F483542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 853 | 348 | 1706 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100294970|Ga0075434_1002949702 |
| Length | 139 |
| Sequence | MIQSSIFYTSGVTGAEEIWFPLVDEPIGSIVQQLQSEDPEIDKLIDSPRKLLAFRTFAYIRVGIVLGRLLVDNDVPEYDGTETWVEALLREPRHRRAVAVELRAVAEEVARSEEPEAGSVGPDDDARARFREFARKQLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 208 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 211 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 213 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 214 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 217 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 218 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 219 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 220 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 221 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 344 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.59 |
| Metatranscriptomes | 1.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.59 |
| Nodule | 0 |
| Rhizoplane | 11.72 |
| Rhizosphere | 86.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075434_100294970 | 3300006871 | Unclassified | 1641 |
| 2 | JGI24749J21850_1022907 | 3300002076 | Bacteria | 886 |
| 3 | JGI24744J21845_10037716 | 3300002077 | Bacteria | 910 |
| 4 | Ga0070658_10036571 | 3300005327 | Bacteria | 3957 |
| 5 | Ga0070658_10094616 | 3300005327 | Bacteria | 2465 |
| 6 | Ga0070658_10104089 | 3300005327 | Bacteria | 2348 |
| 7 | Ga0070658_11005879 | 3300005327 | Bacteria | 725 |
| 8 | Ga0070683_100037582 | 3300005329 | Bacteria | 4432 |
| 9 | Ga0070683_100045570 | 3300005329 | Bacteria | 4048 |
| 10 | Ga0070683_100106057 | 3300005329 | Bacteria | 2649 |
| 11 | Ga0070690_100010870 | 3300005330 | Bacteria | 5311 |
| 12 | Ga0070680_100143926 | 3300005336 | Bacteria | 2000 |
| 13 | Ga0070680_100156968 | 3300005336 | Bacteria | 1912 |
| 14 | Ga0070680_100223236 | 3300005336 | Bacteria | 1591 |
| 15 | Ga0070680_101346384 | 3300005336 | Bacteria | 618 |
| 16 | Ga0070682_100001353 | 3300005337 | Bacteria | 13833 |
| 17 | Ga0070682_100212711 | 3300005337 | Bacteria | 1371 |
| 18 | Ga0070682_100333394 | 3300005337 | Bacteria | 1125 |
| 19 | Ga0068868_100441901 | 3300005338 | Bacteria | 1130 |
| 20 | Ga0068868_100570019 | 3300005338 | Bacteria | 1000 |
| 21 | Ga0070660_100007998 | 3300005339 | Bacteria | 7385 |
| 22 | Ga0070660_100015912 | 3300005339 | Bacteria | 5446 |
| 23 | Ga0070660_100093203 | 3300005339 | Bacteria | 2378 |
| 24 | Ga0070660_100148586 | 3300005339 | Bacteria | 1883 |
| 25 | Ga0070660_100269301 | 3300005339 | Bacteria | 1392 |
| 26 | Ga0070660_100344355 | 3300005339 | Unclassified | 1227 |
| 27 | Ga0070660_100493616 | 3300005339 | Bacteria | 1018 |
| 28 | Ga0070660_100653434 | 3300005339 | Unclassified | 881 |
| 29 | Ga0070691_10956086 | 3300005341 | Unclassified | 532 |
| 30 | Ga0070687_100009155 | 3300005343 | Bacteria | 4231 |
| 31 | Ga0070687_100382950 | 3300005343 | Bacteria | 917 |
| 32 | Ga0070661_100040189 | 3300005344 | Bacteria | 3411 |
| 33 | Ga0070692_10682338 | 3300005345 | Unclassified | 689 |
| 34 | Ga0070669_100654407 | 3300005353 | Bacteria | 884 |
| 35 | Ga0070675_100130161 | 3300005354 | Bacteria | 2144 |
| 36 | Ga0070673_100148930 | 3300005364 | Bacteria | 1980 |
| 37 | Ga0070659_100003771 | 3300005366 | Bacteria | 10814 |
| 38 | Ga0070659_100042127 | 3300005366 | Bacteria | 3570 |
| 39 | Ga0070659_100141754 | 3300005366 | Bacteria | 1957 |
| 40 | Ga0070659_100611963 | 3300005366 | Bacteria | 937 |
| 41 | Ga0070659_101176694 | 3300005366 | Bacteria | 677 |
| 42 | Ga0070703_10316755 | 3300005406 | Bacteria | 655 |
| 43 | Ga0070709_10191392 | 3300005434 | Bacteria | 1443 |
| 44 | Ga0070709_10971570 | 3300005434 | Bacteria | 674 |
| 45 | Ga0070709_11730319 | 3300005434 | Bacteria | 511 |
| 46 | Ga0070714_100035545 | 3300005435 | Bacteria | 4177 |
| 47 | Ga0070714_100077257 | 3300005435 | Bacteria | 2892 |
| 48 | Ga0070714_100339043 | 3300005435 | Bacteria | 1409 |
| 49 | Ga0070714_100548355 | 3300005435 | Bacteria | 1107 |
| 50 | Ga0070714_101243716 | 3300005435 | Unclassified | 727 |
| 51 | Ga0070713_100588914 | 3300005436 | Bacteria | 1056 |
| 52 | Ga0070713_100936479 | 3300005436 | Bacteria | 834 |
| 53 | Ga0070710_10146116 | 3300005437 | Bacteria | 1454 |
| 54 | Ga0070701_10008806 | 3300005438 | Bacteria | 4386 |
| 55 | Ga0070701_10501816 | 3300005438 | Unclassified | 788 |
| 56 | Ga0070711_100002187 | 3300005439 | Bacteria | 11090 |
| 57 | Ga0070711_100012056 | 3300005439 | Bacteria | 5390 |
| 58 | Ga0070711_100198592 | 3300005439 | Bacteria | 1546 |
| 59 | Ga0070711_100599075 | 3300005439 | Bacteria | 919 |
| 60 | Ga0070711_101408566 | 3300005439 | Unclassified | 607 |
| 61 | Ga0070711_101412236 | 3300005439 | Unclassified | 606 |
| 62 | Ga0070700_100002757 | 3300005441 | Bacteria | 8984 |
| 63 | Ga0070700_100805662 | 3300005441 | Unclassified | 757 |
| 64 | Ga0070694_100029990 | 3300005444 | Bacteria | 3555 |
| 65 | Ga0070663_101097367 | 3300005455 | Bacteria | 696 |
| 66 | Ga0070663_101323166 | 3300005455 | Unclassified | 636 |
| 67 | Ga0070678_100002780 | 3300005456 | Bacteria | 9668 |
| 68 | Ga0070678_101723710 | 3300005456 | Unclassified | 590 |
| 69 | Ga0070681_10015700 | 3300005458 | Bacteria | 7546 |
| 70 | Ga0070681_10035668 | 3300005458 | Bacteria | 4995 |
| 71 | Ga0070681_10275245 | 3300005458 | Bacteria | 1594 |
| 72 | Ga0070681_10455838 | 3300005458 | Unclassified | 1191 |
| 73 | Ga0070681_10649802 | 3300005458 | Bacteria | 969 |
| 74 | Ga0068867_100000550 | 3300005459 | Bacteria | 24730 |
| 75 | Ga0070685_10001027 | 3300005466 | Bacteria | 15007 |
| 76 | Ga0070706_100033135 | 3300005467 | Unclassified | 4768 |
| 77 | Ga0070706_100242221 | 3300005467 | Unclassified | 1684 |
| 78 | Ga0070706_101417444 | 3300005467 | Bacteria | 636 |
| 79 | Ga0070707_100001094 | 3300005468 | Bacteria | 26790 |
| 80 | Ga0070707_100999584 | 3300005468 | Unclassified | 802 |
| 81 | Ga0070698_100026743 | 3300005471 | Bacteria | 6002 |
| 82 | Ga0070698_100146394 | 3300005471 | Bacteria | 2311 |
| 83 | Ga0070698_100224357 | 3300005471 | Bacteria | 1812 |
| 84 | Ga0070699_100071957 | 3300005518 | Bacteria | 3007 |
| 85 | Ga0070699_100190846 | 3300005518 | Bacteria | 1820 |
| 86 | Ga0070699_100238644 | 3300005518 | Bacteria | 1622 |
| 87 | Ga0070699_100814400 | 3300005518 | Bacteria | 855 |
| 88 | Ga0070679_100023086 | 3300005530 | Bacteria | 6085 |
| 89 | Ga0070679_100050172 | 3300005530 | Bacteria | 4156 |
| 90 | Ga0070679_100082883 | 3300005530 | Bacteria | 3196 |
| 91 | Ga0070679_100172249 | 3300005530 | Bacteria | 2137 |
| 92 | Ga0070679_100176495 | 3300005530 | Bacteria | 2109 |
| 93 | Ga0070679_100250630 | 3300005530 | Bacteria | 1727 |
| 94 | Ga0070679_100420637 | 3300005530 | Unclassified | 1282 |
| 95 | Ga0070679_100801740 | 3300005530 | Bacteria | 885 |
| 96 | Ga0070679_100974338 | 3300005530 | Bacteria | 792 |
| 97 | Ga0070684_100137723 | 3300005535 | Bacteria | 2206 |
| 98 | Ga0070684_100273652 | 3300005535 | Unclassified | 1546 |
| 99 | Ga0070684_100616947 | 3300005535 | Bacteria | 1009 |
| 100 | Ga0070684_101385986 | 3300005535 | Bacteria | 662 |
| 101 | Ga0070684_101916387 | 3300005535 | Bacteria | 559 |
| 102 | Ga0070697_100115563 | 3300005536 | Bacteria | 2240 |
| 103 | Ga0068853_100004653 | 3300005539 | Bacteria | 10644 |
| 104 | Ga0068853_100101626 | 3300005539 | Bacteria | 2543 |
| 105 | Ga0068853_101015247 | 3300005539 | Bacteria | 799 |
| 106 | Ga0070672_100243590 | 3300005543 | Bacteria | 1513 |
| 107 | Ga0070686_100002324 | 3300005544 | Bacteria | 10491 |
| 108 | Ga0070686_100439690 | 3300005544 | Bacteria | 1000 |
| 109 | Ga0070695_100374167 | 3300005545 | Bacteria | 1073 |
| 110 | Ga0070696_100014317 | 3300005546 | Bacteria | 5320 |
| 111 | Ga0070693_100194078 | 3300005547 | Bacteria | 1315 |
| 112 | Ga0070693_100622718 | 3300005547 | Bacteria | 782 |
| 113 | Ga0070665_100007548 | 3300005548 | Bacteria | 11053 |
| 114 | Ga0070665_100032068 | 3300005548 | Bacteria | 5289 |
| 115 | Ga0070704_100005238 | 3300005549 | Bacteria | 7550 |
| 116 | Ga0070704_100298837 | 3300005549 | Unclassified | 1341 |
| 117 | Ga0070704_101157390 | 3300005549 | Bacteria | 704 |
| 118 | Ga0068855_100028295 | 3300005563 | Bacteria | 6704 |
| 119 | Ga0068855_100048620 | 3300005563 | Bacteria | 5005 |
| 120 | Ga0068855_100088984 | 3300005563 | Bacteria | 3566 |
| 121 | Ga0068855_100112215 | 3300005563 | Bacteria | 3128 |
| 122 | Ga0068855_100209553 | 3300005563 | Bacteria | 2191 |
| 123 | Ga0068855_100467152 | 3300005563 | Unclassified | 1375 |
| 124 | Ga0068857_100011411 | 3300005577 | Bacteria | 7729 |
| 125 | Ga0068857_100195364 | 3300005577 | Bacteria | 1844 |
| 126 | Ga0068854_100082317 | 3300005578 | Bacteria | 2379 |
| 127 | Ga0068854_100266116 | 3300005578 | Bacteria | 1374 |
| 128 | Ga0068856_100009339 | 3300005614 | Bacteria | 9525 |
| 129 | Ga0068856_100111950 | 3300005614 | Bacteria | 2727 |
| 130 | Ga0068856_100211859 | 3300005614 | Bacteria | 1953 |
| 131 | Ga0068856_100301589 | 3300005614 | Bacteria | 1620 |
| 132 | Ga0068856_100329503 | 3300005614 | Unclassified | 1544 |
| 133 | Ga0068856_100546278 | 3300005614 | Bacteria | 1180 |
| 134 | Ga0068856_102152128 | 3300005614 | Bacteria | 567 |
| 135 | Ga0070702_100003004 | 3300005615 | Bacteria | 7455 |
| 136 | Ga0068852_100014317 | 3300005616 | Bacteria | 6100 |
| 137 | Ga0068852_100074071 | 3300005616 | Bacteria | 2997 |
| 138 | Ga0068852_100098441 | 3300005616 | Bacteria | 2634 |
| 139 | Ga0068852_100506960 | 3300005616 | Bacteria | 1202 |
| 140 | Ga0068859_100027843 | 3300005617 | Bacteria | 5668 |
| 141 | Ga0068861_100032064 | 3300005719 | Bacteria | 3866 |
| 142 | Ga0068861_100808496 | 3300005719 | Bacteria | 880 |
| 143 | Ga0068851_10589004 | 3300005834 | Bacteria | 676 |
| 144 | Ga0068860_100171690 | 3300005843 | Bacteria | 2094 |
| 145 | Ga0068860_102370854 | 3300005843 | Bacteria | 551 |
| 146 | Ga0081539_10073708 | 3300005985 | Bacteria | 1820 |
| 147 | Ga0070717_10021799 | 3300006028 | Bacteria | 5054 |
| 148 | Ga0070717_10672654 | 3300006028 | Unclassified | 940 |
| 149 | Ga0075365_10700978 | 3300006038 | Bacteria | 715 |
| 150 | Ga0075364_10269603 | 3300006051 | Bacteria | 1158 |
| 151 | Ga0075364_10505660 | 3300006051 | Bacteria | 826 |
| 152 | Ga0075432_10258876 | 3300006058 | Bacteria | 708 |
