F483457

General Info

Members Datasets Scaffolds Average Seq Length
851 331 1702 190

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10073220|Ga0105245_100732202
Length 226
Sequence VGFVHSFARRDGFGGEGCRQSHSEENMKRRMVLALTPLLLGVGGCGYNQIQTYDENAAQAKQQISVQLQRRADLVPNLVNTVKGYAQHEEAVFTQVAQARAGLAGAIQTGDPQQMATANAGLTAALGRLIAISEAYPQLKADQGFLRLQDELAGTENRIATARGDYNQAVQTYNTYIRTFPQAITAKVTGAKARTYYEAAPGSEVAPTVDFGTRAPTASATPARAP

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
291 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
292 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
293 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
294 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
295 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
296 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
297 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
298 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
299 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
300 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
301 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
302 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
303 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
304 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
305 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
306 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
310 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
311 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
312 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
313 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
314 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
329 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 1.76
Rhizosphere 98.12
Stem 0
Stem Tuber 0
Unclassified 14.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10073220 3300009098 Unclassified 3114
2 MBSR1b_contig_9848075 2162886012 Unclassified 1211
3 Ga0058863_11976216 3300004799 Bacteria 1441
4 Ga0058861_11730983 3300004800 Bacteria 859
5 Ga0065715_10416856 3300005293 Unclassified 863
6 Ga0070658_10003928 3300005327 Bacteria 12190
7 Ga0070658_10108146 3300005327 Bacteria 2302
8 Ga0070658_10321659 3300005327 Bacteria 1321
9 Ga0070658_11157501 3300005327 Unclassified 673
10 Ga0070676_10085846 3300005328 Bacteria 1919
11 Ga0070676_10159151 3300005328 Bacteria 1452
12 Ga0070676_10170808 3300005328 Unclassified 1406
13 Ga0070683_100000870 3300005329 Bacteria 22361
14 Ga0070683_100001776 3300005329 Bacteria 16796
15 Ga0070683_100027040 3300005329 Bacteria 5171
16 Ga0070683_100072503 3300005329 Bacteria 3214
17 Ga0070683_100117030 3300005329 Unclassified 2516
18 Ga0070683_100121495 3300005329 Unclassified 2468
19 Ga0070683_100179899 3300005329 Bacteria 2007
20 Ga0070683_100181737 3300005329 Bacteria 1997
21 Ga0070683_100284989 3300005329 Bacteria 1572
22 Ga0070683_100484408 3300005329 Bacteria 1181
23 Ga0070690_100033216 3300005330 Bacteria 3228
24 Ga0070690_100044937 3300005330 Bacteria 2805
25 Ga0070690_100054036 3300005330 Unclassified 2571
26 Ga0070690_100087951 3300005330 Bacteria 2042
27 Ga0070670_100096159 3300005331 Bacteria 2548
28 Ga0070670_100328871 3300005331 Unclassified 1340
29 Ga0070670_100428108 3300005331 Bacteria 1171
30 Ga0070677_10030042 3300005333 Unclassified 2065
31 Ga0068869_100147135 3300005334 Bacteria 1824
32 Ga0068869_100521865 3300005334 Bacteria 994
33 Ga0070680_100004987 3300005336 Bacteria 10002
34 Ga0070680_100027731 3300005336 Bacteria 4537
35 Ga0070680_100063221 3300005336 Bacteria 3031
36 Ga0070680_100218152 3300005336 Bacteria 1610
37 Ga0070680_100234629 3300005336 Bacteria 1550
38 Ga0070680_100234812 3300005336 Unclassified 1549
39 Ga0070680_100257359 3300005336 Bacteria 1476
40 Ga0070680_100281810 3300005336 Bacteria 1408
41 Ga0070680_100306633 3300005336 Bacteria 1346
42 Ga0070680_100561168 3300005336 Unclassified 979
43 Ga0070682_100000534 3300005337 Bacteria 23681
44 Ga0070682_100001078 3300005337 Bacteria 15730
45 Ga0070682_100004658 3300005337 Bacteria 7617
46 Ga0070682_100434109 3300005337 Bacteria 1002
47 Ga0070682_100758376 3300005337 Unclassified 784
48 Ga0068868_100010776 3300005338 Bacteria 6629
49 Ga0068868_100087455 3300005338 Bacteria 2506
50 Ga0068868_100148718 3300005338 Unclassified 1928
51 Ga0070660_100172609 3300005339 Bacteria 1747
52 Ga0070689_100020638 3300005340 Bacteria 4891
53 Ga0070691_10026302 3300005341 Bacteria 2712
54 Ga0070687_100008213 3300005343 Bacteria 4407
55 Ga0070687_100009892 3300005343 Bacteria 4099
56 Ga0070687_100055560 3300005343 Bacteria 2068
57 Ga0070687_100089797 3300005343 Unclassified 1697
58 Ga0070661_100044014 3300005344 Bacteria 3261
59 Ga0070661_100153672 3300005344 Unclassified 1741
60 Ga0070661_100604971 3300005344 Bacteria 886
61 Ga0070692_10074394 3300005345 Bacteria 1817
62 Ga0070692_10119537 3300005345 Unclassified 1468
63 Ga0070692_10161911 3300005345 Bacteria 1283
64 Ga0070668_100237658 3300005347 Bacteria 1508
65 Ga0070668_100341841 3300005347 Bacteria 1264
66 Ga0070669_100005328 3300005353 Bacteria 9287
67 Ga0070669_100065165 3300005353 Bacteria 2684
68 Ga0070669_100128187 3300005353 Bacteria 1944
69 Ga0070669_100166083 3300005353 Bacteria 1718
70 Ga0070669_100411485 3300005353 Bacteria 1108
71 Ga0070675_100004308 3300005354 Bacteria 10848
72 Ga0070675_100257337 3300005354 Archaea 1529
73 Ga0070671_100024066 3300005355 Bacteria 4984
74 Ga0070671_100168056 3300005355 Bacteria 1855
75 Ga0070671_100222067 3300005355 Bacteria 1603
76 Ga0070671_100243575 3300005355 Bacteria 1527
77 Ga0070671_100367513 3300005355 Bacteria 1228
78 Ga0070671_100714036 3300005355 Unclassified 870
79 Ga0070674_100079007 3300005356 Bacteria 2346
80 Ga0070674_100616435 3300005356 Bacteria 919
81 Ga0070674_100641780 3300005356 Bacteria 902
82 Ga0070673_100011203 3300005364 Bacteria 6115
83 Ga0070673_100154569 3300005364 Bacteria 1946
84 Ga0070673_100199624 3300005364 Bacteria 1722
85 Ga0070673_100439821 3300005364 Bacteria 1172
86 Ga0070673_100564913 3300005364 Bacteria 1035
87 Ga0070688_100166982 3300005365 Bacteria 1516
88 Ga0070688_100575138 3300005365 Bacteria 859
89 Ga0070659_100005260 3300005366 Bacteria 9287
90 Ga0070659_100035859 3300005366 Bacteria 3864
91 Ga0070659_100088821 3300005366 Bacteria 2475
92 Ga0070659_100250423 3300005366 Bacteria 1468
93 Ga0070659_100693211 3300005366 Unclassified 880
94 Ga0070667_100043491 3300005367 Unclassified 3770
95 Ga0070667_100063735 3300005367 Unclassified 3125
96 Ga0070667_100091825 3300005367 Bacteria 2611
97 Ga0070709_10045486 3300005434 Bacteria 2724
98 Ga0070709_10181260 3300005434 Unclassified 1479
99 Ga0070714_100010440 3300005435 Bacteria 7340
100 Ga0070714_100156438 3300005435 Bacteria 2058
101 Ga0070714_100182589 3300005435 Bacteria 1910
102 Ga0070714_100270529 3300005435 Bacteria 1575
103 Ga0070713_100000317 3300005436 Bacteria 31612
104 Ga0070713_100117303 3300005436 Bacteria 2329
105 Ga0070713_100336777 3300005436 Unclassified 1397
106 Ga0070710_10114672 3300005437 Bacteria 1623
107 Ga0070701_10004071 3300005438 Bacteria 5867
108 Ga0070711_100000044 3300005439 Bacteria 83348
109 Ga0070711_100009321 3300005439 Bacteria 6042
110 Ga0070705_100004733 3300005440 Bacteria 6624
111 Ga0070705_100066495 3300005440 Bacteria 2162
112 Ga0070705_100263666 3300005440 Unclassified 1216
113 Ga0070700_100347640 3300005441 Bacteria 1098
114 Ga0070694_100000349 3300005444 Bacteria 24772
115 Ga0070694_100005242 3300005444 Bacteria 7834
116 Ga0070694_100034106 3300005444 Bacteria 3354
117 Ga0070694_100094275 3300005444 Bacteria 2106
118 Ga0070694_100113505 3300005444 Bacteria 1933
119 Ga0070694_100152545 3300005444 Bacteria 1688
120 Ga0070694_100293541 3300005444 Bacteria 1243
121 Ga0070708_100000005 3300005445 Bacteria 159112
122 Ga0070708_100002236 3300005445 Bacteria 14962
123 Ga0070708_100004800 3300005445 Bacteria 10664
124 Ga0070708_100157889 3300005445 Bacteria 2112
125 Ga0070663_100284232 3300005455 Bacteria 1319
126 Ga0070663_100342591 3300005455 Bacteria 1208
127 Ga0070678_100059716 3300005456 Bacteria 2804
128 Ga0070678_100562536 3300005456 Bacteria 1014
129 Ga0070662_100030786 3300005457 Bacteria 3759
