F483542

General Info

Members Datasets Scaffolds Average Seq Length
853 348 1706 131

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100294970|Ga0075434_1002949702
Length 139
Sequence MIQSSIFYTSGVTGAEEIWFPLVDEPIGSIVQQLQSEDPEIDKLIDSPRKLLAFRTFAYIRVGIVLGRLLVDNDVPEYDGTETWVEALLREPRHRRAVAVELRAVAEEVARSEEPEAGSVGPDDDARARFREFARKQLS

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
218 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
219 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
220 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
281 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 1.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 11.72
Rhizosphere 86.75
Stem 0
Stem Tuber 0
Unclassified 12.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100294970 3300006871 Unclassified 1641
2 JGI24749J21850_1022907 3300002076 Bacteria 886
3 JGI24744J21845_10037716 3300002077 Bacteria 910
4 Ga0070658_10036571 3300005327 Bacteria 3957
5 Ga0070658_10094616 3300005327 Bacteria 2465
6 Ga0070658_10104089 3300005327 Bacteria 2348
7 Ga0070658_11005879 3300005327 Bacteria 725
8 Ga0070683_100037582 3300005329 Bacteria 4432
9 Ga0070683_100045570 3300005329 Bacteria 4048
10 Ga0070683_100106057 3300005329 Bacteria 2649
11 Ga0070690_100010870 3300005330 Bacteria 5311
12 Ga0070680_100143926 3300005336 Bacteria 2000
13 Ga0070680_100156968 3300005336 Bacteria 1912
14 Ga0070680_100223236 3300005336 Bacteria 1591
15 Ga0070680_101346384 3300005336 Bacteria 618
16 Ga0070682_100001353 3300005337 Bacteria 13833
17 Ga0070682_100212711 3300005337 Bacteria 1371
18 Ga0070682_100333394 3300005337 Bacteria 1125
19 Ga0068868_100441901 3300005338 Bacteria 1130
20 Ga0068868_100570019 3300005338 Bacteria 1000
21 Ga0070660_100007998 3300005339 Bacteria 7385
22 Ga0070660_100015912 3300005339 Bacteria 5446
23 Ga0070660_100093203 3300005339 Bacteria 2378
24 Ga0070660_100148586 3300005339 Bacteria 1883
25 Ga0070660_100269301 3300005339 Bacteria 1392
26 Ga0070660_100344355 3300005339 Unclassified 1227
27 Ga0070660_100493616 3300005339 Bacteria 1018
28 Ga0070660_100653434 3300005339 Unclassified 881
29 Ga0070691_10956086 3300005341 Unclassified 532
30 Ga0070687_100009155 3300005343 Bacteria 4231
31 Ga0070687_100382950 3300005343 Bacteria 917
32 Ga0070661_100040189 3300005344 Bacteria 3411
33 Ga0070692_10682338 3300005345 Unclassified 689
34 Ga0070669_100654407 3300005353 Bacteria 884
35 Ga0070675_100130161 3300005354 Bacteria 2144
36 Ga0070673_100148930 3300005364 Bacteria 1980
37 Ga0070659_100003771 3300005366 Bacteria 10814
38 Ga0070659_100042127 3300005366 Bacteria 3570
39 Ga0070659_100141754 3300005366 Bacteria 1957
40 Ga0070659_100611963 3300005366 Bacteria 937
41 Ga0070659_101176694 3300005366 Bacteria 677
42 Ga0070703_10316755 3300005406 Bacteria 655
43 Ga0070709_10191392 3300005434 Bacteria 1443
44 Ga0070709_10971570 3300005434 Bacteria 674
45 Ga0070709_11730319 3300005434 Bacteria 511
46 Ga0070714_100035545 3300005435 Bacteria 4177
47 Ga0070714_100077257 3300005435 Bacteria 2892
48 Ga0070714_100339043 3300005435 Bacteria 1409
49 Ga0070714_100548355 3300005435 Bacteria 1107
50 Ga0070714_101243716 3300005435 Unclassified 727
51 Ga0070713_100588914 3300005436 Bacteria 1056
52 Ga0070713_100936479 3300005436 Bacteria 834
53 Ga0070710_10146116 3300005437 Bacteria 1454
54 Ga0070701_10008806 3300005438 Bacteria 4386
55 Ga0070701_10501816 3300005438 Unclassified 788
56 Ga0070711_100002187 3300005439 Bacteria 11090
57 Ga0070711_100012056 3300005439 Bacteria 5390
58 Ga0070711_100198592 3300005439 Bacteria 1546
59 Ga0070711_100599075 3300005439 Bacteria 919
60 Ga0070711_101408566 3300005439 Unclassified 607
61 Ga0070711_101412236 3300005439 Unclassified 606
62 Ga0070700_100002757 3300005441 Bacteria 8984
63 Ga0070700_100805662 3300005441 Unclassified 757
64 Ga0070694_100029990 3300005444 Bacteria 3555
65 Ga0070663_101097367 3300005455 Bacteria 696
66 Ga0070663_101323166 3300005455 Unclassified 636
67 Ga0070678_100002780 3300005456 Bacteria 9668
68 Ga0070678_101723710 3300005456 Unclassified 590
69 Ga0070681_10015700 3300005458 Bacteria 7546
70 Ga0070681_10035668 3300005458 Bacteria 4995
71 Ga0070681_10275245 3300005458 Bacteria 1594
72 Ga0070681_10455838 3300005458 Unclassified 1191
73 Ga0070681_10649802 3300005458 Bacteria 969
74 Ga0068867_100000550 3300005459 Bacteria 24730
75 Ga0070685_10001027 3300005466 Bacteria 15007
76 Ga0070706_100033135 3300005467 Unclassified 4768
77 Ga0070706_100242221 3300005467 Unclassified 1684
78 Ga0070706_101417444 3300005467 Bacteria 636
79 Ga0070707_100001094 3300005468 Bacteria 26790
80 Ga0070707_100999584 3300005468 Unclassified 802
81 Ga0070698_100026743 3300005471 Bacteria 6002
82 Ga0070698_100146394 3300005471 Bacteria 2311
83 Ga0070698_100224357 3300005471 Bacteria 1812
84 Ga0070699_100071957 3300005518 Bacteria 3007
85 Ga0070699_100190846 3300005518 Bacteria 1820
86 Ga0070699_100238644 3300005518 Bacteria 1622
87 Ga0070699_100814400 3300005518 Bacteria 855
88 Ga0070679_100023086 3300005530 Bacteria 6085
89 Ga0070679_100050172 3300005530 Bacteria 4156
90 Ga0070679_100082883 3300005530 Bacteria 3196
91 Ga0070679_100172249 3300005530 Bacteria 2137
92 Ga0070679_100176495 3300005530 Bacteria 2109
93 Ga0070679_100250630 3300005530 Bacteria 1727
94 Ga0070679_100420637 3300005530 Unclassified 1282
95 Ga0070679_100801740 3300005530 Bacteria 885
96 Ga0070679_100974338 3300005530 Bacteria 792
97 Ga0070684_100137723 3300005535 Bacteria 2206
98 Ga0070684_100273652 3300005535 Unclassified 1546
99 Ga0070684_100616947 3300005535 Bacteria 1009
100 Ga0070684_101385986 3300005535 Bacteria 662
101 Ga0070684_101916387 3300005535 Bacteria 559
102 Ga0070697_100115563 3300005536 Bacteria 2240
103 Ga0068853_100004653 3300005539 Bacteria 10644
104 Ga0068853_100101626 3300005539 Bacteria 2543
105 Ga0068853_101015247 3300005539 Bacteria 799
106 Ga0070672_100243590 3300005543 Bacteria 1513
107 Ga0070686_100002324 3300005544 Bacteria 10491
108 Ga0070686_100439690 3300005544 Bacteria 1000
109 Ga0070695_100374167 3300005545 Bacteria 1073
110 Ga0070696_100014317 3300005546 Bacteria 5320
111 Ga0070693_100194078 3300005547 Bacteria 1315
112 Ga0070693_100622718 3300005547 Bacteria 782
113 Ga0070665_100007548 3300005548 Bacteria 11053
114 Ga0070665_100032068 3300005548 Bacteria 5289
115 Ga0070704_100005238 3300005549 Bacteria 7550
116 Ga0070704_100298837 3300005549 Unclassified 1341
117 Ga0070704_101157390 3300005549 Bacteria 704
118 Ga0068855_100028295 3300005563 Bacteria 6704
119 Ga0068855_100048620 3300005563 Bacteria 5005
120 Ga0068855_100088984 3300005563 Bacteria 3566
121 Ga0068855_100112215 3300005563 Bacteria 3128
122 Ga0068855_100209553 3300005563 Bacteria 2191
123 Ga0068855_100467152 3300005563 Unclassified 1375
124 Ga0068857_100011411 3300005577 Bacteria 7729
125 Ga0068857_100195364 3300005577 Bacteria 1844
126 Ga0068854_100082317 3300005578 Bacteria 2379
127 Ga0068854_100266116 3300005578 Bacteria 1374
128 Ga0068856_100009339 3300005614 Bacteria 9525
129 Ga0068856_100111950 3300005614 Bacteria 2727
130 Ga0068856_100211859 3300005614 Bacteria 1953
131 Ga0068856_100301589 3300005614 Bacteria 1620
132 Ga0068856_100329503 3300005614 Unclassified 1544
133 Ga0068856_100546278 3300005614 Bacteria 1180
134 Ga0068856_102152128 3300005614 Bacteria 567
135 Ga0070702_100003004 3300005615 Bacteria 7455
136 Ga0068852_100014317 3300005616 Bacteria 6100
137 Ga0068852_100074071 3300005616 Bacteria 2997
138 Ga0068852_100098441 3300005616 Bacteria 2634
139 Ga0068852_100506960 3300005616 Bacteria 1202
140 Ga0068859_100027843 3300005617 Bacteria 5668
141 Ga0068861_100032064 3300005719 Bacteria 3866
142 Ga0068861_100808496 3300005719 Bacteria 880
143 Ga0068851_10589004 3300005834 Bacteria 676
144 Ga0068860_100171690 3300005843 Bacteria 2094
145 Ga0068860_102370854 3300005843 Bacteria 551
146 Ga0081539_10073708 3300005985 Bacteria 1820
147 Ga0070717_10021799 3300006028 Bacteria 5054
148 Ga0070717_10672654 3300006028 Unclassified 940