| 153 | Ga0070715_10073231 | 3300006163 | Bacteria | 1536 |
| 154 | Ga0070712_100015106 | 3300006175 | Bacteria | 4964 |
| 155 | Ga0070712_100069346 | 3300006175 | Bacteria | 2515 |
| 156 | Ga0070712_100069414 | 3300006175 | Bacteria | 2514 |
| 157 | Ga0097621_100006172 | 3300006237 | Bacteria | 8492 |
| 158 | Ga0097621_100198145 | 3300006237 | Bacteria | 1742 |
| 159 | Ga0068871_100293188 | 3300006358 | Bacteria | 1426 |
| 160 | Ga0068871_100821938 | 3300006358 | Bacteria | 857 |
| 161 | Ga0068871_101754560 | 3300006358 | Bacteria | 589 |
| 162 | Ga0075428_100093160 | 3300006844 | Bacteria | 3284 |
| 163 | Ga0075430_100805559 | 3300006846 | Bacteria | 774 |
| 164 | Ga0075431_100193601 | 3300006847 | Bacteria | 2082 |
| 165 | Ga0075431_100651381 | 3300006847 | Bacteria | 1034 |
| 166 | Ga0075433_10014069 | 3300006852 | Bacteria | 6524 |
| 167 | Ga0075433_10271436 | 3300006852 | Bacteria | 1503 |
| 168 | Ga0075434_100010906 | 3300006871 | Bacteria | 8543 |
| 169 | Ga0075434_101009410 | 3300006871 | Bacteria | 846 |
| 170 | Ga0075429_100011218 | 3300006880 | Bacteria | 7757 |
| 171 | Ga0075429_100963370 | 3300006880 | Unclassified | 746 |
| 172 | Ga0068865_100000227 | 3300006881 | Bacteria | 31272 |
| 173 | Ga0075436_100039906 | 3300006914 | Bacteria | 3239 |
| 174 | Ga0097620_100027843 | 3300006931 | Bacteria | 5668 |
| 175 | Ga0075435_100078957 | 3300007076 | Bacteria | 2700 |
| 176 | Ga0075435_100131872 | 3300007076 | Bacteria | 2091 |
| 177 | Ga0075435_100188256 | 3300007076 | Bacteria | 1746 |
| 178 | Ga0105240_10051622 | 3300009093 | Bacteria | 5172 |
| 179 | Ga0105240_10061052 | 3300009093 | Bacteria | 4698 |
| 180 | Ga0105240_10600297 | 3300009093 | Bacteria | 1212 |
| 181 | Ga0105240_12213464 | 3300009093 | Bacteria | 570 |
| 182 | Ga0111539_10094787 | 3300009094 | Bacteria | 3507 |
| 183 | Ga0111539_10108916 | 3300009094 | Bacteria | 3251 |
| 184 | Ga0105245_10023004 | 3300009098 | Bacteria | 5468 |
| 185 | Ga0105245_10489437 | 3300009098 | Bacteria | 1244 |
| 186 | Ga0105245_11436731 | 3300009098 | Unclassified | 740 |
| 187 | Ga0114129_10040444 | 3300009147 | Bacteria | 6572 |
| 188 | Ga0114129_10055751 | 3300009147 | Bacteria | 5539 |
| 189 | Ga0114129_10083841 | 3300009147 | Unclassified | 4425 |
| 190 | Ga0114129_10095852 | 3300009147 | Bacteria | 4108 |
| 191 | Ga0114129_11030461 | 3300009147 | Bacteria | 1034 |
| 192 | Ga0114129_11902660 | 3300009147 | Bacteria | 721 |
| 193 | Ga0105243_10436534 | 3300009148 | Bacteria | 1225 |
| 194 | Ga0105241_10065053 | 3300009174 | Bacteria | 2817 |
| 195 | Ga0105241_10380142 | 3300009174 | Bacteria | 1234 |
| 196 | Ga0105241_10815440 | 3300009174 | Unclassified | 861 |
| 197 | Ga0105242_10001454 | 3300009176 | Bacteria | 18636 |
| 198 | Ga0105248_10062399 | 3300009177 | Bacteria | 4185 |
| 199 | Ga0105248_12234648 | 3300009177 | Bacteria | 623 |
| 200 | Ga0105248_12297129 | 3300009177 | Bacteria | 614 |
| 201 | Ga0105237_10037076 | 3300009545 | Bacteria | 4929 |
| 202 | Ga0105237_10178240 | 3300009545 | Bacteria | 2125 |
| 203 | Ga0105237_10429259 | 3300009545 | Bacteria | 1327 |
| 204 | Ga0105237_10557635 | 3300009545 | Unclassified | 1152 |
| 205 | Ga0105237_12125518 | 3300009545 | Bacteria | 571 |
| 206 | Ga0105238_10040827 | 3300009551 | Bacteria | 4700 |
| 207 | Ga0105249_10002535 | 3300009553 | Bacteria | 15803 |
| 208 | Ga0105249_10480408 | 3300009553 | Unclassified | 1285 |
| 209 | Ga0105239_10001933 | 3300010375 | Bacteria | 27042 |
| 210 | Ga0105239_10027377 | 3300010375 | Bacteria | 6275 |
| 211 | Ga0105239_10722610 | 3300010375 | Bacteria | 1139 |
| 212 | Ga0105239_11899156 | 3300010375 | Bacteria | 691 |
| 213 | Ga0105239_13055035 | 3300010375 | Unclassified | 545 |
| 214 | Ga0105246_11427591 | 3300011119 | Bacteria | 647 |
| 215 | Ga0157373_10615442 | 3300013100 | Bacteria | 791 |
| 216 | Ga0157373_10656772 | 3300013100 | Bacteria | 766 |
| 217 | Ga0157371_10203443 | 3300013102 | Unclassified | 1420 |
| 218 | Ga0157371_10362177 | 3300013102 | Bacteria | 1057 |
| 219 | Ga0157371_10510877 | 3300013102 | Unclassified | 888 |
| 220 | Ga0157370_10013920 | 3300013104 | Bacteria | 8260 |
| 221 | Ga0157370_10021781 | 3300013104 | Bacteria | 6384 |
| 222 | Ga0157370_10027545 | 3300013104 | Bacteria | 5603 |
| 223 | Ga0157370_10089902 | 3300013104 | Bacteria | 2884 |
| 224 | Ga0157370_10383295 | 3300013104 | Unclassified | 1295 |
| 225 | Ga0157370_10670869 | 3300013104 | Bacteria | 947 |
| 226 | Ga0157370_11066674 | 3300013104 | Bacteria | 730 |
| 227 | Ga0157369_10010672 | 3300013105 | Bacteria | 10455 |
| 228 | Ga0157369_10084027 | 3300013105 | Bacteria | 3404 |
| 229 | Ga0157369_10097700 | 3300013105 | Bacteria | 3132 |
| 230 | Ga0157369_10348917 | 3300013105 | Bacteria | 1537 |
| 231 | Ga0157374_10014191 | 3300013296 | Bacteria | 6966 |
| 232 | Ga0157374_10869611 | 3300013296 | Bacteria | 919 |
| 233 | Ga0157378_10002034 | 3300013297 | Bacteria | 18114 |
| 234 | Ga0163162_10002291 | 3300013306 | Bacteria | 17972 |
| 235 | Ga0163162_10750196 | 3300013306 | Bacteria | 1095 |
| 236 | Ga0157372_10109170 | 3300013307 | Bacteria | 3168 |
| 237 | Ga0157372_10254602 | 3300013307 | Unclassified | 2038 |
| 238 | Ga0157372_10610316 | 3300013307 | Unclassified | 1271 |
| 239 | Ga0157372_11247871 | 3300013307 | Bacteria | 858 |
| 240 | Ga0157372_11744624 | 3300013307 | Unclassified | 716 |
| 241 | Ga0157375_10037709 | 3300013308 | Bacteria | 4633 |
| 242 | Ga0157375_10054990 | 3300013308 | Bacteria | 3922 |
| 243 | Ga0157375_10686967 | 3300013308 | Bacteria | 1178 |
| 244 | Ga0157375_11946180 | 3300013308 | Unclassified | 698 |
| 245 | Ga0157375_12461618 | 3300013308 | Bacteria | 621 |
| 246 | Ga0157380_10002637 | 3300014326 | Bacteria | 12148 |
| 247 | Ga0182008_10085595 | 3300014497 | Bacteria | 1553 |
| 248 | Ga0157377_10022007 | 3300014745 | Bacteria | 3362 |
| 249 | Ga0157376_10077158 | 3300014969 | Bacteria | 2849 |
| 250 | Ga0197907_10994198 | 3300020069 | Bacteria | 1517 |
| 251 | Ga0197907_11299474 | 3300020069 | Bacteria | 1122 |
| 252 | Ga0206356_10008307 | 3300020070 | Bacteria | 1665 |
| 253 | Ga0206356_10150742 | 3300020070 | Bacteria | 3555 |
| 254 | Ga0206356_10827326 | 3300020070 | Bacteria | 1149 |
| 255 | Ga0206356_11299735 | 3300020070 | Unclassified | 803 |
| 256 | Ga0206354_10202118 | 3300020081 | Unclassified | 1652 |
| 257 | Ga0206354_10358543 | 3300020081 | Bacteria | 3540 |
| 258 | Ga0206354_11143875 | 3300020081 | Bacteria | 1264 |
| 259 | Ga0206353_10804099 | 3300020082 | Bacteria | 9328 |
| 260 | Ga0206353_10879736 | 3300020082 | Bacteria | 12937 |
| 261 | Ga0206353_11861837 | 3300020082 | Bacteria | 2607 |
| 262 | Ga0213876_10199893 | 3300021384 | Bacteria | 1062 |
| 263 | Ga0207692_11012264 | 3300025898 | Unclassified | 549 |
| 264 | Ga0207642_10001151 | 3300025899 | Bacteria | 8180 |
| 265 | Ga0207688_10057984 | 3300025901 | Bacteria | 2178 |
| 266 | Ga0207685_10150778 | 3300025905 | Bacteria | 1052 |
| 267 | Ga0207685_10440878 | 3300025905 | Bacteria | 675 |
| 268 | Ga0207699_10100917 | 3300025906 | Bacteria | 1831 |
| 269 | Ga0207699_10212253 | 3300025906 | Bacteria | 1317 |
| 270 | Ga0207705_10005200 | 3300025909 | Bacteria | 9755 |
| 271 | Ga0207705_10158330 | 3300025909 | Unclassified | 1700 |
| 272 | Ga0207705_10209113 | 3300025909 | Bacteria | 1480 |
| 273 | Ga0207705_10303845 | 3300025909 | Bacteria | 1224 |
| 274 | Ga0207705_10321617 | 3300025909 | Bacteria | 1189 |
| 275 | Ga0207705_10373251 | 3300025909 | Bacteria | 1101 |
| 276 | Ga0207684_10106846 | 3300025910 | Unclassified | 2395 |
| 277 | Ga0207684_10260916 | 3300025910 | Archaea | 1495 |
| 278 | Ga0207684_11057574 | 3300025910 | Unclassified | 677 |
| 279 | Ga0207654_10629409 | 3300025911 | Bacteria | 767 |
| 280 | Ga0207707_10017189 | 3300025912 | Bacteria | 6305 |
| 281 | Ga0207707_10073017 | 3300025912 | Bacteria | 2991 |
| 282 | Ga0207707_10082799 | 3300025912 | Unclassified | 2801 |
| 283 | Ga0207707_10112059 | 3300025912 | Bacteria | 2385 |
| 284 | Ga0207707_10148660 | 3300025912 | Bacteria | 2048 |
| 285 | Ga0207695_10097899 | 3300025913 | Bacteria | 2934 |
| 286 | Ga0207695_10116989 | 3300025913 | Bacteria | 2639 |
| 287 | Ga0207695_10561191 | 3300025913 | Bacteria | 1023 |
| 288 | Ga0207671_10103617 | 3300025914 | Bacteria | 2158 |
| 289 | Ga0207671_10316881 | 3300025914 | Bacteria | 1234 |
| 290 | Ga0207671_10484439 | 3300025914 | Bacteria | 986 |
| 291 | Ga0207693_10001103 | 3300025915 | Bacteria | 24273 |
| 292 | Ga0207693_10008867 | 3300025915 | Bacteria | 8216 |
| 293 | Ga0207693_10015845 | 3300025915 | Bacteria | 6038 |
| 294 | Ga0207693_10096026 | 3300025915 | Bacteria | 2324 |
| 295 | Ga0207663_10083739 | 3300025916 | Bacteria | 2096 |
| 296 | Ga0207663_10242943 | 3300025916 | Bacteria | 1321 |
| 297 | Ga0207663_10536268 | 3300025916 | Unclassified | 913 |
| 298 | Ga0207663_10564272 | 3300025916 | Bacteria | 891 |
| 299 | Ga0207663_11362565 | 3300025916 | Unclassified | 571 |
| 300 | Ga0207660_10114927 | 3300025917 | Bacteria | 2031 |
| 301 | Ga0207660_10136979 | 3300025917 | Unclassified | 1869 |
| 302 | Ga0207660_10319076 | 3300025917 | Bacteria | 1240 |
| 303 | Ga0207660_10472480 | 3300025917 | Bacteria | 1015 |
| 304 | Ga0207662_10053700 | 3300025918 | Bacteria | 2401 |
| 305 | Ga0207657_10005129 | 3300025919 | Bacteria | 13727 |
| 306 | Ga0207657_10010441 | 3300025919 | Bacteria | 9268 |
| 307 | Ga0207657_10030136 | 3300025919 | Bacteria | 4929 |
| 308 | Ga0207657_10047476 | 3300025919 | Bacteria | 3754 |
| 309 | Ga0207657_10102133 | 3300025919 | Bacteria | 2378 |
| 310 | Ga0207657_10136437 | 3300025919 | Unclassified | 2007 |
| 311 | Ga0207657_10234620 | 3300025919 | Bacteria | 1466 |
| 312 | Ga0207657_10399586 | 3300025919 | Unclassified | 1081 |
| 313 | Ga0207657_10501340 | 3300025919 | Bacteria | 951 |
| 314 | Ga0207649_10036640 | 3300025920 | Bacteria | 2956 |
| 315 | Ga0207649_10073141 | 3300025920 | Bacteria | 2195 |
| 316 | Ga0207652_10065929 | 3300025921 | Bacteria | 3137 |
| 317 | Ga0207652_10083152 | 3300025921 | Bacteria | 2802 |
| 318 | Ga0207652_10227457 | 3300025921 | Bacteria | 1681 |
| 319 | Ga0207652_10238455 | 3300025921 | Bacteria | 1639 |
| 320 | Ga0207652_10303209 | 3300025921 | Bacteria | 1442 |
| 321 | Ga0207652_10383185 | 3300025921 | Bacteria | 1269 |
| 322 | Ga0207652_10739157 | 3300025921 | Bacteria | 876 |
| 323 | Ga0207652_10987299 | 3300025921 | Bacteria | 741 |