130 Ga0070662_100207609 3300005457 Bacteria 1557
131 Ga0070662_100255603 3300005457 Bacteria 1410
132 Ga0070662_100498355 3300005457 Bacteria 1016
133 Ga0070662_100680996 3300005457 Bacteria 869
134 Ga0070681_10001771 3300005458 Bacteria 19367
135 Ga0070681_10023015 3300005458 Bacteria 6264
136 Ga0070681_10037114 3300005458 Archaea 4891
137 Ga0070681_10038562 3300005458 Unclassified 4790
138 Ga0070681_10073151 3300005458 Bacteria 3390
139 Ga0070681_10140277 3300005458 Bacteria 2347
140 Ga0070681_10191132 3300005458 Bacteria 1967
141 Ga0070681_10418676 3300005458 Bacteria 1251
142 Ga0070681_10539050 3300005458 Unclassified 1080
143 Ga0068867_100044284 3300005459 Bacteria 3260
144 Ga0068867_100124788 3300005459 Bacteria 1994
145 Ga0068867_100161401 3300005459 Unclassified 1768
146 Ga0068867_100178313 3300005459 Bacteria 1688
147 Ga0070685_10008642 3300005466 Bacteria 5242
148 Ga0070706_100030010 3300005467 Bacteria 5007
149 Ga0070706_100117305 3300005467 Bacteria 2480
150 Ga0070706_100260614 3300005467 Bacteria 1618
151 Ga0070706_100302273 3300005467 Bacteria 1493
152 Ga0070706_100533428 3300005467 Bacteria 1092
153 Ga0070706_100943248 3300005467 Bacteria 796
154 Ga0070707_100000654 3300005468 Bacteria 34528
155 Ga0070707_100106702 3300005468 Bacteria 2717
156 Ga0070707_100126434 3300005468 Bacteria 2484
157 Ga0070707_100241393 3300005468 Bacteria 1758
158 Ga0070707_100245388 3300005468 Unclassified 1743
159 Ga0070707_100315881 3300005468 Bacteria 1518
160 Ga0070698_100002299 3300005471 Bacteria 21152
161 Ga0070698_100133131 3300005471 Bacteria 2440
162 Ga0070698_100616176 3300005471 Bacteria 1026
163 Ga0070699_100010037 3300005518 Bacteria 8196
164 Ga0070699_100020189 3300005518 Bacteria 5743
165 Ga0070699_100030205 3300005518 Bacteria 4678
166 Ga0070699_100149719 3300005518 Bacteria 2063
167 Ga0070699_100209395 3300005518 Bacteria 1735
168 Ga0070699_100267154 3300005518 Bacteria 1530
169 Ga0070699_100283810 3300005518 Bacteria 1483
170 Ga0070699_100438837 3300005518 Bacteria 1183
171 Ga0070699_100720273 3300005518 Bacteria 912
172 Ga0070679_100001214 3300005530 Bacteria 22691
173 Ga0070679_100003544 3300005530 Bacteria 14301
174 Ga0070679_100039459 3300005530 Bacteria 4692
175 Ga0070679_100073380 3300005530 Bacteria 3414
176 Ga0070679_100114893 3300005530 Bacteria 2677
177 Ga0070679_100469315 3300005530 Unclassified 1203
178 Ga0070684_100021416 3300005535 Bacteria 5379
179 Ga0070684_100050755 3300005535 Bacteria 3604
180 Ga0070684_100090693 3300005535 Bacteria 2718
181 Ga0070684_100114069 3300005535 Bacteria 2425
182 Ga0070684_100132483 3300005535 Bacteria 2249
183 Ga0070697_100003018 3300005536 Bacteria 12921
184 Ga0070697_100009017 3300005536 Bacteria 7791
185 Ga0070697_100009927 3300005536 Bacteria 7426
186 Ga0070697_100043257 3300005536 Bacteria 3646
187 Ga0070697_100051650 3300005536 Bacteria 3340
188 Ga0070697_100137999 3300005536 Bacteria 2049
189 Ga0070697_100177815 3300005536 Bacteria 1803
190 Ga0070697_100258860 3300005536 Bacteria 1489
191 Ga0070697_100282406 3300005536 Bacteria 1425
192 Ga0070697_100437763 3300005536 Bacteria 1138
193 Ga0068853_100023233 3300005539 Archaea 5188
194 Ga0068853_100226052 3300005539 Bacteria 1711
195 Ga0068853_100844805 3300005539 Unclassified 878
196 Ga0070672_100012484 3300005543 Bacteria 5967
197 Ga0070672_100022077 3300005543 Bacteria 4667
198 Ga0070672_100056071 3300005543 Bacteria 3089
199 Ga0070672_100125676 3300005543 Bacteria 2103
200 Ga0070672_100265046 3300005543 Bacteria 1450
201 Ga0070672_100664562 3300005543 Bacteria 911
202 Ga0070672_100828988 3300005543 Bacteria 815
203 Ga0070686_100018412 3300005544 Bacteria 4098
204 Ga0070686_100160228 3300005544 Bacteria 1584
205 Ga0070686_100208954 3300005544 Bacteria 1404
206 Ga0070686_100223830 3300005544 Bacteria 1361
207 Ga0070686_100586276 3300005544 Bacteria 877
208 Ga0070686_100760029 3300005544 Bacteria 778
209 Ga0070695_100002187 3300005545 Bacteria 11199
210 Ga0070695_100004823 3300005545 Bacteria 7937
211 Ga0070695_100015804 3300005545 Bacteria 4560
212 Ga0070695_100045504 3300005545 Bacteria 2797
213 Ga0070695_100053110 3300005545 Unclassified 2605
214 Ga0070695_100074002 3300005545 Bacteria 2238
215 Ga0070695_100110891 3300005545 Bacteria 1861
216 Ga0070695_100151810 3300005545 Bacteria 1617
217 Ga0070695_100572596 3300005545 Bacteria 883
218 Ga0070696_100007693 3300005546 Bacteria 7197
219 Ga0070696_100014572 3300005546 Bacteria 5277
220 Ga0070696_100016937 3300005546 Bacteria 4916
221 Ga0070696_100025935 3300005546 Bacteria 3986
222 Ga0070696_100172819 3300005546 Unclassified 1598
223 Ga0070696_100176762 3300005546 Bacteria 1581
224 Ga0070696_100781705 3300005546 Unclassified 784
225 Ga0070693_100088732 3300005547 Bacteria 1860
226 Ga0070693_100119714 3300005547 Bacteria 1631
227 Ga0070665_100010948 3300005548 Bacteria 9172
228 Ga0070665_100353104 3300005548 Bacteria 1476
229 Ga0070704_100003026 3300005549 Bacteria 9559
230 Ga0070704_100031318 3300005549 Bacteria 3576
231 Ga0070704_100217694 3300005549 Bacteria 1551
232 Ga0070704_100436730 3300005549 Bacteria 1124
233 Ga0070704_100628031 3300005549 Bacteria 946
234 Ga0068855_100001191 3300005563 Bacteria 32320
235 Ga0068855_100176908 3300005563 Bacteria 2414
236 Ga0068855_100670624 3300005563 Unclassified 1112
237 Ga0070664_100003488 3300005564 Bacteria 12702
238 Ga0070664_100004994 3300005564 Bacteria 10628
239 Ga0070664_100008899 3300005564 Bacteria 8134
240 Ga0070664_100032139 3300005564 Bacteria 4389
241 Ga0070664_100072559 3300005564 Bacteria 2952
242 Ga0070664_100177217 3300005564 Bacteria 1893
243 Ga0070664_100315081 3300005564 Bacteria 1416
244 Ga0070664_100488484 3300005564 Bacteria 1134
245 Ga0070664_100696550 3300005564 Unclassified 946
246 Ga0068857_100001055 3300005577 Bacteria 21351
247 Ga0068857_100005630 3300005577 Bacteria 10707
248 Ga0068857_100076107 3300005577 Bacteria 2993
249 Ga0068857_100128408 3300005577 Bacteria 2285
250 Ga0068857_101170994 3300005577 Bacteria 744
251 Ga0068854_100127648 3300005578 Bacteria 1939
252 Ga0068854_100151261 3300005578 Unclassified 1790
253 Ga0068854_100168458 3300005578 Unclassified 1702
254 Ga0068854_100737090 3300005578 Bacteria 854
255 Ga0068854_101064030 3300005578 Bacteria 719
256 Ga0068856_100156978 3300005614 Unclassified 2285
257 Ga0070702_100010548 3300005615 Bacteria 4557
258 Ga0070702_100263223 3300005615 Unclassified 1175
259 Ga0070702_100453110 3300005615 Bacteria 931
260 Ga0068852_100354836 3300005616 Unclassified 1433
261 Ga0068852_100389502 3300005616 Bacteria 1369
262 Ga0068852_100544218 3300005616 Bacteria 1161
263 Ga0068859_100017975 3300005617 Bacteria 7105
264 Ga0068859_100533239 3300005617 Unclassified 1269
265 Ga0068864_100135007 3300005618 Bacteria 2221
266 Ga0068864_100750734 3300005618 Bacteria 956
267 Ga0068866_10011017 3300005718 Bacteria 3896
268 Ga0068866_10097014 3300005718 Unclassified 1618
269 Ga0068861_100071347 3300005719 Bacteria 2692
270 Ga0068870_10025314 3300005840 Bacteria 2944
271 Ga0068870_10346208 3300005840 Bacteria 952
272 Ga0068870_10364830 3300005840 Bacteria 930
273 Ga0068863_100353825 3300005841 Unclassified 1431
274 Ga0068863_100694375 3300005841 Unclassified 1011
275 Ga0068858_100084052 3300005842 Bacteria 2961
276 Ga0068858_100246644 3300005842 Bacteria 1696
277 Ga0068860_100029039 3300005843 Bacteria 5320
278 Ga0068860_100507274 3300005843 Bacteria 1205
279 Ga0068862_100000767 3300005844 Bacteria 31967
280 Ga0068862_100487569 3300005844 Bacteria 1168
281 Ga0070717_11207929 3300006028 Bacteria 688
282 Ga0070716_100160560 3300006173 Bacteria 1456
283 Ga0070712_100069656 3300006175 Bacteria 2510
284 Ga0070712_100683645 3300006175 Bacteria 874
285 Ga0068871_100890364 3300006358 Bacteria 825
286 Ga0075428_100021874 3300006844 Bacteria 7082
287 Ga0075428_100024854 3300006844 Bacteria 6627
288 Ga0075428_100173273 3300006844 Bacteria 2338
289 Ga0075430_100008637 3300006846 Bacteria 8592
290 Ga0075430_100040348 3300006846 Bacteria 3951
291 Ga0075430_100070982 3300006846 Bacteria 2922
292 Ga0075431_100008775 3300006847 Bacteria 10128
293 Ga0075431_100152299 3300006847 Bacteria 2381
294 Ga0075431_100206812 3300006847 Bacteria 2006