149 Ga0075365_10700978 3300006038 Bacteria 715
150 Ga0075364_10269603 3300006051 Bacteria 1158
151 Ga0075364_10505660 3300006051 Bacteria 826
152 Ga0075432_10258876 3300006058 Bacteria 708
153 Ga0070715_10073231 3300006163 Bacteria 1536
154 Ga0070712_100015106 3300006175 Bacteria 4964
155 Ga0070712_100069346 3300006175 Bacteria 2515
156 Ga0070712_100069414 3300006175 Bacteria 2514
157 Ga0097621_100006172 3300006237 Bacteria 8492
158 Ga0097621_100198145 3300006237 Bacteria 1742
159 Ga0068871_100293188 3300006358 Bacteria 1426
160 Ga0068871_100821938 3300006358 Bacteria 857
161 Ga0068871_101754560 3300006358 Bacteria 589
162 Ga0075428_100093160 3300006844 Bacteria 3284
163 Ga0075430_100805559 3300006846 Bacteria 774
164 Ga0075431_100193601 3300006847 Bacteria 2082
165 Ga0075431_100651381 3300006847 Bacteria 1034
166 Ga0075433_10014069 3300006852 Bacteria 6524
167 Ga0075433_10271436 3300006852 Bacteria 1503
168 Ga0075434_100010906 3300006871 Bacteria 8543
169 Ga0075434_101009410 3300006871 Bacteria 846
170 Ga0075429_100011218 3300006880 Bacteria 7757
171 Ga0075429_100963370 3300006880 Unclassified 746
172 Ga0068865_100000227 3300006881 Bacteria 31272
173 Ga0075436_100039906 3300006914 Bacteria 3239
174 Ga0097620_100027843 3300006931 Bacteria 5668
175 Ga0075435_100078957 3300007076 Bacteria 2700
176 Ga0075435_100131872 3300007076 Bacteria 2091
177 Ga0075435_100188256 3300007076 Bacteria 1746
178 Ga0105240_10051622 3300009093 Bacteria 5172
179 Ga0105240_10061052 3300009093 Bacteria 4698
180 Ga0105240_10600297 3300009093 Bacteria 1212
181 Ga0105240_12213464 3300009093 Bacteria 570
182 Ga0111539_10094787 3300009094 Bacteria 3507
183 Ga0111539_10108916 3300009094 Bacteria 3251
184 Ga0105245_10023004 3300009098 Bacteria 5468
185 Ga0105245_10489437 3300009098 Bacteria 1244
186 Ga0105245_11436731 3300009098 Unclassified 740
187 Ga0114129_10040444 3300009147 Bacteria 6572
188 Ga0114129_10055751 3300009147 Bacteria 5539
189 Ga0114129_10083841 3300009147 Unclassified 4425
190 Ga0114129_10095852 3300009147 Bacteria 4108
191 Ga0114129_11030461 3300009147 Bacteria 1034
192 Ga0114129_11902660 3300009147 Bacteria 721
193 Ga0105243_10436534 3300009148 Bacteria 1225
194 Ga0105241_10065053 3300009174 Bacteria 2817
195 Ga0105241_10380142 3300009174 Bacteria 1234
196 Ga0105241_10815440 3300009174 Unclassified 861
197 Ga0105242_10001454 3300009176 Bacteria 18636
198 Ga0105248_10062399 3300009177 Bacteria 4185
199 Ga0105248_12234648 3300009177 Bacteria 623
200 Ga0105248_12297129 3300009177 Bacteria 614
201 Ga0105237_10037076 3300009545 Bacteria 4929
202 Ga0105237_10178240 3300009545 Bacteria 2125
203 Ga0105237_10429259 3300009545 Bacteria 1327
204 Ga0105237_10557635 3300009545 Unclassified 1152
205 Ga0105237_12125518 3300009545 Bacteria 571
206 Ga0105238_10040827 3300009551 Bacteria 4700
207 Ga0105249_10002535 3300009553 Bacteria 15803
208 Ga0105249_10480408 3300009553 Unclassified 1285
209 Ga0105239_10001933 3300010375 Bacteria 27042
210 Ga0105239_10027377 3300010375 Bacteria 6275
211 Ga0105239_10722610 3300010375 Bacteria 1139
212 Ga0105239_11899156 3300010375 Bacteria 691
213 Ga0105239_13055035 3300010375 Unclassified 545
214 Ga0105246_11427591 3300011119 Bacteria 647
215 Ga0157373_10615442 3300013100 Bacteria 791
216 Ga0157373_10656772 3300013100 Bacteria 766
217 Ga0157371_10203443 3300013102 Unclassified 1420
218 Ga0157371_10362177 3300013102 Bacteria 1057
219 Ga0157371_10510877 3300013102 Unclassified 888
220 Ga0157370_10013920 3300013104 Bacteria 8260
221 Ga0157370_10021781 3300013104 Bacteria 6384
222 Ga0157370_10027545 3300013104 Bacteria 5603
223 Ga0157370_10089902 3300013104 Bacteria 2884
224 Ga0157370_10383295 3300013104 Unclassified 1295
225 Ga0157370_10670869 3300013104 Bacteria 947
226 Ga0157370_11066674 3300013104 Bacteria 730
227 Ga0157369_10010672 3300013105 Bacteria 10455
228 Ga0157369_10084027 3300013105 Bacteria 3404
229 Ga0157369_10097700 3300013105 Bacteria 3132
230 Ga0157369_10348917 3300013105 Bacteria 1537
231 Ga0157374_10014191 3300013296 Bacteria 6966
232 Ga0157374_10869611 3300013296 Bacteria 919
233 Ga0157378_10002034 3300013297 Bacteria 18114
234 Ga0163162_10002291 3300013306 Bacteria 17972
235 Ga0163162_10750196 3300013306 Bacteria 1095
236 Ga0157372_10109170 3300013307 Bacteria 3168
237 Ga0157372_10254602 3300013307 Unclassified 2038
238 Ga0157372_10610316 3300013307 Unclassified 1271
239 Ga0157372_11247871 3300013307 Bacteria 858
240 Ga0157372_11744624 3300013307 Unclassified 716
241 Ga0157375_10037709 3300013308 Bacteria 4633
242 Ga0157375_10054990 3300013308 Bacteria 3922
243 Ga0157375_10686967 3300013308 Bacteria 1178
244 Ga0157375_11946180 3300013308 Unclassified 698
245 Ga0157375_12461618 3300013308 Bacteria 621
246 Ga0157380_10002637 3300014326 Bacteria 12148
247 Ga0182008_10085595 3300014497 Bacteria 1553
248 Ga0157377_10022007 3300014745 Bacteria 3362
249 Ga0157376_10077158 3300014969 Bacteria 2849
250 Ga0197907_10994198 3300020069 Bacteria 1517
251 Ga0197907_11299474 3300020069 Bacteria 1122
252 Ga0206356_10008307 3300020070 Bacteria 1665
253 Ga0206356_10150742 3300020070 Bacteria 3555
254 Ga0206356_10827326 3300020070 Bacteria 1149
255 Ga0206356_11299735 3300020070 Unclassified 803
256 Ga0206354_10202118 3300020081 Unclassified 1652
257 Ga0206354_10358543 3300020081 Bacteria 3540
258 Ga0206354_11143875 3300020081 Bacteria 1264
259 Ga0206353_10804099 3300020082 Bacteria 9328
260 Ga0206353_10879736 3300020082 Bacteria 12937
261 Ga0206353_11861837 3300020082 Bacteria 2607
262 Ga0213876_10199893 3300021384 Bacteria 1062
263 Ga0207692_11012264 3300025898 Unclassified 549
264 Ga0207642_10001151 3300025899 Bacteria 8180
265 Ga0207688_10057984 3300025901 Bacteria 2178
266 Ga0207685_10150778 3300025905 Bacteria 1052
267 Ga0207685_10440878 3300025905 Bacteria 675
268 Ga0207699_10100917 3300025906 Bacteria 1831
269 Ga0207699_10212253 3300025906 Bacteria 1317
270 Ga0207705_10005200 3300025909 Bacteria 9755
271 Ga0207705_10158330 3300025909 Unclassified 1700
272 Ga0207705_10209113 3300025909 Bacteria 1480
273 Ga0207705_10303845 3300025909 Bacteria 1224
274 Ga0207705_10321617 3300025909 Bacteria 1189
275 Ga0207705_10373251 3300025909 Bacteria 1101
276 Ga0207684_10106846 3300025910 Unclassified 2395
277 Ga0207684_10260916 3300025910 Archaea 1495
278 Ga0207684_11057574 3300025910 Unclassified 677
279 Ga0207654_10629409 3300025911 Bacteria 767
280 Ga0207707_10017189 3300025912 Bacteria 6305
281 Ga0207707_10073017 3300025912 Bacteria 2991
282 Ga0207707_10082799 3300025912 Unclassified 2801
283 Ga0207707_10112059 3300025912 Bacteria 2385
284 Ga0207707_10148660 3300025912 Bacteria 2048
285 Ga0207695_10097899 3300025913 Bacteria 2934
286 Ga0207695_10116989 3300025913 Bacteria 2639
287 Ga0207695_10561191 3300025913 Bacteria 1023
288 Ga0207671_10103617 3300025914 Bacteria 2158
289 Ga0207671_10316881 3300025914 Bacteria 1234
290 Ga0207671_10484439 3300025914 Bacteria 986
291 Ga0207693_10001103 3300025915 Bacteria 24273
292 Ga0207693_10008867 3300025915 Bacteria 8216
293 Ga0207693_10015845 3300025915 Bacteria 6038
294 Ga0207693_10096026 3300025915 Bacteria 2324
295 Ga0207663_10083739 3300025916 Bacteria 2096
296 Ga0207663_10242943 3300025916 Bacteria 1321
297 Ga0207663_10536268 3300025916 Unclassified 913
298 Ga0207663_10564272 3300025916 Bacteria 891
299 Ga0207663_11362565 3300025916 Unclassified 571
300 Ga0207660_10114927 3300025917 Bacteria 2031
301 Ga0207660_10136979 3300025917 Unclassified 1869
302 Ga0207660_10319076 3300025917 Bacteria 1240
303 Ga0207660_10472480 3300025917 Bacteria 1015
304 Ga0207662_10053700 3300025918 Bacteria 2401
305 Ga0207657_10005129 3300025919 Bacteria 13727
306 Ga0207657_10010441 3300025919 Bacteria 9268
307 Ga0207657_10030136 3300025919 Bacteria 4929
308 Ga0207657_10047476 3300025919 Bacteria 3754
309 Ga0207657_10102133 3300025919 Bacteria 2378
310 Ga0207657_10136437 3300025919 Unclassified 2007
311 Ga0207657_10234620 3300025919 Bacteria 1466