| 324 | Ga0207652_11622644 | 3300025921 | Bacteria | 551 |
| 325 | Ga0207646_10004975 | 3300025922 | Bacteria | 14201 |
| 326 | Ga0207646_10309013 | 3300025922 | Bacteria | 1428 |
| 327 | Ga0207681_10533593 | 3300025923 | Bacteria | 964 |
| 328 | Ga0207694_10183167 | 3300025924 | Unclassified | 1699 |
| 329 | Ga0207694_10283887 | 3300025924 | Bacteria | 1360 |
| 330 | Ga0207659_10101582 | 3300025926 | Bacteria | 2169 |
| 331 | Ga0207687_10102155 | 3300025927 | Bacteria | 2112 |
| 332 | Ga0207687_10139735 | 3300025927 | Unclassified | 1836 |
| 333 | Ga0207687_10319492 | 3300025927 | Bacteria | 1256 |
| 334 | Ga0207700_10111391 | 3300025928 | Bacteria | 2203 |
| 335 | Ga0207700_10125687 | 3300025928 | Bacteria | 2086 |
| 336 | Ga0207700_10647015 | 3300025928 | Archaea | 942 |
| 337 | Ga0207664_10140000 | 3300025929 | Bacteria | 2046 |
| 338 | Ga0207664_10245957 | 3300025929 | Bacteria | 1559 |
| 339 | Ga0207644_10352884 | 3300025931 | Unclassified | 1195 |
| 340 | Ga0207690_10041792 | 3300025932 | Bacteria | 3007 |
| 341 | Ga0207690_10152801 | 3300025932 | Bacteria | 1713 |
| 342 | Ga0207690_10181460 | 3300025932 | Bacteria | 1585 |
| 343 | Ga0207690_10248190 | 3300025932 | Bacteria | 1374 |
| 344 | Ga0207690_10544939 | 3300025932 | Bacteria | 943 |
| 345 | Ga0207686_10010247 | 3300025934 | Bacteria | 5099 |
| 346 | Ga0207686_10057863 | 3300025934 | Unclassified | 2442 |
| 347 | Ga0207709_10000390 | 3300025935 | Bacteria | 43485 |
| 348 | Ga0207670_10003763 | 3300025936 | Bacteria | 8063 |
| 349 | Ga0207669_10733430 | 3300025937 | Bacteria | 815 |
| 350 | Ga0207704_10011983 | 3300025938 | Bacteria | 4289 |
| 351 | Ga0207665_10216705 | 3300025939 | Bacteria | 1401 |
| 352 | Ga0207691_10024175 | 3300025940 | Bacteria | 5713 |
| 353 | Ga0207711_10112339 | 3300025941 | Bacteria | 2424 |
| 354 | Ga0207689_10593742 | 3300025942 | Bacteria | 931 |
| 355 | Ga0207661_10030134 | 3300025944 | Bacteria | 4175 |
| 356 | Ga0207661_10067008 | 3300025944 | Bacteria | 2918 |
| 357 | Ga0207661_10121846 | 3300025944 | Bacteria | 2221 |
| 358 | Ga0207661_10129272 | 3300025944 | Bacteria | 2161 |
| 359 | Ga0207661_10189324 | 3300025944 | Bacteria | 1803 |
| 360 | Ga0207661_10260449 | 3300025944 | Bacteria | 1545 |
| 361 | Ga0207679_10782744 | 3300025945 | Bacteria | 869 |
| 362 | Ga0207667_10049597 | 3300025949 | Bacteria | 4433 |
| 363 | Ga0207667_10101797 | 3300025949 | Bacteria | 2963 |
| 364 | Ga0207667_10133752 | 3300025949 | Unclassified | 2554 |
| 365 | Ga0207667_10181528 | 3300025949 | Unclassified | 2161 |
| 366 | Ga0207667_10211450 | 3300025949 | Bacteria | 1988 |
| 367 | Ga0207667_10241328 | 3300025949 | Bacteria | 1849 |
| 368 | Ga0207651_11377929 | 3300025960 | Bacteria | 634 |
| 369 | Ga0207712_10002933 | 3300025961 | Bacteria | 10894 |
| 370 | Ga0207668_10098843 | 3300025972 | Bacteria | 2163 |
| 371 | Ga0207640_10233343 | 3300025981 | Bacteria | 1417 |
| 372 | Ga0207677_10276520 | 3300026023 | Bacteria | 1376 |
| 373 | Ga0207677_10540903 | 3300026023 | Bacteria | 1014 |
| 374 | Ga0207677_10717081 | 3300026023 | Bacteria | 889 |
| 375 | Ga0207677_10855653 | 3300026023 | Bacteria | 817 |
| 376 | Ga0207703_10791824 | 3300026035 | Unclassified | 905 |
| 377 | Ga0207639_10021581 | 3300026041 | Bacteria | 4627 |
| 378 | Ga0207639_10399872 | 3300026041 | Bacteria | 1237 |
| 379 | Ga0207678_10034139 | 3300026067 | Bacteria | 4431 |
| 380 | Ga0207708_10000175 | 3300026075 | Bacteria | 51009 |
| 381 | Ga0207702_10112952 | 3300026078 | Bacteria | 2419 |
| 382 | Ga0207702_10124703 | 3300026078 | Bacteria | 2310 |
| 383 | Ga0207702_10143253 | 3300026078 | Bacteria | 2165 |
| 384 | Ga0207702_10228241 | 3300026078 | Bacteria | 1738 |
| 385 | Ga0207702_10331867 | 3300026078 | Bacteria | 1451 |
| 386 | Ga0207702_10923960 | 3300026078 | Bacteria | 865 |
| 387 | Ga0207648_10000082 | 3300026089 | Bacteria | 89474 |
| 388 | Ga0207674_10004721 | 3300026116 | Bacteria | 16335 |
| 389 | Ga0207674_10054833 | 3300026116 | Bacteria | 4056 |
| 390 | Ga0207674_10832995 | 3300026116 | Bacteria | 890 |
| 391 | Ga0207675_100018883 | 3300026118 | Bacteria | 6435 |
| 392 | Ga0207675_100539600 | 3300026118 | Bacteria | 1164 |
| 393 | Ga0207683_10002143 | 3300026121 | Bacteria | 17337 |
| 394 | Ga0207683_10407772 | 3300026121 | Bacteria | 1251 |
| 395 | Ga0207683_12095811 | 3300026121 | Unclassified | 514 |
| 396 | Ga0207698_10042767 | 3300026142 | Bacteria | 3388 |
| 397 | Ga0207698_10390674 | 3300026142 | Bacteria | 1326 |
| 398 | Ga0209998_10079893 | 3300027717 | Bacteria | 791 |
| 399 | Ga0207428_10465728 | 3300027907 | Bacteria | 920 |
| 400 | Ga0207428_10832069 | 3300027907 | Unclassified | 655 |
| 401 | Ga0268266_10018012 | 3300028379 | Bacteria | 6021 |
| 402 | Ga0268266_10072502 | 3300028379 | Bacteria | 2987 |
| 403 | Ga0268265_10678628 | 3300028380 | Bacteria | 993 |
| 404 | Ga0268264_10199860 | 3300028381 | Bacteria | 1828 |
| 405 | Ga0265334_10034004 | 3300028573 | Bacteria | 2025 |
| 406 | Ga0265318_10059467 | 3300028577 | Bacteria | 1425 |
| 407 | Ga0265336_10041387 | 3300028666 | Bacteria | 1409 |
| 408 | Ga0265338_10006150 | 3300028800 | Bacteria | 15405 |
| 409 | Ga0265338_10064047 | 3300028800 | Bacteria | 3201 |
| 410 | Ga0265330_10050813 | 3300031235 | Bacteria | 1818 |
| 411 | Ga0265332_10131464 | 3300031238 | Bacteria | 1050 |
| 412 | Ga0265320_10296078 | 3300031240 | Bacteria | 716 |
| 413 | Ga0265325_10003953 | 3300031241 | Bacteria | 9484 |
| 414 | Ga0265329_10097063 | 3300031242 | Bacteria | 937 |
| 415 | Ga0265339_10142402 | 3300031249 | Bacteria | 1218 |
| 416 | Ga0265327_10012516 | 3300031251 | Bacteria | 5715 |
| 417 | Ga0265316_10009994 | 3300031344 | Bacteria | 8682 |
| 418 | Ga0307408_100133594 | 3300031548 | Bacteria | 1939 |
| 419 | Ga0307408_101292703 | 3300031548 | Bacteria | 683 |
| 420 | Ga0265313_10009829 | 3300031595 | Bacteria | 6158 |
| 421 | Ga0265314_10007139 | 3300031711 | Bacteria | 9733 |
| 422 | Ga0265342_10007806 | 3300031712 | Bacteria | 7776 |
| 423 | Ga0307405_10210747 | 3300031731 | Bacteria | 1418 |
| 424 | Ga0307413_11618829 | 3300031824 | Unclassified | 575 |
| 425 | Ga0307410_11528238 | 3300031852 | Unclassified | 588 |
| 426 | Ga0307406_10096227 | 3300031901 | Bacteria | 2005 |
| 427 | Ga0307407_10250833 | 3300031903 | Bacteria | 1212 |
| 428 | Ga0307412_10535134 | 3300031911 | Bacteria | 981 |
| 429 | Ga0307409_100108632 | 3300031995 | Bacteria | 2320 |
| 430 | Ga0307409_100675934 | 3300031995 | Bacteria | 1029 |
| 431 | Ga0307416_100035823 | 3300032002 | Bacteria | 3796 |
| 432 | Ga0307414_10228975 | 3300032004 | Bacteria | 1531 |
| 433 | Ga0307415_100463883 | 3300032126 | Bacteria | 1098 |
| 434 | Ga0373926_0178755 | 3300035083 | Bacteria | 813 |
| 435 | Ga0373936_0008139 | 3300035113 | Bacteria | 3942 |
| 436 | Ga0373945_0017754 | 3300035116 | Bacteria | 2413 |
| 437 | Ga0373943_0008552 | 3300035170 | Bacteria | 4589 |
| 438 | Ga0373935_0026048 | 3300035692 | Bacteria | 3606 |
| 439 | Ga0373947_0014472 | 3300035725 | Bacteria | 4526 |
| 440 | Ga0373947_0029763 | 3300035725 | Unclassified | 3205 |
| 441 | Ga0373925_0012189 | 3300037068 | Bacteria | 6223 |
| 442 | Ga0395899_0003564 | 3300037312 | Bacteria | 12326 |
| 443 | Ga0395899_0011539 | 3300037312 | Bacteria | 6765 |
| 444 | Ga0395899_0053989 | 3300037312 | Bacteria | 2974 |
| 445 | Ga0395899_0099058 | 3300037312 | Bacteria | 2106 |
| 446 | Ga0395899_0257268 | 3300037312 | Bacteria | 1195 |
| 447 | Ga0395900_0001626 | 3300037418 | Bacteria | 26408 |
| 448 | Ga0395900_0004447 | 3300037418 | Bacteria | 14849 |
| 449 | Ga0395900_0172014 | 3300037418 | Bacteria | 2204 |
| 450 | Ga0395900_0197714 | 3300037418 | Bacteria | 2036 |
| 451 | Ga0395900_0204501 | 3300037418 | Bacteria | 1996 |
| 452 | Ga0395900_0284505 | 3300037418 | Bacteria | 1644 |
| 453 | Ga0395900_0480084 | 3300037418 | Bacteria | 1195 |
| 454 | Ga0395898_0000824 | 3300037466 | Bacteria | 51781 |
| 455 | Ga0395898_0050375 | 3300037466 | Bacteria | 4075 |
| 456 | Ga0395898_0084404 | 3300037466 | Bacteria | 3061 |
| 457 | Ga0395898_0090454 | 3300037466 | Bacteria | 2945 |
| 458 | Ga0395898_0117906 | 3300037466 | Bacteria | 2543 |
| 459 | Ga0395898_0417962 | 3300037466 | Bacteria | 1278 |
| 460 | Ga0395898_0494721 | 3300037466 | Unclassified | 1163 |
| 461 | Ga0395898_0721309 | 3300037466 | Bacteria | 939 |
| 462 | Ga0395898_0814255 | 3300037466 | Bacteria | 874 |
| 463 | Ga0395898_1181958 | 3300037466 | Bacteria | 696 |
| 464 | Ga0395905_0001363 | 3300037471 | Bacteria | 29719 |
| 465 | Ga0395905_0010364 | 3300037471 | Bacteria | 9074 |
| 466 | Ga0395905_0028667 | 3300037471 | Bacteria | 5248 |
| 467 | Ga0395905_0047608 | 3300037471 | Bacteria | 4017 |
| 468 | Ga0395905_0236244 | 3300037471 | Bacteria | 1708 |
| 469 | Ga0395905_0327833 | 3300037471 | Bacteria | 1421 |
| 470 | Ga0395905_0513529 | 3300037471 | Bacteria | 1098 |
| 471 | Ga0436364_0261127 | 3300037853 | Bacteria | 2754 |
| 472 | Ga0395901_0000244 | 3300038443 | Bacteria | 67684 |
| 473 | Ga0395901_0002680 | 3300038443 | Bacteria | 17962 |
| 474 | Ga0395901_0036006 | 3300038443 | Bacteria | 5114 |
| 475 | Ga0395901_0071012 | 3300038443 | Bacteria | 3628 |
| 476 | Ga0395901_0144022 | 3300038443 | Unclassified | 2505 |
| 477 | Ga0395901_0164737 | 3300038443 | Bacteria | 2328 |
| 478 | Ga0395901_0293738 | 3300038443 | Bacteria | 1686 |
| 479 | Ga0395901_0333056 | 3300038443 | Bacteria | 1569 |
| 480 | Ga0395901_0422131 | 3300038443 | Bacteria | 1367 |
| 481 | Ga0395901_0629202 | 3300038443 | Unclassified | 1079 |
| 482 | Ga0395901_1195084 | 3300038443 | Bacteria | 726 |
| 483 | Ga0436365_1472723 | 3300039437 | Bacteria | 716 |
| 484 | Ga0436365_1646705 | 3300039437 | Bacteria | 1446 |
| 485 | Ga0436363_0088067 | 3300039450 | Bacteria | 1924 |
| 486 | Ga0436363_1699454 | 3300039450 | Bacteria | 3295 |
| 487 | Ga0436362_0634204 | 3300039453 | Bacteria | 1295 |
| 488 | Ga0439447_046109 | 3300041407 | Bacteria | 1050 |
| 489 | Ga0439461_0015815 | 3300041410 | Bacteria | 1449 |
| 490 | Ga0439465_0329674 | 3300041413 | Bacteria | 574 |
| 491 | Ga0439465_0374480 | 3300041413 | Unclassified | 540 |
| 492 | Ga0451789_0004674 | 3300041443 | Bacteria | 1133 |
| 493 | Ga0451839_1544580 | 3300041496 | Bacteria | 520 |
| 494 | Ga0451853_1850206 | 3300041512 | Unclassified | 555 |
| 495 | Ga0439437_023876 | 3300042000 | Unclassified | 749 |
