278 | 3300013100 | Ga0157373_10000819 | Ga0157373_1000081911 | 637 |
| 279 | 3300025933 | Ga0207706_10003456 | Ga0207706_100034565 | 637 |
| 280 | 3300027111 | Ga0209281_1000009 | Ga0209281_1000009637 | 637 |
| 281 | 3300031616 | Ga0307508_10067003 | Ga0307508_100670031 | 637 |
| 282 | 3300044658 | Ga0466972_0000754 | Ga0466972_0000754_9231_11189 | 637 |
| 283 | 3300025298 | Ga0209050_1002798 | Ga0209050_10027982 | 638 |
| 284 | 3300025304 | Ga0209257_1000297 | Ga0209257_1000297108 | 638 |
| 285 | 3300049579 | Ga0501043_0018299 | Ga0501043_0018299_2630_4555 | 638 |
| 286 | 3300053093 | Ga0500651_0016231 | Ga0500651_0016231_810_2735 | 638 |
| 287 | 3300053119 | Ga0500595_023197 | Ga0500595_023197_194_2119 | 638 |
| 288 | 3300053130 | Ga0500642_0006822 | Ga0500642_0006822_859_2784 | 638 |
| 289 | 3300053731 | Ga0500609_000357 | Ga0500609_000357_535_2460 | 638 |
| 290 | 3300005288 | Ga0065714_10064673 | Ga0065714_1006467314 | 639 |
| 291 | iso_pu_bacteria | 2593339238 | 2595447386 | 639 |
| 292 | iso_pu_bacteria | 2593339239 | 2595450158 | 639 |
| 293 | iso_pu_bacteria | 2718218334 | 2721028871 | 639 |
| 294 | iso_pu_bacteria | 2818991436 | 2819544991 | 639 |
| 295 | iso_pu_bacteria | 2842918807 | 2842920467 | 639 |
| 296 | iso_pu_bacteria | 2919085039 | 2919087110 | 639 |
| 297 | iso_pu_bacteria | 2919404418 | 2919406707 | 639 |
| 298 | iso_pu_bacteria | 2928130867 | 2928131601 | 639 |
| 299 | iso_pu_bacteria | 2953994433 | 2953995748 | 639 |
| 300 | 2162886007 | SwRhRL2b_contig_2082775 | SwRhRL2b_0453.00007520 | 640 |
| 301 | 3300005289 | Ga0065704_10070740 | Ga0065704_1007074011 | 640 |
| 302 | 3300005445 | Ga0070708_100048922 | Ga0070708_1000489223 | 640 |
| 303 | 3300015261 | Ga0182006_1009981 | Ga0182006_10099811 | 640 |
| 304 | 3300046501 | Ga0495607_0000290 | Ga0495607_0000290_23929_25869 | 640 |
| 305 | 3300002737 | JGI25162J39368_1000015 | JGI25162J39368_1000015301 | 641 |
| 306 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001978 | 641 |
| 307 | 3300003751 | Ga0055538_1000001 | Ga0055538_100000156 | 641 |
| 308 | 3300003751 | Ga0055538_1000057 | Ga0055538_100005746 | 641 |
| 309 | 3300003752 | Ga0055539_1000001 | Ga0055539_100000156 | 641 |
| 310 | 3300003752 | Ga0055539_1000088 | Ga0055539_100008846 | 641 |
| 311 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003978 | 641 |
| 312 | 3300003756 | Ga0055533_1000096 | Ga0055533_100009646 | 641 |
| 313 | 3300003759 | Ga0055525_1000087 | Ga0055525_100008789 | 641 |
| 314 | 3300003759 | Ga0055525_1000129 | Ga0055525_100012946 | 641 |
| 315 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001978 | 641 |
| 316 | 3300003841 | Ga0055541_1000059 | Ga0055541_100005946 | 641 |
| 317 | 3300005457 | Ga0070662_100013868 | Ga0070662_1000138684 | 641 |
| 318 | 3300005466 | Ga0070685_10000935 | Ga0070685_100009356 | 641 |
| 319 | 3300005548 | Ga0070665_100000786 | Ga0070665_10000078630 | 641 |
| 320 | 3300005563 | Ga0068855_100000112 | Ga0068855_10000011222 | 641 |
| 321 | 3300005578 | Ga0068854_100002880 | Ga0068854_1000028808 | 641 |
| 322 | 3300005834 | Ga0068851_10000857 | Ga0068851_100008575 | 641 |
| 323 | 3300005842 | Ga0068858_100005634 | Ga0068858_1000056345 | 641 |
| 324 | 3300005983 | Ga0081540_1009283 | Ga0081540_10092833 | 641 |
| 325 | 3300009093 | Ga0105240_10002080 | Ga0105240_1000208020 | 641 |
| 326 | 3300009551 | Ga0105238_10007435 | Ga0105238_100074356 | 641 |
| 327 | 3300009553 | Ga0105249_10005339 | Ga0105249_100053393 | 641 |
| 328 | 3300014969 | Ga0157376_10016268 | Ga0157376_100162683 | 641 |
| 329 | 3300015265 | Ga0182005_1001311 | Ga0182005_10013118 | 641 |
| 330 | 3300025207 | Ga0209760_100710 | Ga0209760_1007102 | 641 |
| 331 | 3300025224 | Ga0209784_100004 | Ga0209784_100004972 | 641 |
| 332 | 3300025224 | Ga0209784_100009 | Ga0209784_100009438 | 641 |
| 333 | 3300025225 | Ga0209566_100004 | Ga0209566_1000041129 | 641 |
| 334 | 3300025225 | Ga0209566_100007 | Ga0209566_100007438 | 641 |
| 335 | 3300025226 | Ga0209674_100006 | Ga0209674_1000061129 | 641 |
| 336 | 3300025226 | Ga0209674_100018 | Ga0209674_100018438 | 641 |
| 337 | 3300025230 | Ga0209563_100009 | Ga0209563_100009972 | 641 |
| 338 | 3300025230 | Ga0209563_100020 | Ga0209563_100020438 | 641 |
| 339 | 3300025231 | Ga0207427_102581 | Ga0207427_1025812 | 641 |
| 340 | 3300025233 | Ga0209437_100004 | Ga0209437_100004972 | 641 |
| 341 | 3300025253 | Ga0209677_100005 | Ga0209677_100005972 | 641 |
| 342 | 3300025253 | Ga0209677_100010 | Ga0209677_100010438 | 641 |
| 343 | 3300025261 | Ga0209233_1000005 | Ga0209233_10000051129 | 641 |
| 344 | 3300025321 | Ga0207656_10002350 | Ga0207656_100023504 | 641 |
| 345 | 3300025904 | Ga0207647_10002292 | Ga0207647_100022926 | 641 |
| 346 | 3300025913 | Ga0207695_10000033 | Ga0207695_10000033213 | 641 |
| 347 | 3300025924 | Ga0207694_10001986 | Ga0207694_100019865 | 641 |
| 348 | 3300025925 | Ga0207650_10023751 | Ga0207650_100237512 | 641 |
| 349 | 3300025933 | Ga0207706_10011479 | Ga0207706_100114794 | 641 |
| 350 | 3300025949 | Ga0207667_10000032 | Ga0207667_10000032217 | 641 |
| 351 | 3300025961 | Ga0207712_10000288 | Ga0207712_1000028813 | 641 |
| 352 | 3300025986 | Ga0207658_10010889 | Ga0207658_100108893 | 641 |