312 Ga0207657_10399586 3300025919 Unclassified 1081
313 Ga0207657_10501340 3300025919 Bacteria 951
314 Ga0207649_10036640 3300025920 Bacteria 2956
315 Ga0207649_10073141 3300025920 Bacteria 2195
316 Ga0207652_10065929 3300025921 Bacteria 3137
317 Ga0207652_10083152 3300025921 Bacteria 2802
318 Ga0207652_10227457 3300025921 Bacteria 1681
319 Ga0207652_10238455 3300025921 Bacteria 1639
320 Ga0207652_10303209 3300025921 Bacteria 1442
321 Ga0207652_10383185 3300025921 Bacteria 1269
322 Ga0207652_10739157 3300025921 Bacteria 876
323 Ga0207652_10987299 3300025921 Bacteria 741
324 Ga0207652_11622644 3300025921 Bacteria 551
325 Ga0207646_10004975 3300025922 Bacteria 14201
326 Ga0207646_10309013 3300025922 Bacteria 1428
327 Ga0207681_10533593 3300025923 Bacteria 964
328 Ga0207694_10183167 3300025924 Unclassified 1699
329 Ga0207694_10283887 3300025924 Bacteria 1360
330 Ga0207659_10101582 3300025926 Bacteria 2169
331 Ga0207687_10102155 3300025927 Bacteria 2112
332 Ga0207687_10139735 3300025927 Unclassified 1836
333 Ga0207687_10319492 3300025927 Bacteria 1256
334 Ga0207700_10111391 3300025928 Bacteria 2203
335 Ga0207700_10125687 3300025928 Bacteria 2086
336 Ga0207700_10647015 3300025928 Archaea 942
337 Ga0207664_10140000 3300025929 Bacteria 2046
338 Ga0207664_10245957 3300025929 Bacteria 1559
339 Ga0207644_10352884 3300025931 Unclassified 1195
340 Ga0207690_10041792 3300025932 Bacteria 3007
341 Ga0207690_10152801 3300025932 Bacteria 1713
342 Ga0207690_10181460 3300025932 Bacteria 1585
343 Ga0207690_10248190 3300025932 Bacteria 1374
344 Ga0207690_10544939 3300025932 Bacteria 943
345 Ga0207686_10010247 3300025934 Bacteria 5099
346 Ga0207686_10057863 3300025934 Unclassified 2442
347 Ga0207709_10000390 3300025935 Bacteria 43485
348 Ga0207670_10003763 3300025936 Bacteria 8063
349 Ga0207669_10733430 3300025937 Bacteria 815
350 Ga0207704_10011983 3300025938 Bacteria 4289
351 Ga0207665_10216705 3300025939 Bacteria 1401
352 Ga0207691_10024175 3300025940 Bacteria 5713
353 Ga0207711_10112339 3300025941 Bacteria 2424
354 Ga0207689_10593742 3300025942 Bacteria 931
355 Ga0207661_10030134 3300025944 Bacteria 4175
356 Ga0207661_10067008 3300025944 Bacteria 2918
357 Ga0207661_10121846 3300025944 Bacteria 2221
358 Ga0207661_10129272 3300025944 Bacteria 2161
359 Ga0207661_10189324 3300025944 Bacteria 1803
360 Ga0207661_10260449 3300025944 Bacteria 1545
361 Ga0207679_10782744 3300025945 Bacteria 869
362 Ga0207667_10049597 3300025949 Bacteria 4433
363 Ga0207667_10101797 3300025949 Bacteria 2963
364 Ga0207667_10133752 3300025949 Unclassified 2554
365 Ga0207667_10181528 3300025949 Unclassified 2161
366 Ga0207667_10211450 3300025949 Bacteria 1988
367 Ga0207667_10241328 3300025949 Bacteria 1849
368 Ga0207651_11377929 3300025960 Bacteria 634
369 Ga0207712_10002933 3300025961 Bacteria 10894
370 Ga0207668_10098843 3300025972 Bacteria 2163
371 Ga0207640_10233343 3300025981 Bacteria 1417
372 Ga0207677_10276520 3300026023 Bacteria 1376
373 Ga0207677_10540903 3300026023 Bacteria 1014
374 Ga0207677_10717081 3300026023 Bacteria 889
375 Ga0207677_10855653 3300026023 Bacteria 817
376 Ga0207703_10791824 3300026035 Unclassified 905
377 Ga0207639_10021581 3300026041 Bacteria 4627
378 Ga0207639_10399872 3300026041 Bacteria 1237
379 Ga0207678_10034139 3300026067 Bacteria 4431
380 Ga0207708_10000175 3300026075 Bacteria 51009
381 Ga0207702_10112952 3300026078 Bacteria 2419
382 Ga0207702_10124703 3300026078 Bacteria 2310
383 Ga0207702_10143253 3300026078 Bacteria 2165
384 Ga0207702_10228241 3300026078 Bacteria 1738
385 Ga0207702_10331867 3300026078 Bacteria 1451
386 Ga0207702_10923960 3300026078 Bacteria 865
387 Ga0207648_10000082 3300026089 Bacteria 89474
388 Ga0207674_10004721 3300026116 Bacteria 16335
389 Ga0207674_10054833 3300026116 Bacteria 4056
390 Ga0207674_10832995 3300026116 Bacteria 890
391 Ga0207675_100018883 3300026118 Bacteria 6435
392 Ga0207675_100539600 3300026118 Bacteria 1164
393 Ga0207683_10002143 3300026121 Bacteria 17337
394 Ga0207683_10407772 3300026121 Bacteria 1251
395 Ga0207683_12095811 3300026121 Unclassified 514
396 Ga0207698_10042767 3300026142 Bacteria 3388
397 Ga0207698_10390674 3300026142 Bacteria 1326
398 Ga0209998_10079893 3300027717 Bacteria 791
399 Ga0207428_10465728 3300027907 Bacteria 920
400 Ga0207428_10832069 3300027907 Unclassified 655
401 Ga0268266_10018012 3300028379 Bacteria 6021
402 Ga0268266_10072502 3300028379 Bacteria 2987
403 Ga0268265_10678628 3300028380 Bacteria 993
404 Ga0268264_10199860 3300028381 Bacteria 1828
405 Ga0265334_10034004 3300028573 Bacteria 2025
406 Ga0265318_10059467 3300028577 Bacteria 1425
407 Ga0265336_10041387 3300028666 Bacteria 1409
408 Ga0265338_10006150 3300028800 Bacteria 15405
409 Ga0265338_10064047 3300028800 Bacteria 3201
410 Ga0265330_10050813 3300031235 Bacteria 1818
411 Ga0265332_10131464 3300031238 Bacteria 1050
412 Ga0265320_10296078 3300031240 Bacteria 716
413 Ga0265325_10003953 3300031241 Bacteria 9484
414 Ga0265329_10097063 3300031242 Bacteria 937
415 Ga0265339_10142402 3300031249 Bacteria 1218
416 Ga0265327_10012516 3300031251 Bacteria 5715
417 Ga0265316_10009994 3300031344 Bacteria 8682
418 Ga0307408_100133594 3300031548 Bacteria 1939
419 Ga0307408_101292703 3300031548 Bacteria 683
420 Ga0265313_10009829 3300031595 Bacteria 6158
421 Ga0265314_10007139 3300031711 Bacteria 9733
422 Ga0265342_10007806 3300031712 Bacteria 7776
423 Ga0307405_10210747 3300031731 Bacteria 1418
424 Ga0307413_11618829 3300031824 Unclassified 575
425 Ga0307410_11528238 3300031852 Unclassified 588
426 Ga0307406_10096227 3300031901 Bacteria 2005
427 Ga0307407_10250833 3300031903 Bacteria 1212
428 Ga0307412_10535134 3300031911 Bacteria 981
429 Ga0307409_100108632 3300031995 Bacteria 2320
430 Ga0307409_100675934 3300031995 Bacteria 1029
431 Ga0307416_100035823 3300032002 Bacteria 3796
432 Ga0307414_10228975 3300032004 Bacteria 1531
433 Ga0307415_100463883 3300032126 Bacteria 1098
434 Ga0373926_0178755 3300035083 Bacteria 813
435 Ga0373936_0008139 3300035113 Bacteria 3942
436 Ga0373945_0017754 3300035116 Bacteria 2413
437 Ga0373943_0008552 3300035170 Bacteria 4589
438 Ga0373935_0026048 3300035692 Bacteria 3606
439 Ga0373947_0014472 3300035725 Bacteria 4526
440 Ga0373947_0029763 3300035725 Unclassified 3205
441 Ga0373925_0012189 3300037068 Bacteria 6223
442 Ga0395899_0003564 3300037312 Bacteria 12326
443 Ga0395899_0011539 3300037312 Bacteria 6765
444 Ga0395899_0053989 3300037312 Bacteria 2974
445 Ga0395899_0099058 3300037312 Bacteria 2106
446 Ga0395899_0257268 3300037312 Bacteria 1195
447 Ga0395900_0001626 3300037418 Bacteria 26408
448 Ga0395900_0004447 3300037418 Bacteria 14849
449 Ga0395900_0172014 3300037418 Bacteria 2204
450 Ga0395900_0197714 3300037418 Bacteria 2036
451 Ga0395900_0204501 3300037418 Bacteria 1996
452 Ga0395900_0284505 3300037418 Bacteria 1644
453 Ga0395900_0480084 3300037418 Bacteria 1195
454 Ga0395898_0000824 3300037466 Bacteria 51781
455 Ga0395898_0050375 3300037466 Bacteria 4075
456 Ga0395898_0084404 3300037466 Bacteria 3061
457 Ga0395898_0090454 3300037466 Bacteria 2945
458 Ga0395898_0117906 3300037466 Bacteria 2543
459 Ga0395898_0417962 3300037466 Bacteria 1278
460 Ga0395898_0494721 3300037466 Unclassified 1163
461 Ga0395898_0721309 3300037466 Bacteria 939
462 Ga0395898_0814255 3300037466 Bacteria 874
463 Ga0395898_1181958 3300037466 Bacteria 696
464 Ga0395905_0001363 3300037471 Bacteria 29719
465 Ga0395905_0010364 3300037471 Bacteria 9074
466 Ga0395905_0028667 3300037471 Bacteria 5248
467 Ga0395905_0047608 3300037471 Bacteria 4017
468 Ga0395905_0236244 3300037471 Bacteria 1708
469 Ga0395905_0327833 3300037471 Bacteria 1421
470 Ga0395905_0513529 3300037471 Bacteria 1098
471 Ga0436364_0261127 3300037853 Bacteria 2754
472 Ga0395901_0000244 3300038443 Bacteria 67684
473 Ga0395901_0002680 3300038443 Bacteria 17962
474 Ga0395901_0036006 3300038443 Bacteria 5114
475 Ga0395901_0071012 3300038443 Bacteria 3628
476 Ga0395901_0144022 3300038443 Unclassified 2505