| 496 | Ga0439448_0028289 | 3300042005 | Bacteria | 1770 |
| 497 | Ga0439455_0019229 | 3300042012 | Bacteria | 1609 |
| 498 | Ga0450902_084918 | 3300042137 | Bacteria | 557 |
| 499 | Ga0439446_0000838 | 3300042156 | Bacteria | 6580 |
| 500 | Ga0439434_0003603 | 3300042435 | Bacteria | 4525 |
| 501 | Ga0450916_050208 | 3300042530 | Unclassified | 656 |
| 502 | Ga0439440_0226088 | 3300042993 | Unclassified | 563 |
| 503 | Ga0466969_0207111 | 3300044656 | Bacteria | 894 |
| 504 | Ga0466969_0291819 | 3300044656 | Bacteria | 738 |
| 505 | Ga0466965_0142126 | 3300044683 | Bacteria | 1250 |
| 506 | Ga0466965_0480022 | 3300044683 | Unclassified | 695 |
| 507 | Ga0466966_0005063 | 3300044684 | Bacteria | 8660 |
| 508 | Ga0466966_0006031 | 3300044684 | Bacteria | 8001 |
| 509 | Ga0466966_0028061 | 3300044684 | Bacteria | 3667 |
| 510 | Ga0466966_0171071 | 3300044684 | Bacteria | 1320 |
| 511 | Ga0466961_0003168 | 3300044693 | Bacteria | 10245 |
| 512 | Ga0466961_0003920 | 3300044693 | Bacteria | 9308 |
| 513 | Ga0466961_0091045 | 3300044693 | Bacteria | 1926 |
| 514 | Ga0466961_0386554 | 3300044693 | Bacteria | 850 |
| 515 | Ga0466961_0433904 | 3300044693 | Unclassified | 796 |
| 516 | Ga0466961_0626293 | 3300044693 | Bacteria | 646 |
| 517 | Ga0466963_0001137 | 3300044694 | Bacteria | 13906 |
| 518 | Ga0466963_0003559 | 3300044694 | Bacteria | 8949 |
| 519 | Ga0466963_0007724 | 3300044694 | Bacteria | 6426 |
| 520 | Ga0466963_0009266 | 3300044694 | Bacteria | 5929 |
| 521 | Ga0466963_0024212 | 3300044694 | Bacteria | 3864 |
| 522 | Ga0466963_0046731 | 3300044694 | Bacteria | 2855 |
| 523 | Ga0466963_0065055 | 3300044694 | Bacteria | 2444 |
| 524 | Ga0466963_0114292 | 3300044694 | Bacteria | 1854 |
| 525 | Ga0466963_0144774 | 3300044694 | Bacteria | 1648 |
| 526 | Ga0466963_0161482 | 3300044694 | Bacteria | 1559 |
| 527 | Ga0466963_0190361 | 3300044694 | Unclassified | 1433 |
| 528 | Ga0466963_0326836 | 3300044694 | Unclassified | 1079 |
| 529 | Ga0466963_0645971 | 3300044694 | Bacteria | 747 |
| 530 | Ga0466964_0001534 | 3300044706 | Bacteria | 7945 |
| 531 | Ga0466964_0004731 | 3300044706 | Bacteria | 5030 |
| 532 | Ga0466964_0056279 | 3300044706 | Bacteria | 1626 |
| 533 | Ga0466964_0064900 | 3300044706 | Bacteria | 1528 |
| 534 | Ga0466971_0000469 | 3300044719 | Bacteria | 15840 |
| 535 | Ga0466971_0018695 | 3300044719 | Bacteria | 3072 |
| 536 | Ga0466971_0207023 | 3300044719 | Bacteria | 927 |
| 537 | Ga0466968_0021080 | 3300044735 | Bacteria | 2636 |
| 538 | Ga0466968_0045555 | 3300044735 | Bacteria | 1862 |
| 539 | Ga0466968_0073346 | 3300044735 | Bacteria | 1493 |
| 540 | Ga0466968_0117834 | 3300044735 | Bacteria | 1199 |
| 541 | Ga0466970_0021149 | 3300044765 | Bacteria | 3387 |
| 542 | Ga0466957_0013233 | 3300044842 | Bacteria | 4785 |
| 543 | Ga0466957_0030705 | 3300044842 | Bacteria | 3209 |
| 544 | Ga0466960_0141119 | 3300044901 | Bacteria | 1280 |
| 545 | Ga0466960_0337520 | 3300044901 | Unclassified | 857 |
| 546 | Ga0466960_0381284 | 3300044901 | Unclassified | 809 |
| 547 | Ga0466960_0981223 | 3300044901 | Bacteria | 518 |
| 548 | Ga0466959_0004921 | 3300045049 | Bacteria | 9047 |
| 549 | Ga0466959_0007042 | 3300045049 | Bacteria | 7859 |
| 550 | Ga0466959_0018160 | 3300045049 | Bacteria | 5162 |
| 551 | Ga0466959_0024117 | 3300045049 | Bacteria | 4504 |
| 552 | Ga0466959_0037088 | 3300045049 | Bacteria | 3601 |
| 553 | Ga0466958_0003237 | 3300045836 | Bacteria | 8407 |
| 554 | Ga0466958_0007568 | 3300045836 | Bacteria | 5980 |
| 555 | Ga0466958_0019514 | 3300045836 | Bacteria | 3947 |
| 556 | Ga0466958_0041096 | 3300045836 | Bacteria | 2781 |
| 557 | Ga0466958_0341247 | 3300045836 | Unclassified | 964 |
| 558 | Ga0466958_0460705 | 3300045836 | Unclassified | 823 |
| 559 | Ga0466958_0468958 | 3300045836 | Bacteria | 816 |
| 560 | Ga0466958_0481873 | 3300045836 | Bacteria | 804 |
| 561 | Ga0466967_0000859 | 3300045976 | Bacteria | 16152 |
| 562 | Ga0466967_0002328 | 3300045976 | Bacteria | 11748 |
| 563 | Ga0466967_0004759 | 3300045976 | Bacteria | 9241 |
| 564 | Ga0466967_0005890 | 3300045976 | Bacteria | 8586 |
| 565 | Ga0466967_0006213 | 3300045976 | Bacteria | 8418 |
| 566 | Ga0466967_0019124 | 3300045976 | Bacteria | 5499 |
| 567 | Ga0466967_0019521 | 3300045976 | Bacteria | 5452 |
| 568 | Ga0466967_0031365 | 3300045976 | Bacteria | 4473 |
| 569 | Ga0466967_0060145 | 3300045976 | Bacteria | 3365 |
| 570 | Ga0466967_0107455 | 3300045976 | Bacteria | 2559 |
| 571 | Ga0466967_0124924 | 3300045976 | Bacteria | 2382 |
| 572 | Ga0466967_0169661 | 3300045976 | Unclassified | 2052 |
| 573 | Ga0466967_0226629 | 3300045976 | Bacteria | 1778 |
| 574 | Ga0466967_0261675 | 3300045976 | Bacteria | 1655 |
| 575 | Ga0466967_0276804 | 3300045976 | Bacteria | 1609 |
| 576 | Ga0466967_0337549 | 3300045976 | Bacteria | 1456 |
| 577 | Ga0466967_0404686 | 3300045976 | Unclassified | 1328 |
| 578 | Ga0466967_0474418 | 3300045976 | Bacteria | 1225 |
| 579 | Ga0466967_0603779 | 3300045976 | Unclassified | 1083 |
| 580 | Ga0466967_0751441 | 3300045976 | Bacteria | 967 |
| 581 | Ga0466967_0777396 | 3300045976 | Archaea | 950 |
| 582 | Ga0466967_1152292 | 3300045976 | Bacteria | 772 |
| 583 | Ga0466967_2087492 | 3300045976 | Bacteria | 563 |
| 584 | Ga0495603_0029729 | 3300046455 | Bacteria | 3294 |
| 585 | Ga0495603_0090611 | 3300046455 | Bacteria | 1788 |
| 586 | Ga0495629_0055131 | 3300046459 | Bacteria | 2780 |
| 587 | Ga0495629_0075516 | 3300046459 | Unclassified | 2354 |
| 588 | Ga0495629_0342714 | 3300046459 | Unclassified | 1020 |
| 589 | Ga0495629_0383560 | 3300046459 | Bacteria | 956 |
| 590 | Ga0495641_0018748 | 3300046461 | Bacteria | 3563 |
| 591 | Ga0495641_0022803 | 3300046461 | Unclassified | 3125 |
| 592 | Ga0495641_0055941 | 3300046461 | Unclassified | 1790 |
| 593 | Ga0495651_0017715 | 3300046462 | Bacteria | 5515 |
| 594 | Ga0495653_0020122 | 3300046463 | Bacteria | 5410 |
| 595 | Ga0495582_0326106 | 3300046473 | Bacteria | 883 |
| 596 | Ga0495582_0501979 | 3300046473 | Bacteria | 701 |
| 597 | Ga0495605_0412927 | 3300046474 | Viruses | 560 |
| 598 | Ga0495639_0227579 | 3300046475 | Bacteria | 918 |
| 599 | Ga0495662_0064943 | 3300046476 | Bacteria | 1764 |
| 600 | Ga0495662_0070075 | 3300046476 | Bacteria | 1699 |
| 601 | Ga0495584_0039772 | 3300046491 | Unclassified | 2376 |
| 602 | Ga0495584_0484417 | 3300046491 | Bacteria | 630 |
| 603 | Ga0495585_0266316 | 3300046492 | Bacteria | 851 |
| 604 | Ga0495585_0319201 | 3300046492 | Bacteria | 760 |
| 605 | Ga0495594_0019914 | 3300046499 | Unclassified | 3570 |
| 606 | Ga0495594_0079340 | 3300046499 | Bacteria | 1832 |
| 607 | Ga0495596_0079626 | 3300046500 | Unclassified | 1272 |
| 608 | Ga0495596_0360595 | 3300046500 | Bacteria | 566 |
| 609 | Ga0495607_0411328 | 3300046501 | Viruses | 614 |
| 610 | Ga0495608_0076933 | 3300046511 | Bacteria | 2172 |
| 611 | Ga0495618_0094202 | 3300046514 | Unclassified | 1915 |
| 612 | Ga0495628_0029355 | 3300046516 | Bacteria | 4460 |
| 613 | Ga0495630_0006319 | 3300046517 | Bacteria | 8417 |
| 614 | Ga0495630_0014939 | 3300046517 | Bacteria | 5663 |
| 615 | Ga0495630_0645490 | 3300046517 | Bacteria | 811 |
| 616 | Ga0495663_0018070 | 3300046525 | Unclassified | 2006 |
| 617 | Ga0495642_0052903 | 3300046528 | Bacteria | 1673 |
| 618 | Ga0495642_0397831 | 3300046528 | Viruses | 607 |
| 619 | Ga0495652_0095655 | 3300046529 | Bacteria | 2420 |
| 620 | Ga0495665_0037759 | 3300046531 | Bacteria | 2577 |
| 621 | Ga0495640_0007660 | 3300046533 | Bacteria | 8489 |
| 622 | Ga0495586_0029827 | 3300046535 | Unclassified | 2920 |
| 623 | Ga0495587_0082938 | 3300046536 | Unclassified | 1857 |
| 624 | Ga0495621_0546665 | 3300046539 | Bacteria | 503 |
| 625 | Ga0495645_0417185 | 3300046543 | Bacteria | 853 |
| 626 | Ga0495667_0267910 | 3300046559 | Bacteria | 1085 |
| 627 | Ga0495656_0028997 | 3300046615 | Unclassified | 2225 |
| 628 | Ga0495659_0078032 | 3300046664 | Bacteria | 1252 |
| 629 | Ga0495659_0090575 | 3300046664 | Bacteria | 1174 |
| 630 | Ga0495659_0508394 | 3300046664 | Bacteria | 529 |
| 631 | Ga0495661_0258955 | 3300046665 | Bacteria | 885 |
| 632 | Ga0495588_0168981 | 3300046674 | Unclassified | 1156 |
| 633 | Ga0495588_0383659 | 3300046674 | Unclassified | 738 |
| 634 | Ga0495646_0077502 | 3300046680 | Unclassified | 1944 |
| 635 | Ga0495647_0001825 | 3300046681 | Bacteria | 6589 |
| 636 | Ga0495647_0125008 | 3300046681 | Bacteria | 1085 |
| 637 | Ga0495658_0002674 | 3300046683 | Bacteria | 8971 |
| 638 | Ga0495658_0004201 | 3300046683 | Bacteria | 7090 |
| 639 | Ga0495658_0493781 | 3300046683 | Unclassified | 783 |
| 640 | Ga0495613_0017137 | 3300046689 | Bacteria | 5394 |
| 641 | Ga0495613_0078401 | 3300046689 | Bacteria | 2403 |
| 642 | Ga0495613_0303317 | 3300046689 | Bacteria | 1105 |
| 643 | Ga0495613_0410340 | 3300046689 | Unclassified | 923 |
| 644 | Ga0495624_0042532 | 3300046690 | Bacteria | 2903 |
| 645 | Ga0495624_0137625 | 3300046690 | Unclassified | 1497 |
| 646 | Ga0495589_0166102 | 3300046794 | Bacteria | 1050 |
| 647 | Ga0495581_0020837 | 3300047315 | Bacteria | 3803 |
| 648 | Ga0495581_0038806 | 3300047315 | Bacteria | 2757 |
| 649 | Ga0495581_0604089 | 3300047315 | Bacteria | 635 |
| 650 | Ga0495604_0010671 | 3300047317 | Bacteria | 7289 |
| 651 | Ga0495636_0243790 | 3300047318 | Bacteria | 830 |
| 652 | Ga0495674_0000604 | 3300047319 | Bacteria | 33665 |
| 653 | Ga0495676_0019822 | 3300047321 | Bacteria | 5911 |
| 654 | Ga0495676_0036853 | 3300047321 | Bacteria | 4079 |
| 655 | Ga0495676_0056087 | 3300047321 | Unclassified | 3118 |
| 656 | Ga0495680_0001294 | 3300047322 | Bacteria | 27286 |
| 657 | Ga0495677_0129363 | 3300047445 | Bacteria | 966 |
| 658 | Ga0495677_0312429 | 3300047445 | Bacteria | 619 |
| 659 | Ga0495685_229643 | 3300047447 | Viruses | 591 |
| 660 | Ga0495684_0013764 | 3300047471 | Bacteria | 6226 |
| 661 | Ga0495614_0243808 | 3300048089 | Bacteria | 821 |
| 662 | Ga0496100_0000872 | 3300048903 | Bacteria | 14404 |
| 663 | Ga0496100_0008891 | 3300048903 | Bacteria | 5618 |
| 664 | Ga0496100_0012306 | 3300048903 | Bacteria | 4901 |
| 665 | Ga0496100_0063667 | 3300048903 | Bacteria | 2438 |
| 666 | Ga0496100_0280577 | 3300048903 | Bacteria | 1242 |
| 667 | Ga0496100_0356359 | 3300048903 | Bacteria | 1106 |
| 668 | Ga0496100_0383994 | 3300048903 | Bacteria | 1067 |
| 669 | Ga0496100_0659777 | 3300048903 | Bacteria | 815 |