| 353 | 3300026035 | Ga0207703_10001081 | Ga0207703_1000108115 | 641 |
| 354 | 3300026041 | Ga0207639_10000448 | Ga0207639_1000044810 | 641 |
| 355 | 3300026067 | Ga0207678_10014945 | Ga0207678_100149452 | 641 |
| 356 | 3300026089 | Ga0207648_10012176 | Ga0207648_100121766 | 641 |
| 357 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006105 | 641 |
| 358 | 3300039447 | Ga0436361_0513552 | Ga0436361_0513552_165_2135 | 641 |
| 359 | 3300046454 | Ga0495592_0011881 | Ga0495592_0011881_3814_5781 | 641 |
| 360 | 3300046462 | Ga0495651_0007096 | Ga0495651_0007096_2442_4406 | 641 |
| 361 | 3300046463 | Ga0495653_0009203 | Ga0495653_0009203_5293_7260 | 641 |
| 362 | 3300046511 | Ga0495608_0018050 | Ga0495608_0018050_64_2028 | 641 |
| 363 | 3300046511 | Ga0495608_0040254 | Ga0495608_0040254_134_2101 | 641 |
| 364 | 3300046514 | Ga0495618_0002091 | Ga0495618_0002091_2383_4350 | 641 |
| 365 | 3300046516 | Ga0495628_0001001 | Ga0495628_0001001_91_2055 | 641 |
| 366 | 3300046516 | Ga0495628_0004631 | Ga0495628_0004631_4670_6637 | 641 |
| 367 | 3300046529 | Ga0495652_0026645 | Ga0495652_0026645_671_2635 | 641 |
| 368 | 3300046543 | Ga0495645_0008523 | Ga0495645_0008523_1927_3891 | 641 |
| 369 | 3300046543 | Ga0495645_0025652 | Ga0495645_0025652_2114_4081 | 641 |
| 370 | 3300046679 | Ga0495623_0014890 | Ga0495623_0014890_2577_4544 | 641 |
| 371 | 3300046680 | Ga0495646_0003303 | Ga0495646_0003303_935_2902 | 641 |
| 372 | 3300047317 | Ga0495604_0002922 | Ga0495604_0002922_5888_7855 | 641 |
| 373 | 3300048921 | Ga0496118_0019747 | Ga0496118_0019747_1201_3267 | 641 |
| 374 | 3300053077 | Ga0495601_0008699 | Ga0495601_0008699_1874_3841 | 641 |
| 375 | 3300053119 | Ga0500595_014824 | Ga0500595_014824_70_2037 | 641 |
| 376 | 3300053141 | Ga0500574_001090 | Ga0500574_001090_977_2944 | 641 |
| 377 | 3300053154 | Ga0500619_000066 | Ga0500619_000066_21593_23560 | 641 |
| 378 | iso_pu_bacteria | 2510065053 | 2510284531 | 641 |
| 379 | iso_pu_bacteria | 2510065055 | 2510295981 | 641 |
| 380 | iso_pu_bacteria | 2510065058 | 2510311909 | 641 |
| 381 | iso_pu_bacteria | 2511231007 | 2511272552 | 641 |
| 382 | iso_pu_bacteria | 2511231010 | 2511290767 | 641 |
| 383 | iso_pu_bacteria | 2511231014 | 2511313841 | 641 |
| 384 | iso_pu_bacteria | 2511231015 | 2511323324 | 641 |
| 385 | iso_pu_bacteria | 2511231016 | 2511327785 | 641 |
| 386 | iso_pu_bacteria | 2511231019 | 2511343841 | 641 |
| 387 | iso_pu_bacteria | 2511231021 | 2511359761 | 641 |
| 388 | iso_pu_bacteria | 2511231022 | 2511362420 | 641 |
| 389 | iso_pu_bacteria | 2511231156 | 2511824363 | 641 |
| 390 | iso_pu_bacteria | 2512047018 | 2512328373 | 641 |
| 391 | iso_pu_bacteria | 2554235341 | 2555669594 | 641 |
| 392 | iso_pu_bacteria | 2582580891 | 2583792845 | 641 |
| 393 | iso_pu_bacteria | 2597489887 | 2597857598 | 641 |
| 394 | iso_pu_bacteria | 2597489888 | 2597864251 | 641 |
| 395 | iso_pu_bacteria | 2597489889 | 2597869496 | 641 |
| 396 | iso_pu_bacteria | 2599185155 | 2599330601 | 641 |
| 397 | iso_pu_bacteria | 2599185160 | 2599353409 | 641 |
| 398 | iso_pu_bacteria | 2599185161 | 2599363802 | 641 |
| 399 | iso_pu_bacteria | 2599185162 | 2599370122 | 641 |
| 400 | iso_pu_bacteria | 2599185163 | 2599372429 | 641 |
| 401 | iso_pu_bacteria | 2599185164 | 2599378517 | 641 |
| 402 | iso_pu_bacteria | 2599185165 | 2599384106 | 641 |
| 403 | iso_pu_bacteria | 2599185166 | 2599391288 | 641 |
| 404 | iso_pu_bacteria | 2599185167 | 2599399238 | 641 |
| 405 | iso_pu_bacteria | 2599185168 | 2599407533 | 641 |
| 406 | iso_pu_bacteria | 2599185179 | 2599453661 | 641 |
| 407 | iso_pu_bacteria | 2599185181 | 2599460243 | 641 |
| 408 | iso_pu_bacteria | 2599185182 | 2599470635 | 641 |
| 409 | iso_pu_bacteria | 2599185185 | 2599484467 | 641 |
| 410 | iso_pu_bacteria | 2599185186 | 2599489264 | 641 |
| 411 | iso_pu_bacteria | 2599185188 | 2599502196 | 641 |
| 412 | iso_pu_bacteria | 2599185189 | 2599509107 | 641 |
| 413 | iso_pu_bacteria | 2599185190 | 2599513730 | 641 |
| 414 | iso_pu_bacteria | 2599185191 | 2599518910 | 641 |
| 415 | iso_pu_bacteria | 2599185212 | 2599616061 | 641 |
| 416 | iso_pu_bacteria | 2599185248 | 2599772664 | 641 |
| 417 | iso_pu_bacteria | 2599185257 | 2599802261 | 641 |
| 418 | iso_pu_bacteria | 2599185288 | 2599881037 | 641 |
| 419 | iso_pu_bacteria | 2599185289 | 2599885074 | 641 |
| 420 | iso_pu_bacteria | 2599185290 | 2599892787 | 641 |
| 421 | iso_pu_bacteria | 2599185291 | 2599899799 | 641 |
| 422 | iso_pu_bacteria | 2599185300 | 2599932744 | 641 |
| 423 | iso_pu_bacteria | 2599185302 | 2599945259 | 641 |
| 424 | iso_pu_bacteria | 2599185303 | 2599949681 | 641 |
| 425 | iso_pu_bacteria | 2599185304 | 2599955389 | 641 |
| 426 | iso_pu_bacteria | 2599185305 | 2599960890 | 641 |
| 427 | iso_pu_bacteria | 2599185306 | 2599965495 | 641 |
| 428 | iso_pu_bacteria | 2599185308 | 2599976610 | 641 |
| 429 | iso_pu_bacteria | 2599185309 | 2599984434 | 641 |
| 430 | iso_pu_bacteria | 2599185310 | 2599990395 | 641 |
| 431 | iso_pu_bacteria | 2599185311 | 2599992836 | 641 |
| 432 | iso_pu_bacteria | 2599185312 | 2600001663 | 641 |
| 433 | iso_pu_bacteria | 2599185313 | 2600008918 | 641 |
| 434 | iso_pu_bacteria | 2599185314 | 2600010645 | 641 |