477 Ga0395901_0164737 3300038443 Bacteria 2328
478 Ga0395901_0293738 3300038443 Bacteria 1686
479 Ga0395901_0333056 3300038443 Bacteria 1569
480 Ga0395901_0422131 3300038443 Bacteria 1367
481 Ga0395901_0629202 3300038443 Unclassified 1079
482 Ga0395901_1195084 3300038443 Bacteria 726
483 Ga0436365_1472723 3300039437 Bacteria 716
484 Ga0436365_1646705 3300039437 Bacteria 1446
485 Ga0436363_0088067 3300039450 Bacteria 1924
486 Ga0436363_1699454 3300039450 Bacteria 3295
487 Ga0436362_0634204 3300039453 Bacteria 1295
488 Ga0439447_046109 3300041407 Bacteria 1050
489 Ga0439461_0015815 3300041410 Bacteria 1449
490 Ga0439465_0329674 3300041413 Bacteria 574
491 Ga0439465_0374480 3300041413 Unclassified 540
492 Ga0451789_0004674 3300041443 Bacteria 1133
493 Ga0451839_1544580 3300041496 Bacteria 520
494 Ga0451853_1850206 3300041512 Unclassified 555
495 Ga0439437_023876 3300042000 Unclassified 749
496 Ga0439448_0028289 3300042005 Bacteria 1770
497 Ga0439455_0019229 3300042012 Bacteria 1609
498 Ga0450902_084918 3300042137 Bacteria 557
499 Ga0439446_0000838 3300042156 Bacteria 6580
500 Ga0439434_0003603 3300042435 Bacteria 4525
501 Ga0450916_050208 3300042530 Unclassified 656
502 Ga0439440_0226088 3300042993 Unclassified 563
503 Ga0466969_0207111 3300044656 Bacteria 894
504 Ga0466969_0291819 3300044656 Bacteria 738
505 Ga0466965_0142126 3300044683 Bacteria 1250
506 Ga0466965_0480022 3300044683 Unclassified 695
507 Ga0466966_0005063 3300044684 Bacteria 8660
508 Ga0466966_0006031 3300044684 Bacteria 8001
509 Ga0466966_0028061 3300044684 Bacteria 3667
510 Ga0466966_0171071 3300044684 Bacteria 1320
511 Ga0466961_0003168 3300044693 Bacteria 10245
512 Ga0466961_0003920 3300044693 Bacteria 9308
513 Ga0466961_0091045 3300044693 Bacteria 1926
514 Ga0466961_0386554 3300044693 Bacteria 850
515 Ga0466961_0433904 3300044693 Unclassified 796
516 Ga0466961_0626293 3300044693 Bacteria 646
517 Ga0466963_0001137 3300044694 Bacteria 13906
518 Ga0466963_0003559 3300044694 Bacteria 8949
519 Ga0466963_0007724 3300044694 Bacteria 6426
520 Ga0466963_0009266 3300044694 Bacteria 5929
521 Ga0466963_0024212 3300044694 Bacteria 3864
522 Ga0466963_0046731 3300044694 Bacteria 2855
523 Ga0466963_0065055 3300044694 Bacteria 2444
524 Ga0466963_0114292 3300044694 Bacteria 1854
525 Ga0466963_0144774 3300044694 Bacteria 1648
526 Ga0466963_0161482 3300044694 Bacteria 1559
527 Ga0466963_0190361 3300044694 Unclassified 1433
528 Ga0466963_0326836 3300044694 Unclassified 1079
529 Ga0466963_0645971 3300044694 Bacteria 747
530 Ga0466964_0001534 3300044706 Bacteria 7945
531 Ga0466964_0004731 3300044706 Bacteria 5030
532 Ga0466964_0056279 3300044706 Bacteria 1626
533 Ga0466964_0064900 3300044706 Bacteria 1528
534 Ga0466971_0000469 3300044719 Bacteria 15840
535 Ga0466971_0018695 3300044719 Bacteria 3072
536 Ga0466971_0207023 3300044719 Bacteria 927
537 Ga0466968_0021080 3300044735 Bacteria 2636
538 Ga0466968_0045555 3300044735 Bacteria 1862
539 Ga0466968_0073346 3300044735 Bacteria 1493
540 Ga0466968_0117834 3300044735 Bacteria 1199
541 Ga0466970_0021149 3300044765 Bacteria 3387
542 Ga0466957_0013233 3300044842 Bacteria 4785
543 Ga0466957_0030705 3300044842 Bacteria 3209
544 Ga0466960_0141119 3300044901 Bacteria 1280
545 Ga0466960_0337520 3300044901 Unclassified 857
546 Ga0466960_0381284 3300044901 Unclassified 809
547 Ga0466960_0981223 3300044901 Bacteria 518
548 Ga0466959_0004921 3300045049 Bacteria 9047
549 Ga0466959_0007042 3300045049 Bacteria 7859
550 Ga0466959_0018160 3300045049 Bacteria 5162
551 Ga0466959_0024117 3300045049 Bacteria 4504
552 Ga0466959_0037088 3300045049 Bacteria 3601
553 Ga0466958_0003237 3300045836 Bacteria 8407
554 Ga0466958_0007568 3300045836 Bacteria 5980
555 Ga0466958_0019514 3300045836 Bacteria 3947
556 Ga0466958_0041096 3300045836 Bacteria 2781
557 Ga0466958_0341247 3300045836 Unclassified 964
558 Ga0466958_0460705 3300045836 Unclassified 823
559 Ga0466958_0468958 3300045836 Bacteria 816
560 Ga0466958_0481873 3300045836 Bacteria 804
561 Ga0466967_0000859 3300045976 Bacteria 16152
562 Ga0466967_0002328 3300045976 Bacteria 11748
563 Ga0466967_0004759 3300045976 Bacteria 9241
564 Ga0466967_0005890 3300045976 Bacteria 8586
565 Ga0466967_0006213 3300045976 Bacteria 8418
566 Ga0466967_0019124 3300045976 Bacteria 5499
567 Ga0466967_0019521 3300045976 Bacteria 5452
568 Ga0466967_0031365 3300045976 Bacteria 4473
569 Ga0466967_0060145 3300045976 Bacteria 3365
570 Ga0466967_0107455 3300045976 Bacteria 2559
571 Ga0466967_0124924 3300045976 Bacteria 2382
572 Ga0466967_0169661 3300045976 Unclassified 2052
573 Ga0466967_0226629 3300045976 Bacteria 1778
574 Ga0466967_0261675 3300045976 Bacteria 1655
575 Ga0466967_0276804 3300045976 Bacteria 1609
576 Ga0466967_0337549 3300045976 Bacteria 1456
577 Ga0466967_0404686 3300045976 Unclassified 1328
578 Ga0466967_0474418 3300045976 Bacteria 1225
579 Ga0466967_0603779 3300045976 Unclassified 1083
580 Ga0466967_0751441 3300045976 Bacteria 967
581 Ga0466967_0777396 3300045976 Archaea 950
582 Ga0466967_1152292 3300045976 Bacteria 772
583 Ga0466967_2087492 3300045976 Bacteria 563
584 Ga0495603_0029729 3300046455 Bacteria 3294
585 Ga0495603_0090611 3300046455 Bacteria 1788
586 Ga0495629_0055131 3300046459 Bacteria 2780
587 Ga0495629_0075516 3300046459 Unclassified 2354
588 Ga0495629_0342714 3300046459 Unclassified 1020
589 Ga0495629_0383560 3300046459 Bacteria 956
590 Ga0495641_0018748 3300046461 Bacteria 3563
591 Ga0495641_0022803 3300046461 Unclassified 3125
592 Ga0495641_0055941 3300046461 Unclassified 1790
593 Ga0495651_0017715 3300046462 Bacteria 5515
594 Ga0495653_0020122 3300046463 Bacteria 5410
595 Ga0495582_0326106 3300046473 Bacteria 883
596 Ga0495582_0501979 3300046473 Bacteria 701
597 Ga0495605_0412927 3300046474 Viruses 560
598 Ga0495639_0227579 3300046475 Bacteria 918
599 Ga0495662_0064943 3300046476 Bacteria 1764
600 Ga0495662_0070075 3300046476 Bacteria 1699
601 Ga0495584_0039772 3300046491 Unclassified 2376
602 Ga0495584_0484417 3300046491 Bacteria 630
603 Ga0495585_0266316 3300046492 Bacteria 851
604 Ga0495585_0319201 3300046492 Bacteria 760
605 Ga0495594_0019914 3300046499 Unclassified 3570
606 Ga0495594_0079340 3300046499 Bacteria 1832
607 Ga0495596_0079626 3300046500 Unclassified 1272
608 Ga0495596_0360595 3300046500 Bacteria 566
609 Ga0495607_0411328 3300046501 Viruses 614
610 Ga0495608_0076933 3300046511 Bacteria 2172
611 Ga0495618_0094202 3300046514 Unclassified 1915
612 Ga0495628_0029355 3300046516 Bacteria 4460
613 Ga0495630_0006319 3300046517 Bacteria 8417
614 Ga0495630_0014939 3300046517 Bacteria 5663
615 Ga0495630_0645490 3300046517 Bacteria 811
616 Ga0495663_0018070 3300046525 Unclassified 2006
617 Ga0495642_0052903 3300046528 Bacteria 1673
618 Ga0495642_0397831 3300046528 Viruses 607
619 Ga0495652_0095655 3300046529 Bacteria 2420
620 Ga0495665_0037759 3300046531 Bacteria 2577
621 Ga0495640_0007660 3300046533 Bacteria 8489
622 Ga0495586_0029827 3300046535 Unclassified 2920
623 Ga0495587_0082938 3300046536 Unclassified 1857
624 Ga0495621_0546665 3300046539 Bacteria 503
625 Ga0495645_0417185 3300046543 Bacteria 853
626 Ga0495667_0267910 3300046559 Bacteria 1085
627 Ga0495656_0028997 3300046615 Unclassified 2225
628 Ga0495659_0078032 3300046664 Bacteria 1252
629 Ga0495659_0090575 3300046664 Bacteria 1174
630 Ga0495659_0508394 3300046664 Bacteria 529
631 Ga0495661_0258955 3300046665 Bacteria 885
632 Ga0495588_0168981 3300046674 Unclassified 1156
633 Ga0495588_0383659 3300046674 Unclassified 738
634 Ga0495646_0077502 3300046680 Unclassified 1944
635 Ga0495647_0001825 3300046681 Bacteria 6589
636 Ga0495647_0125008 3300046681 Bacteria 1085
637 Ga0495658_0002674 3300046683 Bacteria 8971
638 Ga0495658_0004201 3300046683 Bacteria 7090
639 Ga0495658_0493781 3300046683 Unclassified 783
640 Ga0495613_0017137 3300046689 Bacteria 5394
641 Ga0495613_0078401 3300046689 Bacteria 2403
642 Ga0495613_0303317 3300046689 Bacteria 1105
643 Ga0495613_0410340 3300046689 Unclassified 923