| 670 | Ga0496101_0001154 | 3300048904 | Bacteria | 15804 |
| 671 | Ga0496101_0016759 | 3300048904 | Bacteria | 4959 |
| 672 | Ga0496101_0026973 | 3300048904 | Bacteria | 3995 |
| 673 | Ga0496101_0135874 | 3300048904 | Bacteria | 1871 |
| 674 | Ga0496101_0318779 | 3300048904 | Bacteria | 1219 |
| 675 | Ga0496101_0528536 | 3300048904 | Bacteria | 932 |
| 676 | Ga0496101_1008864 | 3300048904 | Unclassified | 654 |
| 677 | Ga0496102_0002435 | 3300048905 | Bacteria | 15873 |
| 678 | Ga0496102_0062650 | 3300048905 | Bacteria | 3406 |
| 679 | Ga0496102_0078757 | 3300048905 | Bacteria | 3034 |
| 680 | Ga0496102_0240232 | 3300048905 | Bacteria | 1708 |
| 681 | Ga0496102_0314062 | 3300048905 | Bacteria | 1476 |
| 682 | Ga0496102_0366654 | 3300048905 | Bacteria | 1356 |
| 683 | Ga0496102_0478360 | 3300048905 | Bacteria | 1167 |
| 684 | Ga0496103_0001580 | 3300048906 | Bacteria | 15016 |
| 685 | Ga0496103_0236395 | 3300048906 | Bacteria | 1175 |
| 686 | Ga0496103_0264411 | 3300048906 | Bacteria | 1107 |
| 687 | Ga0496103_0306261 | 3300048906 | Bacteria | 1022 |
| 688 | Ga0496103_0537755 | 3300048906 | Bacteria | 746 |
| 689 | Ga0496104_0013250 | 3300048907 | Bacteria | 7431 |
| 690 | Ga0496104_0065377 | 3300048907 | Bacteria | 3451 |
| 691 | Ga0496104_0156427 | 3300048907 | Bacteria | 2187 |
| 692 | Ga0496104_0195748 | 3300048907 | Bacteria | 1933 |
| 693 | Ga0496104_0279482 | 3300048907 | Bacteria | 1582 |
| 694 | Ga0496104_0625568 | 3300048907 | Bacteria | 986 |
| 695 | Ga0496105_0000413 | 3300048908 | Bacteria | 28035 |
| 696 | Ga0496105_0016151 | 3300048908 | Bacteria | 5955 |
| 697 | Ga0496105_0037651 | 3300048908 | Bacteria | 3983 |
| 698 | Ga0496105_0098633 | 3300048908 | Bacteria | 2412 |
| 699 | Ga0496105_1049112 | 3300048908 | Bacteria | 607 |
| 700 | Ga0496106_0000380 | 3300048909 | Bacteria | 31592 |
| 701 | Ga0496106_0001856 | 3300048909 | Bacteria | 15812 |
| 702 | Ga0496106_0073772 | 3300048909 | Bacteria | 2611 |
| 703 | Ga0496106_0097745 | 3300048909 | Bacteria | 2273 |
| 704 | Ga0496106_0119589 | 3300048909 | Bacteria | 2058 |
| 705 | Ga0496107_0024373 | 3300048910 | Unclassified | 4280 |
| 706 | Ga0496107_0025342 | 3300048910 | Bacteria | 4199 |
| 707 | Ga0496107_0029123 | 3300048910 | Bacteria | 3926 |
| 708 | Ga0496107_0036737 | 3300048910 | Bacteria | 3514 |
| 709 | Ga0496107_0045659 | 3300048910 | Bacteria | 3152 |
| 710 | Ga0496107_0058620 | 3300048910 | Bacteria | 2784 |
| 711 | Ga0496107_0084568 | 3300048910 | Bacteria | 2315 |
| 712 | Ga0496107_0120999 | 3300048910 | Bacteria | 1929 |
| 713 | Ga0496108_0002822 | 3300048911 | Bacteria | 13939 |
| 714 | Ga0496108_0008505 | 3300048911 | Bacteria | 8326 |
| 715 | Ga0496108_0026029 | 3300048911 | Bacteria | 4825 |
| 716 | Ga0496108_0322806 | 3300048911 | Bacteria | 1346 |
| 717 | Ga0496108_0595772 | 3300048911 | Bacteria | 963 |
| 718 | Ga0496108_0622853 | 3300048911 | Bacteria | 939 |
| 719 | Ga0496109_0001408 | 3300048912 | Bacteria | 19947 |
| 720 | Ga0496109_0001538 | 3300048912 | Bacteria | 19181 |
| 721 | Ga0496109_0006986 | 3300048912 | Bacteria | 9529 |
| 722 | Ga0496109_0088783 | 3300048912 | Bacteria | 2857 |
| 723 | Ga0496109_0100769 | 3300048912 | Bacteria | 2680 |
| 724 | Ga0496109_0209329 | 3300048912 | Unclassified | 1834 |
| 725 | Ga0496109_0379394 | 3300048912 | Unclassified | 1335 |
| 726 | Ga0496110_0000288 | 3300048913 | Bacteria | 32994 |
| 727 | Ga0496110_0002556 | 3300048913 | Bacteria | 13676 |
| 728 | Ga0496110_0020720 | 3300048913 | Bacteria | 5553 |
| 729 | Ga0496110_0049840 | 3300048913 | Bacteria | 3675 |
| 730 | Ga0496111_0000284 | 3300048914 | Bacteria | 24558 |
| 731 | Ga0496111_0006816 | 3300048914 | Bacteria | 7450 |
| 732 | Ga0496111_0083769 | 3300048914 | Bacteria | 2330 |
| 733 | Ga0496111_0155993 | 3300048914 | Bacteria | 1694 |
| 734 | Ga0496111_0495053 | 3300048914 | Bacteria | 900 |
| 735 | Ga0496111_0651343 | 3300048914 | Bacteria | 768 |
| 736 | Ga0496112_0001681 | 3300048915 | Bacteria | 17225 |
| 737 | Ga0496112_0005474 | 3300048915 | Bacteria | 10991 |
| 738 | Ga0496112_0025777 | 3300048915 | Bacteria | 5648 |
| 739 | Ga0496112_0126898 | 3300048915 | Bacteria | 2522 |
| 740 | Ga0496112_0131776 | 3300048915 | Bacteria | 2471 |
| 741 | Ga0496112_0442967 | 3300048915 | Bacteria | 1237 |
| 742 | Ga0496112_0891493 | 3300048915 | Bacteria | 812 |
| 743 | Ga0496112_1130229 | 3300048915 | Bacteria | 701 |
| 744 | Ga0496113_0011988 | 3300048916 | Bacteria | 5812 |
| 745 | Ga0496113_0103625 | 3300048916 | Bacteria | 2207 |
| 746 | Ga0496113_0151921 | 3300048916 | Bacteria | 1827 |
| 747 | Ga0496113_0208162 | 3300048916 | Bacteria | 1556 |
| 748 | Ga0496113_0788439 | 3300048916 | Bacteria | 755 |
| 749 | Ga0496114_0001478 | 3300048917 | Bacteria | 17845 |
| 750 | Ga0496114_0015574 | 3300048917 | Bacteria | 6113 |
| 751 | Ga0496114_0021947 | 3300048917 | Bacteria | 5198 |
| 752 | Ga0496114_0088077 | 3300048917 | Bacteria | 2633 |
| 753 | Ga0496114_0120060 | 3300048917 | Bacteria | 2260 |
| 754 | Ga0496114_0614840 | 3300048917 | Unclassified | 957 |
| 755 | Ga0496114_1677310 | 3300048917 | Bacteria | 524 |
| 756 | Ga0496115_0001310 | 3300048918 | Bacteria | 17721 |
| 757 | Ga0496115_0002457 | 3300048918 | Bacteria | 13313 |
| 758 | Ga0496115_0083568 | 3300048918 | Bacteria | 2603 |
| 759 | Ga0496115_0495816 | 3300048918 | Bacteria | 982 |
| 760 | Ga0496115_0557422 | 3300048918 | Unclassified | 915 |
| 761 | Ga0501032_0747947 | 3300049569 | Bacteria | 619 |
| 762 | Ga0501032_1027425 | 3300049569 | Bacteria | 517 |
| 763 | Ga0501034_0051076 | 3300049571 | Bacteria | 4170 |
| 764 | Ga0501036_0389032 | 3300049572 | Bacteria | 1163 |
| 765 | Ga0501038_0023496 | 3300049574 | Bacteria | 5510 |
| 766 | Ga0501038_0162326 | 3300049574 | Bacteria | 1815 |
| 767 | Ga0501038_0866933 | 3300049574 | Bacteria | 668 |
| 768 | Ga0501040_0101788 | 3300049576 | Bacteria | 2004 |
| 769 | Ga0501042_0017321 | 3300049578 | Bacteria | 4967 |
| 770 | Ga0501043_0163474 | 3300049579 | Bacteria | 1739 |
| 771 | Ga0501046_0207940 | 3300049580 | Bacteria | 1454 |
| 772 | Ga0501046_0450302 | 3300049580 | Bacteria | 926 |
| 773 | Ga0501047_0019815 | 3300049581 | Bacteria | 6456 |
| 774 | Ga0501047_0024860 | 3300049581 | Bacteria | 5751 |
| 775 | Ga0501047_0072970 | 3300049581 | Bacteria | 3304 |
| 776 | Ga0501047_0355603 | 3300049581 | Bacteria | 1301 |
| 777 | Ga0501048_0014828 | 3300049582 | Bacteria | 5764 |
| 778 | Ga0501048_0666908 | 3300049582 | Unclassified | 747 |
| 779 | Ga0501067_0001127 | 3300049583 | Bacteria | 14464 |
| 780 | Ga0501067_0037524 | 3300049583 | Bacteria | 2691 |
| 781 | Ga0501067_0177230 | 3300049583 | Bacteria | 1187 |
| 782 | Ga0501068_0057163 | 3300049584 | Bacteria | 2365 |
| 783 | Ga0501069_0044224 | 3300049585 | Bacteria | 2465 |
| 784 | Ga0501069_0056653 | 3300049585 | Unclassified | 2184 |
| 785 | Ga0501069_0123102 | 3300049585 | Bacteria | 1482 |
| 786 | Ga0501070_0007864 | 3300049586 | Bacteria | 9035 |
| 787 | Ga0501070_0082062 | 3300049586 | Bacteria | 2668 |
| 788 | Ga0501070_0112698 | 3300049586 | Bacteria | 2248 |
| 789 | Ga0501070_0175845 | 3300049586 | Bacteria | 1762 |
| 790 | Ga0501070_0178309 | 3300049586 | Bacteria | 1749 |
| 791 | Ga0501070_0436709 | 3300049586 | Bacteria | 1056 |
| 792 | Ga0501071_0014250 | 3300049587 | Bacteria | 5437 |
| 793 | Ga0501072_0099725 | 3300049588 | Bacteria | 2308 |
| 794 | Ga0501072_0439584 | 3300049588 | Unclassified | 1033 |
| 795 | Ga0501072_0936720 | 3300049588 | Bacteria | 676 |
| 796 | Ga0501073_0025021 | 3300049589 | Bacteria | 4284 |
| 797 | Ga0501073_0278207 | 3300049589 | Bacteria | 1155 |
| 798 | Ga0501074_0000736 | 3300049590 | Bacteria | 20545 |
| 799 | Ga0501074_0133281 | 3300049590 | Bacteria | 1777 |
| 800 | Ga0501074_0192630 | 3300049590 | Bacteria | 1453 |
| 801 | Ga0501074_0511625 | 3300049590 | Bacteria | 850 |
| 802 | Ga0501075_0012994 | 3300049591 | Bacteria | 5933 |
| 803 | Ga0501076_0027201 | 3300049592 | Bacteria | 4436 |
| 804 | Ga0501077_0018427 | 3300049593 | Bacteria | 4418 |
| 805 | Ga0501079_0078813 | 3300049741 | Bacteria | 2548 |
| 806 | Ga0501080_0000499 | 3300049742 | Bacteria | 30720 |
| 807 | Ga0501080_0045375 | 3300049742 | Bacteria | 4091 |
| 808 | Ga0501080_0484954 | 3300049742 | Bacteria | 1106 |
| 809 | Ga0501081_0036936 | 3300049743 | Bacteria | 3332 |
| 810 | Ga0501083_0090671 | 3300049744 | Bacteria | 2019 |
| 811 | Ga0501035_0257356 | 3300049822 | Bacteria | 1481 |
| 812 | Ga0501035_0884057 | 3300049822 | Bacteria | 709 |
| 813 | Ga0501044_0173566 | 3300049823 | Bacteria | 2126 |
| 814 | Ga0501044_0616475 | 3300049823 | Bacteria | 977 |
| 815 | Ga0501044_0892707 | 3300049823 | Bacteria | 764 |
| 816 | Ga0501045_0000429 | 3300049824 | Bacteria | 25701 |
| 817 | nmdc:mga00v17_246541_c1 | 3300050491 | Bacteria | 1158 |
| 818 | nmdc:mga0yw44_805866_c1 | 3300050492 | Bacteria | 638 |
| 819 | nmdc:mga05p37_214220_c1 | 3300050507 | Bacteria | 2327 |
| 820 | nmdc:mga05p37_2477_c1 | 3300050507 | Bacteria | 21478 |
| 821 | nmdc:mga05p37_6790_c1 | 3300050507 | Bacteria | 13486 |
| 822 | nmdc:mga05p37_724856_c1 | 3300050507 | Bacteria | 1100 |
| 823 | nmdc:mga09592_16652_c1 | 3300050508 | Bacteria | 6016 |
| 824 | nmdc:mga0qj67_13175_c1 | 3300050509 | Bacteria | 6242 |
| 825 | nmdc:mga0qj67_132149_c1 | 3300050509 | Bacteria | 2022 |
| 826 | nmdc:mga06r32_1301667_c1 | 3300050510 | Bacteria | 671 |
| 827 | nmdc:mga06r32_901148_c1 | 3300050510 | Bacteria | 841 |
| 828 | nmdc:mga08y16_103397_c1 | 3300050511 | Bacteria | 2966 |
| 829 | nmdc:mga08y16_1336378_c1 | 3300050511 | Unclassified | 682 |
| 830 | nmdc:mga0n895_231402_c1 | 3300050512 | Bacteria | 1876 |
| 831 | nmdc:mga0n895_74762_c1 | 3300050512 | Bacteria | 3367 |
| 832 | nmdc:mga0rr50_249065_c1 | 3300050513 | Bacteria | 1475 |
| 833 | nmdc:mga0rr50_70984_c1 | 3300050513 | Bacteria | 2656 |
| 834 | nmdc:mga08x19_43029_c1 | 3300050514 | Bacteria | 2881 |
| 835 | nmdc:mga0a205_1260108_c1 | 3300050515 | Unclassified | 587 |
| 836 | nmdc:mga0a205_66112_c1 | 3300050515 | Bacteria | 3494 |
| 837 | nmdc:mga0a205_97071_c1 | 3300050515 | Bacteria | 2846 |
| 838 | Ga0495601_0028288 | 3300053077 | Bacteria | 3472 |
| 839 | Ga0495595_0091937 | 3300053084 | Unclassified | 1456 |
| 840 | Ga0495619_0043577 | 3300053085 | Bacteria | 2942 |
| 841 | Ga0501084_0009449 | 3300054114 | Bacteria | 8069 |
| 842 | Ga0501084_0328034 | 3300054114 | Bacteria | 1293 |