| 435 | iso_pu_bacteria | 2599185315 | 2600018384 | 641 |
| 436 | iso_pu_bacteria | 2599185316 | 2600023314 | 641 |
| 437 | iso_pu_bacteria | 2599185317 | 2600028227 | 641 |
| 438 | iso_pu_bacteria | 2599185318 | 2600034165 | 641 |
| 439 | iso_pu_bacteria | 2599185319 | 2600040323 | 641 |
| 440 | iso_pu_bacteria | 2599185320 | 2600049243 | 641 |
| 441 | iso_pu_bacteria | 2599185321 | 2600052904 | 641 |
| 442 | iso_pu_bacteria | 2599185322 | 2600056986 | 641 |
| 443 | iso_pu_bacteria | 2599185323 | 2600066812 | 641 |
| 444 | iso_pu_bacteria | 2599185324 | 2600074064 | 641 |
| 445 | iso_pu_bacteria | 2599185325 | 2600077529 | 641 |
| 446 | iso_pu_bacteria | 2599185356 | 2600212852 | 641 |
| 447 | iso_pu_bacteria | 2600254930 | 2600357324 | 641 |
| 448 | iso_pu_bacteria | 2600254931 | 2600366916 | 641 |
| 449 | iso_pu_bacteria | 2600255283 | 2601625303 | 641 |
| 450 | iso_pu_bacteria | 2600255296 | 2601690397 | 641 |
| 451 | iso_pu_bacteria | 2600255313 | 2601773020 | 641 |
| 452 | iso_pu_bacteria | 2619619299 | 2621300200 | 641 |
| 453 | iso_pu_bacteria | 2623620446 | 2624491482 | 641 |
| 454 | iso_pu_bacteria | 2643221571 | 2643871073 | 641 |
| 455 | iso_pu_bacteria | 2643221633 | 2644190355 | 641 |
| 456 | iso_pu_bacteria | 2643221650 | 2644284926 | 641 |
| 457 | iso_pu_bacteria | 2643221713 | 2644622514 | 641 |
| 458 | iso_pu_bacteria | 2651869719 | 2652548246 | 641 |
| 459 | iso_pu_bacteria | 2667528170 | 2671094662 | 641 |
| 460 | iso_pu_bacteria | 2667528171 | 2671095024 | 641 |
| 461 | iso_pu_bacteria | 2667528176 | 2671124815 | 641 |
| 462 | iso_pu_bacteria | 2671180172 | 2671770120 | 641 |
| 463 | iso_pu_bacteria | 2675903420 | 2677901169 | 641 |
| 464 | iso_pu_bacteria | 2675903515 | 2678263891 | 641 |
| 465 | iso_pu_bacteria | 2721755607 | 2723249078 | 641 |
| 466 | iso_pu_bacteria | 2738541265 | 2738675104 | 641 |
| 467 | iso_pu_bacteria | 2738541271 | 2738690750 | 641 |
| 468 | iso_pu_bacteria | 2738541282 | 2738753394 | 641 |
| 469 | iso_pu_bacteria | 2738541294 | 2738810544 | 641 |
| 470 | iso_pu_bacteria | 2738541303 | 2738862306 | 641 |
| 471 | iso_pu_bacteria | 2738541309 | 2738897904 | 641 |
| 472 | iso_pu_bacteria | 2738543015 | 2739257992 | 641 |
| 473 | iso_pu_bacteria | 2738543016 | 2739266524 | 641 |
| 474 | iso_pu_bacteria | 2740892503 | 2743737033 | 641 |
| 475 | iso_pu_bacteria | 2744054620 | 2745004344 | 641 |
| 476 | iso_pu_bacteria | 2773857670 | 2774123117 | 641 |
| 477 | iso_pu_bacteria | 2773857672 | 2774130788 | 641 |
| 478 | iso_pu_bacteria | 2784132072 | 2784315477 | 641 |
| 479 | iso_pu_bacteria | 2791355520 | 2794594719 | 641 |
| 480 | iso_pu_bacteria | 2808606361 | 2808854888 | 641 |
| 481 | iso_pu_bacteria | 2808606376 | 2808926330 | 641 |
| 482 | iso_pu_bacteria | 2808606377 | 2808932744 | 641 |
| 483 | iso_pu_bacteria | 2808606378 | 2808934917 | 641 |
| 484 | iso_pu_bacteria | 2808606380 | 2808948431 | 641 |
| 485 | iso_pu_bacteria | 2808606381 | 2808954866 | 641 |
| 486 | iso_pu_bacteria | 2808606383 | 2808963314 | 641 |
| 487 | iso_pu_bacteria | 2808606385 | 2808978547 | 641 |
| 488 | iso_pu_bacteria | 2808606388 | 2808993926 | 641 |
| 489 | iso_pu_bacteria | 2808606389 | 2808998281 | 641 |
| 490 | iso_pu_bacteria | 2816332298 | 2817491545 | 641 |
| 491 | iso_pu_bacteria | 2818991464 | 2819705621 | 641 |
| 492 | iso_pu_bacteria | 2825651385 | 2825657323 | 641 |
| 493 | iso_pu_bacteria | 2826581358 | 2826585164 | 641 |
| 494 | iso_pu_bacteria | 2834028612 | 2834030248 | 641 |
| 495 | iso_pu_bacteria | 2842815866 | 2842818698 | 641 |
| 496 | iso_pu_bacteria | 2842826826 | 2842831861 | 641 |
| 497 | iso_pu_bacteria | 2842837860 | 2842840208 | 641 |
| 498 | iso_pu_bacteria | 2842849001 | 2842853637 | 641 |
| 499 | iso_pu_bacteria | 2842854478 | 2842858376 | 641 |
| 500 | iso_pu_bacteria | 2844665904 | 2844670096 | 641 |
| 501 | iso_pu_bacteria | 2852612431 | 2852617423 | 641 |
| 502 | iso_pu_bacteria | 2852667396 | 2852672458 | 641 |
| 503 | iso_pu_bacteria | 2860339153 | 2860342516 | 641 |
| 504 | iso_pu_bacteria | 2860867994 | 2860870370 | 641 |
| 505 | iso_pu_bacteria | 2908446538 | 2908450193 | 641 |
| 506 | iso_pu_bacteria | 2913036834 | 2913039284 | 641 |
| 507 | iso_pu_bacteria | 2917070673 | 2917073407 | 641 |
| 508 | iso_pu_bacteria | 2917832318 | 2917833662 | 641 |
| 509 | iso_pu_bacteria | 2919125081 | 2919128061 | 641 |
| 510 | iso_pu_bacteria | 2919456309 | 2919456646 | 641 |
| 511 | iso_pu_bacteria | 2919481497 | 2919485284 | 641 |
| 512 | iso_pu_bacteria | 2919697872 | 2919700959 | 641 |
| 513 | iso_pu_bacteria | 2923153595 | 2923156065 | 641 |
| 514 | iso_pu_bacteria | 2923586266 | 2923586589 | 641 |
| 515 | iso_pu_bacteria | 2929144301 | 2929147889 | 641 |
| 516 | iso_pu_bacteria | 2929189879 | 2929192841 | 641 |
| 517 | iso_pu_bacteria | 2931369376 | 2931369753 | 641 |
| 518 | iso_pu_bacteria | 2931390751 | 2931394365 | 641 |
| 519 | iso_pu_bacteria | 2931396565 | 2931402600 | 641 |
| 520 | iso_pu_bacteria | 2935353572 | 2935357595 | 641 |
| 521 | iso_pu_bacteria | 2945928738 | 2945933881 | 641 |
| 522 | iso_pu_bacteria | 2945961074 | 2945964229 | 641 |
| 523 | iso_pu_bacteria | 2946006987 | 2946010312 | 641 |