644 Ga0495624_0042532 3300046690 Bacteria 2903
645 Ga0495624_0137625 3300046690 Unclassified 1497
646 Ga0495589_0166102 3300046794 Bacteria 1050
647 Ga0495581_0020837 3300047315 Bacteria 3803
648 Ga0495581_0038806 3300047315 Bacteria 2757
649 Ga0495581_0604089 3300047315 Bacteria 635
650 Ga0495604_0010671 3300047317 Bacteria 7289
651 Ga0495636_0243790 3300047318 Bacteria 830
652 Ga0495674_0000604 3300047319 Bacteria 33665
653 Ga0495676_0019822 3300047321 Bacteria 5911
654 Ga0495676_0036853 3300047321 Bacteria 4079
655 Ga0495676_0056087 3300047321 Unclassified 3118
656 Ga0495680_0001294 3300047322 Bacteria 27286
657 Ga0495677_0129363 3300047445 Bacteria 966
658 Ga0495677_0312429 3300047445 Bacteria 619
659 Ga0495685_229643 3300047447 Viruses 591
660 Ga0495684_0013764 3300047471 Bacteria 6226
661 Ga0495614_0243808 3300048089 Bacteria 821
662 Ga0496100_0000872 3300048903 Bacteria 14404
663 Ga0496100_0008891 3300048903 Bacteria 5618
664 Ga0496100_0012306 3300048903 Bacteria 4901
665 Ga0496100_0063667 3300048903 Bacteria 2438
666 Ga0496100_0280577 3300048903 Bacteria 1242
667 Ga0496100_0356359 3300048903 Bacteria 1106
668 Ga0496100_0383994 3300048903 Bacteria 1067
669 Ga0496100_0659777 3300048903 Bacteria 815
670 Ga0496101_0001154 3300048904 Bacteria 15804
671 Ga0496101_0016759 3300048904 Bacteria 4959
672 Ga0496101_0026973 3300048904 Bacteria 3995
673 Ga0496101_0135874 3300048904 Bacteria 1871
674 Ga0496101_0318779 3300048904 Bacteria 1219
675 Ga0496101_0528536 3300048904 Bacteria 932
676 Ga0496101_1008864 3300048904 Unclassified 654
677 Ga0496102_0002435 3300048905 Bacteria 15873
678 Ga0496102_0062650 3300048905 Bacteria 3406
679 Ga0496102_0078757 3300048905 Bacteria 3034
680 Ga0496102_0240232 3300048905 Bacteria 1708
681 Ga0496102_0314062 3300048905 Bacteria 1476
682 Ga0496102_0366654 3300048905 Bacteria 1356
683 Ga0496102_0478360 3300048905 Bacteria 1167
684 Ga0496103_0001580 3300048906 Bacteria 15016
685 Ga0496103_0236395 3300048906 Bacteria 1175
686 Ga0496103_0264411 3300048906 Bacteria 1107
687 Ga0496103_0306261 3300048906 Bacteria 1022
688 Ga0496103_0537755 3300048906 Bacteria 746
689 Ga0496104_0013250 3300048907 Bacteria 7431
690 Ga0496104_0065377 3300048907 Bacteria 3451
691 Ga0496104_0156427 3300048907 Bacteria 2187
692 Ga0496104_0195748 3300048907 Bacteria 1933
693 Ga0496104_0279482 3300048907 Bacteria 1582
694 Ga0496104_0625568 3300048907 Bacteria 986
695 Ga0496105_0000413 3300048908 Bacteria 28035
696 Ga0496105_0016151 3300048908 Bacteria 5955
697 Ga0496105_0037651 3300048908 Bacteria 3983
698 Ga0496105_0098633 3300048908 Bacteria 2412
699 Ga0496105_1049112 3300048908 Bacteria 607
700 Ga0496106_0000380 3300048909 Bacteria 31592
701 Ga0496106_0001856 3300048909 Bacteria 15812
702 Ga0496106_0073772 3300048909 Bacteria 2611
703 Ga0496106_0097745 3300048909 Bacteria 2273
704 Ga0496106_0119589 3300048909 Bacteria 2058
705 Ga0496107_0024373 3300048910 Unclassified 4280
706 Ga0496107_0025342 3300048910 Bacteria 4199
707 Ga0496107_0029123 3300048910 Bacteria 3926
708 Ga0496107_0036737 3300048910 Bacteria 3514
709 Ga0496107_0045659 3300048910 Bacteria 3152
710 Ga0496107_0058620 3300048910 Bacteria 2784
711 Ga0496107_0084568 3300048910 Bacteria 2315
712 Ga0496107_0120999 3300048910 Bacteria 1929
713 Ga0496108_0002822 3300048911 Bacteria 13939
714 Ga0496108_0008505 3300048911 Bacteria 8326
715 Ga0496108_0026029 3300048911 Bacteria 4825
716 Ga0496108_0322806 3300048911 Bacteria 1346
717 Ga0496108_0595772 3300048911 Bacteria 963
718 Ga0496108_0622853 3300048911 Bacteria 939
719 Ga0496109_0001408 3300048912 Bacteria 19947
720 Ga0496109_0001538 3300048912 Bacteria 19181
721 Ga0496109_0006986 3300048912 Bacteria 9529
722 Ga0496109_0088783 3300048912 Bacteria 2857
723 Ga0496109_0100769 3300048912 Bacteria 2680
724 Ga0496109_0209329 3300048912 Unclassified 1834
725 Ga0496109_0379394 3300048912 Unclassified 1335
726 Ga0496110_0000288 3300048913 Bacteria 32994
727 Ga0496110_0002556 3300048913 Bacteria 13676
728 Ga0496110_0020720 3300048913 Bacteria 5553
729 Ga0496110_0049840 3300048913 Bacteria 3675
730 Ga0496111_0000284 3300048914 Bacteria 24558
731 Ga0496111_0006816 3300048914 Bacteria 7450
732 Ga0496111_0083769 3300048914 Bacteria 2330
733 Ga0496111_0155993 3300048914 Bacteria 1694
734 Ga0496111_0495053 3300048914 Bacteria 900
735 Ga0496111_0651343 3300048914 Bacteria 768
736 Ga0496112_0001681 3300048915 Bacteria 17225
737 Ga0496112_0005474 3300048915 Bacteria 10991
738 Ga0496112_0025777 3300048915 Bacteria 5648
739 Ga0496112_0126898 3300048915 Bacteria 2522
740 Ga0496112_0131776 3300048915 Bacteria 2471
741 Ga0496112_0442967 3300048915 Bacteria 1237
742 Ga0496112_0891493 3300048915 Bacteria 812
743 Ga0496112_1130229 3300048915 Bacteria 701
744 Ga0496113_0011988 3300048916 Bacteria 5812
745 Ga0496113_0103625 3300048916 Bacteria 2207
746 Ga0496113_0151921 3300048916 Bacteria 1827
747 Ga0496113_0208162 3300048916 Bacteria 1556
748 Ga0496113_0788439 3300048916 Bacteria 755
749 Ga0496114_0001478 3300048917 Bacteria 17845
750 Ga0496114_0015574 3300048917 Bacteria 6113
751 Ga0496114_0021947 3300048917 Bacteria 5198
752 Ga0496114_0088077 3300048917 Bacteria 2633
753 Ga0496114_0120060 3300048917 Bacteria 2260
754 Ga0496114_0614840 3300048917 Unclassified 957
755 Ga0496114_1677310 3300048917 Bacteria 524
756 Ga0496115_0001310 3300048918 Bacteria 17721
757 Ga0496115_0002457 3300048918 Bacteria 13313
758 Ga0496115_0083568 3300048918 Bacteria 2603
759 Ga0496115_0495816 3300048918 Bacteria 982
760 Ga0496115_0557422 3300048918 Unclassified 915
761 Ga0501032_0747947 3300049569 Bacteria 619
762 Ga0501032_1027425 3300049569 Bacteria 517
763 Ga0501034_0051076 3300049571 Bacteria 4170
764 Ga0501036_0389032 3300049572 Bacteria 1163
765 Ga0501038_0023496 3300049574 Bacteria 5510
766 Ga0501038_0162326 3300049574 Bacteria 1815
767 Ga0501038_0866933 3300049574 Bacteria 668
768 Ga0501040_0101788 3300049576 Bacteria 2004
769 Ga0501042_0017321 3300049578 Bacteria 4967
770 Ga0501043_0163474 3300049579 Bacteria 1739
771 Ga0501046_0207940 3300049580 Bacteria 1454
772 Ga0501046_0450302 3300049580 Bacteria 926
773 Ga0501047_0019815 3300049581 Bacteria 6456
774 Ga0501047_0024860 3300049581 Bacteria 5751
775 Ga0501047_0072970 3300049581 Bacteria 3304
776 Ga0501047_0355603 3300049581 Bacteria 1301
777 Ga0501048_0014828 3300049582 Bacteria 5764
778 Ga0501048_0666908 3300049582 Unclassified 747
779 Ga0501067_0001127 3300049583 Bacteria 14464
780 Ga0501067_0037524 3300049583 Bacteria 2691
781 Ga0501067_0177230 3300049583 Bacteria 1187
782 Ga0501068_0057163 3300049584 Bacteria 2365
783 Ga0501069_0044224 3300049585 Bacteria 2465
784 Ga0501069_0056653 3300049585 Unclassified 2184
785 Ga0501069_0123102 3300049585 Bacteria 1482
786 Ga0501070_0007864 3300049586 Bacteria 9035
787 Ga0501070_0082062 3300049586 Bacteria 2668
788 Ga0501070_0112698 3300049586 Bacteria 2248
789 Ga0501070_0175845 3300049586 Bacteria 1762
790 Ga0501070_0178309 3300049586 Bacteria 1749
791 Ga0501070_0436709 3300049586 Bacteria 1056
792 Ga0501071_0014250 3300049587 Bacteria 5437
793 Ga0501072_0099725 3300049588 Bacteria 2308
794 Ga0501072_0439584 3300049588 Unclassified 1033
795 Ga0501072_0936720 3300049588 Bacteria 676
796 Ga0501073_0025021 3300049589 Bacteria 4284
797 Ga0501073_0278207 3300049589 Bacteria 1155
798 Ga0501074_0000736 3300049590 Bacteria 20545
799 Ga0501074_0133281 3300049590 Bacteria 1777
800 Ga0501074_0192630 3300049590 Bacteria 1453
801 Ga0501074_0511625 3300049590 Bacteria 850
802 Ga0501075_0012994 3300049591 Bacteria 5933
803 Ga0501076_0027201 3300049592 Bacteria 4436
804 Ga0501077_0018427 3300049593 Bacteria 4418
805 Ga0501079_0078813 3300049741 Bacteria 2548
806 Ga0501080_0000499 3300049742 Bacteria 30720
807 Ga0501080_0045375 3300049742 Bacteria 4091
808 Ga0501080_0484954 3300049742 Bacteria 1106
809 Ga0501081_0036936 3300049743 Bacteria 3332
810 Ga0501083_0090671 3300049744 Bacteria 2019
811 Ga0501035_0257356 3300049822 Bacteria 1481
812 Ga0501035_0884057 3300049822 Bacteria 709