| 843 | Ga0590071_020351 | 3300059421 | Bacteria | 1563 |
| 844 | Ga0590074_022246 | 3300059423 | Bacteria | 1095 |
| 845 | Ga0590077_015851 | 3300059426 | Bacteria | 1578 |
| 846 | Ga0501082_0056162 | 3300060353 | Bacteria | 3391 |
| 847 | Ga0466962_0003629 | 3300061719 | Bacteria | 7359 |
| 848 | Ga0466962_0020288 | 3300061719 | Bacteria | 3194 |
| 849 | Ga0466962_0039457 | 3300061719 | Bacteria | 2261 |
| 850 | Ga0466962_0051664 | 3300061719 | Bacteria | 1966 |
| 851 | Ga0466962_0140595 | 3300061719 | Bacteria | 1169 |
| 852 | Ga0530510_0009672 | 3300061734 | Bacteria | 6766 |
| 853 | Ga0530510_0297016 | 3300061734 | Bacteria | 1208 |
| 854 | Ga0075434_100294970 | |||
| 855 | JGI24749J21850_1022907 | |||
| 856 | JGI24744J21845_10037716 | |||
| 857 | Ga0070658_10036571 | |||
| 858 | Ga0070658_10094616 | |||
| 859 | Ga0070658_10104089 | |||
| 860 | Ga0070658_11005879 | |||
| 861 | Ga0070683_100037582 | |||
| 862 | Ga0070683_100045570 | |||
| 863 | Ga0070683_100106057 | |||
| 864 | Ga0070690_100010870 | |||
| 865 | Ga0070680_100143926 | |||
| 866 | Ga0070680_100156968 | |||
| 867 | Ga0070680_100223236 | |||
| 868 | Ga0070680_101346384 | |||
| 869 | Ga0070682_100001353 | |||
| 870 | Ga0070682_100212711 | |||
| 871 | Ga0070682_100333394 | |||
| 872 | Ga0068868_100441901 | |||
| 873 | Ga0068868_100570019 | |||
| 874 | Ga0070660_100007998 | |||
| 875 | Ga0070660_100015912 | |||
| 876 | Ga0070660_100093203 | |||
| 877 | Ga0070660_100148586 | |||
| 878 | Ga0070660_100269301 | |||
| 879 | Ga0070660_100344355 | |||
| 880 | Ga0070660_100493616 | |||
| 881 | Ga0070660_100653434 | |||
| 882 | Ga0070691_10956086 | |||
| 883 | Ga0070687_100009155 | |||
| 884 | Ga0070687_100382950 | |||
| 885 | Ga0070661_100040189 | |||
| 886 | Ga0070692_10682338 | |||
| 887 | Ga0070669_100654407 | |||
| 888 | Ga0070675_100130161 | |||
| 889 | Ga0070673_100148930 | |||
| 890 | Ga0070659_100003771 | |||
| 891 | Ga0070659_100042127 | |||
| 892 | Ga0070659_100141754 | |||
| 893 | Ga0070659_100611963 | |||
| 894 | Ga0070659_101176694 | |||
| 895 | Ga0070703_10316755 | |||
| 896 | Ga0070709_10191392 | |||
| 897 | Ga0070709_10971570 | |||
| 898 | Ga0070709_11730319 | |||
| 899 | Ga0070714_100035545 | |||
| 900 | Ga0070714_100077257 | |||
| 901 | Ga0070714_100339043 | |||
| 902 | Ga0070714_100548355 | |||
| 903 | Ga0070714_101243716 | |||
| 904 | Ga0070713_100588914 | |||
| 905 | Ga0070713_100936479 | |||
| 906 | Ga0070710_10146116 | |||
| 907 | Ga0070701_10008806 | |||
| 908 | Ga0070701_10501816 | |||
| 909 | Ga0070711_100002187 | |||
| 910 | Ga0070711_100012056 | |||
| 911 | Ga0070711_100198592 | |||
| 912 | Ga0070711_100599075 | |||
| 913 | Ga0070711_101408566 | |||
| 914 | Ga0070711_101412236 | |||
| 915 | Ga0070700_100002757 | |||
| 916 | Ga0070700_100805662 | |||
| 917 | Ga0070694_100029990 | |||
| 918 | Ga0070663_101097367 | |||
| 919 | Ga0070663_101323166 | |||
| 920 | Ga0070678_100002780 | |||
| 921 | Ga0070678_101723710 | |||
| 922 | Ga0070681_10015700 | |||
| 923 | Ga0070681_10035668 | |||
| 924 | Ga0070681_10275245 | |||
| 925 | Ga0070681_10455838 | |||
| 926 | Ga0070681_10649802 | |||
| 927 | Ga0068867_100000550 | |||
| 928 | Ga0070685_10001027 | |||
| 929 | Ga0070706_100033135 | |||
| 930 | Ga0070706_100242221 | |||
| 931 | Ga0070706_101417444 | |||
| 932 | Ga0070707_100001094 | |||
| 933 | Ga0070707_100999584 | |||
| 934 | Ga0070698_100026743 | |||
| 935 | Ga0070698_100146394 | |||
| 936 | Ga0070698_100224357 | |||
| 937 | Ga0070699_100071957 | |||
| 938 | Ga0070699_100190846 | |||
| 939 | Ga0070699_100238644 | |||
| 940 | Ga0070699_100814400 | |||
| 941 | Ga0070679_100023086 | |||
| 942 | Ga0070679_100050172 | |||
| 943 | Ga0070679_100082883 | |||
| 944 | Ga0070679_100172249 | |||
| 945 | Ga0070679_100176495 | |||
| 946 | Ga0070679_100250630 | |||
| 947 | Ga0070679_100420637 | |||
| 948 | Ga0070679_100801740 | |||
| 949 | Ga0070679_100974338 | |||
| 950 | Ga0070684_100137723 | |||
| 951 | Ga0070684_100273652 | |||
| 952 | Ga0070684_100616947 | |||
| 953 | Ga0070684_101385986 | |||
| 954 | Ga0070684_101916387 | |||
| 955 | Ga0070697_100115563 | |||
| 956 | Ga0068853_100004653 | |||
| 957 | Ga0068853_100101626 | |||
| 958 | Ga0068853_101015247 | |||
| 959 | Ga0070672_100243590 | |||
| 960 | Ga0070686_100002324 | |||
| 961 | Ga0070686_100439690 | |||
| 962 | Ga0070695_100374167 | |||
| 963 | Ga0070696_100014317 | |||
| 964 | Ga0070693_100194078 | |||
| 965 | Ga0070693_100622718 | |||
| 966 | Ga0070665_100007548 | |||
| 967 | Ga0070665_100032068 | |||
| 968 | Ga0070704_100005238 | |||
| 969 | Ga0070704_100298837 | |||
| 970 | Ga0070704_101157390 | |||
| 971 | Ga0068855_100028295 | |||
| 972 | Ga0068855_100048620 | |||
| 973 | Ga0068855_100088984 | |||
| 974 | Ga0068855_100112215 | |||
| 975 | Ga0068855_100209553 | |||
| 976 | Ga0068855_100467152 | |||
| 977 | Ga0068857_100011411 | |||
| 978 | Ga0068857_100195364 | |||
| 979 | Ga0068854_100082317 | |||
| 980 | Ga0068854_100266116 | |||
| 981 | Ga0068856_100009339 | |||
| 982 | Ga0068856_100111950 | |||
| 983 | Ga0068856_100211859 | |||
| 984 | Ga0068856_100301589 | |||
| 985 | Ga0068856_100329503 | |||
| 986 | Ga0068856_100546278 | |||
| 987 | Ga0068856_102152128 | |||
| 988 | Ga0070702_100003004 | |||
| 989 | Ga0068852_100014317 | |||
| 990 | Ga0068852_100074071 | |||
| 991 | Ga0068852_100098441 | |||
| 992 | Ga0068852_100506960 | |||
| 993 | Ga0068859_100027843 | |||
| 994 | Ga0068861_100032064 | |||
| 995 | Ga0068861_100808496 | |||
| 996 | Ga0068851_10589004 | |||
| 997 | Ga0068860_100171690 | |||
| 998 | Ga0068860_102370854 | |||
| 999 | Ga0081539_10073708 | |||
| 1000 | Ga0070717_10021799 | |||
| 1001 | Ga0070717_10672654 | |||
| 1002 | Ga0075365_10700978 | |||
| 1003 | Ga0075364_10269603 | |||
| 1004 | Ga0075364_10505660 | |||
| 1005 | Ga0075432_10258876 | |||
| 1006 | Ga0070715_10073231 | |||
| 1007 | Ga0070712_100015106 | |||
| 1008 | Ga0070712_100069346 | |||
| 1009 | Ga0070712_100069414 | |||
| 1010 | Ga0097621_100006172 | |||
| 1011 | Ga0097621_100198145 | |||
| 1012 | Ga0068871_100293188 | |||
| 1013 | Ga0068871_100821938 | |||
| 1014 | Ga0068871_101754560 | |||
| 1015 | Ga0075428_100093160 | |||
| 1016 | Ga0075430_100805559 | |||
| 1017 | Ga0075431_100193601 | |||
| 1018 | Ga0075431_100651381 | |||
| 1019 | Ga0075433_10014069 | |||
| 1020 | Ga0075433_10271436 | |||
| 1021 | Ga0075434_100010906 | |||
| 1022 | Ga0075434_101009410 | |||
| 1023 | Ga0075429_100011218 | |||
| 1024 | Ga0075429_100963370 | |||
| 1025 | Ga0068865_100000227 | |||
| 1026 | Ga0075436_100039906 | |||
| 1027 | Ga0097620_100027843 | |||
| 1028 | Ga0075435_100078957 | |||
| 1029 | Ga0075435_100131872 | |||
| 1030 | Ga0075435_100188256 | |||
| 1031 | Ga0105240_10051622 | |||
| 1032 | Ga0105240_10061052 | |||
| 1033 | Ga0105240_10600297 | |||
| 1034 | Ga0105240_12213464 | |||
| 1035 | Ga0111539_10094787 | |||
| 1036 | Ga0111539_10108916 | |||
| 1037 | Ga0105245_10023004 | |||
| 1038 | Ga0105245_10489437 | |||
| 1039 | Ga0105245_11436731 | |||
| 1040 | Ga0114129_10040444 | |||
| 1041 | Ga0114129_10055751 | |||
| 1042 | Ga0114129_10083841 | |||
| 1043 | Ga0114129_10095852 | |||
| 1044 | Ga0114129_11030461 | |||
| 1045 | Ga0114129_11902660 | |||
| 1046 | Ga0105243_10436534 | |||
| 1047 | Ga0105241_10065053 | |||
| 1048 | Ga0105241_10380142 | |||
| 1049 | Ga0105241_10815440 | |||
| 1050 | Ga0105242_10001454 | |||
| 1051 | Ga0105248_10062399 | |||
| 1052 | Ga0105248_12234648 | |||
| 1053 | Ga0105248_12297129 | |||
| 1054 | Ga0105237_10037076 | |||
| 1055 | Ga0105237_10178240 | |||
| 1056 | Ga0105237_10429259 | |||
| 1057 | Ga0105237_10557635 | |||
| 1058 | Ga0105237_12125518 | |||
| 1059 | Ga0105238_10040827 | |||
| 1060 | Ga0105249_10002535 | |||
| 1061 | Ga0105249_10480408 | |||
| 1062 | Ga0105239_10001933 | |||
| 1063 | Ga0105239_10027377 | |||
| 1064 | Ga0105239_10722610 | |||
| 1065 | Ga0105239_11899156 | |||
| 1066 | Ga0105239_13055035 | |||
| 1067 | Ga0105246_11427591 | |||
| 1068 | Ga0157373_10615442 | |||
| 1069 | Ga0157373_10656772 | |||
| 1070 | Ga0157371_10203443 | |||
| 1071 | Ga0157371_10362177 | |||
| 1072 | Ga0157371_10510877 | |||
| 1073 | Ga0157370_10013920 | |||
| 1074 | Ga0157370_10021781 | |||
| 1075 | Ga0157370_10027545 | |||
| 1076 | Ga0157370_10089902 | |||
| 1077 | Ga0157370_10383295 | |||
| 1078 | Ga0157370_10670869 | |||
| 1079 | Ga0157370_11066674 | |||
| 1080 | Ga0157369_10010672 | |||
| 1081 | Ga0157369_10084027 | |||
| 1082 | Ga0157369_10097700 | |||
| 1083 | Ga0157369_10348917 | |||
| 1084 | Ga0157374_10014191 | |||
| 1085 | Ga0157374_10869611 | |||
| 1086 | Ga0157378_10002034 | |||
| 1087 | Ga0163162_10002291 | |||
| 1088 | Ga0163162_10750196 | |||
| 1089 | Ga0157372_10109170 | |||
| 1090 | Ga0157372_10254602 | |||
| 1091 | Ga0157372_10610316 | |||
| 1092 | Ga0157372_11247871 | |||
| 1093 | Ga0157372_11744624 | |||
| 1094 | Ga0157375_10037709 | |||
| 1095 | Ga0157375_10054990 | |||
| 1096 | Ga0157375_10686967 | |||
| 1097 | Ga0157375_11946180 | |||
| 1098 | Ga0157375_12461618 | |||
| 1099 | Ga0157380_10002637 | |||
| 1100 | Ga0182008_10085595 | |||
| 1101 | Ga0157377_10022007 | |||
| 1102 | Ga0157376_10077158 | |||
| 1103 | Ga0197907_10994198 | |||
| 1104 | Ga0197907_11299474 | |||
| 1105 | Ga0206356_10008307 | |||
| 1106 | Ga0206356_10150742 | |||
| 1107 | Ga0206356_10827326 | |||
| 1108 | Ga0206356_11299735 | |||
| 1109 | Ga0206354_10202118 | |||
| 1110 | Ga0206354_10358543 | |||
| 1111 | Ga0206354_11143875 | |||
| 1112 | Ga0206353_10804099 | |||
| 1113 | Ga0206353_10879736 | |||
| 1114 | Ga0206353_11861837 | |||
| 1115 | Ga0213876_10199893 | |||
| 1116 | Ga0207692_11012264 | |||
| 1117 | Ga0207642_10001151 | |||
| 1118 | Ga0207688_10057984 | |||
| 1119 | Ga0207685_10150778 | |||
| 1120 | Ga0207685_10440878 | |||
| 1121 | Ga0207699_10100917 | |||
| 1122 | Ga0207699_10212253 | |||
| 1123 | Ga0207705_10005200 | |||
| 1124 | Ga0207705_10158330 | |||
| 1125 | Ga0207705_10209113 | |||
| 1126 | Ga0207705_10303845 | |||
| 1127 | Ga0207705_10321617 | |||
| 1128 | Ga0207705_10373251 | |||
| 1129 | Ga0207684_10106846 | |||
| 1130 | Ga0207684_10260916 | |||
| 1131 | Ga0207684_11057574 | |||
| 1132 | Ga0207654_10629409 | |||
| 1133 | Ga0207707_10017189 | |||
| 1134 | Ga0207707_10073017 | |||
| 1135 | Ga0207707_10082799 | |||
| 1136 | Ga0207707_10112059 | |||
| 1137 | Ga0207707_10148660 | |||
| 1138 | Ga0207695_10097899 | |||