| 524 | iso_pu_bacteria | 2946027586 | 2946030619 | 641 |
| 525 | iso_pu_bacteria | 2947233263 | 2947237415 | 641 |
| 526 | iso_pu_bacteria | 2974298342 | 2974298358 | 641 |
| 527 | iso_pu_bacteria | 2984286254 | 2984289959 | 641 |
| 528 | iso_pu_bacteria | 2984499530 | 2984504264 | 641 |
| 529 | iso_pu_bacteria | 2984504281 | 2984505959 | 641 |
| 530 | iso_pu_bacteria | 2988728565 | 2988729470 | 641 |
| 531 | iso_pu_bacteria | 3007395558 | 3007401595 | 641 |
| 532 | iso_pu_bacteria | 3007866637 | 3007869751 | 641 |
| 533 | iso_pu_bacteria | 637000220 | 637319925 | 641 |
| 534 | iso_pu_bacteria | 8015687852 | 8015690282 | 641 |
| 535 | iso_pu_bacteria | 8019769354 | 8019772539 | 641 |
| 536 | iso_pu_bacteria | 8019775933 | 8019778375 | 641 |
| 537 | iso_pu_bacteria | 8054285046 | 8054286281 | 641 |
| 538 | iso_pu_bacteria | 8054347763 | 8054348239 | 641 |
| 539 | iso_pu_bacteria | 8054503363 | 8054505797 | 641 |
| 540 | iso_pu_bacteria | 8055770955 | 8055773411 | 641 |
| 541 | iso_pu_bacteria | 8055817908 | 8055820410 | 641 |
| 542 | iso_pu_bacteria | 8056131705 | 8056134363 | 641 |
| 543 | iso_pu_bacteria | 8056143049 | 8056145529 | 641 |
| 544 | iso_pu_bacteria | 8056148874 | 8056149806 | 641 |
| 545 | iso_pu_bacteria | 8056155041 | 8056156905 | 641 |
| 546 | iso_pu_bacteria | 8056161164 | 8056166490 | 641 |
| 547 | iso_pu_bacteria | 8057798959 | 8057800885 | 641 |
| 548 | 3300001904 | JGI24736J21556_1000922 | JGI24736J21556_10009222 | 642 |
| 549 | 3300002075 | JGI24738J21930_10001672 | JGI24738J21930_100016723 | 642 |
| 550 | 3300003578 | Ga0006562J51391_1046111 | Ga0006562J51391_10461113 | 642 |
| 551 | 3300003578 | Ga0006562J51391_1046112 | Ga0006562J51391_10461123 | 642 |
| 552 | 3300009551 | Ga0105238_10043229 | Ga0105238_100432292 | 642 |
| 553 | 3300013104 | Ga0157370_10000127 | Ga0157370_1000012743 | 642 |
| 554 | 3300015265 | Ga0182005_1000045 | Ga0182005_100004564 | 642 |
| 555 | 3300025226 | Ga0209674_100443 | Ga0209674_10044313 | 642 |
| 556 | 3300025233 | Ga0209437_105108 | Ga0209437_1051082 | 642 |
| 557 | 3300025254 | Ga0209148_1001500 | Ga0209148_10015009 | 642 |
| 558 | 3300031911 | Ga0307412_10000720 | Ga0307412_100007205 | 642 |
| 559 | 3300041413 | Ga0439465_0000091 | Ga0439465_0000091_16346_18313 | 642 |
| 560 | 3300046501 | Ga0495607_0000008 | Ga0495607_0000008_14242_16212 | 642 |
| 561 | 3300048919 | Ga0496116_0043318 | Ga0496116_0043318_487_2457 | 642 |
| 562 | 2124908027 | MRS2a_Contig_11 | MRS2a_00011800 | 645 |
| 563 | 3300002737 | JGI25162J39368_1000014 | JGI25162J39368_1000014266 | 645 |
| 564 | 3300002771 | JGI25163J39215_1001215 | JGI25163J39215_10012154 | 645 |
| 565 | 3300002771 | JGI25163J39215_1002286 | JGI25163J39215_10022861 | 645 |
| 566 | 3300002772 | JGI25164J39214_1000037 | JGI25164J39214_100003735 | 645 |
| 567 | 3300002772 | JGI25164J39214_1000059 | JGI25164J39214_100005954 | 645 |
| 568 | 3300003214 | JGI25165J46597_1000027 | JGI25165J46597_100002754 | 645 |
| 569 | 3300003214 | JGI25165J46597_1000118 | JGI25165J46597_100011836 | 645 |
| 570 | 3300003751 | Ga0055538_1000158 | Ga0055538_100015824 | 645 |
| 571 | 3300003752 | Ga0055539_1000208 | Ga0055539_100020824 | 645 |
| 572 | 3300003756 | Ga0055533_1000209 | Ga0055533_100020924 | 645 |
| 573 | 3300003758 | Ga0055532_1000214 | Ga0055532_100021418 | 645 |
| 574 | 3300003759 | Ga0055525_1000287 | Ga0055525_100028724 | 645 |
| 575 | 3300003781 | Ga0055536_1000046 | Ga0055536_1000046104 | 645 |
| 576 | 3300003791 | Ga0055530_10000133 | Ga0055530_1000013318 | 645 |
| 577 | 3300003791 | Ga0055530_10000136 | Ga0055530_1000013616 | 645 |
| 578 | 3300003791 | Ga0055530_10006501 | Ga0055530_100065011 | 645 |
| 579 | 3300003792 | Ga0055540_1000070 | Ga0055540_1000070104 | 645 |
| 580 | 3300003792 | Ga0055540_1000168 | Ga0055540_100016818 | 645 |
| 581 | 3300003792 | Ga0055540_1000303 | Ga0055540_10003037 | 645 |
| 582 | 3300003794 | Ga0055531_10002895 | Ga0055531_1000289511 | 645 |
| 583 | 3300003794 | Ga0055531_10004152 | Ga0055531_100041525 | 645 |
| 584 | 3300003841 | Ga0055541_1000067 | Ga0055541_100006724 | 645 |
| 585 | 3300005288 | Ga0065714_10011647 | Ga0065714_100116471 | 645 |
| 586 | 3300005288 | Ga0065714_10084986 | Ga0065714_100849861 | 645 |
| 587 | 3300005290 | Ga0065712_10067765 | Ga0065712_1006776541 | 645 |
| 588 | 3300005331 | Ga0070670_100043450 | Ga0070670_1000434503 | 645 |
| 589 | 3300005457 | Ga0070662_100006829 | Ga0070662_1000068292 | 645 |
| 590 | 3300005539 | Ga0068853_100030852 | Ga0068853_1000308522 | 645 |
| 591 | 3300005834 | Ga0068851_10009790 | Ga0068851_100097902 | 645 |
| 592 | 3300009011 | Ga0105251_10000215 | Ga0105251_100002156 | 645 |
| 593 | 3300009011 | Ga0105251_10000924 | Ga0105251_1000092410 | 645 |
| 594 | 3300009011 | Ga0105251_10012316 | Ga0105251_100123163 | 645 |
| 595 | 3300009011 | Ga0105251_10017057 | Ga0105251_100170572 | 645 |
| 596 | 3300009036 | Ga0105244_10000564 | Ga0105244_1000056416 | 645 |
| 597 | 3300009036 | Ga0105244_10001338 | Ga0105244_100013388 | 645 |
| 598 | 3300009036 | Ga0105244_10009100 | Ga0105244_100091003 | 645 |
| 599 | 3300009036 | Ga0105244_10013244 | Ga0105244_100132444 | 645 |
| 600 | 3300009036 | Ga0105244_10016000 | Ga0105244_100160002 | 645 |