295 Ga0075431_100228599 3300006847 Unclassified 1896
296 Ga0075431_100572339 3300006847 Unclassified 1116
297 Ga0075433_10006608 3300006852 Bacteria 9181
298 Ga0075433_10007595 3300006852 Bacteria 8605
299 Ga0075433_10025007 3300006852 Bacteria 5046
300 Ga0075433_10158277 3300006852 Bacteria 2015
301 Ga0075433_10174897 3300006852 Unclassified 1910
302 Ga0075433_10241273 3300006852 Bacteria 1604
303 Ga0075433_10271658 3300006852 Bacteria 1502
304 Ga0075433_10360213 3300006852 Bacteria 1285
305 Ga0075434_100004323 3300006871 Bacteria 12777
306 Ga0075434_100007916 3300006871 Bacteria 9850
307 Ga0075434_100015330 3300006871 Bacteria 7346
308 Ga0075434_100016852 3300006871 Bacteria 7029
309 Ga0075434_100027932 3300006871 Bacteria 5539
310 Ga0075434_100086506 3300006871 Bacteria 3134
311 Ga0075434_100958910 3300006871 Bacteria 870
312 Ga0075429_100007150 3300006880 Bacteria 9686
313 Ga0075429_100092121 3300006880 Bacteria 2644
314 Ga0068865_100286658 3300006881 Bacteria 1313
315 Ga0068865_100308321 3300006881 Bacteria 1269
316 Ga0068865_100325979 3300006881 Bacteria 1237
317 Ga0075436_100005770 3300006914 Bacteria 8511
318 Ga0075436_100015199 3300006914 Bacteria 5274
319 Ga0075436_100046336 3300006914 Bacteria 2998
320 Ga0075436_100054093 3300006914 Bacteria 2770
321 Ga0075436_100098970 3300006914 Bacteria 2030
322 Ga0075436_100143452 3300006914 Bacteria 1679
323 Ga0075436_100204832 3300006914 Bacteria 1398
324 Ga0075436_100212979 3300006914 Unclassified 1370
325 Ga0075436_100267368 3300006914 Bacteria 1220
326 Ga0075436_100897859 3300006914 Bacteria 663
327 Ga0097620_100017975 3300006931 Bacteria 7105
328 Ga0097620_100476761 3300006931 Bacteria 1343
329 Ga0097620_100533263 3300006931 Unclassified 1269
330 Ga0075435_100003426 3300007076 Bacteria 10756
331 Ga0075435_100008762 3300007076 Bacteria 7282
332 Ga0075435_100008948 3300007076 Bacteria 7217
333 Ga0075435_100045901 3300007076 Bacteria 3503
334 Ga0075435_100126738 3300007076 Bacteria 2134
335 Ga0075435_100240411 3300007076 Bacteria 1540
336 Ga0075435_100633444 3300007076 Bacteria 928
337 Ga0075435_100663234 3300007076 Bacteria 906
338 Ga0099794_10000245 3300007265 Bacteria 18962
339 Ga0099794_10001463 3300007265 Bacteria 8267
340 Ga0099794_10087693 3300007265 Bacteria 1541
341 Ga0099794_10290267 3300007265 Bacteria 846
342 Ga0105240_10037795 3300009093 Bacteria 6201
343 Ga0105240_10122646 3300009093 Bacteria 3127
344 Ga0105240_10240540 3300009093 Unclassified 2099
345 Ga0111539_10042484 3300009094 Bacteria 5458
346 Ga0105245_10003097 3300009098 Bacteria 14881
347 Ga0105245_10306434 3300009098 Bacteria 1560
348 Ga0114129_10052317 3300009147 Bacteria 5732
349 Ga0114129_10636220 3300009147 Bacteria 1378
350 Ga0114129_10988786 3300009147 Bacteria 1060
351 Ga0105243_10315500 3300009148 Bacteria 1422
352 Ga0105242_10004336 3300009176 Bacteria 11050
353 Ga0105242_10174785 3300009176 Bacteria 1890
354 Ga0105242_10400617 3300009176 Bacteria 1281
355 Ga0105242_10933911 3300009176 Bacteria 870
356 Ga0105248_10050848 3300009177 Bacteria 4649
357 Ga0105248_10237566 3300009177 Bacteria 2051
358 Ga0105237_10397107 3300009545 Unclassified 1384
359 Ga0105249_10000186 3300009553 Bacteria 71781
360 Ga0105249_10675459 3300009553 Bacteria 1092
361 Ga0099796_10042318 3300010159 Unclassified 1547
362 Ga0105246_10155582 3300011119 Bacteria 1736
363 Ga0105246_10449575 3300011119 Bacteria 1082
364 Ga0157373_10179967 3300013100 Bacteria 1488
365 Ga0157373_10489778 3300013100 Unclassified 887
366 Ga0157371_10091967 3300013102 Bacteria 2149
367 Ga0157371_10188936 3300013102 Bacteria 1474
368 Ga0157371_10371319 3300013102 Bacteria 1043
369 Ga0157370_10050305 3300013104 Bacteria 3983
370 Ga0157370_10164947 3300013104 Unclassified 2060
371 Ga0157370_10326659 3300013104 Bacteria 1415
372 Ga0157370_10327989 3300013104 Unclassified 1411
373 Ga0157369_10120661 3300013105 Unclassified 2782
374 Ga0157369_10338951 3300013105 Unclassified 1562
375 Ga0157369_10394870 3300013105 Bacteria 1435
376 Ga0157374_10035487 3300013296 Bacteria 4562
377 Ga0157374_10124146 3300013296 Bacteria 2494
378 Ga0157374_10158174 3300013296 Unclassified 2206
379 Ga0157378_10081862 3300013297 Bacteria 2918
380 Ga0157378_10197316 3300013297 Bacteria 1902
381 Ga0163162_10026901 3300013306 Bacteria 5689
382 Ga0157372_10005925 3300013307 Bacteria 12999
383 Ga0157372_10107750 3300013307 Bacteria 3188
384 Ga0157372_10137355 3300013307 Bacteria 2816
385 Ga0157372_10160743 3300013307 Bacteria 2596
386 Ga0157372_10212665 3300013307 Bacteria 2241
387 Ga0157375_10018838 3300013308 Bacteria 6265
388 Ga0157375_10090755 3300013308 Bacteria 3115
389 Ga0157375_10119244 3300013308 Bacteria 2746
390 Ga0157375_10120571 3300013308 Bacteria 2732
391 Ga0157380_10058794 3300014326 Bacteria 3066
392 Ga0157380_10466087 3300014326 Bacteria 1217
393 Ga0157380_10567618 3300014326 Bacteria 1116
394 Ga0157380_10743591 3300014326 Unclassified 991
395 Ga0182008_10109790 3300014497 Unclassified 1367
396 Ga0157376_10137412 3300014969 Bacteria 2189
397 Ga0163161_10280880 3300017792 Bacteria 1306
398 Ga0206356_10535048 3300020070 Unclassified 1493
399 Ga0207653_10001466 3300025885 Bacteria 7656
400 Ga0207682_10026899 3300025893 Bacteria 2289
401 Ga0207682_10098165 3300025893 Bacteria 1277
402 Ga0207692_10151023 3300025898 Bacteria 1330
403 Ga0207642_10186679 3300025899 Bacteria 1134
404 Ga0207688_10077864 3300025901 Bacteria 1890
405 Ga0207680_10116992 3300025903 Bacteria 1738
406 Ga0207699_10004282 3300025906 Bacteria 6824
407 Ga0207699_10159911 3300025906 Bacteria 1498
408 Ga0207699_10541209 3300025906 Bacteria 844
409 Ga0207699_10626037 3300025906 Unclassified 785
410 Ga0207645_10113567 3300025907 Bacteria 1755
411 Ga0207645_10121992 3300025907 Bacteria 1692
412 Ga0207643_10005239 3300025908 Bacteria 6936
413 Ga0207643_10015811 3300025908 Bacteria 4111
414 Ga0207705_10006207 3300025909 Bacteria 8882
415 Ga0207705_10085998 3300025909 Bacteria 2297
416 Ga0207705_10232655 3300025909 Unclassified 1402
417 Ga0207684_10030500 3300025910 Bacteria 4589
418 Ga0207684_10201811 3300025910 Unclassified 1715
419 Ga0207684_10206455 3300025910 Bacteria 1695
420 Ga0207684_10218359 3300025910 Bacteria 1645
421 Ga0207684_10242662 3300025910 Bacteria 1554
422 Ga0207684_10474534 3300025910 Bacteria 1073
423 Ga0207684_10533943 3300025910 Bacteria 1004
424 Ga0207707_10001365 3300025912 Bacteria 22660
425 Ga0207707_10003848 3300025912 Bacteria 13301
426 Ga0207707_10018983 3300025912 Bacteria 5997
427 Ga0207707_10056752 3300025912 Bacteria 3407
428 Ga0207707_10073867 3300025912 Unclassified 2974
429 Ga0207707_10107985 3300025912 Bacteria 2433
430 Ga0207707_10236331 3300025912 Unclassified 1590
431 Ga0207707_10266282 3300025912 Bacteria 1486
432 Ga0207707_10345941 3300025912 Unclassified 1281
433 Ga0207707_10527454 3300025912 Unclassified 1005
434 Ga0207695_10007131 3300025913 Bacteria 14304
435 Ga0207695_10064471 3300025913 Bacteria 3772
436 Ga0207693_10078108 3300025915 Bacteria 2591
437 Ga0207693_10256365 3300025915 Bacteria 1372
438 Ga0207663_10000062 3300025916 Bacteria 53663
439 Ga0207663_10095098 3300025916 Bacteria 1987
440 Ga0207663_10644875 3300025916 Bacteria 835
441 Ga0207660_10003954 3300025917 Bacteria 9655
442 Ga0207660_10037787 3300025917 Bacteria 3367
443 Ga0207660_10039407 3300025917 Bacteria 3303
444 Ga0207660_10046371 3300025917 Bacteria 3066
445 Ga0207660_10104930 3300025917 Bacteria 2117
446 Ga0207660_10219880 3300025917 Bacteria 1490
447 Ga0207660_10307057 3300025917 Unclassified 1264
448 Ga0207660_10669216 3300025917 Bacteria 846
449 Ga0207662_10000790 3300025918 Bacteria 14557
450 Ga0207662_10058406 3300025918 Bacteria 2309
451 Ga0207662_10171410 3300025918 Bacteria 1392
452 Ga0207662_10400614 3300025918 Unclassified 930
453 Ga0207657_10028895 3300025919 Bacteria 5051
454 Ga0207657_10071021 3300025919 Bacteria 2949
455 Ga0207649_10028337 3300025920 Bacteria 3297
456 Ga0207649_10030308 3300025920 Bacteria 3203
457 Ga0207649_10204623 3300025920 Unclassified 1397
458 Ga0207652_10004657 3300025921 Bacteria 11119
459 Ga0207652_10012354 3300025921 Bacteria 6899
460 Ga0207652_10031737 3300025921 Bacteria 4437
461 Ga0207652_10044671 3300025921 Unclassified 3775