| 1139 | Ga0207695_10116989 | |||
| 1140 | Ga0207695_10561191 | |||
| 1141 | Ga0207671_10103617 | |||
| 1142 | Ga0207671_10316881 | |||
| 1143 | Ga0207671_10484439 | |||
| 1144 | Ga0207693_10001103 | |||
| 1145 | Ga0207693_10008867 | |||
| 1146 | Ga0207693_10015845 | |||
| 1147 | Ga0207693_10096026 | |||
| 1148 | Ga0207663_10083739 | |||
| 1149 | Ga0207663_10242943 | |||
| 1150 | Ga0207663_10536268 | |||
| 1151 | Ga0207663_10564272 | |||
| 1152 | Ga0207663_11362565 | |||
| 1153 | Ga0207660_10114927 | |||
| 1154 | Ga0207660_10136979 | |||
| 1155 | Ga0207660_10319076 | |||
| 1156 | Ga0207660_10472480 | |||
| 1157 | Ga0207662_10053700 | |||
| 1158 | Ga0207657_10005129 | |||
| 1159 | Ga0207657_10010441 | |||
| 1160 | Ga0207657_10030136 | |||
| 1161 | Ga0207657_10047476 | |||
| 1162 | Ga0207657_10102133 | |||
| 1163 | Ga0207657_10136437 | |||
| 1164 | Ga0207657_10234620 | |||
| 1165 | Ga0207657_10399586 | |||
| 1166 | Ga0207657_10501340 | |||
| 1167 | Ga0207649_10036640 | |||
| 1168 | Ga0207649_10073141 | |||
| 1169 | Ga0207652_10065929 | |||
| 1170 | Ga0207652_10083152 | |||
| 1171 | Ga0207652_10227457 | |||
| 1172 | Ga0207652_10238455 | |||
| 1173 | Ga0207652_10303209 | |||
| 1174 | Ga0207652_10383185 | |||
| 1175 | Ga0207652_10739157 | |||
| 1176 | Ga0207652_10987299 | |||
| 1177 | Ga0207652_11622644 | |||
| 1178 | Ga0207646_10004975 | |||
| 1179 | Ga0207646_10309013 | |||
| 1180 | Ga0207681_10533593 | |||
| 1181 | Ga0207694_10183167 | |||
| 1182 | Ga0207694_10283887 | |||
| 1183 | Ga0207659_10101582 | |||
| 1184 | Ga0207687_10102155 | |||
| 1185 | Ga0207687_10139735 | |||
| 1186 | Ga0207687_10319492 | |||
| 1187 | Ga0207700_10111391 | |||
| 1188 | Ga0207700_10125687 | |||
| 1189 | Ga0207700_10647015 | |||
| 1190 | Ga0207664_10140000 | |||
| 1191 | Ga0207664_10245957 | |||
| 1192 | Ga0207644_10352884 | |||
| 1193 | Ga0207690_10041792 | |||
| 1194 | Ga0207690_10152801 | |||
| 1195 | Ga0207690_10181460 | |||
| 1196 | Ga0207690_10248190 | |||
| 1197 | Ga0207690_10544939 | |||
| 1198 | Ga0207686_10010247 | |||
| 1199 | Ga0207686_10057863 | |||
| 1200 | Ga0207709_10000390 | |||
| 1201 | Ga0207670_10003763 | |||
| 1202 | Ga0207669_10733430 | |||
| 1203 | Ga0207704_10011983 | |||
| 1204 | Ga0207665_10216705 | |||
| 1205 | Ga0207691_10024175 | |||
| 1206 | Ga0207711_10112339 | |||
| 1207 | Ga0207689_10593742 | |||
| 1208 | Ga0207661_10030134 | |||
| 1209 | Ga0207661_10067008 | |||
| 1210 | Ga0207661_10121846 | |||
| 1211 | Ga0207661_10129272 | |||
| 1212 | Ga0207661_10189324 | |||
| 1213 | Ga0207661_10260449 | |||
| 1214 | Ga0207679_10782744 | |||
| 1215 | Ga0207667_10049597 | |||
| 1216 | Ga0207667_10101797 | |||
| 1217 | Ga0207667_10133752 | |||
| 1218 | Ga0207667_10181528 | |||
| 1219 | Ga0207667_10211450 | |||
| 1220 | Ga0207667_10241328 | |||
| 1221 | Ga0207651_11377929 | |||
| 1222 | Ga0207712_10002933 | |||
| 1223 | Ga0207668_10098843 | |||
| 1224 | Ga0207640_10233343 | |||
| 1225 | Ga0207677_10276520 | |||
| 1226 | Ga0207677_10540903 | |||
| 1227 | Ga0207677_10717081 | |||
| 1228 | Ga0207677_10855653 | |||
| 1229 | Ga0207703_10791824 | |||
| 1230 | Ga0207639_10021581 | |||
| 1231 | Ga0207639_10399872 | |||
| 1232 | Ga0207678_10034139 | |||
| 1233 | Ga0207708_10000175 | |||
| 1234 | Ga0207702_10112952 | |||
| 1235 | Ga0207702_10124703 | |||
| 1236 | Ga0207702_10143253 | |||
| 1237 | Ga0207702_10228241 | |||
| 1238 | Ga0207702_10331867 | |||
| 1239 | Ga0207702_10923960 | |||
| 1240 | Ga0207648_10000082 | |||
| 1241 | Ga0207674_10004721 | |||
| 1242 | Ga0207674_10054833 | |||
| 1243 | Ga0207674_10832995 | |||
| 1244 | Ga0207675_100018883 | |||
| 1245 | Ga0207675_100539600 | |||
| 1246 | Ga0207683_10002143 | |||
| 1247 | Ga0207683_10407772 | |||
| 1248 | Ga0207683_12095811 | |||
| 1249 | Ga0207698_10042767 | |||
| 1250 | Ga0207698_10390674 | |||
| 1251 | Ga0209998_10079893 | |||
| 1252 | Ga0207428_10465728 | |||
| 1253 | Ga0207428_10832069 | |||
| 1254 | Ga0268266_10018012 | |||
| 1255 | Ga0268266_10072502 | |||
| 1256 | Ga0268265_10678628 | |||
| 1257 | Ga0268264_10199860 | |||
| 1258 | Ga0265334_10034004 | |||
| 1259 | Ga0265318_10059467 | |||
| 1260 | Ga0265336_10041387 | |||
| 1261 | Ga0265338_10006150 | |||
| 1262 | Ga0265338_10064047 | |||
| 1263 | Ga0265330_10050813 | |||
| 1264 | Ga0265332_10131464 | |||
| 1265 | Ga0265320_10296078 | |||
| 1266 | Ga0265325_10003953 | |||
| 1267 | Ga0265329_10097063 | |||
| 1268 | Ga0265339_10142402 | |||
| 1269 | Ga0265327_10012516 | |||
| 1270 | Ga0265316_10009994 | |||
| 1271 | Ga0307408_100133594 | |||
| 1272 | Ga0307408_101292703 | |||
| 1273 | Ga0265313_10009829 | |||
| 1274 | Ga0265314_10007139 | |||
| 1275 | Ga0265342_10007806 | |||
| 1276 | Ga0307405_10210747 | |||
| 1277 | Ga0307413_11618829 | |||
| 1278 | Ga0307410_11528238 | |||
| 1279 | Ga0307406_10096227 | |||
| 1280 | Ga0307407_10250833 | |||
| 1281 | Ga0307412_10535134 | |||
| 1282 | Ga0307409_100108632 | |||
| 1283 | Ga0307409_100675934 | |||
| 1284 | Ga0307416_100035823 | |||
| 1285 | Ga0307414_10228975 | |||
| 1286 | Ga0307415_100463883 | |||
| 1287 | Ga0373926_0178755 | |||
| 1288 | Ga0373936_0008139 | |||
| 1289 | Ga0373945_0017754 | |||
| 1290 | Ga0373943_0008552 | |||
| 1291 | Ga0373935_0026048 | |||
| 1292 | Ga0373947_0014472 | |||
| 1293 | Ga0373947_0029763 | |||
| 1294 | Ga0373925_0012189 | |||
| 1295 | Ga0395899_0003564 | |||
| 1296 | Ga0395899_0011539 | |||
| 1297 | Ga0395899_0053989 | |||
| 1298 | Ga0395899_0099058 | |||
| 1299 | Ga0395899_0257268 | |||
| 1300 | Ga0395900_0001626 | |||
| 1301 | Ga0395900_0004447 | |||
| 1302 | Ga0395900_0172014 | |||
| 1303 | Ga0395900_0197714 | |||
| 1304 | Ga0395900_0204501 | |||
| 1305 | Ga0395900_0284505 | |||
| 1306 | Ga0395900_0480084 | |||
| 1307 | Ga0395898_0000824 | |||
| 1308 | Ga0395898_0050375 | |||
| 1309 | Ga0395898_0084404 | |||
| 1310 | Ga0395898_0090454 | |||
| 1311 | Ga0395898_0117906 | |||
| 1312 | Ga0395898_0417962 | |||
| 1313 | Ga0395898_0494721 | |||
| 1314 | Ga0395898_0721309 | |||
| 1315 | Ga0395898_0814255 | |||
| 1316 | Ga0395898_1181958 | |||
| 1317 | Ga0395905_0001363 | |||
| 1318 | Ga0395905_0010364 | |||
| 1319 | Ga0395905_0028667 | |||
| 1320 | Ga0395905_0047608 | |||
| 1321 | Ga0395905_0236244 | |||
| 1322 | Ga0395905_0327833 | |||
| 1323 | Ga0395905_0513529 | |||
| 1324 | Ga0436364_0261127 | |||
| 1325 | Ga0395901_0000244 | |||
| 1326 | Ga0395901_0002680 | |||
| 1327 | Ga0395901_0036006 | |||
| 1328 | Ga0395901_0071012 | |||
| 1329 | Ga0395901_0144022 | |||
| 1330 | Ga0395901_0164737 | |||
| 1331 | Ga0395901_0293738 | |||
| 1332 | Ga0395901_0333056 | |||
| 1333 | Ga0395901_0422131 | |||
| 1334 | Ga0395901_0629202 | |||
| 1335 | Ga0395901_1195084 | |||
| 1336 | Ga0436365_1472723 | |||
| 1337 | Ga0436365_1646705 | |||
| 1338 | Ga0436363_0088067 | |||
| 1339 | Ga0436363_1699454 | |||
| 1340 | Ga0436362_0634204 | |||
| 1341 | Ga0439447_046109 | |||
| 1342 | Ga0439461_0015815 | |||
| 1343 | Ga0439465_0329674 | |||
| 1344 | Ga0439465_0374480 | |||
| 1345 | Ga0451789_0004674 | |||
| 1346 | Ga0451839_1544580 | |||
| 1347 | Ga0451853_1850206 | |||
| 1348 | Ga0439437_023876 | |||
| 1349 | Ga0439448_0028289 | |||
| 1350 | Ga0439455_0019229 | |||
| 1351 | Ga0450902_084918 | |||
| 1352 | Ga0439446_0000838 | |||
| 1353 | Ga0439434_0003603 | |||
| 1354 | Ga0450916_050208 | |||
| 1355 | Ga0439440_0226088 | |||
| 1356 | Ga0466969_0207111 | |||
| 1357 | Ga0466969_0291819 | |||
| 1358 | Ga0466965_0142126 | |||
| 1359 | Ga0466965_0480022 | |||
| 1360 | Ga0466966_0005063 | |||
| 1361 | Ga0466966_0006031 | |||
| 1362 | Ga0466966_0028061 | |||
| 1363 | Ga0466966_0171071 | |||
| 1364 | Ga0466961_0003168 | |||
| 1365 | Ga0466961_0003920 | |||
| 1366 | Ga0466961_0091045 | |||
| 1367 | Ga0466961_0386554 | |||
| 1368 | Ga0466961_0433904 | |||
| 1369 | Ga0466961_0626293 | |||
| 1370 | Ga0466963_0001137 | |||
| 1371 | Ga0466963_0003559 | |||
| 1372 | Ga0466963_0007724 | |||
| 1373 | Ga0466963_0009266 | |||
| 1374 | Ga0466963_0024212 | |||
| 1375 | Ga0466963_0046731 | |||
| 1376 | Ga0466963_0065055 | |||
| 1377 | Ga0466963_0114292 | |||
| 1378 | Ga0466963_0144774 | |||
| 1379 | Ga0466963_0161482 | |||
| 1380 | Ga0466963_0190361 | |||
| 1381 | Ga0466963_0326836 | |||
| 1382 | Ga0466963_0645971 | |||
| 1383 | Ga0466964_0001534 | |||
| 1384 | Ga0466964_0004731 | |||
| 1385 | Ga0466964_0056279 | |||
| 1386 | Ga0466964_0064900 | |||
| 1387 | Ga0466971_0000469 | |||
| 1388 | Ga0466971_0018695 | |||
| 1389 | Ga0466971_0207023 | |||
| 1390 | Ga0466968_0021080 | |||
| 1391 | Ga0466968_0045555 | |||
| 1392 | Ga0466968_0073346 | |||
| 1393 | Ga0466968_0117834 | |||
| 1394 | Ga0466970_0021149 | |||
| 1395 | Ga0466957_0013233 | |||
| 1396 | Ga0466957_0030705 | |||
| 1397 | Ga0466960_0141119 | |||
| 1398 | Ga0466960_0337520 | |||
| 1399 | Ga0466960_0381284 | |||
| 1400 | Ga0466960_0981223 | |||
| 1401 | Ga0466959_0004921 | |||
| 1402 | Ga0466959_0007042 | |||
| 1403 | Ga0466959_0018160 | |||
| 1404 | Ga0466959_0024117 | |||
| 1405 | Ga0466959_0037088 | |||
| 1406 | Ga0466958_0003237 | |||
| 1407 | Ga0466958_0007568 | |||
| 1408 | Ga0466958_0019514 | |||
| 1409 | Ga0466958_0041096 | |||
| 1410 | Ga0466958_0341247 | |||
| 1411 | Ga0466958_0460705 | |||
| 1412 | Ga0466958_0468958 | |||
| 1413 | Ga0466958_0481873 | |||
| 1414 | Ga0466967_0000859 | |||
| 1415 | Ga0466967_0002328 | |||
| 1416 | Ga0466967_0004759 | |||
| 1417 | Ga0466967_0005890 | |||
| 1418 | Ga0466967_0006213 | |||
| 1419 | Ga0466967_0019124 | |||
| 1420 | Ga0466967_0019521 | |||
| 1421 | Ga0466967_0031365 | |||
| 1422 | Ga0466967_0060145 | |||
| 1423 | Ga0466967_0107455 | |||
| 1424 | Ga0466967_0124924 | |||
| 1425 | Ga0466967_0169661 | |||
| 1426 | Ga0466967_0226629 | |||
| 1427 | Ga0466967_0261675 | |||
| 1428 | Ga0466967_0276804 | |||
| 1429 | Ga0466967_0337549 | |||
| 1430 | Ga0466967_0404686 | |||
| 1431 | Ga0466967_0474418 | |||
| 1432 | Ga0466967_0603779 | |||
| 1433 | Ga0466967_0751441 | |||
| 1434 | Ga0466967_0777396 | |||
| 1435 | Ga0466967_1152292 | |||
| 1436 | Ga0466967_2087492 | |||
| 1437 | Ga0495603_0029729 | |||
| 1438 | Ga0495603_0090611 | |||
| 1439 | Ga0495629_0055131 | |||
| 1440 | Ga0495629_0075516 | |||
| 1441 | Ga0495629_0342714 | |||
| 1442 | Ga0495629_0383560 | |||
| 1443 | Ga0495641_0018748 | |||
| 1444 | Ga0495641_0022803 | |||
| 1445 | Ga0495641_0055941 | |||
| 1446 | Ga0495651_0017715 | |||
| 1447 | Ga0495653_0020122 | |||