| 601 | 3300009036 | Ga0105244_10024178 | Ga0105244_100241781 | 645 |
| 602 | 3300009036 | Ga0105244_10044264 | Ga0105244_100442641 | 645 |
| 603 | 3300009092 | Ga0105250_10000370 | Ga0105250_1000037015 | 645 |
| 604 | 3300009092 | Ga0105250_10001079 | Ga0105250_100010792 | 645 |
| 605 | 3300009092 | Ga0105250_10003522 | Ga0105250_100035226 | 645 |
| 606 | 3300009148 | Ga0105243_10000045 | Ga0105243_100000458 | 645 |
| 607 | 3300011119 | Ga0105246_10005991 | Ga0105246_100059912 | 645 |
| 608 | 3300013100 | Ga0157373_10008189 | Ga0157373_100081895 | 645 |
| 609 | 3300013102 | Ga0157371_10000359 | Ga0157371_1000035948 | 645 |
| 610 | 3300013102 | Ga0157371_10002766 | Ga0157371_100027663 | 645 |
| 611 | 3300013104 | Ga0157370_10070231 | Ga0157370_100702311 | 645 |
| 612 | 3300013105 | Ga0157369_10026879 | Ga0157369_100268793 | 645 |
| 613 | 3300013307 | Ga0157372_10097213 | Ga0157372_100972132 | 645 |
| 614 | 3300014497 | Ga0182008_10021402 | Ga0182008_100214023 | 645 |
| 615 | 3300014497 | Ga0182008_10031554 | Ga0182008_100315542 | 645 |
| 616 | 3300015261 | Ga0182006_1000342 | Ga0182006_100034233 | 645 |
| 617 | 3300015261 | Ga0182006_1011544 | Ga0182006_10115443 | 645 |
| 618 | 3300015262 | Ga0182007_10000177 | Ga0182007_1000017712 | 645 |
| 619 | 3300015265 | Ga0182005_1004405 | Ga0182005_10044054 | 645 |
| 620 | 3300017792 | Ga0163161_10004619 | Ga0163161_100046197 | 645 |
| 621 | 3300025207 | Ga0209760_100023 | Ga0209760_100023122 | 645 |
| 622 | 3300025207 | Ga0209760_100025 | Ga0209760_10002559 | 645 |
| 623 | 3300025224 | Ga0209784_100058 | Ga0209784_100058125 | 645 |
| 624 | 3300025225 | Ga0209566_100045 | Ga0209566_100045125 | 645 |
| 625 | 3300025226 | Ga0209674_100096 | Ga0209674_100096125 | 645 |
| 626 | 3300025229 | Ga0209147_100056 | Ga0209147_100056125 | 645 |
| 627 | 3300025230 | Ga0209563_100064 | Ga0209563_100064125 | 645 |
| 628 | 3300025231 | Ga0207427_100003 | Ga0207427_100003532 | 645 |
| 629 | 3300025231 | Ga0207427_100018 | Ga0207427_100018121 | 645 |
| 630 | 3300025233 | Ga0209437_100002 | Ga0209437_100002481 | 645 |
| 631 | 3300025233 | Ga0209437_100031 | Ga0209437_100031121 | 645 |
| 632 | 3300025242 | Ga0209258_100446 | Ga0209258_10044619 | 645 |
| 633 | 3300025246 | Ga0209646_1000147 | Ga0209646_100014757 | 645 |
| 634 | 3300025253 | Ga0209677_100053 | Ga0209677_100053125 | 645 |
| 635 | 3300025261 | Ga0209233_1000004 | Ga0209233_1000004944 | 645 |
| 636 | 3300025261 | Ga0209233_1000012 | Ga0209233_1000012120 | 645 |
| 637 | 3300025292 | Ga0209676_1000003 | Ga0209676_10000031258 | 645 |
| 638 | 3300025292 | Ga0209676_1000055 | Ga0209676_1000055201 | 645 |
| 639 | 3300025298 | Ga0209050_1000004 | Ga0209050_10000041240 | 645 |
| 640 | 3300025298 | Ga0209050_1000043 | Ga0209050_1000043269 | 645 |
| 641 | 3300025298 | Ga0209050_1000231 | Ga0209050_10002319 | 645 |
| 642 | 3300025303 | Ga0209051_1000030 | Ga0209051_100003081 | 645 |
| 643 | 3300025303 | Ga0209051_1000052 | Ga0209051_100005216 | 645 |
| 644 | 3300025303 | Ga0209051_1000165 | Ga0209051_10001659 | 645 |
| 645 | 3300025304 | Ga0209257_1000767 | Ga0209257_10007679 | 645 |
| 646 | 3300025304 | Ga0209257_1012816 | Ga0209257_10128162 | 645 |
| 647 | 3300025321 | Ga0207656_10005547 | Ga0207656_100055472 | 645 |
| 648 | 3300025711 | Ga0207696_1000011 | Ga0207696_1000011236 | 645 |
| 649 | 3300025711 | Ga0207696_1000041 | Ga0207696_1000041215 | 645 |
| 650 | 3300025711 | Ga0207696_1000628 | Ga0207696_100062814 | 645 |
| 651 | 3300025728 | Ga0207655_1000085 | Ga0207655_100008556 | 645 |
| 652 | 3300025728 | Ga0207655_1000141 | Ga0207655_100014154 | 645 |
| 653 | 3300025728 | Ga0207655_1001565 | Ga0207655_100156515 | 645 |
| 654 | 3300025728 | Ga0207655_1009316 | Ga0207655_10093164 | 645 |
| 655 | 3300025728 | Ga0207655_1031660 | Ga0207655_10316601 | 645 |
| 656 | 3300025735 | Ga0207713_1000042 | Ga0207713_100004271 | 645 |
| 657 | 3300025735 | Ga0207713_1000162 | Ga0207713_100016244 | 645 |
| 658 | 3300025735 | Ga0207713_1001279 | Ga0207713_100127919 | 645 |
| 659 | 3300025735 | Ga0207713_1003516 | Ga0207713_10035161 | 645 |
| 660 | 3300025735 | Ga0207713_1012405 | Ga0207713_10124052 | 645 |
| 661 | 3300025735 | Ga0207713_1016476 | Ga0207713_10164762 | 645 |
| 662 | 3300025735 | Ga0207713_1035283 | Ga0207713_10352831 | 645 |
| 663 | 3300025923 | Ga0207681_10003143 | Ga0207681_100031436 | 645 |
| 664 | 3300025925 | Ga0207650_10000384 | Ga0207650_100003847 | 645 |
| 665 | 3300025925 | Ga0207650_10040682 | Ga0207650_100406823 | 645 |
| 666 | 3300025933 | Ga0207706_10031620 | Ga0207706_100316203 | 645 |
| 667 | 3300025935 | Ga0207709_10000011 | Ga0207709_10000011341 | 645 |
| 668 | 3300026041 | Ga0207639_10089134 | Ga0207639_100891342 | 645 |
| 669 | 3300031548 | Ga0307408_100015782 | Ga0307408_1000157822 | 645 |
| 670 | 3300031731 | Ga0307405_10000390 | Ga0307405_1000039015 | 645 |
| 671 | 3300031731 | Ga0307405_10004963 | Ga0307405_100049635 | 645 |
| 672 | 3300031731 | Ga0307405_10026124 | Ga0307405_100261242 | 645 |
| 673 | 3300031824 | Ga0307413_10011428 | Ga0307413_100114284 | 645 |
| 674 | 3300031901 | Ga0307406_10020193 | Ga0307406_100201932 | 645 |
| 675 | 3300031995 | Ga0307409_100090202 | Ga0307409_1000902021 | 645 |