462 Ga0207652_10067012 3300025921 Bacteria 3112
463 Ga0207652_11052399 3300025921 Bacteria 713
464 Ga0207646_10002582 3300025922 Bacteria 21380
465 Ga0207646_10144176 3300025922 Bacteria 2146
466 Ga0207646_10201865 3300025922 Bacteria 1796
467 Ga0207646_10203530 3300025922 Bacteria 1788
468 Ga0207646_10415270 3300025922 Unclassified 1215
469 Ga0207646_10730722 3300025922 Bacteria 884
470 Ga0207681_10002985 3300025923 Bacteria 10634
471 Ga0207681_10014752 3300025923 Bacteria 4864
472 Ga0207681_10218076 3300025923 Bacteria 1474
473 Ga0207681_10277500 3300025923 Bacteria 1318
474 Ga0207694_10309254 3300025924 Unclassified 1302
475 Ga0207650_10215446 3300025925 Bacteria 1544
476 Ga0207650_10671845 3300025925 Bacteria 874
477 Ga0207659_10020208 3300025926 Bacteria 4397
478 Ga0207659_10094553 3300025926 Bacteria 2240
479 Ga0207687_10058209 3300025927 Bacteria 2718
480 Ga0207687_10122562 3300025927 Bacteria 1946
481 Ga0207687_10175446 3300025927 Unclassified 1656
482 Ga0207700_10000640 3300025928 Bacteria 20431
483 Ga0207700_10039032 3300025928 Bacteria 3452
484 Ga0207664_10054370 3300025929 Unclassified 3172
485 Ga0207664_10054665 3300025929 Bacteria 3164
486 Ga0207664_10202542 3300025929 Bacteria 1714
487 Ga0207664_10262962 3300025929 Bacteria 1509
488 Ga0207664_10314726 3300025929 Unclassified 1380
489 Ga0207664_10421340 3300025929 Bacteria 1189
490 Ga0207644_10184739 3300025931 Bacteria 1636
491 Ga0207644_10381792 3300025931 Bacteria 1149
492 Ga0207644_10561858 3300025931 Bacteria 945
493 Ga0207644_10597484 3300025931 Unclassified 916
494 Ga0207690_10030237 3300025932 Bacteria 3452
495 Ga0207690_10344836 3300025932 Bacteria 1176
496 Ga0207690_10580725 3300025932 Bacteria 913
497 Ga0207706_10001490 3300025933 Bacteria 23259
498 Ga0207706_10053959 3300025933 Bacteria 3547
499 Ga0207706_10110187 3300025933 Bacteria 2422
500 Ga0207706_10222805 3300025933 Bacteria 1651
501 Ga0207686_10081150 3300025934 Bacteria 2116
502 Ga0207709_10049214 3300025935 Unclassified 2571
503 Ga0207670_10151070 3300025936 Bacteria 1723
504 Ga0207670_10405941 3300025936 Bacteria 1090
505 Ga0207670_10815487 3300025936 Bacteria 778
506 Ga0207669_10543100 3300025937 Unclassified 937
507 Ga0207704_10010519 3300025938 Bacteria 4519
508 Ga0207704_10188695 3300025938 Bacteria 1497
509 Ga0207704_10194591 3300025938 Bacteria 1478
510 Ga0207665_10076061 3300025939 Bacteria 2301
511 Ga0207665_10550373 3300025939 Bacteria 896
512 Ga0207691_10008002 3300025940 Bacteria 10165
513 Ga0207691_10056338 3300025940 Bacteria 3580
514 Ga0207691_10131437 3300025940 Bacteria 2211
515 Ga0207691_10144914 3300025940 Bacteria 2091
516 Ga0207691_10277508 3300025940 Bacteria 1442
517 Ga0207691_11045501 3300025940 Bacteria 681
518 Ga0207711_10193210 3300025941 Bacteria 1855
519 Ga0207711_10232423 3300025941 Bacteria 1689
520 Ga0207661_10002665 3300025944 Bacteria 12274
521 Ga0207661_10008647 3300025944 Bacteria 7276
522 Ga0207661_10013510 3300025944 Bacteria 5964
523 Ga0207661_10048024 3300025944 Bacteria 3391
524 Ga0207661_10085222 3300025944 Bacteria 2618
525 Ga0207661_10138768 3300025944 Bacteria 2090
526 Ga0207661_10232692 3300025944 Bacteria 1632
527 Ga0207661_10531494 3300025944 Bacteria 1076
528 Ga0207679_10020149 3300025945 Bacteria 4496
529 Ga0207679_10023763 3300025945 Unclassified 4195
530 Ga0207679_10072752 3300025945 Unclassified 2598
531 Ga0207679_10261761 3300025945 Bacteria 1475
532 Ga0207679_10338441 3300025945 Bacteria 1308
533 Ga0207679_10421086 3300025945 Unclassified 1179
534 Ga0207679_10439482 3300025945 Bacteria 1155
535 Ga0207667_10004964 3300025949 Bacteria 16251
536 Ga0207667_10005591 3300025949 Bacteria 15337
537 Ga0207667_10046854 3300025949 Bacteria 4578
538 Ga0207667_10117091 3300025949 Bacteria 2746
539 Ga0207667_10291272 3300025949 Unclassified 1668
540 Ga0207651_10039161 3300025960 Bacteria 3123
541 Ga0207651_10073060 3300025960 Bacteria 2437
542 Ga0207651_10192814 3300025960 Bacteria 1627
543 Ga0207651_10599751 3300025960 Unclassified 962
544 Ga0207651_10742671 3300025960 Bacteria 867
545 Ga0207712_10000260 3300025961 Bacteria 51278
546 Ga0207712_10631093 3300025961 Bacteria 929
547 Ga0207668_10131134 3300025972 Bacteria 1914
548 Ga0207668_11421358 3300025972 Bacteria 625
549 Ga0207640_10717145 3300025981 Bacteria 859
550 Ga0207658_10111865 3300025986 Unclassified 2160
551 Ga0207658_10660471 3300025986 Unclassified 943
552 Ga0207677_10003138 3300026023 Bacteria 8716
553 Ga0207677_10678963 3300026023 Bacteria 912
554 Ga0207703_10385421 3300026035 Bacteria 1297
555 Ga0207639_10197317 3300026041 Bacteria 1723
556 Ga0207639_10477721 3300026041 Bacteria 1135
557 Ga0207639_10978031 3300026041 Bacteria 792
558 Ga0207678_10000873 3300026067 Bacteria 27675
559 Ga0207678_10223547 3300026067 Bacteria 1612
560 Ga0207678_10320392 3300026067 Bacteria 1334
561 Ga0207678_10326753 3300026067 Unclassified 1320
562 Ga0207708_10021862 3300026075 Bacteria 4827
563 Ga0207708_10075968 3300026075 Bacteria 2576
564 Ga0207708_10169117 3300026075 Bacteria 1730
565 Ga0207708_10490092 3300026075 Bacteria 1029
566 Ga0207702_10140518 3300026078 Bacteria 2185
567 Ga0207702_10228752 3300026078 Bacteria 1737
568 Ga0207702_10275330 3300026078 Bacteria 1589
569 Ga0207702_10523785 3300026078 Unclassified 1157
570 Ga0207641_10331652 3300026088 Unclassified 1445
571 Ga0207648_10012210 3300026089 Bacteria 8045
572 Ga0207648_10147407 3300026089 Unclassified 2076
573 Ga0207648_10199743 3300026089 Bacteria 1773
574 Ga0207648_10423553 3300026089 Bacteria 1209
575 Ga0207648_10641520 3300026089 Bacteria 981
576 Ga0207676_10282677 3300026095 Unclassified 1507
577 Ga0207676_10378890 3300026095 Bacteria 1316
578 Ga0207674_10015560 3300026116 Bacteria 8354
579 Ga0207674_10041812 3300026116 Bacteria 4738
580 Ga0207674_10125251 3300026116 Bacteria 2535
581 Ga0207674_10171849 3300026116 Bacteria 2120
582 Ga0207675_100111713 3300026118 Bacteria 2579
583 Ga0207675_100533277 3300026118 Unclassified 1171
584 Ga0207683_10007440 3300026121 Bacteria 9389
585 Ga0207683_10176109 3300026121 Bacteria 1938
586 Ga0207683_10192521 3300026121 Bacteria 1852
587 Ga0207698_10224872 3300026142 Bacteria 1699
588 Ga0207698_10319930 3300026142 Bacteria 1452
589 Ga0207698_10511675 3300026142 Unclassified 1170
590 Ga0207698_10829382 3300026142 Bacteria 929
591 Ga0209969_1001324 3300027360 Unclassified 3403
592 Ga0209981_1013285 3300027378 Unclassified 1144
593 Ga0209983_1017218 3300027665 Bacteria 1495
594 Ga0209588_1000139 3300027671 Bacteria 20984
595 Ga0209588_1000206 3300027671 Bacteria 15898
596 Ga0209966_1021070 3300027695 Bacteria 1266
597 Ga0209998_10000482 3300027717 Bacteria 11002
598 Ga0209974_10021978 3300027876 Unclassified 2112
599 Ga0207428_10151726 3300027907 Bacteria 1763
600 Ga0268266_10181761 3300028379 Bacteria 1915
601 Ga0268266_11558195 3300028379 Bacteria 636
602 Ga0268265_10000144 3300028380 Bacteria 90132
603 Ga0268265_10116957 3300028380 Bacteria 2189
604 Ga0268264_10060340 3300028381 Bacteria 3179
605 Ga0268264_10344248 3300028381 Bacteria 1417
606 Ga0265332_10020124 3300031238 Bacteria 2946
607 Ga0265332_10022934 3300031238 Bacteria 2754
608 Ga0265316_10411113 3300031344 Bacteria 974
609 Ga0307408_100008152 3300031548 Bacteria 6919
610 Ga0307408_100102293 3300031548 Bacteria 2185
611 Ga0307408_100137219 3300031548 Bacteria 1915
612 Ga0265314_10005797 3300031711 Bacteria 11079
613 Ga0265314_10008093 3300031711 Bacteria 9048
614 Ga0307405_10094001 3300031731 Unclassified 1993
615 Ga0307413_10889268 3300031824 Unclassified 756
616 Ga0307410_10038178 3300031852 Bacteria 3144
617 Ga0307410_10762438 3300031852 Unclassified 820
618 Ga0307406_10006081 3300031901 Bacteria 6634
619 Ga0307406_10073174 3300031901 Bacteria 2252
620 Ga0307406_10082371 3300031901 Bacteria 2142
621 Ga0307406_11032412 3300031901 Bacteria 707
622 Ga0307412_10111515 3300031911 Bacteria 1954
623 Ga0307409_100076416 3300031995 Bacteria 2685
624 Ga0307409_100385103 3300031995 Unclassified 1334
625 Ga0307409_100787224 3300031995 Bacteria 958
626 Ga0307416_100039748 3300032002 Bacteria 3646
627 Ga0307416_100845238 3300032002 Unclassified 1013
628 Ga0307416_101352951 3300032002 Bacteria 818