| 1448 | Ga0495582_0326106 | |||
| 1449 | Ga0495582_0501979 | |||
| 1450 | Ga0495605_0412927 | |||
| 1451 | Ga0495639_0227579 | |||
| 1452 | Ga0495662_0064943 | |||
| 1453 | Ga0495662_0070075 | |||
| 1454 | Ga0495584_0039772 | |||
| 1455 | Ga0495584_0484417 | |||
| 1456 | Ga0495585_0266316 | |||
| 1457 | Ga0495585_0319201 | |||
| 1458 | Ga0495594_0019914 | |||
| 1459 | Ga0495594_0079340 | |||
| 1460 | Ga0495596_0079626 | |||
| 1461 | Ga0495596_0360595 | |||
| 1462 | Ga0495607_0411328 | |||
| 1463 | Ga0495608_0076933 | |||
| 1464 | Ga0495618_0094202 | |||
| 1465 | Ga0495628_0029355 | |||
| 1466 | Ga0495630_0006319 | |||
| 1467 | Ga0495630_0014939 | |||
| 1468 | Ga0495630_0645490 | |||
| 1469 | Ga0495663_0018070 | |||
| 1470 | Ga0495642_0052903 | |||
| 1471 | Ga0495642_0397831 | |||
| 1472 | Ga0495652_0095655 | |||
| 1473 | Ga0495665_0037759 | |||
| 1474 | Ga0495640_0007660 | |||
| 1475 | Ga0495586_0029827 | |||
| 1476 | Ga0495587_0082938 | |||
| 1477 | Ga0495621_0546665 | |||
| 1478 | Ga0495645_0417185 | |||
| 1479 | Ga0495667_0267910 | |||
| 1480 | Ga0495656_0028997 | |||
| 1481 | Ga0495659_0078032 | |||
| 1482 | Ga0495659_0090575 | |||
| 1483 | Ga0495659_0508394 | |||
| 1484 | Ga0495661_0258955 | |||
| 1485 | Ga0495588_0168981 | |||
| 1486 | Ga0495588_0383659 | |||
| 1487 | Ga0495646_0077502 | |||
| 1488 | Ga0495647_0001825 | |||
| 1489 | Ga0495647_0125008 | |||
| 1490 | Ga0495658_0002674 | |||
| 1491 | Ga0495658_0004201 | |||
| 1492 | Ga0495658_0493781 | |||
| 1493 | Ga0495613_0017137 | |||
| 1494 | Ga0495613_0078401 | |||
| 1495 | Ga0495613_0303317 | |||
| 1496 | Ga0495613_0410340 | |||
| 1497 | Ga0495624_0042532 | |||
| 1498 | Ga0495624_0137625 | |||
| 1499 | Ga0495589_0166102 | |||
| 1500 | Ga0495581_0020837 | |||
| 1501 | Ga0495581_0038806 | |||
| 1502 | Ga0495581_0604089 | |||
| 1503 | Ga0495604_0010671 | |||
| 1504 | Ga0495636_0243790 | |||
| 1505 | Ga0495674_0000604 | |||
| 1506 | Ga0495676_0019822 | |||
| 1507 | Ga0495676_0036853 | |||
| 1508 | Ga0495676_0056087 | |||
| 1509 | Ga0495680_0001294 | |||
| 1510 | Ga0495677_0129363 | |||
| 1511 | Ga0495677_0312429 | |||
| 1512 | Ga0495685_229643 | |||
| 1513 | Ga0495684_0013764 | |||
| 1514 | Ga0495614_0243808 | |||
| 1515 | Ga0496100_0000872 | |||
| 1516 | Ga0496100_0008891 | |||
| 1517 | Ga0496100_0012306 | |||
| 1518 | Ga0496100_0063667 | |||
| 1519 | Ga0496100_0280577 | |||
| 1520 | Ga0496100_0356359 | |||
| 1521 | Ga0496100_0383994 | |||
| 1522 | Ga0496100_0659777 | |||
| 1523 | Ga0496101_0001154 | |||
| 1524 | Ga0496101_0016759 | |||
| 1525 | Ga0496101_0026973 | |||
| 1526 | Ga0496101_0135874 | |||
| 1527 | Ga0496101_0318779 | |||
| 1528 | Ga0496101_0528536 | |||
| 1529 | Ga0496101_1008864 | |||
| 1530 | Ga0496102_0002435 | |||
| 1531 | Ga0496102_0062650 | |||
| 1532 | Ga0496102_0078757 | |||
| 1533 | Ga0496102_0240232 | |||
| 1534 | Ga0496102_0314062 | |||
| 1535 | Ga0496102_0366654 | |||
| 1536 | Ga0496102_0478360 | |||
| 1537 | Ga0496103_0001580 | |||
| 1538 | Ga0496103_0236395 | |||
| 1539 | Ga0496103_0264411 | |||
| 1540 | Ga0496103_0306261 | |||
| 1541 | Ga0496103_0537755 | |||
| 1542 | Ga0496104_0013250 | |||
| 1543 | Ga0496104_0065377 | |||
| 1544 | Ga0496104_0156427 | |||
| 1545 | Ga0496104_0195748 | |||
| 1546 | Ga0496104_0279482 | |||
| 1547 | Ga0496104_0625568 | |||
| 1548 | Ga0496105_0000413 | |||
| 1549 | Ga0496105_0016151 | |||
| 1550 | Ga0496105_0037651 | |||
| 1551 | Ga0496105_0098633 | |||
| 1552 | Ga0496105_1049112 | |||
| 1553 | Ga0496106_0000380 | |||
| 1554 | Ga0496106_0001856 | |||
| 1555 | Ga0496106_0073772 | |||
| 1556 | Ga0496106_0097745 | |||
| 1557 | Ga0496106_0119589 | |||
| 1558 | Ga0496107_0024373 | |||
| 1559 | Ga0496107_0025342 | |||
| 1560 | Ga0496107_0029123 | |||
| 1561 | Ga0496107_0036737 | |||
| 1562 | Ga0496107_0045659 | |||
| 1563 | Ga0496107_0058620 | |||
| 1564 | Ga0496107_0084568 | |||
| 1565 | Ga0496107_0120999 | |||
| 1566 | Ga0496108_0002822 | |||
| 1567 | Ga0496108_0008505 | |||
| 1568 | Ga0496108_0026029 | |||
| 1569 | Ga0496108_0322806 | |||
| 1570 | Ga0496108_0595772 | |||
| 1571 | Ga0496108_0622853 | |||
| 1572 | Ga0496109_0001408 | |||
| 1573 | Ga0496109_0001538 | |||
| 1574 | Ga0496109_0006986 | |||
| 1575 | Ga0496109_0088783 | |||
| 1576 | Ga0496109_0100769 | |||
| 1577 | Ga0496109_0209329 | |||
| 1578 | Ga0496109_0379394 | |||
| 1579 | Ga0496110_0000288 | |||
| 1580 | Ga0496110_0002556 | |||
| 1581 | Ga0496110_0020720 | |||
| 1582 | Ga0496110_0049840 | |||
| 1583 | Ga0496111_0000284 | |||
| 1584 | Ga0496111_0006816 | |||
| 1585 | Ga0496111_0083769 | |||
| 1586 | Ga0496111_0155993 | |||
| 1587 | Ga0496111_0495053 | |||
| 1588 | Ga0496111_0651343 | |||
| 1589 | Ga0496112_0001681 | |||
| 1590 | Ga0496112_0005474 | |||
| 1591 | Ga0496112_0025777 | |||
| 1592 | Ga0496112_0126898 | |||
| 1593 | Ga0496112_0131776 | |||
| 1594 | Ga0496112_0442967 | |||
| 1595 | Ga0496112_0891493 | |||
| 1596 | Ga0496112_1130229 | |||
| 1597 | Ga0496113_0011988 | |||
| 1598 | Ga0496113_0103625 | |||
| 1599 | Ga0496113_0151921 | |||
| 1600 | Ga0496113_0208162 | |||
| 1601 | Ga0496113_0788439 | |||
| 1602 | Ga0496114_0001478 | |||
| 1603 | Ga0496114_0015574 | |||
| 1604 | Ga0496114_0021947 | |||
| 1605 | Ga0496114_0088077 | |||
| 1606 | Ga0496114_0120060 | |||
| 1607 | Ga0496114_0614840 | |||
| 1608 | Ga0496114_1677310 | |||
| 1609 | Ga0496115_0001310 | |||
| 1610 | Ga0496115_0002457 | |||
| 1611 | Ga0496115_0083568 | |||
| 1612 | Ga0496115_0495816 | |||
| 1613 | Ga0496115_0557422 | |||
| 1614 | Ga0501032_0747947 | |||
| 1615 | Ga0501032_1027425 | |||
| 1616 | Ga0501034_0051076 | |||
| 1617 | Ga0501036_0389032 | |||
| 1618 | Ga0501038_0023496 | |||
| 1619 | Ga0501038_0162326 | |||
| 1620 | Ga0501038_0866933 | |||
| 1621 | Ga0501040_0101788 | |||
| 1622 | Ga0501042_0017321 | |||
| 1623 | Ga0501043_0163474 | |||
| 1624 | Ga0501046_0207940 | |||
| 1625 | Ga0501046_0450302 | |||
| 1626 | Ga0501047_0019815 | |||
| 1627 | Ga0501047_0024860 | |||
| 1628 | Ga0501047_0072970 | |||
| 1629 | Ga0501047_0355603 | |||
| 1630 | Ga0501048_0014828 | |||
| 1631 | Ga0501048_0666908 | |||
| 1632 | Ga0501067_0001127 | |||
| 1633 | Ga0501067_0037524 | |||
| 1634 | Ga0501067_0177230 | |||
| 1635 | Ga0501068_0057163 | |||
| 1636 | Ga0501069_0044224 | |||
| 1637 | Ga0501069_0056653 | |||
| 1638 | Ga0501069_0123102 | |||
| 1639 | Ga0501070_0007864 | |||
| 1640 | Ga0501070_0082062 | |||
| 1641 | Ga0501070_0112698 | |||
| 1642 | Ga0501070_0175845 | |||
| 1643 | Ga0501070_0178309 | |||
| 1644 | Ga0501070_0436709 | |||
| 1645 | Ga0501071_0014250 | |||
| 1646 | Ga0501072_0099725 | |||
| 1647 | Ga0501072_0439584 | |||
| 1648 | Ga0501072_0936720 | |||
| 1649 | Ga0501073_0025021 | |||
| 1650 | Ga0501073_0278207 | |||
| 1651 | Ga0501074_0000736 | |||
| 1652 | Ga0501074_0133281 | |||
| 1653 | Ga0501074_0192630 | |||
| 1654 | Ga0501074_0511625 | |||
| 1655 | Ga0501075_0012994 | |||
| 1656 | Ga0501076_0027201 | |||
| 1657 | Ga0501077_0018427 | |||
| 1658 | Ga0501079_0078813 | |||
| 1659 | Ga0501080_0000499 | |||
| 1660 | Ga0501080_0045375 | |||
| 1661 | Ga0501080_0484954 | |||
| 1662 | Ga0501081_0036936 | |||
| 1663 | Ga0501083_0090671 | |||
| 1664 | Ga0501035_0257356 | |||
| 1665 | Ga0501035_0884057 | |||
| 1666 | Ga0501044_0173566 | |||
| 1667 | Ga0501044_0616475 | |||
| 1668 | Ga0501044_0892707 | |||
| 1669 | Ga0501045_0000429 | |||
| 1670 | nmdc:mga00v17_246541_c1 | |||
| 1671 | nmdc:mga0yw44_805866_c1 | |||
| 1672 | nmdc:mga05p37_214220_c1 | |||
| 1673 | nmdc:mga05p37_2477_c1 | |||
| 1674 | nmdc:mga05p37_6790_c1 | |||
| 1675 | nmdc:mga05p37_724856_c1 | |||
| 1676 | nmdc:mga09592_16652_c1 | |||
| 1677 | nmdc:mga0qj67_13175_c1 | |||
| 1678 | nmdc:mga0qj67_132149_c1 | |||
| 1679 | nmdc:mga06r32_1301667_c1 | |||
| 1680 | nmdc:mga06r32_901148_c1 | |||
| 1681 | nmdc:mga08y16_103397_c1 | |||
| 1682 | nmdc:mga08y16_1336378_c1 | |||
| 1683 | nmdc:mga0n895_231402_c1 | |||
| 1684 | nmdc:mga0n895_74762_c1 | |||
| 1685 | nmdc:mga0rr50_249065_c1 | |||
| 1686 | nmdc:mga0rr50_70984_c1 | |||
| 1687 | nmdc:mga08x19_43029_c1 | |||
| 1688 | nmdc:mga0a205_1260108_c1 | |||
| 1689 | nmdc:mga0a205_66112_c1 | |||
| 1690 | nmdc:mga0a205_97071_c1 | |||
| 1691 | Ga0495601_0028288 | |||
| 1692 | Ga0495595_0091937 | |||
| 1693 | Ga0495619_0043577 | |||
| 1694 | Ga0501084_0009449 | |||
| 1695 | Ga0501084_0328034 | |||
| 1696 | Ga0590071_020351 | |||
| 1697 | Ga0590074_022246 | |||
| 1698 | Ga0590077_015851 | |||
| 1699 | Ga0501082_0056162 | |||
| 1700 | Ga0466962_0003629 | |||
| 1701 | Ga0466962_0020288 | |||
| 1702 | Ga0466962_0039457 | |||
| 1703 | Ga0466962_0051664 | |||
| 1704 | Ga0466962_0140595 | |||
| 1705 | Ga0530510_0009672 | |||
| 1706 | Ga0530510_0297016 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h77-assembly2.cif.gz_C | crystal structure of the pka-protein a fusion protein | 0.3693 | 28 | 112 |
| 2uul-assembly2.cif.gz_T | crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers. | 0.3642 | 30 | 128 |
| 5j0l-assembly2.cif.gz_D | de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity | 0.3563 | 30 | 112 |
| 5h77-assembly2.cif.gz_C | crystal structure of the pka-protein a fusion protein | 0.356 | 28 | 112 |
| 3qnm-assembly1.cif.gz_A | haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function | 0.3328 | 32 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t6pG03 | Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 | 0.3717 | 32 | 114 | 1.10.274.20 |
| af_Q17775_1_116_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.3525 | 34 | 124 | 1.20.120.160 |
| af_Q2FUW6_607_786_1.10.3060.10 | Mainly Alpha;Orthogonal Bundle;Helical scaffold and wing domains of SecA;Helical scaffold and wing domains of SecA | 0.3492 | 32 | 127 | 1.10.3060.10 |
| af_A0A1D6NEE8_1_99_1.20.58.400 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins | 0.3425 | 32 | 116 | 1.20.58.400 |
| 1t6jB03 | Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 | 0.3245 | 32 | 114 | 1.10.274.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9CZR9-F1-model_v4 | Uncharacterized protein | 0.8749 | 28 | 142 |
|
| AF-A0A7V9CZR9-F1-model_v4 | Uncharacterized protein | 0.8608 | 28 | 142 |
|
| AF-A0A537ZTZ3-F1-model_v4 | Uncharacterized protein | 0.8358 | 15 | 128 |
|
| AF-A0A537ZTZ3-F1-model_v4 | Uncharacterized protein | 0.8151 | 15 | 128 |
|
| AF-A0A537TNS8-F1-model_v4 | Uncharacterized protein | 0.7748 | 17 | 145 |
|