| 676 | 3300032005 | Ga0307411_10007688 | Ga0307411_100076884 | 645 |
| 677 | 3300041405 | Ga0439438_001497 | Ga0439438_001497_2320_4431 | 645 |
| 678 | 3300041405 | Ga0439438_001800 | Ga0439438_001800_5553_7664 | 645 |
| 679 | 3300041407 | Ga0439447_002071 | Ga0439447_002071_684_2621 | 645 |
| 680 | 3300041411 | Ga0439466_0004012 | Ga0439466_0004012_96_2033 | 645 |
| 681 | 3300041411 | Ga0439466_0010241 | Ga0439466_0010241_872_2809 | 645 |
| 682 | 3300041512 | Ga0451853_0587720 | Ga0451853_0587720_121_2058 | 645 |
| 683 | 3300042006 | Ga0439432_022622 | Ga0439432_022622_37_1974 | 645 |
| 684 | 3300042009 | Ga0439451_003923 | Ga0439451_003923_916_2853 | 645 |
| 685 | 3300042010 | Ga0439452_006659 | Ga0439452_006659_781_2892 | 645 |
| 686 | 3300042146 | Ga0450907_000010 | Ga0450907_000010_11533_13470 | 645 |
| 687 | 3300042185 | Ga0450909_000696 | Ga0450909_000696_2524_4461 | 645 |
| 688 | 3300046452 | Ga0495617_000054 | Ga0495617_000054_49077_51014 | 645 |
| 689 | 3300046452 | Ga0495617_000144 | Ga0495617_000144_39_1976 | 645 |
| 690 | 3300046453 | Ga0495627_000308 | Ga0495627_000308_44727_46664 | 645 |
| 691 | 3300046453 | Ga0495627_012417 | Ga0495627_012417_673_2610 | 645 |
| 692 | 3300046455 | Ga0495603_0001986 | Ga0495603_0001986_7819_9756 | 645 |
| 693 | 3300046457 | Ga0495590_0000364 | Ga0495590_0000364_15261_17198 | 645 |
| 694 | 3300046457 | Ga0495590_0001495 | Ga0495590_0001495_5776_7713 | 645 |
| 695 | 3300046457 | Ga0495590_0005545 | Ga0495590_0005545_717_2654 | 645 |
| 696 | 3300046458 | Ga0495591_000064 | Ga0495591_000064_67515_69452 | 645 |
| 697 | 3300046458 | Ga0495591_000315 | Ga0495591_000315_26105_28042 | 645 |
| 698 | 3300046458 | Ga0495591_001261 | Ga0495591_001261_631_2568 | 645 |
| 699 | 3300046458 | Ga0495591_003301 | Ga0495591_003301_1302_3239 | 645 |
| 700 | 3300046460 | Ga0495638_0017737 | Ga0495638_0017737_424_2361 | 645 |
| 701 | 3300046460 | Ga0495638_0038691 | Ga0495638_0038691_536_2473 | 645 |
| 702 | 3300046463 | Ga0495653_0001170 | Ga0495653_0001170_11532_13472 | 645 |
| 703 | 3300046471 | Ga0495650_0000557 | Ga0495650_0000557_654_2591 | 645 |
| 704 | 3300046471 | Ga0495650_0000881 | Ga0495650_0000881_21101_23038 | 645 |
| 705 | 3300046471 | Ga0495650_0001501 | Ga0495650_0001501_459_2396 | 645 |
| 706 | 3300046471 | Ga0495650_0003204 | Ga0495650_0003204_2403_4340 | 645 |
| 707 | 3300046474 | Ga0495605_0000057 | Ga0495605_0000057_58065_60002 | 645 |
| 708 | 3300046474 | Ga0495605_0000191 | Ga0495605_0000191_899_2836 | 645 |
| 709 | 3300046474 | Ga0495605_0000794 | Ga0495605_0000794_1993_3930 | 645 |
| 710 | 3300046474 | Ga0495605_0003323 | Ga0495605_0003323_4542_6479 | 645 |
| 711 | 3300046474 | Ga0495605_0032845 | Ga0495605_0032845_135_2072 | 645 |
| 712 | 3300046475 | Ga0495639_0000032 | Ga0495639_0000032_13822_15759 | 645 |
| 713 | 3300046491 | Ga0495584_0000409 | Ga0495584_0000409_14331_16268 | 645 |
| 714 | 3300046491 | Ga0495584_0000547 | Ga0495584_0000547_13173_15110 | 645 |
| 715 | 3300046491 | Ga0495584_0002662 | Ga0495584_0002662_157_2094 | 645 |
| 716 | 3300046491 | Ga0495584_0014174 | Ga0495584_0014174_768_2705 | 645 |
| 717 | 3300046492 | Ga0495585_0013643 | Ga0495585_0013643_2020_3957 | 645 |
| 718 | 3300046499 | Ga0495594_0044447 | Ga0495594_0044447_424_2361 | 645 |
| 719 | 3300046501 | Ga0495607_0000058 | Ga0495607_0000058_61780_63717 | 645 |
| 720 | 3300046501 | Ga0495607_0000185 | Ga0495607_0000185_42522_44459 | 645 |
| 721 | 3300046501 | Ga0495607_0000266 | Ga0495607_0000266_22720_24657 | 645 |
| 722 | 3300046501 | Ga0495607_0000617 | Ga0495607_0000617_18153_20090 | 645 |
| 723 | 3300046501 | Ga0495607_0003284 | Ga0495607_0003284_4593_6530 | 645 |
| 724 | 3300046501 | Ga0495607_0011010 | Ga0495607_0011010_1747_3684 | 645 |
| 725 | 3300046501 | Ga0495607_0016974 | Ga0495607_0016974_643_2580 | 645 |
| 726 | 3300046506 | Ga0495583_0000483 | Ga0495583_0000483_11243_13180 | 645 |
| 727 | 3300046506 | Ga0495583_0001110 | Ga0495583_0001110_8763_10700 | 645 |
| 728 | 3300046506 | Ga0495583_0003663 | Ga0495583_0003663_9209_11146 | 645 |
| 729 | 3300046506 | Ga0495583_0004945 | Ga0495583_0004945_3468_5405 | 645 |
| 730 | 3300046506 | Ga0495583_0010911 | Ga0495583_0010911_2303_4240 | 645 |
| 731 | 3300046506 | Ga0495583_0014279 | Ga0495583_0014279_2043_3980 | 645 |
| 732 | 3300046507 | Ga0495606_0000633 | Ga0495606_0000633_41904_43844 | 645 |
| 733 | 3300046507 | Ga0495606_0001206 | Ga0495606_0001206_7706_9643 | 645 |
| 734 | 3300046507 | Ga0495606_0001714 | Ga0495606_0001714_23862_25799 | 645 |
| 735 | 3300046507 | Ga0495606_0003155 | Ga0495606_0003155_2441_4378 | 645 |
| 736 | 3300046513 | Ga0495616_0000226 | Ga0495616_0000226_26103_28040 | 645 |
| 737 | 3300046513 | Ga0495616_0000661 | Ga0495616_0000661_2496_4433 | 645 |
| 738 | 3300046513 | Ga0495616_0003952 | Ga0495616_0003952_1960_3897 | 645 |
| 739 | 3300046513 | Ga0495616_0004782 | Ga0495616_0004782_5083_7020 | 645 |
| 740 | 3300046515 | Ga0495620_0000166 | Ga0495620_0000166_16550_18487 | 645 |
| 741 | 3300046515 | Ga0495620_0000537 | Ga0495620_0000537_588_2525 | 645 |
| 742 | 3300046515 | Ga0495620_0011683 | Ga0495620_0011683_601_2538 | 645 |
| 743 | 3300046515 | Ga0495620_0014405 | Ga0495620_0014405_347_2284 | 645 |