813 Ga0501044_0173566 3300049823 Bacteria 2126
814 Ga0501044_0616475 3300049823 Bacteria 977
815 Ga0501044_0892707 3300049823 Bacteria 764
816 Ga0501045_0000429 3300049824 Bacteria 25701
817 nmdc:mga00v17_246541_c1 3300050491 Bacteria 1158
818 nmdc:mga0yw44_805866_c1 3300050492 Bacteria 638
819 nmdc:mga05p37_214220_c1 3300050507 Bacteria 2327
820 nmdc:mga05p37_2477_c1 3300050507 Bacteria 21478
821 nmdc:mga05p37_6790_c1 3300050507 Bacteria 13486
822 nmdc:mga05p37_724856_c1 3300050507 Bacteria 1100
823 nmdc:mga09592_16652_c1 3300050508 Bacteria 6016
824 nmdc:mga0qj67_13175_c1 3300050509 Bacteria 6242
825 nmdc:mga0qj67_132149_c1 3300050509 Bacteria 2022
826 nmdc:mga06r32_1301667_c1 3300050510 Bacteria 671
827 nmdc:mga06r32_901148_c1 3300050510 Bacteria 841
828 nmdc:mga08y16_103397_c1 3300050511 Bacteria 2966
829 nmdc:mga08y16_1336378_c1 3300050511 Unclassified 682
830 nmdc:mga0n895_231402_c1 3300050512 Bacteria 1876
831 nmdc:mga0n895_74762_c1 3300050512 Bacteria 3367
832 nmdc:mga0rr50_249065_c1 3300050513 Bacteria 1475
833 nmdc:mga0rr50_70984_c1 3300050513 Bacteria 2656
834 nmdc:mga08x19_43029_c1 3300050514 Bacteria 2881
835 nmdc:mga0a205_1260108_c1 3300050515 Unclassified 587
836 nmdc:mga0a205_66112_c1 3300050515 Bacteria 3494
837 nmdc:mga0a205_97071_c1 3300050515 Bacteria 2846
838 Ga0495601_0028288 3300053077 Bacteria 3472
839 Ga0495595_0091937 3300053084 Unclassified 1456
840 Ga0495619_0043577 3300053085 Bacteria 2942
841 Ga0501084_0009449 3300054114 Bacteria 8069
842 Ga0501084_0328034 3300054114 Bacteria 1293
843 Ga0590071_020351 3300059421 Bacteria 1563
844 Ga0590074_022246 3300059423 Bacteria 1095
845 Ga0590077_015851 3300059426 Bacteria 1578
846 Ga0501082_0056162 3300060353 Bacteria 3391
847 Ga0466962_0003629 3300061719 Bacteria 7359
848 Ga0466962_0020288 3300061719 Bacteria 3194
849 Ga0466962_0039457 3300061719 Bacteria 2261
850 Ga0466962_0051664 3300061719 Bacteria 1966
851 Ga0466962_0140595 3300061719 Bacteria 1169
852 Ga0530510_0009672 3300061734 Bacteria 6766
853 Ga0530510_0297016 3300061734 Bacteria 1208
854 Ga0075434_100294970
855 JGI24749J21850_1022907
856 JGI24744J21845_10037716
857 Ga0070658_10036571
858 Ga0070658_10094616
859 Ga0070658_10104089
860 Ga0070658_11005879
861 Ga0070683_100037582
862 Ga0070683_100045570
863 Ga0070683_100106057
864 Ga0070690_100010870
865 Ga0070680_100143926
866 Ga0070680_100156968
867 Ga0070680_100223236
868 Ga0070680_101346384
869 Ga0070682_100001353
870 Ga0070682_100212711
871 Ga0070682_100333394
872 Ga0068868_100441901
873 Ga0068868_100570019
874 Ga0070660_100007998
875 Ga0070660_100015912
876 Ga0070660_100093203
877 Ga0070660_100148586
878 Ga0070660_100269301
879 Ga0070660_100344355
880 Ga0070660_100493616
881 Ga0070660_100653434
882 Ga0070691_10956086
883 Ga0070687_100009155
884 Ga0070687_100382950
885 Ga0070661_100040189
886 Ga0070692_10682338
887 Ga0070669_100654407
888 Ga0070675_100130161
889 Ga0070673_100148930
890 Ga0070659_100003771
891 Ga0070659_100042127
892 Ga0070659_100141754
893 Ga0070659_100611963
894 Ga0070659_101176694
895 Ga0070703_10316755
896 Ga0070709_10191392
897 Ga0070709_10971570
898 Ga0070709_11730319
899 Ga0070714_100035545
900 Ga0070714_100077257
901 Ga0070714_100339043
902 Ga0070714_100548355
903 Ga0070714_101243716
904 Ga0070713_100588914
905 Ga0070713_100936479
906 Ga0070710_10146116
907 Ga0070701_10008806
908 Ga0070701_10501816
909 Ga0070711_100002187
910 Ga0070711_100012056
911 Ga0070711_100198592
912 Ga0070711_100599075
913 Ga0070711_101408566
914 Ga0070711_101412236
915 Ga0070700_100002757
916 Ga0070700_100805662
917 Ga0070694_100029990
918 Ga0070663_101097367
919 Ga0070663_101323166
920 Ga0070678_100002780
921 Ga0070678_101723710
922 Ga0070681_10015700
923 Ga0070681_10035668
924 Ga0070681_10275245
925 Ga0070681_10455838
926 Ga0070681_10649802
927 Ga0068867_100000550
928 Ga0070685_10001027
929 Ga0070706_100033135
930 Ga0070706_100242221
931 Ga0070706_101417444
932 Ga0070707_100001094
933 Ga0070707_100999584
934 Ga0070698_100026743
935 Ga0070698_100146394
936 Ga0070698_100224357
937 Ga0070699_100071957
938 Ga0070699_100190846
939 Ga0070699_100238644
940 Ga0070699_100814400
941 Ga0070679_100023086
942 Ga0070679_100050172
943 Ga0070679_100082883
944 Ga0070679_100172249
945 Ga0070679_100176495
946 Ga0070679_100250630
947 Ga0070679_100420637
948 Ga0070679_100801740
949 Ga0070679_100974338
950 Ga0070684_100137723
951 Ga0070684_100273652
952 Ga0070684_100616947
953 Ga0070684_101385986
954 Ga0070684_101916387
955 Ga0070697_100115563
956 Ga0068853_100004653
957 Ga0068853_100101626
958 Ga0068853_101015247
959 Ga0070672_100243590
960 Ga0070686_100002324
961 Ga0070686_100439690
962 Ga0070695_100374167
963 Ga0070696_100014317
964 Ga0070693_100194078
965 Ga0070693_100622718
966 Ga0070665_100007548
967 Ga0070665_100032068
968 Ga0070704_100005238
969 Ga0070704_100298837
970 Ga0070704_101157390
971 Ga0068855_100028295
972 Ga0068855_100048620
973 Ga0068855_100088984
974 Ga0068855_100112215
975 Ga0068855_100209553
976 Ga0068855_100467152
977 Ga0068857_100011411
978 Ga0068857_100195364
979 Ga0068854_100082317
980 Ga0068854_100266116
981 Ga0068856_100009339
982 Ga0068856_100111950
983 Ga0068856_100211859
984 Ga0068856_100301589
985 Ga0068856_100329503
986 Ga0068856_100546278
987 Ga0068856_102152128
988 Ga0070702_100003004
989 Ga0068852_100014317
990 Ga0068852_100074071
991 Ga0068852_100098441
992 Ga0068852_100506960
993 Ga0068859_100027843
994 Ga0068861_100032064
995 Ga0068861_100808496
996 Ga0068851_10589004
997 Ga0068860_100171690
998 Ga0068860_102370854
999 Ga0081539_10073708
1000 Ga0070717_10021799
1001 Ga0070717_10672654
1002 Ga0075365_10700978
1003 Ga0075364_10269603
1004 Ga0075364_10505660
1005 Ga0075432_10258876
1006 Ga0070715_10073231
1007 Ga0070712_100015106
1008 Ga0070712_100069346
1009 Ga0070712_100069414
1010 Ga0097621_100006172
1011 Ga0097621_100198145
1012 Ga0068871_100293188
1013 Ga0068871_100821938
1014 Ga0068871_101754560
1015 Ga0075428_100093160
1016 Ga0075430_100805559
1017 Ga0075431_100193601
1018 Ga0075431_100651381
1019 Ga0075433_10014069
1020 Ga0075433_10271436
1021 Ga0075434_100010906
1022 Ga0075434_101009410
1023 Ga0075429_100011218
1024 Ga0075429_100963370
1025 Ga0068865_100000227
1026 Ga0075436_100039906
1027 Ga0097620_100027843
1028 Ga0075435_100078957
1029 Ga0075435_100131872
1030 Ga0075435_100188256
1031 Ga0105240_10051622
1032 Ga0105240_10061052
1033 Ga0105240_10600297
1034 Ga0105240_12213464
1035 Ga0111539_10094787
1036 Ga0111539_10108916
1037 Ga0105245_10023004
1038 Ga0105245_10489437
1039 Ga0105245_11436731
1040 Ga0114129_10040444
1041 Ga0114129_10055751
1042 Ga0114129_10083841
1043 Ga0114129_10095852
1044 Ga0114129_11030461
1045 Ga0114129_11902660
1046 Ga0105243_10436534
1047 Ga0105241_10065053
1048 Ga0105241_10380142
1049 Ga0105241_10815440
1050 Ga0105242_10001454
1051 Ga0105248_10062399
1052 Ga0105248_12234648
1053 Ga0105248_12297129
1054 Ga0105237_10037076
1055 Ga0105237_10178240
1056 Ga0105237_10429259
1057 Ga0105237_10557635
1058 Ga0105237_12125518
1059 Ga0105238_10040827
1060 Ga0105249_10002535
1061 Ga0105249_10480408
1062 Ga0105239_10001933
1063 Ga0105239_10027377
1064 Ga0105239_10722610
1065 Ga0105239_11899156
1066 Ga0105239_13055035
1067 Ga0105246_11427591
1068 Ga0157373_10615442
1069 Ga0157373_10656772
1070 Ga0157371_10203443
1071 Ga0157371_10362177
1072 Ga0157371_10510877
1073 Ga0157370_10013920
1074 Ga0157370_10021781
1075 Ga0157370_10027545
1076 Ga0157370_10089902
1077 Ga0157370_10383295
1078 Ga0157370_10670869
1079 Ga0157370_11066674
1080 Ga0157369_10010672
1081 Ga0157369_10084027
1082 Ga0157369_10097700
1083 Ga0157369_10348917
1084 Ga0157374_10014191
1085 Ga0157374_10869611
1086 Ga0157378_10002034
1087 Ga0163162_10002291
1088 Ga0163162_10750196
1089 Ga0157372_10109170
1090 Ga0157372_10254602
1091 Ga0157372_10610316
1092 Ga0157372_11247871
1093 Ga0157372_11744624
1094 Ga0157375_10037709
1095 Ga0157375_10054990
1096 Ga0157375_10686967
1097 Ga0157375_11946180
1098 Ga0157375_12461618