629 Ga0307416_101401910 3300032002 Bacteria 805
630 Ga0307414_10402799 3300032004 Bacteria 1189
631 Ga0307414_10492838 3300032004 Bacteria 1083
632 Ga0307414_10561274 3300032004 Bacteria 1019
633 Ga0307414_10715344 3300032004 Unclassified 908
634 Ga0307411_10057050 3300032005 Bacteria 2577
635 Ga0307411_10061913 3300032005 Bacteria 2494
636 Ga0307411_10130750 3300032005 Bacteria 1834
637 Ga0307411_10144102 3300032005 Bacteria 1761
638 Ga0307415_100070043 3300032126 Bacteria 2461
639 Ga0307415_100169923 3300032126 Unclassified 1699
640 Ga0307415_100224951 3300032126 Unclassified 1507
641 Ga0307415_100901883 3300032126 Bacteria 815
642 Ga0373959_0006070 3300034820 Bacteria 1995
643 Ga0373934_0001566 3300035086 Bacteria 8390
644 Ga0373940_0044888 3300035088 Bacteria 1226
645 Ga0373944_0019418 3300035089 Bacteria 1950
646 Ga0373923_0024571 3300035111 Bacteria 2379
647 Ga0373923_0048210 3300035111 Bacteria 1778
648 Ga0373936_0053767 3300035113 Bacteria 1633
649 Ga0373941_0009301 3300035115 Bacteria 2470
650 Ga0373941_0048889 3300035115 Bacteria 1337
651 Ga0373954_0040733 3300035118 Bacteria 2164
652 Ga0373956_0039935 3300035119 Bacteria 2080
653 Ga0373960_0027413 3300035121 Bacteria 1564
654 Ga0373924_0002303 3300035410 Bacteria 6407
655 Ga0373935_0142069 3300035692 Bacteria 1622
656 Ga0373935_0332384 3300035692 Bacteria 1080
657 Ga0373927_0285944 3300035695 Archaea 1085
658 Ga0373927_0311238 3300035695 Bacteria 1037
659 Ga0373933_0000305 3300035724 Bacteria 31659
660 Ga0373933_0367830 3300035724 Bacteria 935
661 Ga0373947_0206168 3300035725 Bacteria 1288
662 Ga0373937_0001214 3300036401 Bacteria 21668
663 Ga0373937_0408435 3300036401 Bacteria 1288
664 Ga0373925_0016396 3300037068 Bacteria 5367
665 Ga0395898_1282427 3300037466 Bacteria 662
666 Ga0242420_014308 3300038996 Bacteria 1360
667 Ga0439439_0016907 3300041406 Bacteria 1790
668 Ga0451577_0000001 3300042876 Bacteria 2461803
669 Ga0453683_0030462 3300044673 Bacteria 3410
670 Ga0453684_0020545 3300044712 Bacteria 9948
671 Ga0466959_0153305 3300045049 Bacteria 1623
672 Ga0466959_0427347 3300045049 Bacteria 899
673 Ga0451576_0003678 3300045051 Bacteria 20806
674 Ga0451576_0005748 3300045051 Bacteria 15444
675 Ga0451576_0012437 3300045051 Bacteria 9559
676 Ga0451576_0012798 3300045051 Bacteria 9413
677 Ga0451576_0035600 3300045051 Bacteria 5280
678 Ga0451576_0047324 3300045051 Bacteria 4522
679 Ga0466958_0122211 3300045836 Unclassified 1631
680 Ga0495592_0001353 3300046454 Bacteria 16950
681 Ga0495592_0353918 3300046454 Bacteria 941
682 Ga0495603_0023523 3300046455 Bacteria 3726
683 Ga0495629_0112092 3300046459 Bacteria 1901
684 Ga0495629_0137435 3300046459 Bacteria 1701
685 Ga0495651_0000448 3300046462 Bacteria 31774
686 Ga0495653_0001606 3300046463 Bacteria 17765
687 Ga0495653_0021175 3300046463 Bacteria 5269
688 Ga0495653_0060861 3300046463 Bacteria 2859
689 Ga0495639_0267115 3300046475 Bacteria 848
690 Ga0495664_0028421 3300046477 Bacteria 3266
691 Ga0495594_0011875 3300046499 Bacteria 4531
692 Ga0495594_0013936 3300046499 Bacteria 4208
693 Ga0495596_0022998 3300046500 Unclassified 2532
694 Ga0495608_0000482 3300046511 Bacteria 27697
695 Ga0495608_0057482 3300046511 Bacteria 2567
696 Ga0495608_0104274 3300046511 Bacteria 1826
697 Ga0495618_0022577 3300046514 Bacteria 3887
698 Ga0495618_0135376 3300046514 Unclassified 1576
699 Ga0495628_0012834 3300046516 Bacteria 7055
700 Ga0495628_0020472 3300046516 Bacteria 5454
701 Ga0495630_0012094 3300046517 Bacteria 6258
702 Ga0495630_0302355 3300046517 Bacteria 1222
703 Ga0495642_0030957 3300046528 Bacteria 2144
704 Ga0495652_0005176 3300046529 Bacteria 12329
705 Ga0495652_0009560 3300046529 Bacteria 8804
706 Ga0495652_0039567 3300046529 Bacteria 4077
707 Ga0495640_0023044 3300046533 Bacteria 4545
708 Ga0495640_0052009 3300046533 Bacteria 2814
709 Ga0495640_0302400 3300046533 Bacteria 993
710 Ga0495640_0405079 3300046533 Unclassified 837
711 Ga0495586_0132082 3300046535 Bacteria 1398
712 Ga0495587_0024773 3300046536 Bacteria 3674
713 Ga0495587_0196034 3300046536 Bacteria 1143
714 Ga0495621_0007949 3300046539 Bacteria 3159
715 Ga0495621_0104512 3300046539 Bacteria 1081
716 Ga0495621_0172079 3300046539 Bacteria 861
717 Ga0495645_0001613 3300046543 Bacteria 15266
718 Ga0495645_0038870 3300046543 Bacteria 3470
719 Ga0495667_0002048 3300046559 Bacteria 13376
720 Ga0495667_0089249 3300046559 Bacteria 1998
721 Ga0495667_0521527 3300046559 Bacteria 743
722 Ga0495634_0026285 3300046642 Bacteria 4064
723 Ga0495635_0011480 3300046663 Bacteria 6211
724 Ga0495635_0327138 3300046663 Bacteria 1025
725 Ga0495659_0045620 3300046664 Bacteria 1580
726 Ga0495588_0106084 3300046674 Unclassified 1478
727 Ga0495657_0000832 3300046675 Bacteria 27258
728 Ga0495657_0082893 3300046675 Bacteria 2071
729 Ga0495599_0001031 3300046678 Bacteria 15639
730 Ga0495623_0000618 3300046679 Bacteria 23684
731 Ga0495623_0367606 3300046679 Bacteria 780
732 Ga0495646_0002986 3300046680 Bacteria 10487
733 Ga0495647_0065499 3300046681 Bacteria 1443
734 Ga0495613_0087789 3300046689 Bacteria 2254
735 Ga0495624_0032820 3300046690 Bacteria 3365
736 Ga0495600_0000463 3300046809 Bacteria 21090
737 Ga0495600_0115776 3300046809 Bacteria 1745
738 Ga0495581_0103052 3300047315 Bacteria 1658
739 Ga0495604_0000184 3300047317 Bacteria 55687
740 Ga0495636_0225326 3300047318 Archaea 861
741 Ga0495674_0004278 3300047319 Bacteria 13739
742 Ga0495674_0004511 3300047319 Bacteria 13392
743 Ga0495674_0142833 3300047319 Bacteria 2011
744 Ga0495680_0015995 3300047322 Bacteria 6454
745 Ga0495680_0100955 3300047322 Bacteria 2149
746 Ga0495675_0007957 3300047444 Bacteria 6555
747 Ga0495684_0001087 3300047471 Bacteria 21918
748 Ga0495684_0001473 3300047471 Bacteria 18840
749 Ga0495684_0139288 3300047471 Bacteria 1819
750 Ga0495593_0137932 3300047673 Bacteria 1236
751 Ga0495602_0022274 3300048088 Bacteria 6207
752 Ga0495602_0197098 3300048088 Bacteria 1539
753 Ga0496101_0393180 3300048904 Bacteria 1091
754 Ga0496104_0088634 3300048907 Bacteria 2956
755 Ga0496106_0084817 3300048909 Bacteria 2438
756 Ga0496106_0176418 3300048909 Unclassified 1695
757 Ga0496106_0521719 3300048909 Bacteria 954
758 Ga0496107_0250370 3300048910 Bacteria 1318
759 Ga0496107_0740684 3300048910 Bacteria 721
760 Ga0496108_0460403 3300048911 Bacteria 1111
761 Ga0496109_0469335 3300048912 Bacteria 1188
762 Ga0496112_0002761 3300048915 Bacteria 14238
763 Ga0496112_0008328 3300048915 Bacteria 9281
764 Ga0496112_0161875 3300048915 Bacteria 2205
765 Ga0496113_0242761 3300048916 Bacteria 1437
766 Ga0496115_0058217 3300048918 Bacteria 3109
767 Ga0496115_0453693 3300048918 Bacteria 1035
768 Ga0501031_0369060 3300049568 Bacteria 929
769 Ga0501036_0061835 3300049572 Bacteria 3172
770 Ga0501040_0024034 3300049576 Bacteria 4089
771 Ga0501041_0140957 3300049577 Bacteria 1503
772 Ga0501046_0105697 3300049580 Bacteria 2156
773 Ga0501046_0253633 3300049580 Bacteria 1294
774 Ga0501047_0158201 3300049581 Bacteria 2138
775 Ga0501048_0132052 3300049582 Bacteria 1765
776 Ga0501069_0104199 3300049585 Unclassified 1612
777 Ga0501070_0069637 3300049586 Bacteria 2913
778 Ga0501071_0197327 3300049587 Bacteria 1511
779 Ga0501072_0475657 3300049588 Bacteria 989
780 Ga0501198_009714 3300049649 Bacteria 1415
781 Ga0501202_007405 3300049652 Unclassified 1983
782 Ga0501207_006885 3300049654 Unclassified 1608
783 Ga0501216_004935 3300049660 Unclassified 1995
784 Ga0501223_018664 3300049663 Unclassified 1364
785 Ga0501224_008863 3300049664 Bacteria 1469
786 Ga0501233_000321 3300049668 Bacteria 7383
787 Ga0501235_000133 3300049669 Bacteria 12374
788 Ga0501240_002306 3300049673 Bacteria 2007
789 Ga0501242_005412 3300049674 Unclassified 1437
790 Ga0501251_021606 3300049681 Bacteria 859
791 Ga0501256_004063 3300049685 Bacteria 1243
792 Ga0501257_007220 3300049686 Bacteria 2481
793 Ga0501259_004934 3300049688 Bacteria 2115
794 Ga0501221_002131 3300049704 Bacteria 3291
795 Ga0501225_0000652 3300049705 Bacteria 10800
796 Ga0501234_002959 3300049707 Unclassified 2671
797 Ga0501079_0086922 3300049741 Unclassified 2420
798 Ga0501079_0242310 3300049741 Bacteria 1409
799 Ga0501081_0587297 3300049743 Bacteria 833
800 Ga0501266_003484 3300049763 Unclassified 1951