| 744 | 3300046518 | Ga0495631_0006742 | Ga0495631_0006742_3229_5166 | 645 |
| 745 | 3300046518 | Ga0495631_0015307 | Ga0495631_0015307_1110_3047 | 645 |
| 746 | 3300046519 | Ga0495632_0000754 | Ga0495632_0000754_11861_13798 | 645 |
| 747 | 3300046519 | Ga0495632_0001740 | Ga0495632_0001740_14094_16031 | 645 |
| 748 | 3300046519 | Ga0495632_0002380 | Ga0495632_0002380_6544_8481 | 645 |
| 749 | 3300046519 | Ga0495632_0028117 | Ga0495632_0028117_539_2476 | 645 |
| 750 | 3300046520 | Ga0495637_0000037 | Ga0495637_0000037_70916_72853 | 645 |
| 751 | 3300046520 | Ga0495637_0000977 | Ga0495637_0000977_3671_5608 | 645 |
| 752 | 3300046520 | Ga0495637_0001374 | Ga0495637_0001374_11128_13065 | 645 |
| 753 | 3300046520 | Ga0495637_0003424 | Ga0495637_0003424_4040_5977 | 645 |
| 754 | 3300046520 | Ga0495637_0017095 | Ga0495637_0017095_815_2752 | 645 |
| 755 | 3300046522 | Ga0495643_0024936 | Ga0495643_0024936_1326_3263 | 645 |
| 756 | 3300046522 | Ga0495643_0030373 | Ga0495643_0030373_393_2330 | 645 |
| 757 | 3300046524 | Ga0495648_0000377 | Ga0495648_0000377_7234_9171 | 645 |
| 758 | 3300046524 | Ga0495648_0001717 | Ga0495648_0001717_12764_14701 | 645 |
| 759 | 3300046524 | Ga0495648_0010178 | Ga0495648_0010178_1318_3255 | 645 |
| 760 | 3300046528 | Ga0495642_0000316 | Ga0495642_0000316_12842_14779 | 645 |
| 761 | 3300046530 | Ga0495654_0000288 | Ga0495654_0000288_11762_13699 | 645 |
| 762 | 3300046530 | Ga0495654_0000306 | Ga0495654_0000306_15390_17327 | 645 |
| 763 | 3300046530 | Ga0495654_0006785 | Ga0495654_0006785_1359_3296 | 645 |
| 764 | 3300046536 | Ga0495587_0014470 | Ga0495587_0014470_2971_4908 | 645 |
| 765 | 3300046538 | Ga0495609_0000011 | Ga0495609_0000011_69406_71343 | 645 |
| 766 | 3300046538 | Ga0495609_0000075 | Ga0495609_0000075_65473_67410 | 645 |
| 767 | 3300046538 | Ga0495609_0001756 | Ga0495609_0001756_6375_8312 | 645 |
| 768 | 3300046557 | Ga0495622_0000590 | Ga0495622_0000590_10594_12531 | 645 |
| 769 | 3300046557 | Ga0495622_0001201 | Ga0495622_0001201_6437_8374 | 645 |
| 770 | 3300046642 | Ga0495634_0000025 | Ga0495634_0000025_91107_93044 | 645 |
| 771 | 3300046648 | Ga0495611_0000349 | Ga0495611_0000349_3620_5557 | 645 |
| 772 | 3300046660 | Ga0495625_0000089 | Ga0495625_0000089_83007_84944 | 645 |
| 773 | 3300046660 | Ga0495625_0000847 | Ga0495625_0000847_13755_15692 | 645 |
| 774 | 3300046663 | Ga0495635_0000298 | Ga0495635_0000298_403_2340 | 645 |
| 775 | 3300046664 | Ga0495659_0000123 | Ga0495659_0000123_29812_31749 | 645 |
| 776 | 3300046665 | Ga0495661_0000018 | Ga0495661_0000018_78650_80587 | 645 |
| 777 | 3300046665 | Ga0495661_0000083 | Ga0495661_0000083_100364_102301 | 645 |
| 778 | 3300046665 | Ga0495661_0000101 | Ga0495661_0000101_18708_20645 | 645 |
| 779 | 3300046665 | Ga0495661_0031298 | Ga0495661_0031298_804_2741 | 645 |
| 780 | 3300046679 | Ga0495623_0006329 | Ga0495623_0006329_5643_7580 | 645 |
| 781 | 3300046684 | Ga0495669_0003084 | Ga0495669_0003084_3958_5895 | 645 |
| 782 | 3300046691 | Ga0495670_0000332 | Ga0495670_0000332_1639_3576 | 645 |
| 783 | 3300046692 | Ga0495671_0000295 | Ga0495671_0000295_14345_16282 | 645 |
| 784 | 3300046692 | Ga0495671_0000960 | Ga0495671_0000960_12486_14423 | 645 |
| 785 | 3300046692 | Ga0495671_0001060 | Ga0495671_0001060_1695_3632 | 645 |
| 786 | 3300046692 | Ga0495671_0029739 | Ga0495671_0029739_518_2455 | 645 |
| 787 | 3300046694 | Ga0495649_0000013 | Ga0495649_0000013_134106_136043 | 645 |
| 788 | 3300046694 | Ga0495649_0000909 | Ga0495649_0000909_19587_21524 | 645 |
| 789 | 3300046694 | Ga0495649_0027968 | Ga0495649_0027968_594_2531 | 645 |
| 790 | 3300046794 | Ga0495589_0000141 | Ga0495589_0000141_12792_14729 | 645 |
| 791 | 3300046794 | Ga0495589_0000846 | Ga0495589_0000846_10034_11971 | 645 |
| 792 | 3300046810 | Ga0495660_0003252 | Ga0495660_0003252_6850_8787 | 645 |
| 793 | 3300047315 | Ga0495581_0013045 | Ga0495581_0013045_2773_4710 | 645 |
| 794 | 3300047317 | Ga0495604_0002087 | Ga0495604_0002087_9807_11744 | 645 |
| 795 | 3300047318 | Ga0495636_0002282 | Ga0495636_0002282_4950_6887 | 645 |
| 796 | 3300047319 | Ga0495674_0054405 | Ga0495674_0054405_859_2796 | 645 |
| 797 | 3300047320 | Ga0495672_0000419 | Ga0495672_0000419_2322_4259 | 645 |
| 798 | 3300047320 | Ga0495672_0001510 | Ga0495672_0001510_18922_20859 | 645 |
| 799 | 3300047320 | Ga0495672_0013150 | Ga0495672_0013150_78_2015 | 645 |
| 800 | 3300047321 | Ga0495676_0000020 | Ga0495676_0000020_78073_80010 | 645 |
| 801 | 3300047322 | Ga0495680_0047968 | Ga0495680_0047968_101_2038 | 645 |
| 802 | 3300047323 | Ga0495683_0031829 | Ga0495683_0031829_698_2635 | 645 |
| 803 | 3300047443 | Ga0495687_000715 | Ga0495687_000715_11845_13782 | 645 |
| 804 | 3300047443 | Ga0495687_001973 | Ga0495687_001973_2196_4133 | 645 |
| 805 | 3300047443 | Ga0495687_004068 | Ga0495687_004068_2298_4235 | 645 |
| 806 | 3300047443 | Ga0495687_009189 | Ga0495687_009189_2887_4824 | 645 |
| 807 | 3300047446 | Ga0495679_000079 | Ga0495679_000079_17496_19433 | 645 |
| 808 | 3300047446 | Ga0495679_000711 | Ga0495679_000711_17605_19542 | 645 |
| 809 | 3300047469 | Ga0495673_0000190 | Ga0495673_0000190_44093_46030 | 645 |