1099 Ga0157380_10002637
1100 Ga0182008_10085595
1101 Ga0157377_10022007
1102 Ga0157376_10077158
1103 Ga0197907_10994198
1104 Ga0197907_11299474
1105 Ga0206356_10008307
1106 Ga0206356_10150742
1107 Ga0206356_10827326
1108 Ga0206356_11299735
1109 Ga0206354_10202118
1110 Ga0206354_10358543
1111 Ga0206354_11143875
1112 Ga0206353_10804099
1113 Ga0206353_10879736
1114 Ga0206353_11861837
1115 Ga0213876_10199893
1116 Ga0207692_11012264
1117 Ga0207642_10001151
1118 Ga0207688_10057984
1119 Ga0207685_10150778
1120 Ga0207685_10440878
1121 Ga0207699_10100917
1122 Ga0207699_10212253
1123 Ga0207705_10005200
1124 Ga0207705_10158330
1125 Ga0207705_10209113
1126 Ga0207705_10303845
1127 Ga0207705_10321617
1128 Ga0207705_10373251
1129 Ga0207684_10106846
1130 Ga0207684_10260916
1131 Ga0207684_11057574
1132 Ga0207654_10629409
1133 Ga0207707_10017189
1134 Ga0207707_10073017
1135 Ga0207707_10082799
1136 Ga0207707_10112059
1137 Ga0207707_10148660
1138 Ga0207695_10097899
1139 Ga0207695_10116989
1140 Ga0207695_10561191
1141 Ga0207671_10103617
1142 Ga0207671_10316881
1143 Ga0207671_10484439
1144 Ga0207693_10001103
1145 Ga0207693_10008867
1146 Ga0207693_10015845
1147 Ga0207693_10096026
1148 Ga0207663_10083739
1149 Ga0207663_10242943
1150 Ga0207663_10536268
1151 Ga0207663_10564272
1152 Ga0207663_11362565
1153 Ga0207660_10114927
1154 Ga0207660_10136979
1155 Ga0207660_10319076
1156 Ga0207660_10472480
1157 Ga0207662_10053700
1158 Ga0207657_10005129
1159 Ga0207657_10010441
1160 Ga0207657_10030136
1161 Ga0207657_10047476
1162 Ga0207657_10102133
1163 Ga0207657_10136437
1164 Ga0207657_10234620
1165 Ga0207657_10399586
1166 Ga0207657_10501340
1167 Ga0207649_10036640
1168 Ga0207649_10073141
1169 Ga0207652_10065929
1170 Ga0207652_10083152
1171 Ga0207652_10227457
1172 Ga0207652_10238455
1173 Ga0207652_10303209
1174 Ga0207652_10383185
1175 Ga0207652_10739157
1176 Ga0207652_10987299
1177 Ga0207652_11622644
1178 Ga0207646_10004975
1179 Ga0207646_10309013
1180 Ga0207681_10533593
1181 Ga0207694_10183167
1182 Ga0207694_10283887
1183 Ga0207659_10101582
1184 Ga0207687_10102155
1185 Ga0207687_10139735
1186 Ga0207687_10319492
1187 Ga0207700_10111391
1188 Ga0207700_10125687
1189 Ga0207700_10647015
1190 Ga0207664_10140000
1191 Ga0207664_10245957
1192 Ga0207644_10352884
1193 Ga0207690_10041792
1194 Ga0207690_10152801
1195 Ga0207690_10181460
1196 Ga0207690_10248190
1197 Ga0207690_10544939
1198 Ga0207686_10010247
1199 Ga0207686_10057863
1200 Ga0207709_10000390
1201 Ga0207670_10003763
1202 Ga0207669_10733430
1203 Ga0207704_10011983
1204 Ga0207665_10216705
1205 Ga0207691_10024175
1206 Ga0207711_10112339
1207 Ga0207689_10593742
1208 Ga0207661_10030134
1209 Ga0207661_10067008
1210 Ga0207661_10121846
1211 Ga0207661_10129272
1212 Ga0207661_10189324
1213 Ga0207661_10260449
1214 Ga0207679_10782744
1215 Ga0207667_10049597
1216 Ga0207667_10101797
1217 Ga0207667_10133752
1218 Ga0207667_10181528
1219 Ga0207667_10211450
1220 Ga0207667_10241328
1221 Ga0207651_11377929
1222 Ga0207712_10002933
1223 Ga0207668_10098843
1224 Ga0207640_10233343
1225 Ga0207677_10276520
1226 Ga0207677_10540903
1227 Ga0207677_10717081
1228 Ga0207677_10855653
1229 Ga0207703_10791824
1230 Ga0207639_10021581
1231 Ga0207639_10399872
1232 Ga0207678_10034139
1233 Ga0207708_10000175
1234 Ga0207702_10112952
1235 Ga0207702_10124703
1236 Ga0207702_10143253
1237 Ga0207702_10228241
1238 Ga0207702_10331867
1239 Ga0207702_10923960
1240 Ga0207648_10000082
1241 Ga0207674_10004721
1242 Ga0207674_10054833
1243 Ga0207674_10832995
1244 Ga0207675_100018883
1245 Ga0207675_100539600
1246 Ga0207683_10002143
1247 Ga0207683_10407772
1248 Ga0207683_12095811
1249 Ga0207698_10042767
1250 Ga0207698_10390674
1251 Ga0209998_10079893
1252 Ga0207428_10465728
1253 Ga0207428_10832069
1254 Ga0268266_10018012
1255 Ga0268266_10072502
1256 Ga0268265_10678628
1257 Ga0268264_10199860
1258 Ga0265334_10034004
1259 Ga0265318_10059467
1260 Ga0265336_10041387
1261 Ga0265338_10006150
1262 Ga0265338_10064047
1263 Ga0265330_10050813
1264 Ga0265332_10131464
1265 Ga0265320_10296078
1266 Ga0265325_10003953
1267 Ga0265329_10097063
1268 Ga0265339_10142402
1269 Ga0265327_10012516
1270 Ga0265316_10009994
1271 Ga0307408_100133594
1272 Ga0307408_101292703
1273 Ga0265313_10009829
1274 Ga0265314_10007139
1275 Ga0265342_10007806
1276 Ga0307405_10210747
1277 Ga0307413_11618829
1278 Ga0307410_11528238
1279 Ga0307406_10096227
1280 Ga0307407_10250833
1281 Ga0307412_10535134
1282 Ga0307409_100108632
1283 Ga0307409_100675934
1284 Ga0307416_100035823
1285 Ga0307414_10228975
1286 Ga0307415_100463883
1287 Ga0373926_0178755
1288 Ga0373936_0008139
1289 Ga0373945_0017754
1290 Ga0373943_0008552
1291 Ga0373935_0026048
1292 Ga0373947_0014472
1293 Ga0373947_0029763
1294 Ga0373925_0012189
1295 Ga0395899_0003564
1296 Ga0395899_0011539
1297 Ga0395899_0053989
1298 Ga0395899_0099058
1299 Ga0395899_0257268
1300 Ga0395900_0001626
1301 Ga0395900_0004447
1302 Ga0395900_0172014
1303 Ga0395900_0197714
1304 Ga0395900_0204501
1305 Ga0395900_0284505
1306 Ga0395900_0480084
1307 Ga0395898_0000824
1308 Ga0395898_0050375
1309 Ga0395898_0084404
1310 Ga0395898_0090454
1311 Ga0395898_0117906
1312 Ga0395898_0417962
1313 Ga0395898_0494721
1314 Ga0395898_0721309
1315 Ga0395898_0814255
1316 Ga0395898_1181958
1317 Ga0395905_0001363
1318 Ga0395905_0010364
1319 Ga0395905_0028667
1320 Ga0395905_0047608
1321 Ga0395905_0236244
1322 Ga0395905_0327833
1323 Ga0395905_0513529
1324 Ga0436364_0261127
1325 Ga0395901_0000244
1326 Ga0395901_0002680
1327 Ga0395901_0036006
1328 Ga0395901_0071012
1329 Ga0395901_0144022
1330 Ga0395901_0164737
1331 Ga0395901_0293738
1332 Ga0395901_0333056
1333 Ga0395901_0422131
1334 Ga0395901_0629202
1335 Ga0395901_1195084
1336 Ga0436365_1472723
1337 Ga0436365_1646705
1338 Ga0436363_0088067
1339 Ga0436363_1699454
1340 Ga0436362_0634204
1341 Ga0439447_046109
1342 Ga0439461_0015815
1343 Ga0439465_0329674
1344 Ga0439465_0374480
1345 Ga0451789_0004674
1346 Ga0451839_1544580
1347 Ga0451853_1850206
1348 Ga0439437_023876
1349 Ga0439448_0028289
1350 Ga0439455_0019229
1351 Ga0450902_084918
1352 Ga0439446_0000838
1353 Ga0439434_0003603
1354 Ga0450916_050208
1355 Ga0439440_0226088
1356 Ga0466969_0207111
1357 Ga0466969_0291819
1358 Ga0466965_0142126
1359 Ga0466965_0480022
1360 Ga0466966_0005063
1361 Ga0466966_0006031
1362 Ga0466966_0028061
1363 Ga0466966_0171071
1364 Ga0466961_0003168
1365 Ga0466961_0003920
1366 Ga0466961_0091045
1367 Ga0466961_0386554
1368 Ga0466961_0433904
1369 Ga0466961_0626293
1370 Ga0466963_0001137
1371 Ga0466963_0003559
1372 Ga0466963_0007724
1373 Ga0466963_0009266
1374 Ga0466963_0024212
1375 Ga0466963_0046731
1376 Ga0466963_0065055
1377 Ga0466963_0114292
1378 Ga0466963_0144774
1379 Ga0466963_0161482
1380 Ga0466963_0190361
1381 Ga0466963_0326836
1382 Ga0466963_0645971
1383 Ga0466964_0001534
1384 Ga0466964_0004731
1385 Ga0466964_0056279
1386 Ga0466964_0064900
1387 Ga0466971_0000469
1388 Ga0466971_0018695
1389 Ga0466971_0207023
1390 Ga0466968_0021080
1391 Ga0466968_0045555
1392 Ga0466968_0073346
1393 Ga0466968_0117834
1394 Ga0466970_0021149
1395 Ga0466957_0013233
1396 Ga0466957_0030705
1397 Ga0466960_0141119
1398 Ga0466960_0337520
1399 Ga0466960_0381284
1400 Ga0466960_0981223
1401 Ga0466959_0004921
1402 Ga0466959_0007042
1403 Ga0466959_0018160
1404 Ga0466959_0024117
1405 Ga0466959_0037088
1406 Ga0466958_0003237
1407 Ga0466958_0007568
1408 Ga0466958_0019514
1409 Ga0466958_0041096
1410 Ga0466958_0341247
1411 Ga0466958_0460705
1412 Ga0466958_0468958
1413 Ga0466958_0481873
1414 Ga0466967_0000859
1415 Ga0466967_0002328
1416 Ga0466967_0004759
1417 Ga0466967_0005890
1418 Ga0466967_0006213
1419 Ga0466967_0019124
1420 Ga0466967_0019521
1421 Ga0466967_0031365
1422 Ga0466967_0060145
1423 Ga0466967_0107455
1424 Ga0466967_0124924
1425 Ga0466967_0169661
1426 Ga0466967_0226629
1427 Ga0466967_0261675
1428 Ga0466967_0276804
1429 Ga0466967_0337549
1430 Ga0466967_0404686
1431 Ga0466967_0474418
1432 Ga0466967_0603779
1433 Ga0466967_0751441
1434 Ga0466967_0777396
1435 Ga0466967_1152292
1436 Ga0466967_2087492
1437 Ga0495603_0029729
1438 Ga0495603_0090611
1439 Ga0495629_0055131
1440 Ga0495629_0075516
1441 Ga0495629_0342714
1442 Ga0495629_0383560
1443 Ga0495641_0018748
1444 Ga0495641_0022803
1445 Ga0495641_0055941
1446 Ga0495651_0017715
1447 Ga0495653_0020122
1448 Ga0495582_0326106
1449 Ga0495582_0501979
1450 Ga0495605_0412927
1451 Ga0495639_0227579
1452 Ga0495662_0064943
1453 Ga0495662_0070075
1454 Ga0495584_0039772
1455 Ga0495584_0484417
1456 Ga0495585_0266316
1457 Ga0495585_0319201
1458 Ga0495594_0019914
1459 Ga0495594_0079340
1460 Ga0495596_0079626
1461 Ga0495596_0360595
1462 Ga0495607_0411328
1463 Ga0495608_0076933
1464 Ga0495618_0094202
1465 Ga0495628_0029355
1466 Ga0495630_0006319
1467 Ga0495630_0014939
1468 Ga0495630_0645490
1469 Ga0495663_0018070
1470 Ga0495642_0052903
1471 Ga0495642_0397831
1472 Ga0495652_0095655
1473 Ga0495665_0037759
1474 Ga0495640_0007660
1475 Ga0495586_0029827
1476 Ga0495587_0082938
1477 Ga0495621_0546665
1478 Ga0495645_0417185
1479 Ga0495667_0267910
1480 Ga0495656_0028997
1481 Ga0495659_0078032
1482 Ga0495659_0090575
1483 Ga0495659_0508394
1484 Ga0495661_0258955
1485 Ga0495588_0168981
1486 Ga0495588_0383659
1487 Ga0495646_0077502
1488 Ga0495647_0001825
1489 Ga0495647_0125008
1490 Ga0495658_0002674
1491 Ga0495658_0004201
1492 Ga0495658_0493781
1493 Ga0495613_0017137
1494 Ga0495613_0078401
1495 Ga0495613_0303317
1496 Ga0495613_0410340
1497 Ga0495624_0042532
1498 Ga0495624_0137625
1499 Ga0495589_0166102
1500 Ga0495581_0020837
1501 Ga0495581_0038806
1502 Ga0495581_0604089
1503 Ga0495604_0010671
1504 Ga0495636_0243790
1505 Ga0495674_0000604
1506 Ga0495676_0019822
1507 Ga0495676_0036853
1508 Ga0495676_0056087
1509 Ga0495680_0001294
1510 Ga0495677_0129363
1511 Ga0495677_0312429
1512 Ga0495685_229643
1513 Ga0495684_0013764
1514 Ga0495614_0243808
1515 Ga0496100_0000872
1516 Ga0496100_0008891
1517 Ga0496100_0012306
1518 Ga0496100_0063667
1519 Ga0496100_0280577
1520 Ga0496100_0356359
1521 Ga0496100_0383994
1522 Ga0496100_0659777
1523 Ga0496101_0001154
1524 Ga0496101_0016759
1525 Ga0496101_0026973
1526 Ga0496101_0135874
1527 Ga0496101_0318779
1528 Ga0496101_0528536
1529 Ga0496101_1008864
1530 Ga0496102_0002435
1531 Ga0496102_0062650
1532 Ga0496102_0078757
1533 Ga0496102_0240232
1534 Ga0496102_0314062
1535 Ga0496102_0366654
1536 Ga0496102_0478360
1537 Ga0496103_0001580
1538 Ga0496103_0236395
1539 Ga0496103_0264411
1540 Ga0496103_0306261
1541 Ga0496103_0537755
1542 Ga0496104_0013250
1543 Ga0496104_0065377
1544 Ga0496104_0156427
1545 Ga0496104_0195748
1546 Ga0496104_0279482
1547 Ga0496104_0625568
1548 Ga0496105_0000413
1549 Ga0496105_0016151
1550 Ga0496105_0037651
1551 Ga0496105_0098633
1552 Ga0496105_1049112
1553 Ga0496106_0000380
1554 Ga0496106_0001856
1555 Ga0496106_0073772
1556 Ga0496106_0097745
1557 Ga0496106_0119589
1558 Ga0496107_0024373
1559 Ga0496107_0025342
1560 Ga0496107_0029123
1561 Ga0496107_0036737
1562 Ga0496107_0045659
1563 Ga0496107_0058620
1564 Ga0496107_0084568
1565 Ga0496107_0120999
1566 Ga0496108_0002822
1567 Ga0496108_0008505
1568 Ga0496108_0026029
1569 Ga0496108_0322806
1570 Ga0496108_0595772
1571 Ga0496108_0622853
1572 Ga0496109_0001408
1573 Ga0496109_0001538
1574 Ga0496109_0006986
1575 Ga0496109_0088783
1576 Ga0496109_0100769
1577 Ga0496109_0209329
1578 Ga0496109_0379394
1579 Ga0496110_0000288
1580 Ga0496110_0002556
1581 Ga0496110_0020720
1582 Ga0496110_0049840
1583 Ga0496111_0000284
1584 Ga0496111_0006816
1585 Ga0496111_0083769
1586 Ga0496111_0155993
1587 Ga0496111_0495053
1588 Ga0496111_0651343
1589 Ga0496112_0001681
1590 Ga0496112_0005474
1591 Ga0496112_0025777
1592 Ga0496112_0126898
1593 Ga0496112_0131776
1594 Ga0496112_0442967
1595 Ga0496112_0891493
1596 Ga0496112_1130229
1597 Ga0496113_0011988
1598 Ga0496113_0103625
1599 Ga0496113_0151921
1600 Ga0496113_0208162
1601 Ga0496113_0788439
1602 Ga0496114_0001478
1603 Ga0496114_0015574
1604 Ga0496114_0021947
1605 Ga0496114_0088077
1606 Ga0496114_0120060
1607 Ga0496114_0614840
1608 Ga0496114_1677310
1609 Ga0496115_0001310
1610 Ga0496115_0002457
1611 Ga0496115_0083568
1612 Ga0496115_0495816
1613 Ga0496115_0557422
1614 Ga0501032_0747947
1615 Ga0501032_1027425
1616 Ga0501034_0051076
1617 Ga0501036_0389032
1618 Ga0501038_0023496
1619 Ga0501038_0162326
1620 Ga0501038_0866933
1621 Ga0501040_0101788
1622 Ga0501042_0017321
1623 Ga0501043_0163474
1624 Ga0501046_0207940
1625 Ga0501046_0450302
1626 Ga0501047_0019815
1627 Ga0501047_0024860
1628 Ga0501047_0072970
1629 Ga0501047_0355603
1630 Ga0501048_0014828
1631 Ga0501048_0666908
1632 Ga0501067_0001127
1633 Ga0501067_0037524
1634 Ga0501067_0177230
1635 Ga0501068_0057163
1636 Ga0501069_0044224
1637 Ga0501069_0056653
1638 Ga0501069_0123102
1639 Ga0501070_0007864
1640 Ga0501070_0082062
1641 Ga0501070_0112698
1642 Ga0501070_0175845
1643 Ga0501070_0178309
1644 Ga0501070_0436709
1645 Ga0501071_0014250
1646 Ga0501072_0099725
1647 Ga0501072_0439584
1648 Ga0501072_0936720
1649 Ga0501073_0025021
1650 Ga0501073_0278207
1651 Ga0501074_0000736
1652 Ga0501074_0133281
1653 Ga0501074_0192630
1654 Ga0501074_0511625
1655 Ga0501075_0012994
1656 Ga0501076_0027201
1657 Ga0501077_0018427
1658 Ga0501079_0078813
1659 Ga0501080_0000499
1660 Ga0501080_0045375
1661 Ga0501080_0484954
1662 Ga0501081_0036936
1663 Ga0501083_0090671
1664 Ga0501035_0257356
1665 Ga0501035_0884057
1666 Ga0501044_0173566
1667 Ga0501044_0616475
1668 Ga0501044_0892707
1669 Ga0501045_0000429
1670 nmdc:mga00v17_246541_c1
1671 nmdc:mga0yw44_805866_c1
1672 nmdc:mga05p37_214220_c1
1673 nmdc:mga05p37_2477_c1
1674 nmdc:mga05p37_6790_c1
1675 nmdc:mga05p37_724856_c1
1676 nmdc:mga09592_16652_c1
1677 nmdc:mga0qj67_13175_c1
1678 nmdc:mga0qj67_132149_c1
1679 nmdc:mga06r32_1301667_c1
1680 nmdc:mga06r32_901148_c1
1681 nmdc:mga08y16_103397_c1
1682 nmdc:mga08y16_1336378_c1
1683 nmdc:mga0n895_231402_c1
1684 nmdc:mga0n895_74762_c1
1685 nmdc:mga0rr50_249065_c1
1686 nmdc:mga0rr50_70984_c1
1687 nmdc:mga08x19_43029_c1
1688 nmdc:mga0a205_1260108_c1
1689 nmdc:mga0a205_66112_c1
1690 nmdc:mga0a205_97071_c1
1691 Ga0495601_0028288
1692 Ga0495595_0091937
1693 Ga0495619_0043577
1694 Ga0501084_0009449
1695 Ga0501084_0328034
1696 Ga0590071_020351
1697 Ga0590074_022246
1698 Ga0590077_015851
1699 Ga0501082_0056162
1700 Ga0466962_0003629
1701 Ga0466962_0020288
1702 Ga0466962_0039457
1703 Ga0466962_0051664
1704 Ga0466962_0140595
1705 Ga0530510_0009672
1706 Ga0530510_0297016

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h77-assembly2.cif.gz_C crystal structure of the pka-protein a fusion protein 0.3693 28 112
2uul-assembly2.cif.gz_T crystal structure of c-phycocyanin from phormidium, lyngbya spp. (marine) and spirulina sp. (fresh water) shows two different ways of energy transfer between two hexamers. 0.3642 30 128
5j0l-assembly2.cif.gz_D de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.3563 30 112
5h77-assembly2.cif.gz_C crystal structure of the pka-protein a fusion protein 0.356 28 112
3qnm-assembly1.cif.gz_A haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function 0.3328 32 109
ID Description Score Start End Superfamily
1t6pG03 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 0.3717 32 114 1.10.274.20
af_Q17775_1_116_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.3525 34 124 1.20.120.160
af_Q2FUW6_607_786_1.10.3060.10 Mainly Alpha;Orthogonal Bundle;Helical scaffold and wing domains of SecA;Helical scaffold and wing domains of SecA 0.3492 32 127 1.10.3060.10
af_A0A1D6NEE8_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.3425 32 116 1.20.58.400
1t6jB03 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 0.3245 32 114 1.10.274.20
ID Description Score Start End GO Terms
AF-A0A7V9CZR9-F1-model_v4 Uncharacterized protein 0.8749 28 142
AF-A0A7V9CZR9-F1-model_v4 Uncharacterized protein 0.8608 28 142
AF-A0A537ZTZ3-F1-model_v4 Uncharacterized protein 0.8358 15 128
AF-A0A537ZTZ3-F1-model_v4 Uncharacterized protein 0.8151 15 128
AF-A0A537TNS8-F1-model_v4 Uncharacterized protein 0.7748 17 145

Map