801 Ga0501268_000066 3300049765 Bacteria 8285
802 Ga0501272_003800 3300049769 Unclassified 1551
803 Ga0501276_001326 3300049773 Bacteria 1659
804 Ga0501279_040251 3300049775 Bacteria 715
805 Ga0501283_002334 3300049779 Unclassified 2466
806 Ga0501045_0256940 3300049824 Bacteria 1300
807 nmdc:mga05p37_255353_c1 3300050507 Bacteria 2101
808 nmdc:mga09592_47173_c1 3300050508 Bacteria 3630
809 nmdc:mga09592_644689_c1 3300050508 Bacteria 905
810 nmdc:mga0qj67_24955_c1 3300050509 Bacteria 4614
811 nmdc:mga0qj67_4887_c1 3300050509 Bacteria 9744
812 nmdc:mga0qj67_72375_c1 3300050509 Bacteria 2752
813 nmdc:mga0qj67_93302_c1 3300050509 Bacteria 2420
814 nmdc:mga06r32_154143_c1 3300050510 Unclassified 2277
815 nmdc:mga06r32_464379_c1 3300050510 Bacteria 1245
816 nmdc:mga06r32_57813_c1 3300050510 Bacteria 3726
817 nmdc:mga08y16_42500_c1 3300050511 Bacteria 4760
818 nmdc:mga08y16_709498_c1 3300050511 Bacteria 1005
819 nmdc:mga0n895_13819_c1 3300050512 Bacteria 7305
820 nmdc:mga0n895_17447_c1 3300050512 Bacteria 6614
821 nmdc:mga0n895_1846_c1 3300050512 Bacteria 16162
822 nmdc:mga0n895_2638_c1 3300050512 Bacteria 14134
823 nmdc:mga0n895_382024_c1 3300050512 Bacteria 1425
824 nmdc:mga0n895_424_c1 3300050512 Bacteria 28339
825 nmdc:mga0n895_93425_c1 3300050512 Bacteria 3012
826 nmdc:mga0rr50_122269_c1 3300050513 Bacteria 2074
827 nmdc:mga0rr50_150402_c1 3300050513 Bacteria 1881
828 nmdc:mga0rr50_39003_c1 3300050513 Bacteria 3443
829 nmdc:mga0rr50_422330_c1 3300050513 Bacteria 1128
830 nmdc:mga08x19_122798_c1 3300050514 Bacteria 1742
831 nmdc:mga08x19_166263_c1 3300050514 Bacteria 1500
832 nmdc:mga08x19_18438_c1 3300050514 Bacteria 4276
833 nmdc:mga08x19_22002_c1 3300050514 Bacteria 3944
834 nmdc:mga08x19_27276_c1 3300050514 Bacteria 3571
835 nmdc:mga08x19_72425_c1 3300050514 Bacteria 2248
836 nmdc:mga08x19_740055_c1 3300050514 Bacteria 698
837 nmdc:mga08x19_8153_c1 3300050514 Bacteria 6226
838 nmdc:mga0a205_160635_c1 3300050515 Bacteria 2144
839 nmdc:mga0a205_192094_c1 3300050515 Bacteria 1934
840 nmdc:mga0a205_20656_c1 3300050515 Bacteria 6218
841 nmdc:mga0a205_238922_c1 3300050515 Bacteria 1698
842 nmdc:mga0a205_25938_c1 3300050515 Bacteria 5584
843 nmdc:mga0a205_8934_c1 3300050515 Bacteria 9133
844 Ga0495601_0350216 3300053077 Bacteria 960
845 Ga0495612_0009758 3300053078 Bacteria 3889
846 Ga0495619_0005271 3300053085 Bacteria 8192
847 Ga0495619_0255285 3300053085 Bacteria 1215
848 Ga0500596_032759 3300053735 Bacteria 810
849 Ga0590075_023703 3300059424 Bacteria 1538
850 Ga0501082_0695818 3300060353 Bacteria 890
851 Ga0530510_0066090 3300061734 Bacteria 2621
852 Ga0105245_10073220
853 MBSR1b_contig_9848075
854 Ga0058863_11976216
855 Ga0058861_11730983
856 Ga0065715_10416856
857 Ga0070658_10003928
858 Ga0070658_10108146
859 Ga0070658_10321659
860 Ga0070658_11157501
861 Ga0070676_10085846
862 Ga0070676_10159151
863 Ga0070676_10170808
864 Ga0070683_100000870
865 Ga0070683_100001776
866 Ga0070683_100027040
867 Ga0070683_100072503
868 Ga0070683_100117030
869 Ga0070683_100121495
870 Ga0070683_100179899
871 Ga0070683_100181737
872 Ga0070683_100284989
873 Ga0070683_100484408
874 Ga0070690_100033216
875 Ga0070690_100044937
876 Ga0070690_100054036
877 Ga0070690_100087951
878 Ga0070670_100096159
879 Ga0070670_100328871
880 Ga0070670_100428108
881 Ga0070677_10030042
882 Ga0068869_100147135
883 Ga0068869_100521865
884 Ga0070680_100004987
885 Ga0070680_100027731
886 Ga0070680_100063221
887 Ga0070680_100218152
888 Ga0070680_100234629
889 Ga0070680_100234812
890 Ga0070680_100257359
891 Ga0070680_100281810
892 Ga0070680_100306633
893 Ga0070680_100561168
894 Ga0070682_100000534
895 Ga0070682_100001078
896 Ga0070682_100004658
897 Ga0070682_100434109
898 Ga0070682_100758376
899 Ga0068868_100010776
900 Ga0068868_100087455
901 Ga0068868_100148718
902 Ga0070660_100172609
903 Ga0070689_100020638
904 Ga0070691_10026302
905 Ga0070687_100008213
906 Ga0070687_100009892
907 Ga0070687_100055560
908 Ga0070687_100089797
909 Ga0070661_100044014
910 Ga0070661_100153672
911 Ga0070661_100604971
912 Ga0070692_10074394
913 Ga0070692_10119537
914 Ga0070692_10161911
915 Ga0070668_100237658
916 Ga0070668_100341841
917 Ga0070669_100005328
918 Ga0070669_100065165
919 Ga0070669_100128187
920 Ga0070669_100166083
921 Ga0070669_100411485
922 Ga0070675_100004308
923 Ga0070675_100257337
924 Ga0070671_100024066
925 Ga0070671_100168056
926 Ga0070671_100222067
927 Ga0070671_100243575
928 Ga0070671_100367513
929 Ga0070671_100714036
930 Ga0070674_100079007
931 Ga0070674_100616435
932 Ga0070674_100641780
933 Ga0070673_100011203
934 Ga0070673_100154569
935 Ga0070673_100199624
936 Ga0070673_100439821
937 Ga0070673_100564913
938 Ga0070688_100166982
939 Ga0070688_100575138
940 Ga0070659_100005260
941 Ga0070659_100035859
942 Ga0070659_100088821
943 Ga0070659_100250423
944 Ga0070659_100693211
945 Ga0070667_100043491
946 Ga0070667_100063735
947 Ga0070667_100091825
948 Ga0070709_10045486
949 Ga0070709_10181260
950 Ga0070714_100010440
951 Ga0070714_100156438
952 Ga0070714_100182589
953 Ga0070714_100270529
954 Ga0070713_100000317
955 Ga0070713_100117303
956 Ga0070713_100336777
957 Ga0070710_10114672
958 Ga0070701_10004071
959 Ga0070711_100000044
960 Ga0070711_100009321
961 Ga0070705_100004733
962 Ga0070705_100066495
963 Ga0070705_100263666
964 Ga0070700_100347640
965 Ga0070694_100000349
966 Ga0070694_100005242
967 Ga0070694_100034106
968 Ga0070694_100094275
969 Ga0070694_100113505
970 Ga0070694_100152545
971 Ga0070694_100293541
972 Ga0070708_100000005
973 Ga0070708_100002236
974 Ga0070708_100004800
975 Ga0070708_100157889
976 Ga0070663_100284232
977 Ga0070663_100342591
978 Ga0070678_100059716
979 Ga0070678_100562536
980 Ga0070662_100030786
981 Ga0070662_100207609
982 Ga0070662_100255603
983 Ga0070662_100498355
984 Ga0070662_100680996
985 Ga0070681_10001771
986 Ga0070681_10023015
987 Ga0070681_10037114
988 Ga0070681_10038562
989 Ga0070681_10073151
990 Ga0070681_10140277
991 Ga0070681_10191132
992 Ga0070681_10418676
993 Ga0070681_10539050
994 Ga0068867_100044284
995 Ga0068867_100124788
996 Ga0068867_100161401
997 Ga0068867_100178313
998 Ga0070685_10008642
999 Ga0070706_100030010
1000 Ga0070706_100117305
1001 Ga0070706_100260614
1002 Ga0070706_100302273
1003 Ga0070706_100533428
1004 Ga0070706_100943248
1005 Ga0070707_100000654
1006 Ga0070707_100106702
1007 Ga0070707_100126434
1008 Ga0070707_100241393
1009 Ga0070707_100245388
1010 Ga0070707_100315881
1011 Ga0070698_100002299
1012 Ga0070698_100133131
1013 Ga0070698_100616176
1014 Ga0070699_100010037
1015 Ga0070699_100020189
1016 Ga0070699_100030205
1017 Ga0070699_100149719
1018 Ga0070699_100209395
1019 Ga0070699_100267154
1020 Ga0070699_100283810
1021 Ga0070699_100438837
1022 Ga0070699_100720273
1023 Ga0070679_100001214
1024 Ga0070679_100003544
1025 Ga0070679_100039459
1026 Ga0070679_100073380
1027 Ga0070679_100114893
1028 Ga0070679_100469315
1029 Ga0070684_100021416
1030 Ga0070684_100050755
1031 Ga0070684_100090693
1032 Ga0070684_100114069
1033 Ga0070684_100132483
1034 Ga0070697_100003018
1035 Ga0070697_100009017
1036 Ga0070697_100009927
1037 Ga0070697_100043257
1038 Ga0070697_100051650
1039 Ga0070697_100137999
1040 Ga0070697_100177815
1041 Ga0070697_100258860
1042 Ga0070697_100282406
1043 Ga0070697_100437763
1044 Ga0068853_100023233
1045 Ga0068853_100226052
1046 Ga0068853_100844805
1047 Ga0070672_100012484
1048 Ga0070672_100022077
1049 Ga0070672_100056071
1050 Ga0070672_100125676
1051 Ga0070672_100265046
1052 Ga0070672_100664562
1053 Ga0070672_100828988
1054 Ga0070686_100018412
1055 Ga0070686_100160228
1056 Ga0070686_100208954
1057 Ga0070686_100223830
1058 Ga0070686_100586276
1059 Ga0070686_100760029
1060 Ga0070695_100002187
1061 Ga0070695_100004823
1062 Ga0070695_100015804
1063 Ga0070695_100045504
1064 Ga0070695_100053110
1065 Ga0070695_100074002
1066 Ga0070695_100110891
1067 Ga0070695_100151810
1068 Ga0070695_100572596
1069 Ga0070696_100007693
1070 Ga0070696_100014572
1071 Ga0070696_100016937
1072 Ga0070696_100025935
1073 Ga0070696_100172819
1074 Ga0070696_100176762
1075 Ga0070696_100781705
1076 Ga0070693_100088732
1077 Ga0070693_100119714
1078 Ga0070665_100010948
1079 Ga0070665_100353104
1080 Ga0070704_100003026
1081 Ga0070704_100031318
1082 Ga0070704_100217694
1083 Ga0070704_100436730
1084 Ga0070704_100628031
1085 Ga0068855_100001191
1086 Ga0068855_100176908
1087 Ga0068855_100670624
1088 Ga0070664_100003488
1089 Ga0070664_100004994
1090 Ga0070664_100008899
1091 Ga0070664_100032139
1092 Ga0070664_100072559
1093 Ga0070664_100177217
1094 Ga0070664_100315081
1095 Ga0070664_100488484
1096 Ga0070664_100696550
1097 Ga0068857_100001055
1098 Ga0068857_100005630
1099 Ga0068857_100076107
1100 Ga0068857_100128408
1101 Ga0068857_101170994
1102 Ga0068854_100127648
1103 Ga0068854_100151261
1104 Ga0068854_100168458
1105 Ga0068854_100737090
1106 Ga0068854_101064030
1107 Ga0068856_100156978
1108 Ga0070702_100010548
1109 Ga0070702_100263223
1110 Ga0070702_100453110
1111 Ga0068852_100354836
1112 Ga0068852_100389502
1113 Ga0068852_100544218
1114 Ga0068859_100017975
1115 Ga0068859_100533239
1116 Ga0068864_100135007
1117 Ga0068864_100750734
1118 Ga0068866_10011017
1119 Ga0068866_10097014
1120 Ga0068861_100071347
1121 Ga0068870_10025314
1122 Ga0068870_10346208
1123 Ga0068870_10364830
1124 Ga0068863_100353825
1125 Ga0068863_100694375
1126 Ga0068858_100084052
1127 Ga0068858_100246644
1128 Ga0068860_100029039
1129 Ga0068860_100507274
1130 Ga0068862_100000767
1131 Ga0068862_100487569
1132 Ga0070717_11207929
1133 Ga0070716_100160560
1134 Ga0070712_100069656
1135 Ga0070712_100683645
1136 Ga0068871_100890364
1137 Ga0075428_100021874
1138 Ga0075428_100024854
1139 Ga0075428_100173273
1140 Ga0075430_100008637
1141 Ga0075430_100040348
1142 Ga0075430_100070982
1143 Ga0075431_100008775
1144 Ga0075431_100152299
1145 Ga0075431_100206812
1146 Ga0075431_100228599
1147 Ga0075431_100572339
1148 Ga0075433_10006608
1149 Ga0075433_10007595
1150 Ga0075433_10025007
1151 Ga0075433_10158277
1152 Ga0075433_10174897
1153 Ga0075433_10241273
1154 Ga0075433_10271658
1155 Ga0075433_10360213
1156 Ga0075434_100004323
1157 Ga0075434_100007916
1158 Ga0075434_100015330
1159 Ga0075434_100016852
1160 Ga0075434_100027932
1161 Ga0075434_100086506
1162 Ga0075434_100958910
1163 Ga0075429_100007150
1164 Ga0075429_100092121
1165 Ga0068865_100286658
1166 Ga0068865_100308321
1167 Ga0068865_100325979
1168 Ga0075436_100005770
1169 Ga0075436_100015199
1170 Ga0075436_100046336
1171 Ga0075436_100054093
1172 Ga0075436_100098970
1173 Ga0075436_100143452
1174 Ga0075436_100204832
1175 Ga0075436_100212979
1176 Ga0075436_100267368
1177 Ga0075436_100897859
1178 Ga0097620_100017975
1179 Ga0097620_100476761
1180 Ga0097620_100533263
1181 Ga0075435_100003426
1182 Ga0075435_100008762
1183 Ga0075435_100008948
1184 Ga0075435_100045901
1185 Ga0075435_100126738
1186 Ga0075435_100240411
1187 Ga0075435_100633444
1188 Ga0075435_100663234
1189 Ga0099794_10000245
1190 Ga0099794_10001463
1191 Ga0099794_10087693
1192 Ga0099794_10290267
1193 Ga0105240_10037795
1194 Ga0105240_10122646
1195 Ga0105240_10240540
1196 Ga0111539_10042484
1197 Ga0105245_10003097
1198 Ga0105245_10306434
1199 Ga0114129_10052317
1200 Ga0114129_10636220
1201 Ga0114129_10988786
1202 Ga0105243_10315500
1203 Ga0105242_10004336
1204 Ga0105242_10174785
1205 Ga0105242_10400617
1206 Ga0105242_10933911
1207 Ga0105248_10050848
1208 Ga0105248_10237566
1209 Ga0105237_10397107
1210 Ga0105249_10000186
1211 Ga0105249_10675459
1212 Ga0099796_10042318
1213 Ga0105246_10155582
1214 Ga0105246_10449575
1215 Ga0157373_10179967
1216 Ga0157373_10489778
1217 Ga0157371_10091967
1218 Ga0157371_10188936
1219 Ga0157371_10371319
1220 Ga0157370_10050305
1221 Ga0157370_10164947
1222 Ga0157370_10326659
1223 Ga0157370_10327989
1224 Ga0157369_10120661
1225 Ga0157369_10338951
1226 Ga0157369_10394870
1227 Ga0157374_10035487
1228 Ga0157374_10124146
1229 Ga0157374_10158174
1230 Ga0157378_10081862
1231 Ga0157378_10197316
1232 Ga0163162_10026901
1233 Ga0157372_10005925
1234 Ga0157372_10107750
1235 Ga0157372_10137355
1236 Ga0157372_10160743
1237 Ga0157372_10212665
1238 Ga0157375_10018838
1239 Ga0157375_10090755
1240 Ga0157375_10119244
1241 Ga0157375_10120571
1242 Ga0157380_10058794
1243 Ga0157380_10466087
1244 Ga0157380_10567618
1245 Ga0157380_10743591
1246 Ga0182008_10109790
1247 Ga0157376_10137412
1248 Ga0163161_10280880
1249 Ga0206356_10535048
1250 Ga0207653_10001466
1251 Ga0207682_10026899
1252 Ga0207682_10098165
1253 Ga0207692_10151023
1254 Ga0207642_10186679
1255 Ga0207688_10077864
1256 Ga0207680_10116992
1257 Ga0207699_10004282
1258 Ga0207699_10159911
1259 Ga0207699_10541209
1260 Ga0207699_10626037
1261 Ga0207645_10113567
1262 Ga0207645_10121992
1263 Ga0207643_10005239
1264 Ga0207643_10015811
1265 Ga0207705_10006207
1266 Ga0207705_10085998
1267 Ga0207705_10232655
1268 Ga0207684_10030500
1269 Ga0207684_10201811
1270 Ga0207684_10206455
1271 Ga0207684_10218359
1272 Ga0207684_10242662
1273 Ga0207684_10474534
1274 Ga0207684_10533943
1275 Ga0207707_10001365
1276 Ga0207707_10003848
1277 Ga0207707_10018983
1278 Ga0207707_10056752
1279 Ga0207707_10073867
1280 Ga0207707_10107985
1281 Ga0207707_10236331
1282 Ga0207707_10266282
1283 Ga0207707_10345941
1284 Ga0207707_10527454
1285 Ga0207695_10007131
1286 Ga0207695_10064471
1287 Ga0207693_10078108
1288 Ga0207693_10256365
1289 Ga0207663_10000062
1290 Ga0207663_10095098
1291 Ga0207663_10644875
1292 Ga0207660_10003954
1293 Ga0207660_10037787
1294 Ga0207660_10039407
1295 Ga0207660_10046371
1296 Ga0207660_10104930
1297 Ga0207660_10219880
1298 Ga0207660_10307057
1299 Ga0207660_10669216
1300 Ga0207662_10000790
1301 Ga0207662_10058406
1302 Ga0207662_10171410
1303 Ga0207662_10400614
1304 Ga0207657_10028895
1305 Ga0207657_10071021
1306 Ga0207649_10028337
1307 Ga0207649_10030308
1308 Ga0207649_10204623
1309 Ga0207652_10004657
1310 Ga0207652_10012354
1311 Ga0207652_10031737
1312 Ga0207652_10044671
1313 Ga0207652_10067012
1314 Ga0207652_11052399
1315 Ga0207646_10002582
1316 Ga0207646_10144176
1317 Ga0207646_10201865
1318 Ga0207646_10203530
1319 Ga0207646_10415270
1320 Ga0207646_10730722
1321 Ga0207681_10002985
1322 Ga0207681_10014752
1323 Ga0207681_10218076
1324 Ga0207681_10277500
1325 Ga0207694_10309254
1326 Ga0207650_10215446
1327 Ga0207650_10671845
1328 Ga0207659_10020208
1329 Ga0207659_10094553
1330 Ga0207687_10058209
1331 Ga0207687_10122562
1332 Ga0207687_10175446
1333 Ga0207700_10000640
1334 Ga0207700_10039032
1335 Ga0207664_10054370
1336 Ga0207664_10054665
1337 Ga0207664_10202542
1338 Ga0207664_10262962
1339 Ga0207664_10314726
1340 Ga0207664_10421340
1341 Ga0207644_10184739
1342 Ga0207644_10381792
1343 Ga0207644_10561858
1344 Ga0207644_10597484
1345 Ga0207690_10030237
1346 Ga0207690_10344836
1347 Ga0207690_10580725
1348 Ga0207706_10001490
1349 Ga0207706_10053959
1350 Ga0207706_10110187
1351 Ga0207706_10222805
1352 Ga0207686_10081150
1353 Ga0207709_10049214
1354 Ga0207670_10151070
1355 Ga0207670_10405941
1356 Ga0207670_10815487
1357 Ga0207669_10543100
1358 Ga0207704_10010519
1359 Ga0207704_10188695
1360 Ga0207704_10194591
1361 Ga0207665_10076061
1362 Ga0207665_10550373
1363 Ga0207691_10008002
1364 Ga0207691_10056338
1365 Ga0207691_10131437
1366 Ga0207691_10144914
1367 Ga0207691_10277508
1368 Ga0207691_11045501
1369 Ga0207711_10193210
1370 Ga0207711_10232423
1371 Ga0207661_10002665
1372 Ga0207661_10008647
1373 Ga0207661_10013510
1374 Ga0207661_10048024
1375 Ga0207661_10085222
1376 Ga0207661_10138768
1377 Ga0207661_10232692
1378 Ga0207661_10531494
1379 Ga0207679_10020149
1380 Ga0207679_10023763
1381 Ga0207679_10072752
1382 Ga0207679_10261761
1383 Ga0207679_10338441
1384 Ga0207679_10421086
1385 Ga0207679_10439482
1386 Ga0207667_10004964
1387 Ga0207667_10005591
1388 Ga0207667_10046854
1389 Ga0207667_10117091
1390 Ga0207667_10291272
1391 Ga0207651_10039161
1392 Ga0207651_10073060
1393 Ga0207651_10192814
1394 Ga0207651_10599751
1395 Ga0207651_10742671
1396 Ga0207712_10000260
1397 Ga0207712_10631093
1398 Ga0207668_10131134
1399 Ga0207668_11421358
1400 Ga0207640_10717145
1401 Ga0207658_10111865
1402 Ga0207658_10660471
1403 Ga0207677_10003138
1404 Ga0207677_10678963
1405 Ga0207703_10385421
1406 Ga0207639_10197317
1407 Ga0207639_10477721
1408 Ga0207639_10978031
1409 Ga0207678_10000873
1410 Ga0207678_10223547
1411 Ga0207678_10320392
1412 Ga0207678_10326753
1413 Ga0207708_10021862
1414 Ga0207708_10075968
1415 Ga0207708_10169117
1416 Ga0207708_10490092
1417 Ga0207702_10140518
1418 Ga0207702_10228752
1419 Ga0207702_10275330
1420 Ga0207702_10523785
1421 Ga0207641_10331652
1422 Ga0207648_10012210
1423 Ga0207648_10147407
1424 Ga0207648_10199743
1425 Ga0207648_10423553
1426 Ga0207648_10641520
1427 Ga0207676_10282677
1428 Ga0207676_10378890
1429 Ga0207674_10015560
1430 Ga0207674_10041812
1431 Ga0207674_10125251
1432 Ga0207674_10171849
1433 Ga0207675_100111713
1434 Ga0207675_100533277
1435 Ga0207683_10007440
1436 Ga0207683_10176109
1437 Ga0207683_10192521
1438 Ga0207698_10224872
1439 Ga0207698_10319930
1440 Ga0207698_10511675
1441 Ga0207698_10829382
1442 Ga0209969_1001324
1443 Ga0209981_1013285
1444 Ga0209983_1017218
1445 Ga0209588_1000139
1446 Ga0209588_1000206
1447 Ga0209966_1021070
1448 Ga0209998_10000482
1449 Ga0209974_10021978
1450 Ga0207428_10151726
1451 Ga0268266_10181761
1452 Ga0268266_11558195
1453 Ga0268265_10000144
1454 Ga0268265_10116957
1455 Ga0268264_10060340
1456 Ga0268264_10344248
1457 Ga0265332_10020124
1458 Ga0265332_10022934
1459 Ga0265316_10411113
1460 Ga0307408_100008152
1461 Ga0307408_100102293
1462 Ga0307408_100137219
1463 Ga0265314_10005797
1464 Ga0265314_10008093
1465 Ga0307405_10094001
1466 Ga0307413_10889268
1467 Ga0307410_10038178
1468 Ga0307410_10762438
1469 Ga0307406_10006081
1470 Ga0307406_10073174
1471 Ga0307406_10082371
1472 Ga0307406_11032412
1473 Ga0307412_10111515
1474 Ga0307409_100076416
1475 Ga0307409_100385103
1476 Ga0307409_100787224
1477 Ga0307416_100039748
1478 Ga0307416_100845238
1479 Ga0307416_101352951
1480 Ga0307416_101401910
1481 Ga0307414_10402799
1482 Ga0307414_10492838
1483 Ga0307414_10561274
1484 Ga0307414_10715344
1485 Ga0307411_10057050
1486 Ga0307411_10061913
1487 Ga0307411_10130750
1488 Ga0307411_10144102
1489 Ga0307415_100070043
1490 Ga0307415_100169923
1491 Ga0307415_100224951
1492 Ga0307415_100901883
1493 Ga0373959_0006070
1494 Ga0373934_0001566
1495 Ga0373940_0044888
1496 Ga0373944_0019418
1497 Ga0373923_0024571
1498 Ga0373923_0048210
1499 Ga0373936_0053767
1500 Ga0373941_0009301
1501 Ga0373941_0048889
1502 Ga0373954_0040733
1503 Ga0373956_0039935
1504 Ga0373960_0027413
1505 Ga0373924_0002303
1506 Ga0373935_0142069
1507 Ga0373935_0332384
1508 Ga0373927_0285944
1509 Ga0373927_0311238
1510 Ga0373933_0000305
1511 Ga0373933_0367830
1512 Ga0373947_0206168
1513 Ga0373937_0001214
1514 Ga0373937_0408435
1515 Ga0373925_0016396
1516 Ga0395898_1282427
1517 Ga0242420_014308
1518 Ga0439439_0016907
1519 Ga0451577_0000001
1520 Ga0453683_0030462
1521 Ga0453684_0020545
1522 Ga0466959_0153305
1523 Ga0466959_0427347
1524 Ga0451576_0003678
1525 Ga0451576_0005748
1526 Ga0451576_0012437
1527 Ga0451576_0012798
1528 Ga0451576_0035600
1529 Ga0451576_0047324
1530 Ga0466958_0122211
1531 Ga0495592_0001353
1532 Ga0495592_0353918
1533 Ga0495603_0023523
1534 Ga0495629_0112092
1535 Ga0495629_0137435
1536 Ga0495651_0000448
1537 Ga0495653_0001606
1538 Ga0495653_0021175
1539 Ga0495653_0060861
1540 Ga0495639_0267115
1541 Ga0495664_0028421
1542 Ga0495594_0011875
1543 Ga0495594_0013936
1544 Ga0495596_0022998
1545 Ga0495608_0000482
1546 Ga0495608_0057482
1547 Ga0495608_0104274
1548 Ga0495618_0022577
1549 Ga0495618_0135376
1550 Ga0495628_0012834
1551 Ga0495628_0020472
1552 Ga0495630_0012094
1553 Ga0495630_0302355
1554 Ga0495642_0030957
1555 Ga0495652_0005176
1556 Ga0495652_0009560
1557 Ga0495652_0039567
1558 Ga0495640_0023044
1559 Ga0495640_0052009
1560 Ga0495640_0302400
1561 Ga0495640_0405079
1562 Ga0495586_0132082
1563 Ga0495587_0024773
1564 Ga0495587_0196034
1565 Ga0495621_0007949
1566 Ga0495621_0104512
1567 Ga0495621_0172079
1568 Ga0495645_0001613
1569 Ga0495645_0038870
1570 Ga0495667_0002048
1571 Ga0495667_0089249
1572 Ga0495667_0521527
1573 Ga0495634_0026285
1574 Ga0495635_0011480
1575 Ga0495635_0327138
1576 Ga0495659_0045620
1577 Ga0495588_0106084
1578 Ga0495657_0000832
1579 Ga0495657_0082893
1580 Ga0495599_0001031
1581 Ga0495623_0000618
1582 Ga0495623_0367606
1583 Ga0495646_0002986
1584 Ga0495647_0065499
1585 Ga0495613_0087789
1586 Ga0495624_0032820
1587 Ga0495600_0000463
1588 Ga0495600_0115776
1589 Ga0495581_0103052
1590 Ga0495604_0000184
1591 Ga0495636_0225326
1592 Ga0495674_0004278
1593 Ga0495674_0004511
1594 Ga0495674_0142833
1595 Ga0495680_0015995
1596 Ga0495680_0100955
1597 Ga0495675_0007957
1598 Ga0495684_0001087
1599 Ga0495684_0001473
1600 Ga0495684_0139288
1601 Ga0495593_0137932
1602 Ga0495602_0022274
1603 Ga0495602_0197098
1604 Ga0496101_0393180
1605 Ga0496104_0088634
1606 Ga0496106_0084817
1607 Ga0496106_0176418
1608 Ga0496106_0521719
1609 Ga0496107_0250370
1610 Ga0496107_0740684
1611 Ga0496108_0460403
1612 Ga0496109_0469335
1613 Ga0496112_0002761
1614 Ga0496112_0008328
1615 Ga0496112_0161875
1616 Ga0496113_0242761
1617 Ga0496115_0058217
1618 Ga0496115_0453693
1619 Ga0501031_0369060
1620 Ga0501036_0061835
1621 Ga0501040_0024034
1622 Ga0501041_0140957
1623 Ga0501046_0105697
1624 Ga0501046_0253633
1625 Ga0501047_0158201
1626 Ga0501048_0132052
1627 Ga0501069_0104199
1628 Ga0501070_0069637
1629 Ga0501071_0197327
1630 Ga0501072_0475657
1631 Ga0501198_009714
1632 Ga0501202_007405
1633 Ga0501207_006885
1634 Ga0501216_004935
1635 Ga0501223_018664
1636 Ga0501224_008863
1637 Ga0501233_000321
1638 Ga0501235_000133
1639 Ga0501240_002306
1640 Ga0501242_005412
1641 Ga0501251_021606
1642 Ga0501256_004063
1643 Ga0501257_007220
1644 Ga0501259_004934
1645 Ga0501221_002131
1646 Ga0501225_0000652
1647 Ga0501234_002959
1648 Ga0501079_0086922
1649 Ga0501079_0242310
1650 Ga0501081_0587297
1651 Ga0501266_003484
1652 Ga0501268_000066
1653 Ga0501272_003800
1654 Ga0501276_001326
1655 Ga0501279_040251
1656 Ga0501283_002334
1657 Ga0501045_0256940
1658 nmdc:mga05p37_255353_c1
1659 nmdc:mga09592_47173_c1
1660 nmdc:mga09592_644689_c1
1661 nmdc:mga0qj67_24955_c1
1662 nmdc:mga0qj67_4887_c1
1663 nmdc:mga0qj67_72375_c1
1664 nmdc:mga0qj67_93302_c1
1665 nmdc:mga06r32_154143_c1
1666 nmdc:mga06r32_464379_c1
1667 nmdc:mga06r32_57813_c1
1668 nmdc:mga08y16_42500_c1
1669 nmdc:mga08y16_709498_c1
1670 nmdc:mga0n895_13819_c1
1671 nmdc:mga0n895_17447_c1
1672 nmdc:mga0n895_1846_c1
1673 nmdc:mga0n895_2638_c1
1674 nmdc:mga0n895_382024_c1
1675 nmdc:mga0n895_424_c1
1676 nmdc:mga0n895_93425_c1
1677 nmdc:mga0rr50_122269_c1
1678 nmdc:mga0rr50_150402_c1
1679 nmdc:mga0rr50_39003_c1
1680 nmdc:mga0rr50_422330_c1
1681 nmdc:mga08x19_122798_c1
1682 nmdc:mga08x19_166263_c1
1683 nmdc:mga08x19_18438_c1
1684 nmdc:mga08x19_22002_c1
1685 nmdc:mga08x19_27276_c1
1686 nmdc:mga08x19_72425_c1
1687 nmdc:mga08x19_740055_c1
1688 nmdc:mga08x19_8153_c1
1689 nmdc:mga0a205_160635_c1
1690 nmdc:mga0a205_192094_c1
1691 nmdc:mga0a205_20656_c1
1692 nmdc:mga0a205_238922_c1
1693 nmdc:mga0a205_25938_c1
1694 nmdc:mga0a205_8934_c1
1695 Ga0495601_0350216
1696 Ga0495612_0009758
1697 Ga0495619_0005271
1698 Ga0495619_0255285
1699 Ga0500596_032759
1700 Ga0590075_023703
1701 Ga0501082_0695818
1702 Ga0530510_0066090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

60

211

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9605 37 187
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9343 37 187
7jrl-assembly1.cif.gz_A the structure of cbm51-2 in complex with glcnac and int domains from clostridium perfringens zmpb 0.8806 53 116
1nze-assembly1.cif.gz_A crystal structure of psbq polypeptide of photosystem ii from higher plants 0.6404 33 119
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.6367 45 150
ID Description Score Start End Superfamily
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8041 35 199 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.7699 35 199 1.20.1440.20
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7266 19 187 1.10.287.1490
2v6yA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7096 76 152 1.20.58.80
4ezxB02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.7004 39 117 1.20.1270.10
ID Description Score Start End GO Terms
AF-I0R1D5-F1-model_v4 LemA family protein 0.9384 34 190 GO:0016020
AF-A0A7Y5SF65-F1-model_v4 LemA family protein 0.9373 35 187 GO:0016020
AF-A0A1A3TAW2-F1-model_v4 LemA family protein 0.9334 44 187 GO:0016020
AF-A0A3N5TX63-F1-model_v4 LemA family protein 0.9205 27 187 GO:0016020
AF-A0A7Y0RPJ3-F1-model_v4 deleted 0.9122 35 188

Map