| 810 | 3300047469 | Ga0495673_0000421 | Ga0495673_0000421_555_2492 | 645 |
| 811 | 3300047469 | Ga0495673_0000833 | Ga0495673_0000833_18729_20666 | 645 |
| 812 | 3300047469 | Ga0495673_0002842 | Ga0495673_0002842_8068_10005 | 645 |
| 813 | 3300047469 | Ga0495673_0012840 | Ga0495673_0012840_711_2648 | 645 |
| 814 | 3300047469 | Ga0495673_0017156 | Ga0495673_0017156_798_2735 | 645 |
| 815 | 3300047469 | Ga0495673_0031214 | Ga0495673_0031214_365_2302 | 645 |
| 816 | 3300047470 | Ga0495681_0000027 | Ga0495681_0000027_90522_92459 | 645 |
| 817 | 3300047470 | Ga0495681_0000237 | Ga0495681_0000237_18664_20601 | 645 |
| 818 | 3300048091 | Ga0495626_0000041 | Ga0495626_0000041_87499_89436 | 645 |
| 819 | 3300048091 | Ga0495626_0000352 | Ga0495626_0000352_25407_27344 | 645 |
| 820 | 3300048091 | Ga0495626_0000583 | Ga0495626_0000583_4381_6318 | 645 |
| 821 | 3300048905 | Ga0496102_0000038 | Ga0496102_0000038_161674_163611 | 645 |
| 822 | 3300048913 | Ga0496110_0012406 | Ga0496110_0012406_2738_4675 | 645 |
| 823 | 3300048919 | Ga0496116_0000221 | Ga0496116_0000221_40272_42212 | 645 |
| 824 | 3300048919 | Ga0496116_0000984 | Ga0496116_0000984_1533_3470 | 645 |
| 825 | 3300048919 | Ga0496116_0010423 | Ga0496116_0010423_275_2212 | 645 |
| 826 | 3300048920 | Ga0496117_0001257 | Ga0496117_0001257_22172_24109 | 645 |
| 827 | 3300048920 | Ga0496117_0007657 | Ga0496117_0007657_2744_4681 | 645 |
| 828 | 3300048921 | Ga0496118_0001081 | Ga0496118_0001081_40365_42302 | 645 |
| 829 | 3300048921 | Ga0496118_0028393 | Ga0496118_0028393_95_2032 | 645 |
| 830 | 3300048922 | Ga0496119_0018617 | Ga0496119_0018617_1203_3140 | 645 |
| 831 | 3300048924 | Ga0496121_0000307 | Ga0496121_0000307_40280_42220 | 645 |
| 832 | 3300048924 | Ga0496121_0004753 | Ga0496121_0004753_11446_13383 | 645 |
| 833 | 3300048924 | Ga0496121_0005910 | Ga0496121_0005910_3079_5016 | 645 |
| 834 | 3300048924 | Ga0496121_0018989 | Ga0496121_0018989_3496_5433 | 645 |
| 835 | 3300048925 | Ga0496122_0000285 | Ga0496122_0000285_73538_75475 | 645 |
| 836 | 3300048925 | Ga0496122_0001763 | Ga0496122_0001763_25844_27784 | 645 |
| 837 | 3300048925 | Ga0496122_0010175 | Ga0496122_0010175_2275_4212 | 645 |
| 838 | 3300048926 | Ga0496123_0000232 | Ga0496123_0000232_37599_39536 | 645 |
| 839 | 3300048927 | Ga0496124_0001091 | Ga0496124_0001091_29130_31067 | 645 |
| 840 | 3300048927 | Ga0496124_0003813 | Ga0496124_0003813_13701_15638 | 645 |
| 841 | 3300048927 | Ga0496124_0003909 | Ga0496124_0003909_2745_4682 | 645 |
| 842 | 3300048927 | Ga0496124_0045951 | Ga0496124_0045951_171_2108 | 645 |
| 843 | 3300048927 | Ga0496124_0058092 | Ga0496124_0058092_464_2401 | 645 |
| 844 | 3300048928 | Ga0496125_0003672 | Ga0496125_0003672_13703_15640 | 645 |
| 845 | 3300049459 | Ga0495678_000724 | Ga0495678_000724_1943_3880 | 645 |
| 846 | 3300049459 | Ga0495678_001110 | Ga0495678_001110_18978_20915 | 645 |
| 847 | 3300049459 | Ga0495678_002200 | Ga0495678_002200_5785_7722 | 645 |
| 848 | 3300049459 | Ga0495678_003441 | Ga0495678_003441_2965_4902 | 645 |
| 849 | 3300049459 | Ga0495678_007111 | Ga0495678_007111_427_2364 | 645 |
| 850 | 3300049459 | Ga0495678_035745 | Ga0495678_035745_56_1993 | 645 |
| 851 | 3300049460 | Ga0495682_0000020 | Ga0495682_0000020_203944_205887 | 645 |
| 852 | 3300049460 | Ga0495682_0000065 | Ga0495682_0000065_56628_58565 | 645 |
| 853 | 3300049460 | Ga0495682_0001951 | Ga0495682_0001951_6020_7957 | 645 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v19-assembly1.cif.gz_A | 2-keto-3-deoxygluconate kinase from thermus thermophilus | 0.9208 | 11 | 334 |
| 3iq0-assembly1.cif.gz_B | crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.coli | 0.9201 | 12 | 334 |
| 3k9e-assembly1.cif.gz_B | crystal structure of a putative ribokinase ii (apo form) from e.coli | 0.9196 | 12 | 334 |
| 2qcv-assembly1.cif.gz_A | crystal structure of a putative 5-dehydro-2-deoxygluconokinase (iolc) from bacillus halodurans c-125 at 1.90 a resolution | 0.9181 | 4 | 332 |
| 3pl2-assembly2.cif.gz_D | crystal structure of a 5-keto-2-deoxygluconokinase (ncgl0155, cgl0158) from corynebacterium glutamicum atcc 13032 kitasato at 1.89 a resolution | 0.9177 | 12 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v1aA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9344 | 11 | 333 | 3.40.1190.20 |
| 1v1aA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9225 | 11 | 333 | 3.40.1190.20 |
| 3iq0B00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9146 | 12 | 334 | 3.40.1190.20 |
| 3pl2D01 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9028 | 11 | 334 | 3.40.1190.20 |
| 4du5C00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.8998 | 12 | 332 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656K0A8-F1-model_v4 | IolC protein | 0.9929 | 84 | 240 |
GO:0006796
GO:0016301 |
| AF-A0A6N6XG16-F1-model_v4 | deleted | 0.9922 | 10 | 257 |
|
| AF-A0A5C6RNF6-F1-model_v4 | 5-dehydro-2-deoxygluconokinase | 0.9915 | 9 | 107 |
GO:0016301
|
| AF-F3C2G5-F1-model_v4 | IolC protein | 0.9867 | 1 | 362 |
GO:0006796
GO:0016301 |
| AF-A0A2X2TAV0-F1-model_v4 | 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92) | 0.9847 | 63 | 312 |
GO:0006796
GO:0047590 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar