F483441

General Info

Members Datasets Scaffolds Average Seq Length
850 578 622 441

Family's Representative Sequence

Representative Sequence 3300053145|Ga0500586_019666|Ga0500586_019666_286_1890
Length 482
Sequence MLTPRTRKRRENASAWLFDIHIRNDQGTEPRSGFGMRHQRLRASLTLPRTFIPAALAWQRNAHHLALRHQQTSTGTPTMDVHRRHLLTVSGAGLAAGAFAASSDAARAAPLTSTLGRDATQYGVRPGSQDDQTRVLQRAIDEAARAQVPLALPPGVYRTGTLKLARGSQIIGIRGLTLDGNFAKLPPRRGLLHMVQARELRISDCSITNSGGAGIWLENSAGAITGNTLTNIATTAIVSFDAQGLIVAQNTIAGSSSNGIEILRTAIGDDGTQVIDNRIEDIKAGPGGSGQYGNAINAFRAGNVIVSGNRIRNCDYSAVRGNREVALYSEFAFEAAIIANNTVDGAALGVSVCNFNEGGRIAVVQGNIIRNLIPKRPIGTAPDDDAGIGIYIEADASVTGNVVENAPSFGMIAGWGKYLRFIGIGVSVAPGAGTALVSNNMISGAARGAVVGLDHAKPVTPDLTADGAQRYQQVALSGNTVR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
59 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
60 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
61 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
62 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
63 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
64 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
65 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
66 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
69 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
70 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
71 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
72 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
75 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
76 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
77 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
93 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
94 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
95 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
96 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
97 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
98 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
99 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
100 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
101 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
102 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
103 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
104 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
105 2904699407
106 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
107 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
108 2906610324
109 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
110 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
111 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
112 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
113 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
114 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
115 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
116 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
117 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
118 2922368715
119 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
120 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
121 2922425934
122 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
123 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
124 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
125 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
126 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
127 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
128 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
129 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
130 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
131 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
132 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
133 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
134 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
135 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
136 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
137 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
138 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
139 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
140 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
141 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
142 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
143 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
144 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
145 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
146 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
147 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
148 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
149 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
150 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
151 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
152 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
153 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
154 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
155 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
156 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
157 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
158 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
159 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
160 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
161 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
162 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
163 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
164 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
165 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
166 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
167 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
168 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
169 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
170 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
171 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
172 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
173 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
174 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
175 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
176 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
177 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
178 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
179 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
180 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
181 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
182 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
183 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
184 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
185 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
186 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
187 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
188 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
189 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
190 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
191 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
192 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
193 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
196 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
197 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
198 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
199 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
200 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
201 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
202 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
203 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
204 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
205 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
206 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
207 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
208 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
209 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
210 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
211 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
212 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
213 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
214 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
215 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
216 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
217 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
218 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
219 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
220 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
221 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
222 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
223 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
224 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
225 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
226 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
227 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
228 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
229 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
230 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
231 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
232 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
233 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
234 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
235 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
236 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
237 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
238 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
239 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
240 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
241 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
242 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
243 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
244 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
245 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
246 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
247 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
248 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
249 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
250 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
251 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
252 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
253 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
254 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
255 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
259 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
260 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
261 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
262 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
263 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
264 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
265 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
266 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
267 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
268 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
269 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
270 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
271 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
272 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
279 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
281 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
321 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
322 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
323 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
324 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
328 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
329 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
330 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
331 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
332 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
333 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
334 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
335 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
336 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
337 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
338 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
339 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
340 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
341 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
342 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
343 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
344 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
345 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
346 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
347 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
348 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
349 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
350 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
352 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
353 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
354 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
355 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
356 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
357 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
358 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
359 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
360 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
361 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
362 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
363 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
364 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
365 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
366 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
367 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
368 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
369 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
370 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
371 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
372 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
373 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
374 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
375 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
376 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
377 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
378 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
379 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
380 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
381 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
382 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
383 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
384 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
385 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
386 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
387 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
388 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
389 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
390 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
391 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
392 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
393 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
394 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
395 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
396 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
397 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
398 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
399 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
400 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
403 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
404 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
405 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
406 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
407 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
410 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
411 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
415 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
416 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
417 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
418 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
419 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
420 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
421 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
422 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
423 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
424 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
425 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
426 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
427 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
428 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
429 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
430 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
431 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
437 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
438 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
439 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
440 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
441 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
442 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
443 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
444 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
445 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
446 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
447 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
448 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
449 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
450 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
451 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
452 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
453 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
454 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
455 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
458 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
459 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
460 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
461 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
462 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
476 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
477 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
478 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
479 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
480 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
481 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
482 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
483 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
484 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
485 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
486 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
489 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
490 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
491 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
492 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
493 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
494 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
495 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
496 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
499 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
500 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
501 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
502 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
503 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
504 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
505 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
506 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
507 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
508 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
509 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
510 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
511 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
512 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
513 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
514 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
515 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
516 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
517 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
518 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
519 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
520 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
521 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
522 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
523 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
524 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
525 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
526 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
527 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
528 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
529 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
530 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
531 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
532 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
533 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
534 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
535 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
536 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
537 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
538 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
539 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
540 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
541 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
542 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
543 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
544 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
545 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
546 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
547 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
548 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
549 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
550 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
551 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
552 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
553 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
554 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
555 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
556 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
557 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
558 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
559 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
560 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
561 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
562 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
563 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
564 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
565 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
566 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
567 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
568 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
569 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
570 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
571 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
572 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
573 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
574 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
575 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
576 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
577 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
578 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.61
Metatranscriptomes 0
Isolates 26.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 21.06
Rhizoplane 3.53
Rhizosphere 49.65
Stem 0
Stem Tuber 0
Unclassified 14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000034 3300003203 Bacteria 64645
2 JGI25406J46586_10003494 3300003203 Bacteria 7382
3 JGI25153J46596_10006205 3300003215 Bacteria 6115
4 JGI25153J46596_10008275 3300003215 Bacteria 4993
5 JGI25160J50197_1004954 3300003354 Bacteria 5654
6 JGI25404J52841_10006160 3300003659 Bacteria 2499
7 Ga0055543_1003802 3300004625 Bacteria 4295
8 Ga0065165_1002181 3300005262 Bacteria 17639
9 Ga0065165_1002644 3300005262 Bacteria 14510
10 Ga0065165_1013018 3300005262 Bacteria 3337
11 Ga0070658_10077056 3300005327 Bacteria 2735
12 Ga0070683_100016132 3300005329 Bacteria 6577
13 Ga0070680_100016901 3300005336 Bacteria 5743
14 Ga0070680_100027944 3300005336 Bacteria 4521
15 Ga0070682_100024159 3300005337 Bacteria 3615
16 Ga0068868_100016332 3300005338 Bacteria 5511
17 Ga0070674_100053656 3300005356 Bacteria 2784
18 Ga0070674_100126772 3300005356 Bacteria 1897
19 Ga0070659_100058474 3300005366 Bacteria 3043
20 Ga0070659_100171022 3300005366 Bacteria 1780
21 Ga0070659_100259197 3300005366 Bacteria 1442
22 Ga0070667_100101821 3300005367 Bacteria 2481
23 Ga0070709_10000376 3300005434 Bacteria 27515
24 Ga0070714_100071962 3300005435 Bacteria 2991
25 Ga0070713_100093072 3300005436 Bacteria 2597
26 Ga0070710_10000497 3300005437 Bacteria 18490
27 Ga0070710_10011859 3300005437 Bacteria 4316
28 Ga0070710_10093308 3300005437 Bacteria 1779
29 Ga0070711_100023752 3300005439 Bacteria 3992
30 Ga0070711_100028927 3300005439 Bacteria 3651
31 Ga0070711_100031162 3300005439 Bacteria 3537
32 Ga0070711_100057504 3300005439 Bacteria 2693
33 Ga0070663_100014414 3300005455 Bacteria 5073
34 Ga0070663_100034654 3300005455 Bacteria 3497
35 Ga0070678_100081258 3300005456 Bacteria 2456
36 Ga0070662_100223020 3300005457 Bacteria 1505
37 Ga0070681_10042647 3300005458 Bacteria 4546
38 Ga0070698_100065850 3300005471 Bacteria 3648
39 Ga0070679_100022990 3300005530 Bacteria 6097
40 Ga0070679_100040520 3300005530 Bacteria 4634
41 Ga0070679_100046635 3300005530 Bacteria 4319
42 Ga0070684_100090204 3300005535 Bacteria 2725
43 Ga0068853_100016983 3300005539 Bacteria 6000
44 Ga0068855_100053112 3300005563 Bacteria 4768
45 Ga0068855_100094442 3300005563 Bacteria 3448
46 Ga0068855_100291560 3300005563 Bacteria 1809
47 Ga0068857_100014724 3300005577 Bacteria 6824
48 Ga0068857_100023313 3300005577 Bacteria 5447
49 Ga0068854_100003845 3300005578 Bacteria 9407
50 Ga0068854_100036066 3300005578 Bacteria 3465
51 Ga0068856_100000061 3300005614 Bacteria 100823
52 Ga0068856_100005538 3300005614 Bacteria 12434
53 Ga0068856_100011815 3300005614 Bacteria 8463
54 Ga0068856_100050178 3300005614 Bacteria 4113
55 Ga0068852_100002580 3300005616 Bacteria 12500
56 Ga0068852_100016848 3300005616 Bacteria 5713
57 Ga0068852_100049351 3300005616 Bacteria 3600
58 Ga0068852_100090084 3300005616 Bacteria 2743
59 Ga0068859_100147849 3300005617 Bacteria 2425
60 Ga0068861_100179594 3300005719 Bacteria 1761
61 Ga0068851_10006584 3300005834 Bacteria 5310
62 Ga0068863_100033056 3300005841 Bacteria 4928
63 Ga0068860_100001652 3300005843 Bacteria 23863
64 Ga0068862_100080072 3300005844 Bacteria 2832
65 Ga0081455_10000577 3300005937 Bacteria 47777
66 Ga0081455_10001359 3300005937 Bacteria 30249
67 Ga0081455_10006207 3300005937 Bacteria 12886
68 Ga0081455_10043382 3300005937 Bacteria 3934
69 Ga0081455_10075981 3300005937 Bacteria 2769
70 Ga0081540_1000575 3300005983 Bacteria 35551
71 Ga0081540_1006111 3300005983 Bacteria 8845
72 Ga0081540_1006404 3300005983 Bacteria 8580
73 Ga0081540_1011696 3300005983 Bacteria 5843
74 Ga0081540_1012437 3300005983 Bacteria 5604
75 Ga0081540_1017871 3300005983 Bacteria 4373
76 Ga0081540_1035952 3300005983 Bacteria 2649
77 Ga0081539_10000113 3300005985 Bacteria 189418
78 Ga0081539_10000341 3300005985 Bacteria 103044
79 Ga0081539_10087132 3300005985 Bacteria 1623
80 Ga0070717_10051048 3300006028 Bacteria 3402
81 Ga0070717_10163017 3300006028 Bacteria 1935
82 Ga0070717_10287549 3300006028 Bacteria 1459
83 Ga0075365_10032771 3300006038 Bacteria 3344
84 Ga0075365_10119454 3300006038 Bacteria 1817
85 Ga0075365_10128669 3300006038 Bacteria 1751
86 Ga0075363_100082159 3300006048 Bacteria 1763
87 Ga0075364_10028026 3300006051 Bacteria 3603
88 Ga0070716_100045989 3300006173 Bacteria 2454
89 Ga0070712_100003491 3300006175 Bacteria 9671
90 Ga0070712_100093737 3300006175 Bacteria 2205
91 Ga0075367_10001858 3300006178 Bacteria 9326
92 Ga0075367_10019050 3300006178 Bacteria 3799
93 Ga0075369_10007616 3300006186 Bacteria 4136
94 Ga0075369_10022057 3300006186 Bacteria 2624
95 Ga0075370_10037604 3300006353 Bacteria 2722
96 Ga0075431_100212076 3300006847 Bacteria 1978
97 Ga0068865_100201048 3300006881 Bacteria 1547
98 Ga0097620_100147857 3300006931 Bacteria 2425
99 Ga0099825_1026117 3300006941 Bacteria 3158
100 Ga0099824_1005536 3300006942 Bacteria 17739
101 Ga0099824_1015819 3300006942 Bacteria 7020
102 Ga0099794_10010045 3300007265 Bacteria 4007
103 Ga0099794_10058269 3300007265 Bacteria 1872
104 Ga0105240_10013705 3300009093 Bacteria 11109
105 Ga0105240_10016135 3300009093 Bacteria 10123
106 Ga0105240_10022923 3300009093 Bacteria 8271
107 Ga0105240_10084733 3300009093 Bacteria 3885
108 Ga0111539_10091707 3300009094 Bacteria 3569
109 Ga0105245_10141381 3300009098 Bacteria 2267
110 Ga0114129_10052838 3300009147 Bacteria 5701
111 Ga0105241_10001401 3300009174 Bacteria 18447
112 Ga0105241_10054655 3300009174 Bacteria 3057
113 Ga0105242_10088105 3300009176 Bacteria 2607
114 Ga0105248_10223486 3300009177 Bacteria 2120
115 Ga0105237_10008696 3300009545 Bacteria 10967
116 Ga0105237_10025027 3300009545 Bacteria 6106
117 Ga0105237_10058120 3300009545 Bacteria 3871
118 Ga0105237_10070560 3300009545 Bacteria 3490
119 Ga0105237_10233551 3300009545 Bacteria 1840
120 Ga0105238_10006652 3300009551 Bacteria 11526
121 Ga0105238_10011666 3300009551 Bacteria 8855
122 Ga0105238_10051276 3300009551 Bacteria 4151
123 Ga0105238_10071644 3300009551 Bacteria 3463
124 Ga0105249_10107809 3300009553 Bacteria 2629
125 Ga0105239_10034156 3300010375 Bacteria 5583
126 Ga0105239_10040516 3300010375 Bacteria 5104
127 Ga0105239_10054806 3300010375 Bacteria 4374
128 Ga0105239_10058442 3300010375 Bacteria 4232
129 Ga0157370_10188643 3300013104 Bacteria 1914
130 Ga0157369_10003682 3300013105 Bacteria 18215
131 Ga0157369_10004083 3300013105 Bacteria 17280
132 Ga0157378_10009387 3300013297 Bacteria 8523
133 Ga0157372_10043633 3300013307 Bacteria 4965
134 Ga0157372_10177915 3300013307 Bacteria 2462
135 Ga0157375_10011128 3300013308 Bacteria 7934
136 Ga0157380_10013986 3300014326 Bacteria 5861
137 Ga0157376_10008594 3300014969 Bacteria 7379
138 Ga0214544_1000368 3300021320 Bacteria 79177
139 Ga0214542_1002192 3300021321 Bacteria 40482
140 Ga0214545_1000203 3300021324 Bacteria 79176
141 Ga0214543_1000322 3300021327 Bacteria 76376
142 Ga0213876_10000898 3300021384 Bacteria 19843
143 Ga0209563_100727 3300025230 Bacteria 10170
144 Ga0209677_100437 3300025253 Bacteria 24430
145 Ga0209677_104304 3300025253 Bacteria 4170
146 Ga0209148_1000180 3300025254 Bacteria 124830
147 Ga0209233_1004255 3300025261 Bacteria 4900
148 Ga0209455_1007803 3300025272 Bacteria 2979
149 Ga0209564_1001937 3300025295 Bacteria 18414
150 Ga0209758_1000011 3300025297 Bacteria 1049685
151 Ga0209758_1000359 3300025297 Bacteria 81559
152 Ga0209758_1000365 3300025297 Bacteria 80645
153 Ga0209758_1000530 3300025297 Bacteria 60826
154 Ga0209758_1004237 3300025297 Bacteria 12139
155 Ga0209758_1005198 3300025297 Bacteria 10225
156 Ga0209758_1027110 3300025297 Bacteria 2458
157 Ga0209256_1003423 3300025299 Bacteria 11147
158 Ga0207426_1000429 3300025302 Bacteria 68612
159 Ga0207426_1000998 3300025302 Bacteria 27598
160 Ga0207426_1020516 3300025302 Bacteria 2295
161 Ga0209257_1001196 3300025304 Bacteria 32644
162 Ga0207692_10000915 3300025898 Bacteria 10659
163 Ga0207692_10075490 3300025898 Bacteria 1788
164 Ga0207688_10049442 3300025901 Bacteria 2350
165 Ga0207647_10022267 3300025904 Bacteria 4212
166 Ga0207647_10118780 3300025904 Bacteria 1560
167 Ga0207699_10001327 3300025906 Bacteria 11741
168 Ga0207699_10010250 3300025906 Bacteria 4695
169 Ga0207699_10019793 3300025906 Bacteria 3597
170 Ga0207705_10057946 3300025909 Bacteria 2795
171 Ga0207684_10086326 3300025910 Bacteria 2673
172 Ga0207654_10000411 3300025911 Bacteria 24726
173 Ga0207707_10001362 3300025912 Bacteria 22693
174 Ga0207707_10016091 3300025912 Bacteria 6524
175 Ga0207707_10109082 3300025912 Bacteria 2420
176 Ga0207695_10000008 3300025913 Bacteria 1058268
177 Ga0207695_10000424 3300025913 Bacteria 93657
178 Ga0207695_10035687 3300025913 Bacteria 5387
179 Ga0207671_10016997 3300025914 Bacteria 5630
180 Ga0207693_10008179 3300025915 Bacteria 8569
181 Ga0207663_10028587 3300025916 Bacteria 3265
182 Ga0207663_10111602 3300025916 Bacteria 1856
183 Ga0207663_10145865 3300025916 Bacteria 1654
184 Ga0207660_10020110 3300025917 Bacteria 4477
185 Ga0207660_10092897 3300025917 Bacteria 2240
186 Ga0207657_10006063 3300025919 Bacteria 12571
187 Ga0207652_10009418 3300025921 Bacteria 7854
188 Ga0207681_10048754 3300025923 Bacteria 2860
189 Ga0207694_10000347 3300025924 Bacteria 43770
190 Ga0207694_10046201 3300025924 Bacteria 3365
191 Ga0207694_10056360 3300025924 Bacteria 3052
192 Ga0207650_10096336 3300025925 Bacteria 2270
193 Ga0207687_10073302 3300025927 Bacteria 2451
194 Ga0207664_10044500 3300025929 Bacteria 3476
195 Ga0207664_10059216 3300025929 Bacteria 3049
196 Ga0207644_10031587 3300025931 Bacteria 3691
197 Ga0207669_10014040 3300025937 Bacteria 4003
198 Ga0207704_10078578 3300025938 Bacteria 2123
199 Ga0207665_10005475 3300025939 Bacteria 8475
200 Ga0207711_10025944 3300025941 Bacteria 4915
201 Ga0207661_10000647 3300025944 Bacteria 22491
202 Ga0207661_10161451 3300025944 Bacteria 1944
203 Ga0207667_10050734 3300025949 Bacteria 4377
204 Ga0207667_10257860 3300025949 Bacteria 1783
205 Ga0207668_10074081 3300025972 Bacteria 2442
206 Ga0207640_10017736 3300025981 Bacteria 4171
207 Ga0207640_10086180 3300025981 Bacteria 2162
208 Ga0207677_10021930 3300026023 Bacteria 3915
209 Ga0207703_10088661 3300026035 Bacteria 2597
210 Ga0207678_10015346 3300026067 Bacteria 6738
211 Ga0207678_10039799 3300026067 Bacteria 4078
212 Ga0207678_10078914 3300026067 Bacteria 2819
213 Ga0207678_10089106 3300026067 Bacteria 2637
214 Ga0207678_10097100 3300026067 Bacteria 2518
215 Ga0207708_10048033 3300026075 Bacteria 3248
216 Ga0207702_10000002 3300026078 Bacteria 491507
217 Ga0207702_10000243 3300026078 Bacteria 63718
218 Ga0207702_10011407 3300026078 Bacteria 7409
219 Ga0207702_10191830 3300026078 Bacteria 1888
220 Ga0207674_10003854 3300026116 Bacteria 18276
221 Ga0207674_10009561 3300026116 Bacteria 11063
222 Ga0207675_100029871 3300026118 Bacteria 5074
223 Ga0207675_100048223 3300026118 Bacteria 3977
224 Ga0207675_100130941 3300026118 Bacteria 2379
225 Ga0207683_10046044 3300026121 Bacteria 3815
226 Ga0207683_10070990 3300026121 Bacteria 3078
227 Ga0207698_10026014 3300026142 Bacteria 4134
228 Ga0209389_1000001 3300027296 Bacteria 463799
229 Ga0209389_1000134 3300027296 Bacteria 65168
230 Ga0209589_1000014 3300027357 Bacteria 227996
231 Ga0209589_1000033 3300027357 Bacteria 140561
232 Ga0209489_100014 3300027361 Bacteria 227996
233 Ga0209489_100040 3300027361 Bacteria 164986
234 Ga0209489_119453 3300027361 Bacteria 2265
235 Ga0209489_119748 3300027361 Bacteria 2139
236 Ga0209700_100007 3300027363 Bacteria 454608
237 Ga0209700_100024 3300027363 Bacteria 227996
238 Ga0268266_10036645 3300028379 Bacteria 4176
239 Ga0268266_10073800 3300028379 Bacteria 2961
240 Ga0268266_10105326 3300028379 Bacteria 2491
241 Ga0268265_10069583 3300028380 Bacteria 2733
242 Ga0268264_10000048 3300028381 Bacteria 334457
243 Ga0265337_1009505 3300028556 Bacteria 3467
244 Ga0265326_10016163 3300028558 Bacteria 2158
245 Ga0265319_1005194 3300028563 Bacteria 6291
246 Ga0265334_10003849 3300028573 Bacteria 6776
247 Ga0265323_10001021 3300028653 Bacteria 14579
248 Ga0265336_10000397 3300028666 Bacteria 27403
249 Ga0307517_10001507 3300028786 Bacteria 38891
250 Ga0307515_10056013 3300028794 Bacteria 5742
251 Ga0265338_10000034 3300028800 Bacteria 244623
252 Ga0265325_10015311 3300031241 Bacteria 4315
253 Ga0265340_10001084 3300031247 Bacteria 15490
254 Ga0265339_10020405 3300031249 Bacteria 3872
255 Ga0265331_10016991 3300031250 Bacteria 3806
256 Ga0307509_10143252 3300031507 Bacteria 2320
257 Ga0307508_10000249 3300031616 Bacteria 65482
258 Ga0307508_10107568 3300031616 Bacteria 2388
259 Ga0265314_10014031 3300031711 Bacteria 6439
260 Ga0265342_10003896 3300031712 Bacteria 11989
261 Ga0307516_10005695 3300031730 Bacteria 14770
262 Ga0307516_10055077 3300031730 Bacteria 3884
263 Ga0307516_10089715 3300031730 Bacteria 2904
264 Ga0307405_10047565 3300031731 Bacteria 2642
265 Ga0307405_10105036 3300031731 Bacteria 1902
266 Ga0307507_10080724 3300033179 Bacteria 2866
267 Ga0307510_10008055 3300033180 Bacteria 12542
268 Ga0307510_10017631 3300033180 Bacteria 8416
269 Ga0307510_10024060 3300033180 Bacteria 7044
270 Ga0307510_10133015 3300033180 Bacteria 2153
271 Ga0315911_1000002 3300033442 Bacteria 926833
272 Ga0373926_0004912 3300035083 Bacteria 4391
273 Ga0373923_0006495 3300035111 Bacteria 4047
274 Ga0373936_0006011 3300035113 Bacteria 4575
275 Ga0373945_0005674 3300035116 Bacteria 4002
276 Ga0373954_0007067 3300035118 Bacteria 4899
277 Ga0373943_0008537 3300035170 Bacteria 4593
278 Ga0373946_0002265 3300035171 Bacteria 6795
279 Ga0373946_0013981 3300035171 Bacteria 3022
280 Ga0373955_0005896 3300035172 Bacteria 5539
281 Ga0373935_0000681 3300035692 Bacteria 17958
282 Ga0373935_0028648 3300035692 Bacteria 3442
283 Ga0373927_0000985 3300035695 Bacteria 21674
284 Ga0373927_0002439 3300035695 Bacteria 13560
285 Ga0373927_0031836 3300035695 Bacteria 3435
286 Ga0373933_0001176 3300035724 Bacteria 15509
287 Ga0373947_0000118 3300035725 Bacteria 39817
288 Ga0373947_0025523 3300035725 Bacteria 3447
289 Ga0373937_0069070 3300036401 Bacteria 3257
290 Ga0373937_0130575 3300036401 Bacteria 2346
291 Ga0373925_0001151 3300037068 Bacteria 23461
292 Ga0373925_0093688 3300037068 Bacteria 2299
293 Ga0395899_0056072 3300037312 Bacteria 2913
294 Ga0395900_0001529 3300037418 Bacteria 27494
295 Ga0395900_0083776 3300037418 Bacteria 3276
296 Ga0395898_0014173 3300037466 Bacteria 8198
297 Ga0395898_0042524 3300037466 Bacteria 4482
298 Ga0395905_0009682 3300037471 Bacteria 9408
299 Ga0395905_0014127 3300037471 Bacteria 7631
300 Ga0436364_1112623 3300037853 Bacteria 2676
301 Ga0395901_0011625 3300038443 Bacteria 8916
302 Ga0395901_0109013 3300038443 Bacteria 2907
303 Ga0395901_0140309 3300038443 Bacteria 2540
304 Ga0436365_0191965 3300039437 Bacteria 59780
305 Ga0436363_0996694 3300039450 Bacteria 4547
306 Ga0439465_0005851 3300041413 Bacteria 3913
307 Ga0466969_0022064 3300044656 Bacteria 3290
308 Ga0466972_0000200 3300044658 Bacteria 43953
309 Ga0466965_0076660 3300044683 Bacteria 1687
310 Ga0466961_0000050 3300044693 Bacteria 71289
311 Ga0466961_0076880 3300044693 Bacteria 2115
312 Ga0466963_0014914 3300044694 Bacteria 4802
313 Ga0466964_0038812 3300044706 Bacteria 1916
314 Ga0466957_0017874 3300044842 Bacteria 4160
315 Ga0466957_0045999 3300044842 Bacteria 2648
316 Ga0466959_0003216 3300045049 Bacteria 10627
317 Ga0466959_0063305 3300045049 Bacteria 2686
318 Ga0466967_0006745 3300045976 Bacteria 8170
319 Ga0466967_0077106 3300045976 Bacteria 2999
320 Ga0495592_0028302 3300046454 Bacteria 4245
321 Ga0495592_0033732 3300046454 Bacteria 3860
322 Ga0495603_0000053 3300046455 Bacteria 49373
323 Ga0495603_0011237 3300046455 Bacteria 5423
324 Ga0495603_0014491 3300046455 Bacteria 4768
325 Ga0495629_0008916 3300046459 Bacteria 7373
326 Ga0495629_0018227 3300046459 Bacteria 5028
327 Ga0495629_0045223 3300046459 Bacteria 3089
328 Ga0495629_0085573 3300046459 Bacteria 2200
329 Ga0495638_0001532 3300046460 Bacteria 20807
330 Ga0495638_0051184 3300046460 Bacteria 2576
331 Ga0495638_0060740 3300046460 Bacteria 2336
332 Ga0495638_0086418 3300046460 Bacteria 1895
333 Ga0495641_0010050 3300046461 Bacteria 5546
334 Ga0495651_0001520 3300046462 Bacteria 17929
335 Ga0495651_0050024 3300046462 Bacteria 3225
336 Ga0495651_0051215 3300046462 Bacteria 3185
337 Ga0495651_0067192 3300046462 Bacteria 2735
338 Ga0495651_0095975 3300046462 Bacteria 2216
339 Ga0495653_0057882 3300046463 Bacteria 2948
340 Ga0495580_0001877 3300046472 Bacteria 18497
341 Ga0495582_0000186 3300046473 Bacteria 34006
342 Ga0495639_0000078 3300046475 Bacteria 46048
343 Ga0495639_0022927 3300046475 Bacteria 2741
344 Ga0495662_0001326 3300046476 Bacteria 12264
345 Ga0495664_0008167 3300046477 Bacteria 5830
346 Ga0495664_0011159 3300046477 Bacteria 5057
347 Ga0495594_0000103 3300046499 Bacteria 39690
348 Ga0495594_0030010 3300046499 Bacteria 2940
349 Ga0495583_0040787 3300046506 Bacteria 2178
350 Ga0495606_0004866 3300046507 Bacteria 13163
351 Ga0495608_0017545 3300046511 Bacteria 4950
352 Ga0495608_0031044 3300046511 Bacteria 3614
353 Ga0495618_0117514 3300046514 Bacteria 1703
354 Ga0495618_0120901 3300046514 Bacteria 1677
355 Ga0495628_0014211 3300046516 Bacteria 6682
356 Ga0495630_0003505 3300046517 Bacteria 10910
357 Ga0495630_0153994 3300046517 Bacteria 1749
358 Ga0495631_0042068 3300046518 Bacteria 2020
359 Ga0495631_0043587 3300046518 Bacteria 1979
360 Ga0495643_0099939 3300046522 Bacteria 1488
361 Ga0495644_0026973 3300046523 Bacteria 2178
362 Ga0495648_0002554 3300046524 Bacteria 16674
363 Ga0495648_0007789 3300046524 Bacteria 8521
364 Ga0495648_0024700 3300046524 Bacteria 4084
365 Ga0495666_0093854 3300046526 Bacteria 1415
366 Ga0495652_0004137 3300046529 Bacteria 13996
367 Ga0495652_0131261 3300046529 Bacteria 1983
368 Ga0495652_0166790 3300046529 Bacteria 1704
369 Ga0495665_0000190 3300046531 Bacteria 31563
370 Ga0495640_0001905 3300046533 Bacteria 16627
371 Ga0495640_0087702 3300046533 Bacteria 2057
372 Ga0495622_0005230 3300046557 Bacteria 6015
373 Ga0495622_0015848 3300046557 Bacteria 3505
374 Ga0495667_0006001 3300046559 Bacteria 8214
375 Ga0495667_0009435 3300046559 Bacteria 6611
376 Ga0495656_0060531 3300046615 Bacteria 1651
377 Ga0495634_0001169 3300046642 Bacteria 24315
378 Ga0495634_0064194 3300046642 Bacteria 2435
379 Ga0495625_0053578 3300046660 Bacteria 2884
380 Ga0495635_0000211 3300046663 Bacteria 36892
381 Ga0495635_0000985 3300046663 Bacteria 18760
382 Ga0495635_0015479 3300046663 Bacteria 5332
383 Ga0495588_0001447 3300046674 Bacteria 10166
384 Ga0495588_0033733 3300046674 Bacteria 2586
385 Ga0495588_0054544 3300046674 Bacteria 2062
386 Ga0495657_0000889 3300046675 Bacteria 26346
387 Ga0495657_0013750 3300046675 Bacteria 5959
388 Ga0495599_0000957 3300046678 Bacteria 16146
389 Ga0495599_0083621 3300046678 Bacteria 1993
390 Ga0495623_0005834 3300046679 Bacteria 8030
391 Ga0495623_0005846 3300046679 Bacteria 8019
392 Ga0495646_0022073 3300046680 Bacteria 4018
393 Ga0495647_0028522 3300046681 Bacteria 2058
394 Ga0495658_0000108 3300046683 Bacteria 43771
395 Ga0495658_0013308 3300046683 Bacteria 4186
396 Ga0495669_0001878 3300046684 Bacteria 8615
397 Ga0495613_0010887 3300046689 Bacteria 6750
398 Ga0495613_0105927 3300046689 Bacteria 2029
399 Ga0495624_0003469 3300046690 Bacteria 11689
400 Ga0495600_0001856 3300046809 Bacteria 11854
401 Ga0495600_0009971 3300046809 Bacteria 5886
402 Ga0495600_0036170 3300046809 Bacteria 3208
403 Ga0495581_0000501 3300047315 Bacteria 20012
404 Ga0495581_0013051 3300047315 Bacteria 4815
405 Ga0495581_0127441 3300047315 Bacteria 1482
406 Ga0495604_0015222 3300047317 Bacteria 6139
407 Ga0495604_0025993 3300047317 Bacteria 4662
408 Ga0495674_0000228 3300047319 Bacteria 46998
409 Ga0495674_0008379 3300047319 Bacteria 9850
410 Ga0495674_0070755 3300047319 Bacteria 3014
411 Ga0495672_0011909 3300047320 Bacteria 6101
412 Ga0495676_0152454 3300047321 Bacteria 1643
413 Ga0495680_0002530 3300047322 Bacteria 18695
414 Ga0495673_0012247 3300047469 Bacteria 4561
415 Ga0495684_0018149 3300047471 Bacteria 5422
416 Ga0495684_0143545 3300047471 Bacteria 1789
417 Ga0495686_0008845 3300047472 Bacteria 7331
418 Ga0495593_0002763 3300047673 Bacteria 10557
419 Ga0495593_0056534 3300047673 Bacteria 2062
420 Ga0495593_0084435 3300047673 Bacteria 1639
421 Ga0495602_0003401 3300048088 Bacteria 16456
422 Ga0496100_0041350 3300048903 Bacteria 2938
423 Ga0496101_0039152 3300048904 Bacteria 3370
424 Ga0496101_0081029 3300048904 Bacteria 2399
425 Ga0496102_0008501 3300048905 Bacteria 8801
426 Ga0496103_0016380 3300048906 Bacteria 4423
427 Ga0496103_0157513 3300048906 Bacteria 1456
428 Ga0496104_0000281 3300048907 Bacteria 45166
429 Ga0496104_0005754 3300048907 Bacteria 10852
430 Ga0496104_0008421 3300048907 Bacteria 9169
431 Ga0496104_0025549 3300048907 Bacteria 5446
432 Ga0496105_0011220 3300048908 Bacteria 7069
433 Ga0496105_0043844 3300048908 Bacteria 3689
434 Ga0496106_0005076 3300048909 Bacteria 9744
435 Ga0496106_0131349 3300048909 Bacteria 1964
436 Ga0496107_0070819 3300048910 Bacteria 2533
437 Ga0496108_0000845 3300048911 Bacteria 23854
438 Ga0496109_0000592 3300048912 Bacteria 30336
439 Ga0496109_0298042 3300048912 Bacteria 1520
440 Ga0496110_0011293 3300048913 Bacteria 7302
441 Ga0496110_0023231 3300048913 Bacteria 5272
442 Ga0496110_0245293 3300048913 Bacteria 1630
443 Ga0496111_0031284 3300048914 Bacteria 3791
444 Ga0496112_0000017 3300048915 Bacteria 191284
445 Ga0496112_0001178 3300048915 Bacteria 19598
446 Ga0496112_0079384 3300048915 Bacteria 3246
447 Ga0496113_0011677 3300048916 Bacteria 5875
448 Ga0496113_0053320 3300048916 Bacteria 3024
449 Ga0496115_0022242 3300048918 Bacteria 4910
450 Ga0496116_0022752 3300048919 Bacteria 4687
451 Ga0496116_0054476 3300048919 Bacteria 2635
452 Ga0496116_0130238 3300048919 Bacteria 1436
453 Ga0496117_0132713 3300048920 Bacteria 1506
454 Ga0496118_0003113 3300048921 Bacteria 21268
455 Ga0496118_0053861 3300048921 Bacteria 3052
456 Ga0496118_0126482 3300048921 Bacteria 1652
457 Ga0496119_0005325 3300048922 Bacteria 12378
458 Ga0496119_0049769 3300048922 Bacteria 2588
459 Ga0496120_0001511 3300048923 Bacteria 27505
460 Ga0496120_0055680 3300048923 Bacteria 2235
461 Ga0496121_0000886 3300048924 Bacteria 54049
462 Ga0496121_0002017 3300048924 Bacteria 32207
463 Ga0496121_0002694 3300048924 Bacteria 26563
464 Ga0496121_0013709 3300048924 Bacteria 8688
465 Ga0496121_0017276 3300048924 Bacteria 7381
466 Ga0496121_0026234 3300048924 Bacteria 5498
467 Ga0496121_0041651 3300048924 Bacteria 4011
468 Ga0496121_0042521 3300048924 Bacteria 3950
469 Ga0496121_0056125 3300048924 Bacteria 3274
470 Ga0496121_0081237 3300048924 Bacteria 2566
471 Ga0496122_0014132 3300048925 Bacteria 7742
472 Ga0496122_0079207 3300048925 Bacteria 2297
473 Ga0496123_0068394 3300048926 Bacteria 2237
474 Ga0496124_0096800 3300048927 Bacteria 2397
475 Ga0496125_0000040 3300048928 Bacteria 314478
476 Ga0496125_0002027 3300048928 Bacteria 27438
477 Ga0496125_0005006 3300048928 Bacteria 14960
478 Ga0496125_0054179 3300048928 Bacteria 3280
479 Ga0496126_0008257 3300048929 Bacteria 11246
480 Ga0496126_0017486 3300048929 Bacteria 7141
481 Ga0496126_0025006 3300048929 Bacteria 5755
482 Ga0496126_0028691 3300048929 Bacteria 5299
483 Ga0496126_0046030 3300048929 Bacteria 4006
484 Ga0496126_0058006 3300048929 Bacteria 3491
485 Ga0496126_0062123 3300048929 Bacteria 3353
486 Ga0496126_0121969 3300048929 Bacteria 2259
487 Ga0496126_0205544 3300048929 Bacteria 1660
488 Ga0501031_0010139 3300049568 Bacteria 6140
489 Ga0501032_0007050 3300049569 Bacteria 8245
490 Ga0501032_0027533 3300049569 Bacteria 3906
491 Ga0501032_0113009 3300049569 Bacteria 1796
492 Ga0501032_0123021 3300049569 Bacteria 1714
493 Ga0501033_0000250 3300049570 Bacteria 51978
494 Ga0501033_0000553 3300049570 Bacteria 34827
495 Ga0501033_0050247 3300049570 Bacteria 3094
496 Ga0501034_0000892 3300049571 Bacteria 43725
497 Ga0501036_0000267 3300049572 Bacteria 35613
498 Ga0501036_0016285 3300049572 Bacteria 6211
499 Ga0501036_0065694 3300049572 Bacteria 3069
500 Ga0501037_0000257 3300049573 Bacteria 45676
501 Ga0501037_0006617 3300049573 Bacteria 8472
502 Ga0501038_0001535 3300049574 Bacteria 21306
503 Ga0501038_0004912 3300049574 Bacteria 12421
504 Ga0501038_0014599 3300049574 Bacteria 7158
505 Ga0501038_0059534 3300049574 Bacteria 3271
506 Ga0501039_0000488 3300049575 Bacteria 28748
507 Ga0501039_0002930 3300049575 Bacteria 12771
508 Ga0501042_0021357 3300049578 Bacteria 4511
509 Ga0501042_0025726 3300049578 Bacteria 4135
510 Ga0501043_0001660 3300049579 Bacteria 19307
511 Ga0501043_0003909 3300049579 Bacteria 12219
512 Ga0501043_0005331 3300049579 Bacteria 10393
513 Ga0501043_0006924 3300049579 Bacteria 9041
514 Ga0501043_0101724 3300049579 Bacteria 2258
515 Ga0501046_0006487 3300049580 Bacteria 10349
516 Ga0501046_0024923 3300049580 Bacteria 4900
517 Ga0501046_0039030 3300049580 Bacteria 3806
518 Ga0501046_0081404 3300049580 Bacteria 2500
519 Ga0501047_0000123 3300049581 Bacteria 95016
520 Ga0501047_0019457 3300049581 Bacteria 6512
521 Ga0501048_0000108 3300049582 Bacteria 46455
522 Ga0501048_0092763 3300049582 Bacteria 2130
523 Ga0501067_0000267 3300049583 Bacteria 28494
524 Ga0501068_0007488 3300049584 Bacteria 6042
525 Ga0501068_0112976 3300049584 Bacteria 1690
526 Ga0501069_0002404 3300049585 Bacteria 9510
527 Ga0501069_0075288 3300049585 Bacteria 1896
528 Ga0501070_0016149 3300049586 Bacteria 6275
529 Ga0501070_0024041 3300049586 Bacteria 5109
530 Ga0501071_0041215 3300049587 Bacteria 3307
531 Ga0501072_0000898 3300049588 Bacteria 21826
532 Ga0501073_0000014 3300049589 Bacteria 159719
533 Ga0501073_0008879 3300049589 Bacteria 7430
534 Ga0501074_0009185 3300049590 Bacteria 7181
535 Ga0501076_0165258 3300049592 Bacteria 1804
536 Ga0501080_0018899 3300049742 Bacteria 6381
537 Ga0501080_0031341 3300049742 Bacteria 4954
538 Ga0501080_0204945 3300049742 Bacteria 1809
539 Ga0501083_0000289 3300049744 Bacteria 31855
540 Ga0501083_0018277 3300049744 Bacteria 4886
541 Ga0501035_0000608 3300049822 Bacteria 39520
542 Ga0501035_0115601 3300049822 Bacteria 2348
543 Ga0501035_0143976 3300049822 Bacteria 2071
544 Ga0501044_0000344 3300049823 Bacteria 58547
545 Ga0501044_0070406 3300049823 Bacteria 3557
546 Ga0501044_0146266 3300049823 Bacteria 2348
547 Ga0501045_0005228 3300049824 Bacteria 8978
548 nmdc:mga06z11_1297_c1 3300050494 Bacteria 9247
549 nmdc:mga06z11_53375_c1 3300050494 Bacteria 2079
550 nmdc:mga05p37_52659_c1 3300050507 Bacteria 5004
551 nmdc:mga08y16_65892_c1 3300050511 Bacteria 3780
552 nmdc:mga0rr50_165411_c1 3300050513 Bacteria 1798
553 nmdc:mga0sz30_43742_c1 3300050516 Bacteria 1886
554 Ga0495612_0023374 3300053078 Bacteria 2480
555 Ga0500635_0003054 3300053080 Bacteria 4182
556 Ga0495595_0079663 3300053084 Bacteria 1558
557 Ga0495619_0014968 3300053085 Bacteria 4901
558 Ga0495619_0061030 3300053085 Bacteria 2507
559 Ga0500643_000319 3300053087 Bacteria 38698
560 Ga0500646_0007605 3300053090 Bacteria 2769
561 Ga0500583_0026742 3300053092 Bacteria 2482
562 Ga0500651_0001711 3300053093 Bacteria 11216
563 Ga0500566_0000117 3300053094 Bacteria 41371
564 Ga0500566_0001715 3300053094 Bacteria 12869
565 Ga0500640_000141 3300053095 Bacteria 13874
566 Ga0500641_0059093 3300053096 Bacteria 1593
567 Ga0500641_0067055 3300053096 Bacteria 1503
568 Ga0500554_000617 3300053102 Bacteria 7222
569 Ga0500555_003231 3300053103 Bacteria 4642
570 Ga0500556_0000002 3300053104 Bacteria 773626
571 Ga0500556_0009163 3300053104 Bacteria 2870
572 Ga0500557_000162 3300053105 Bacteria 14804
573 Ga0500572_000828 3300053111 Bacteria 9757
574 Ga0500572_001082 3300053111 Bacteria 8023
575 Ga0500592_007011 3300053116 Bacteria 1792
576 Ga0500595_001406 3300053119 Bacteria 12911
577 Ga0500595_001750 3300053119 Bacteria 11313
578 Ga0500595_023301 3300053119 Bacteria 2178
579 Ga0500608_043407 3300053122 Bacteria 2159
580 Ga0500614_000264 3300053123 Bacteria 13542
581 Ga0500618_003608 3300053125 Bacteria 5251
582 Ga0500642_0000057 3300053130 Bacteria 67011
583 Ga0500642_0000876 3300053130 Bacteria 8748
584 Ga0500652_000965 3300053131 Bacteria 9504
585 Ga0500658_0035161 3300053134 Bacteria 1981
586 Ga0500559_0000242 3300053136 Bacteria 43285
587 Ga0500559_0002978 3300053136 Bacteria 8498
588 Ga0500559_0012427 3300053136 Bacteria 3618
589 Ga0500568_0001500 3300053139 Bacteria 14911
590 Ga0500568_0013309 3300053139 Bacteria 3752
591 Ga0500568_0024271 3300053139 Bacteria 2569
592 Ga0500577_0000095 3300053142 Bacteria 21049
593 Ga0500586_019666 3300053145 Bacteria 2103
594 Ga0500590_035432 3300053148 Bacteria 2583
595 Ga0500603_000306 3300053150 Bacteria 12834
596 Ga0500603_000586 3300053150 Bacteria 9099
597 Ga0500604_0003637 3300053151 Bacteria 4145
598 Ga0500616_0000031 3300053153 Bacteria 415013
599 Ga0500616_0000034 3300053153 Bacteria 396651
600 Ga0500622_0005168 3300053156 Bacteria 7911
601 Ga0500622_0042459 3300053156 Bacteria 2362
602 Ga0500630_000221 3300053159 Bacteria 22394
603 Ga0500639_000041 3300053163 Bacteria 61893
604 Ga0500636_0000614 3300053177 Bacteria 19317
605 Ga0500636_0082173 3300053177 Bacteria 1854
606 Ga0500637_0000282 3300053178 Bacteria 18981
607 Ga0500637_0076481 3300053178 Bacteria 1930
608 Ga0500570_065323 3300053724 Bacteria 1734
609 Ga0500576_041784 3300053725 Bacteria 2061
610 Ga0500625_001494 3300053729 Bacteria 8078
611 Ga0500645_006818 3300053730 Bacteria 4037
612 Ga0500645_019623 3300053730 Bacteria 2101
613 Ga0500609_004321 3300053731 Bacteria 1970
614 Ga0500596_001100 3300053735 Bacteria 5443
615 Ga0500599_000137 3300053736 Bacteria 6696
616 Ga0500601_000052 3300053737 Bacteria 24522
617 Ga0500601_002092 3300053737 Bacteria 2141
618 Ga0501084_0001855 3300054114 Bacteria 16855
619 Ga0500661_000108 3300055283 Bacteria 13387
620 Ga0501082_0006680 3300060353 Bacteria 9981
621 Ga0501082_0085494 3300060353 Bacteria 2720
622 Ga0466962_0038186 3300061719 Bacteria 2300

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0040787 Ga0495583_0040787_22_1188 351
2 iso_pu_bacteria 2824704595 2824714581 365
3 3300053725 Ga0500576_041784 Ga0500576_041784_11_1213 377
4 iso_pu_bacteria 2824661429 2824671226 378
5 iso_pu_bacteria 2824644064 2824652921 379
6 iso_pu_bacteria 2824714736 2824723674 382
7 iso_pu_bacteria 2824723954 2824732780 384
8 3300049584 Ga0501068_0112976 Ga0501068_0112976_41_1345 387
9 iso_pu_bacteria 2824635225 2824643956 388
10 3300050494 nmdc:mga06z11_1297_c1 nmdc:mga06z11_1297_c1_2016_3389 389
11 iso_pu_bacteria 2824653114 2824661363 389
12 3300009545 Ga0105237_10025027 Ga0105237_100250276 390
13 3300047471 Ga0495684_0018149 Ga0495684_0018149_4172_5410 390
14 3300025914 Ga0207671_10016997 Ga0207671_100169976 392
15 3300053125 Ga0500618_003608 Ga0500618_003608_1541_2911 394
16 3300053177 Ga0500636_0000614 Ga0500636_0000614_2761_4131 394
17 3300031712 Ga0265342_10003896 Ga0265342_100038968 398
18 3300049585 Ga0501069_0075288 Ga0501069_0075288_72_1445 399
19 iso_pu_bacteria 2824617872 2824621915 399
20 3300006178 Ga0075367_10001858 Ga0075367_100018586 400
21 3300053142 Ga0500577_0000095 Ga0500577_0000095_15596_16966 400
22 iso_pu_bacteria 2903768456 2903775891 400
23 iso_pu_bacteria 2885383462 2885388296 401
24 3300025297 Ga0209758_1027110 Ga0209758_10271103 402
25 3300033180 Ga0307510_10133015 Ga0307510_101330152 402
26 3300013104 Ga0157370_10188643 Ga0157370_101886431 403
27 3300037471 Ga0395905_0009682 Ga0395905_0009682_1377_2747 403
28 3300048910 Ga0496107_0070819 Ga0496107_0070819_641_2005 403
29 3300048924 Ga0496121_0002694 Ga0496121_0002694_2614_3978 403
30 3300048929 Ga0496126_0062123 Ga0496126_0062123_1235_2599 403
31 3300053145 Ga0500586_019666 Ga0500586_019666_286_1890 403
32 3300053156 Ga0500622_0042459 Ga0500622_0042459_589_1959 403
33 3300053177 Ga0500636_0082173 Ga0500636_0082173_408_1781 403
34 3300053736 Ga0500599_000137 Ga0500599_000137_2716_4086 403
35 3300025929 Ga0207664_10059216 Ga0207664_100592162 404
36 3300033180 Ga0307510_10017631 Ga0307510_100176314 404
37 3300046507 Ga0495606_0004866 Ga0495606_0004866_7983_9383 404
38 3300053116 Ga0500592_007011 Ga0500592_007011_274_1644 404
39 3300005985 Ga0081539_10087132 Ga0081539_100871321 405
40 3300009551 Ga0105238_10051276 Ga0105238_100512763 405
41 3300025924 Ga0207694_10056360 Ga0207694_100563603 405
42 3300046460 Ga0495638_0001532 Ga0495638_0001532_6668_8038 405
43 3300053130 Ga0500642_0000057 Ga0500642_0000057_21720_23090 405
44 3300053729 Ga0500625_001494 Ga0500625_001494_1095_2465 405
45 3300031507 Ga0307509_10143252 Ga0307509_101432521 406
46 3300049587 Ga0501071_0041215 Ga0501071_0041215_12_1316 406
47 3300004625 Ga0055543_1003802 Ga0055543_10038023 407
48 3300005262 Ga0065165_1002181 Ga0065165_10021814 407
49 3300007265 Ga0099794_10058269 Ga0099794_100582692 407
50 3300025302 Ga0207426_1020516 Ga0207426_10205162 407
51 3300006038 Ga0075365_10128669 Ga0075365_101286691 408
52 3300046518 Ga0495631_0043587 Ga0495631_0043587_348_1718 408
53 3300046660 Ga0495625_0053578 Ga0495625_0053578_352_1722 408
54 3300048921 Ga0496118_0126482 Ga0496118_0126482_230_1600 408
55 3300048928 Ga0496125_0005006 Ga0496125_0005006_1519_2889 408
56 3300049568 Ga0501031_0010139 Ga0501031_0010139_4109_5476 408
57 3300049569 Ga0501032_0027533 Ga0501032_0027533_2341_3708 408
58 3300049570 Ga0501033_0000250 Ga0501033_0000250_45742_47109 408
59 3300049572 Ga0501036_0065694 Ga0501036_0065694_34_1401 408
60 3300049573 Ga0501037_0006617 Ga0501037_0006617_2540_3907 408
61 3300049575 Ga0501039_0002930 Ga0501039_0002930_6696_8063 408
62 3300049578 Ga0501042_0025726 Ga0501042_0025726_1503_2870 408
63 3300049579 Ga0501043_0001660 Ga0501043_0001660_15051_16418 408
64 3300049580 Ga0501046_0081404 Ga0501046_0081404_757_2124 408
65 3300005983 Ga0081540_1006111 Ga0081540_10061112 409
66 3300006038 Ga0075365_10032771 Ga0075365_100327711 409
67 3300046459 Ga0495629_0085573 Ga0495629_0085573_99_1394 409
68 iso_pu_bacteria 8006994254 8006994814 409
69 3300005366 Ga0070659_100171022 Ga0070659_1001710222 410
70 3300005563 Ga0068855_100094442 Ga0068855_1000944424 410
71 3300005616 Ga0068852_100016848 Ga0068852_1000168484 410
72 3300035724 Ga0373933_0001176 Ga0373933_0001176_9534_10904 410
73 3300046524 Ga0495648_0002554 Ga0495648_0002554_14633_16003 410
74 3300046524 Ga0495648_0024700 Ga0495648_0024700_871_2241 411
75 3300048919 Ga0496116_0022752 Ga0496116_0022752_490_1860 411
76 3300048921 Ga0496118_0053861 Ga0496118_0053861_1160_2530 411
77 3300048927 Ga0496124_0096800 Ga0496124_0096800_685_2055 411
78 3300053156 Ga0500622_0005168 Ga0500622_0005168_5914_7284 411
79 3300053730 Ga0500645_019623 Ga0500645_019623_719_2089 411
80 3300005614 Ga0068856_100005538 Ga0068856_1000055384 412
81 3300006175 Ga0070712_100093737 Ga0070712_1000937372 412
82 3300025915 Ga0207693_10008179 Ga0207693_100081792 412
83 3300026078 Ga0207702_10191830 Ga0207702_101918302 412
84 3300049580 Ga0501046_0039030 Ga0501046_0039030_368_1735 412
85 3300049742 Ga0501080_0031341 Ga0501080_0031341_3195_4562 412
86 3300053724 Ga0500570_065323 Ga0500570_065323_25_1395 412
87 3300005455 Ga0070663_100014414 Ga0070663_1000144144 413
88 3300006038 Ga0075365_10119454 Ga0075365_101194541 413
89 3300006847 Ga0075431_100212076 Ga0075431_1002120762 413
90 3300026067 Ga0207678_10015346 Ga0207678_100153466 413
91 3300046522 Ga0495643_0099939 Ga0495643_0099939_70_1467 413
92 3300048923 Ga0496120_0055680 Ga0496120_0055680_23_1393 413
93 3300053130 Ga0500642_0000876 Ga0500642_0000876_665_2035 413
94 3300053139 Ga0500568_0001500 Ga0500568_0001500_546_1916 413
95 3300053151 Ga0500604_0003637 Ga0500604_0003637_1160_2530 413
96 3300053153 Ga0500616_0000031 Ga0500616_0000031_3874_5244 413
97 3300006178 Ga0075367_10019050 Ga0075367_100190501 414
98 3300048924 Ga0496121_0013709 Ga0496121_0013709_640_2010 414
99 3300035118 Ga0373954_0007067 Ga0373954_0007067_12_1325 415
100 3300046454 Ga0495592_0028302 Ga0495592_0028302_437_1807 415
101 3300046462 Ga0495651_0001520 Ga0495651_0001520_12704_14074 415
102 3300046511 Ga0495608_0017545 Ga0495608_0017545_1920_3290 415
103 3300046516 Ga0495628_0014211 Ga0495628_0014211_5182_6552 415
104 3300046529 Ga0495652_0004137 Ga0495652_0004137_7310_8680 415
105 3300046559 Ga0495667_0006001 Ga0495667_0006001_581_1951 415
106 3300046642 Ga0495634_0064194 Ga0495634_0064194_604_1974 415
107 3300046675 Ga0495657_0000889 Ga0495657_0000889_9199_10569 415
108 3300046678 Ga0495599_0083621 Ga0495599_0083621_251_1621 415
109 3300046679 Ga0495623_0005846 Ga0495623_0005846_1146_2516 415
110 3300046809 Ga0495600_0001856 Ga0495600_0001856_4403_5773 415
111 3300047319 Ga0495674_0008379 Ga0495674_0008379_2299_3669 415
112 3300047322 Ga0495680_0002530 Ga0495680_0002530_8751_10121 415
113 3300048088 Ga0495602_0003401 Ga0495602_0003401_9086_10456 415
114 3300005434 Ga0070709_10000376 Ga0070709_100003769 416
115 3300005435 Ga0070714_100071962 Ga0070714_1000719623 416
116 3300005437 Ga0070710_10000497 Ga0070710_100004977 416
117 3300005439 Ga0070711_100023752 Ga0070711_1000237521 416
118 3300005841 Ga0068863_100033056 Ga0068863_1000330563 416
119 3300006028 Ga0070717_10051048 Ga0070717_100510482 416
120 3300006173 Ga0070716_100045989 Ga0070716_1000459892 416
121 3300025230 Ga0209563_100727 Ga0209563_1007279 416
122 3300025253 Ga0209677_104304 Ga0209677_1043044 416
123 3300025898 Ga0207692_10000915 Ga0207692_100009152 416
124 3300025906 Ga0207699_10001327 Ga0207699_100013276 416
125 3300025916 Ga0207663_10145865 Ga0207663_101458651 416
126 3300025929 Ga0207664_10044500 Ga0207664_100445003 416
127 3300031616 Ga0307508_10107568 Ga0307508_101075681 416
128 3300041413 Ga0439465_0005851 Ga0439465_0005851_1752_3122 416
129 3300046460 Ga0495638_0060740 Ga0495638_0060740_557_1927 416
130 3300048924 Ga0496121_0042521 Ga0496121_0042521_82_1452 416
131 3300048925 Ga0496122_0079207 Ga0496122_0079207_487_1857 416
132 3300048926 Ga0496123_0068394 Ga0496123_0068394_729_2099 416
133 3300048929 Ga0496126_0058006 Ga0496126_0058006_1667_3037 416
134 3300053090 Ga0500646_0007605 Ga0500646_0007605_1006_2376 416
135 3300053094 Ga0500566_0001715 Ga0500566_0001715_3743_5113 416
136 3300005366 Ga0070659_100259197 Ga0070659_1002591971 417
137 3300026067 Ga0207678_10089106 Ga0207678_100891062 417
138 3300028379 Ga0268266_10036645 Ga0268266_100366453 417
139 3300003203 JGI25406J46586_10003494 JGI25406J46586_100034945 418
140 3300005437 Ga0070710_10093308 Ga0070710_100933081 418
141 3300005843 Ga0068860_100001652 Ga0068860_10000165219 418
142 3300005985 Ga0081539_10000341 Ga0081539_1000034144 418
143 3300006028 Ga0070717_10163017 Ga0070717_101630171 418
144 3300025898 Ga0207692_10075490 Ga0207692_100754901 418
145 3300025906 Ga0207699_10019793 Ga0207699_100197934 418
146 3300025916 Ga0207663_10028587 Ga0207663_100285871 418
147 3300028381 Ga0268264_10000048 Ga0268264_10000048158 418
148 3300047315 Ga0495581_0127441 Ga0495581_0127441_33_1358 418
149 3300048919 Ga0496116_0130238 Ga0496116_0130238_99_1424 418
150 3300013307 Ga0157372_10043633 Ga0157372_100436333 419
151 3300028556 Ga0265337_1009505 Ga0265337_10095052 419
152 3300028558 Ga0265326_10016163 Ga0265326_100161632 419
153 3300028563 Ga0265319_1005194 Ga0265319_10051944 419
154 3300028573 Ga0265334_10003849 Ga0265334_100038495 419
155 3300028653 Ga0265323_10001021 Ga0265323_100010218 419
156 3300028666 Ga0265336_10000397 Ga0265336_1000039724 419
157 3300028800 Ga0265338_10000034 Ga0265338_10000034102 419
158 3300031241 Ga0265325_10015311 Ga0265325_100153111 419
159 3300037418 Ga0395900_0083776 Ga0395900_0083776_1466_2839 419
160 3300046517 Ga0495630_0003505 Ga0495630_0003505_15_1340 419
161 3300053092 Ga0500583_0026742 Ga0500583_0026742_1010_2380 419
162 3300053096 Ga0500641_0059093 Ga0500641_0059093_120_1490 419
163 3300053103 Ga0500555_003231 Ga0500555_003231_583_1953 419
164 3300053139 Ga0500568_0024271 Ga0500568_0024271_117_1487 419
165 3300009094 Ga0111539_10091707 Ga0111539_100917073 420
166 3300021384 Ga0213876_10000898 Ga0213876_100008986 420
167 3300025910 Ga0207684_10086326 Ga0207684_100863262 420
168 3300039437 Ga0436365_0191965 Ga0436365_0191965_29290_30723 420
169 3300048924 Ga0496121_0081237 Ga0496121_0081237_429_1799 420
170 3300053136 Ga0500559_0012427 Ga0500559_0012427_1371_2741 420
171 3300005937 Ga0081455_10001359 Ga0081455_1000135922 421
172 3300006353 Ga0075370_10037604 Ga0075370_100376042 421
173 3300044656 Ga0466969_0022064 Ga0466969_0022064_1523_2893 421
174 3300044693 Ga0466961_0000050 Ga0466961_0000050_5381_6751 421
175 3300045049 Ga0466959_0003216 Ga0466959_0003216_492_1862 421
176 3300026121 Ga0207683_10046044 Ga0207683_100460442 422
177 3300031711 Ga0265314_10014031 Ga0265314_100140317 422
178 3300048928 Ga0496125_0000040 Ga0496125_0000040_122385_123755 422
179 3300005617 Ga0068859_100147849 Ga0068859_1001478492 423
180 3300006931 Ga0097620_100147857 Ga0097620_1001478572 423
181 3300025297 Ga0209758_1000530 Ga0209758_100053020 423
182 3300025302 Ga0207426_1000429 Ga0207426_100042920 423
183 3300031731 Ga0307405_10047565 Ga0307405_100475652 423
184 3300046518 Ga0495631_0042068 Ga0495631_0042068_152_1522 423
185 3300048922 Ga0496119_0049769 Ga0496119_0049769_313_1683 423
186 3300048924 Ga0496121_0017276 Ga0496121_0017276_4653_6017 423
187 3300048929 Ga0496126_0121969 Ga0496126_0121969_13_1383 423
188 3300050516 nmdc:mga0sz30_43742_c1 nmdc:mga0sz30_43742_c1_33_1403 423
189 3300005329 Ga0070683_100016132 Ga0070683_1000161323 424
190 3300005535 Ga0070684_100090204 Ga0070684_1000902042 424
191 3300025944 Ga0207661_10000647 Ga0207661_100006479 424
192 3300037471 Ga0395905_0014127 Ga0395905_0014127_1247_2617 424
193 3300048928 Ga0496125_0002027 Ga0496125_0002027_500_1870 424
194 3300049822 Ga0501035_0143976 Ga0501035_0143976_14_1387 424
195 3300053153 Ga0500616_0000034 Ga0500616_0000034_218396_219781 424
196 3300025901 Ga0207688_10049442 Ga0207688_100494422 425
197 3300031250 Ga0265331_10016991 Ga0265331_100169913 425
198 3300047472 Ga0495686_0008845 Ga0495686_0008845_4494_5861 425
199 3300048929 Ga0496126_0017486 Ga0496126_0017486_4498_5865 425
200 3300049569 Ga0501032_0123021 Ga0501032_0123021_301_1668 425
201 3300049574 Ga0501038_0014599 Ga0501038_0014599_4236_5603 425
202 3300053093 Ga0500651_0001711 Ga0500651_0001711_7139_8503 425
203 iso_pu_bacteria 2513237141 2513891366 425
204 3300005262 Ga0065165_1002644 Ga0065165_100264413 426
205 3300005367 Ga0070667_100101821 Ga0070667_1001018212 426
206 3300006942 Ga0099824_1015819 Ga0099824_10158194 426
207 3300025302 Ga0207426_1000998 Ga0207426_10009986 426
208 3300025904 Ga0207647_10118780 Ga0207647_101187801 426
209 3300025919 Ga0207657_10006063 Ga0207657_100060638 426
210 3300027296 Ga0209389_1000134 Ga0209389_100013432 426
211 3300027357 Ga0209589_1000033 Ga0209589_100003394 426
212 3300027361 Ga0209489_100040 Ga0209489_10004056 426
213 3300028379 Ga0268266_10105326 Ga0268266_101053263 426
214 3300035695 Ga0373927_0000985 Ga0373927_0000985_17863_19233 426
215 3300038443 Ga0395901_0109013 Ga0395901_0109013_1219_2592 426
216 3300046460 Ga0495638_0051184 Ga0495638_0051184_557_1927 426
217 3300048906 Ga0496103_0157513 Ga0496103_0157513_46_1416 426
218 3300049570 Ga0501033_0050247 Ga0501033_0050247_884_2251 426
219 3300049574 Ga0501038_0001535 Ga0501038_0001535_2151_3518 426
220 3300049574 Ga0501038_0059534 Ga0501038_0059534_1342_2709 426
221 3300049579 Ga0501043_0006924 Ga0501043_0006924_5467_6834 426
222 3300049579 Ga0501043_0101724 Ga0501043_0101724_478_1845 426
223 3300049581 Ga0501047_0019457 Ga0501047_0019457_4185_5552 426
224 3300049584 Ga0501068_0007488 Ga0501068_0007488_4620_5987 426
225 3300049589 Ga0501073_0008879 Ga0501073_0008879_4747_6114 426
226 3300049592 Ga0501076_0165258 Ga0501076_0165258_33_1400 426
227 3300053096 Ga0500641_0067055 Ga0500641_0067055_55_1425 426
228 3300053131 Ga0500652_000965 Ga0500652_000965_7474_8844 426
229 3300060353 Ga0501082_0085494 Ga0501082_0085494_1074_2441 426
230 3300005356 Ga0070674_100053656 Ga0070674_1000536563 427
231 3300005366 Ga0070659_100058474 Ga0070659_1000584743 427
232 3300005563 Ga0068855_100291560 Ga0068855_1002915601 427
233 3300005719 Ga0068861_100179594 Ga0068861_1001795942 427
234 3300009093 Ga0105240_10013705 Ga0105240_100137052 427
235 3300009098 Ga0105245_10141381 Ga0105245_101413812 427
236 3300009553 Ga0105249_10107809 Ga0105249_101078092 427
237 3300013105 Ga0157369_10004083 Ga0157369_1000408317 427
238 3300025297 Ga0209758_1005198 Ga0209758_10051983 427
239 3300025937 Ga0207669_10014040 Ga0207669_100140402 427
240 3300026075 Ga0207708_10048033 Ga0207708_100480332 427
241 3300026118 Ga0207675_100029871 Ga0207675_1000298713 427
242 3300044658 Ga0466972_0000200 Ga0466972_0000200_3580_4950 427
243 3300044683 Ga0466965_0076660 Ga0466965_0076660_14_1384 427
244 3300044842 Ga0466957_0017874 Ga0466957_0017874_1758_3164 427
245 3300046459 Ga0495629_0008916 Ga0495629_0008916_2106_3476 427
246 3300046462 Ga0495651_0067192 Ga0495651_0067192_216_1586 427
247 3300046463 Ga0495653_0057882 Ga0495653_0057882_1107_2477 427
248 3300046511 Ga0495608_0031044 Ga0495608_0031044_211_1581 427
249 3300046514 Ga0495618_0120901 Ga0495618_0120901_268_1638 427
250 3300046557 Ga0495622_0005230 Ga0495622_0005230_2477_3847 427
251 3300046663 Ga0495635_0015479 Ga0495635_0015479_1030_2400 427
252 3300046675 Ga0495657_0013750 Ga0495657_0013750_4510_5880 427
253 3300046684 Ga0495669_0001878 Ga0495669_0001878_3290_4660 427
254 3300046689 Ga0495613_0010887 Ga0495613_0010887_4043_5413 427
255 3300046809 Ga0495600_0036170 Ga0495600_0036170_705_2075 427
256 3300047317 Ga0495604_0015222 Ga0495604_0015222_2006_3376 427
257 3300047471 Ga0495684_0143545 Ga0495684_0143545_292_1662 427
258 3300047673 Ga0495593_0084435 Ga0495593_0084435_151_1521 427
259 3300048904 Ga0496101_0039152 Ga0496101_0039152_861_2324 427
260 3300048907 Ga0496104_0000281 Ga0496104_0000281_16394_17764 427
261 3300048907 Ga0496104_0025549 Ga0496104_0025549_2335_3798 427
262 3300048908 Ga0496105_0011220 Ga0496105_0011220_197_1567 427
263 3300048909 Ga0496106_0005076 Ga0496106_0005076_3878_5341 427
264 3300048911 Ga0496108_0000845 Ga0496108_0000845_8606_10069 427
265 3300048912 Ga0496109_0000592 Ga0496109_0000592_17567_19030 427
266 3300048913 Ga0496110_0011293 Ga0496110_0011293_3264_4727 427
267 3300048915 Ga0496112_0001178 Ga0496112_0001178_3171_4634 427
268 3300048916 Ga0496113_0011677 Ga0496113_0011677_2588_3958 427
269 3300048922 Ga0496119_0005325 Ga0496119_0005325_4174_5544 427
270 3300048923 Ga0496120_0001511 Ga0496120_0001511_22774_24144 427
271 3300048929 Ga0496126_0025006 Ga0496126_0025006_2396_3766 427
272 3300053087 Ga0500643_000319 Ga0500643_000319_19773_21143 427
273 3300053737 Ga0500601_000052 Ga0500601_000052_12529_13899 427
274 iso_pu_bacteria 3005587118 3005587166 427
275 3300005327 Ga0070658_10077056 Ga0070658_100770563 428
276 3300005937 Ga0081455_10075981 Ga0081455_100759813 428
277 3300021320 Ga0214544_1000368 Ga0214544_100036847 428
278 3300021321 Ga0214542_1002192 Ga0214542_100219221 428
279 3300021324 Ga0214545_1000203 Ga0214545_100020347 428
280 3300021327 Ga0214543_1000322 Ga0214543_100032247 428
281 3300025261 Ga0209233_1004255 Ga0209233_10042555 428
282 3300025909 Ga0207705_10057946 Ga0207705_100579462 428
283 3300025923 Ga0207681_10048754 Ga0207681_100487542 428
284 3300049580 Ga0501046_0024923 Ga0501046_0024923_1309_2676 428
285 3300049744 Ga0501083_0018277 Ga0501083_0018277_413_1780 428
286 iso_pu_bacteria 2508501128 2509149397 428
287 iso_pu_bacteria 2643221651 2644291394 428
288 3300003659 JGI25404J52841_10006160 JGI25404J52841_100061602 429
289 3300005937 Ga0081455_10043382 Ga0081455_100433822 429
290 3300005983 Ga0081540_1012437 Ga0081540_10124374 429
291 3300005983 Ga0081540_1017871 Ga0081540_10178714 429
292 3300005983 Ga0081540_1035952 Ga0081540_10359522 429
293 3300006048 Ga0075363_100082159 Ga0075363_1000821591 429
294 3300025295 Ga0209564_1001937 Ga0209564_10019372 429
295 3300025297 Ga0209758_1004237 Ga0209758_10042376 429
296 3300050513 nmdc:mga0rr50_165411_c1 nmdc:mga0rr50_165411_c1_196_1566 429
297 3300053104 Ga0500556_0000002 Ga0500556_0000002_127235_128605 429
298 3300053735 Ga0500596_001100 Ga0500596_001100_3809_5176 429
299 iso_pu_bacteria 2602042107 2603861427 429
300 iso_pu_bacteria 2857524615 2857530202 429
301 iso_pu_bacteria 2881665667 2881671847 429
302 iso_pu_bacteria 2893066018 2893066092 429
303 iso_pu_bacteria 2919073203 2919079527 429
304 iso_pu_bacteria 2941531003 2941531107 429
305 3300003215 JGI25153J46596_10006205 JGI25153J46596_100062053 430
306 3300005338 Ga0068868_100016332 Ga0068868_1000163323 430
307 3300005457 Ga0070662_100223020 Ga0070662_1002230201 430
308 3300005616 Ga0068852_100049351 Ga0068852_1000493513 430
309 3300005983 Ga0081540_1000575 Ga0081540_10005753 430
310 3300006881 Ga0068865_100201048 Ga0068865_1002010481 430
311 3300009545 Ga0105237_10058120 Ga0105237_100581203 430
312 3300013308 Ga0157375_10011128 Ga0157375_100111286 430
313 3300014969 Ga0157376_10008594 Ga0157376_100085944 430
314 3300025297 Ga0209758_1000365 Ga0209758_100036566 430
315 3300025925 Ga0207650_10096336 Ga0207650_100963362 430
316 3300025931 Ga0207644_10031587 Ga0207644_100315873 430
317 3300026023 Ga0207677_10021930 Ga0207677_100219304 430
318 3300039450 Ga0436363_0996694 Ga0436363_0996694_1282_2652 430
319 3300046524 Ga0495648_0007789 Ga0495648_0007789_6429_7799 430
320 3300046615 Ga0495656_0060531 Ga0495656_0060531_71_1441 430
321 3300048904 Ga0496101_0081029 Ga0496101_0081029_989_2359 430
322 3300048906 Ga0496103_0016380 Ga0496103_0016380_2198_3568 430
323 3300048907 Ga0496104_0008421 Ga0496104_0008421_6843_8213 430
324 3300048918 Ga0496115_0022242 Ga0496115_0022242_2404_3774 430
325 3300048924 Ga0496121_0041651 Ga0496121_0041651_1056_2453 430
326 3300053085 Ga0495619_0014968 Ga0495619_0014968_3304_4674 430
327 iso_pu_bacteria 2507262055 2507507751 430
328 iso_pu_bacteria 2508501009 2508541875 430
329 iso_pu_bacteria 2508501042 2508692582 430
330 iso_pu_bacteria 2511231028 2511398956 430
331 iso_pu_bacteria 2513237092 2513622962 430
332 iso_pu_bacteria 2513237094 2513642879 430
333 iso_pu_bacteria 2513237095 2513647421 430
334 iso_pu_bacteria 2513237096 2513653981 430
335 iso_pu_bacteria 2513237098 2513676254 430
336 iso_pu_bacteria 2513237101 2513695806 430
337 iso_pu_bacteria 2513237102 2513699540 430
338 iso_pu_bacteria 2513237104 2513719389 430
339 iso_pu_bacteria 2513237137 2513856417 430
340 iso_pu_bacteria 2513237139 2513878428 430
341 iso_pu_bacteria 2513237145 2513918321 430
342 iso_pu_bacteria 2513237161 2514009525 430
343 iso_pu_bacteria 2515154112 2515625991 430
344 iso_pu_bacteria 2517093001 2517104059 430
345 iso_pu_bacteria 2517572143 2517891449 430
346 iso_pu_bacteria 2524023205 2524436380 430
347 iso_pu_bacteria 2524023210 2524470290 430
348 iso_pu_bacteria 2524023228 2524538377 430
349 iso_pu_bacteria 2528768022 2528849082 430
350 iso_pu_bacteria 2617270735 2617346706 430
351 iso_pu_bacteria 2617270741 2617372634 430
352 iso_pu_bacteria 2667528175 2671118786 430
353 iso_pu_bacteria 2721755755 2723847271 430
354 iso_pu_bacteria 2728368998 2728750143 430
355 iso_pu_bacteria 2744054633 2745080666 430
356 iso_pu_bacteria 2791355196 2793064446 430
357 iso_pu_bacteria 2791355197 2793066813 430
358 iso_pu_bacteria 2791355199 2793084138 430
359 iso_pu_bacteria 2802429603 2805919149 430
360 iso_pu_bacteria 2816332527 2818236457 430
361 iso_pu_bacteria 2824600985 2824608238 430
362 iso_pu_bacteria 2824609381 2824612960 430
363 iso_pu_bacteria 2824626560 2824631617 430
364 iso_pu_bacteria 2824671348 2824679504 430
365 iso_pu_bacteria 2824679649 2824687787 430
366 iso_pu_bacteria 2824687955 2824695855 430
367 iso_pu_bacteria 2824696289 2824701773 430
368 iso_pu_bacteria 2824746037 2824749796 430
369 iso_pu_bacteria 2824753945 2824762400 430
370 iso_pu_bacteria 2824763712 2824772694 430
371 iso_pu_bacteria 2824773399 2824775221 430
372 iso_pu_bacteria 2838122688 2838128893 430
373 iso_pu_bacteria 2841941048 2841944960 430
374 iso_pu_bacteria 2841949485 2841953383 430
375 iso_pu_bacteria 2841957949 2841959789 430
376 iso_pu_bacteria 2841966195 2841972145 430
377 iso_pu_bacteria 2841974524 2841978109 430
378 iso_pu_bacteria 2841983080 2841986268 430
379 iso_pu_bacteria 2842038055 2842040557 430
380 iso_pu_bacteria 2842045827 2842046497 430
381 iso_pu_bacteria 2844315083 2844319923 430
382 iso_pu_bacteria 2847930680 2847937232 430
383 iso_pu_bacteria 2847939898 2847947646 430
384 iso_pu_bacteria 2849076700 2849078499 430
385 iso_pu_bacteria 2857509624 2857512858 430
386 iso_pu_bacteria 2874590934 2874598860 430
387 iso_pu_bacteria 2874604998 2874607290 430
388 iso_pu_bacteria 2874612657 2874614670 430
389 iso_pu_bacteria 2874620515 2874627984 430
390 iso_pu_bacteria 2874628541 2874635127 430
391 iso_pu_bacteria 2874645413 2874652316 430
392 iso_pu_bacteria 2876761206 2876766189 430
393 iso_pu_bacteria 2876771140 2876778899 430
394 iso_pu_bacteria 2876808645 2876814526 430
395 iso_pu_bacteria 2876818435 2876824206 430
396 iso_pu_bacteria 2879074833 2879082692 430
397 iso_pu_bacteria 2879083081 2879088459 430
398 iso_pu_bacteria 2879099564 2879107039 430
399 iso_pu_bacteria 2879110137 2879114622 430
400 iso_pu_bacteria 2879127579 2879132147 430
401 iso_pu_bacteria 2879142872 2879148326 430
402 iso_pu_bacteria 2881364244 2881371551 430
403 iso_pu_bacteria 2885366525 2885369878 430
404 iso_pu_bacteria 2885374607 2885378295 430
405 iso_pu_bacteria 2885409591 2885412285 430
406 iso_pu_bacteria 2888378607 2888385356 430
407 iso_pu_bacteria 2888388044 2888392894 430
408 iso_pu_bacteria 2888419890 2888425494 430
409 iso_pu_bacteria 2903727486 2903730404 430
410 iso_pu_bacteria 2904666416 2904674398 430
411 iso_pu_bacteria 2904690495 2904691292 430
412 iso_pu_bacteria 2904699407 2904704887 430
413 iso_pu_bacteria 2904711408 2904712077 430
414 iso_pu_bacteria 2906602504 2906604663 430
415 iso_pu_bacteria 2906610324 2906616621 430
416 iso_pu_bacteria 2906626472 2906627439 430
417 iso_pu_bacteria 2906635258 2906635405 430
418 iso_pu_bacteria 2906643746 2906649357 430
419 iso_pu_bacteria 2906660503 2906666951 430
420 iso_pu_bacteria 2908756301 2908759067 430
421 iso_pu_bacteria 2908775508 2908781080 430
422 iso_pu_bacteria 2922361189 2922368583 430
423 iso_pu_bacteria 2922368715 2922372508 430
424 iso_pu_bacteria 2922386360 2922387444 430
425 iso_pu_bacteria 2922393267 2922397161 430
426 iso_pu_bacteria 2922425934 2922431358 430
427 iso_pu_bacteria 2929615660 2929620928 430
428 iso_pu_bacteria 2929624759 2929626241 430
429 iso_pu_bacteria 2932784394 2932784880 430
430 iso_pu_bacteria 2932794094 2932795247 430
431 iso_pu_bacteria 2932801729 2932805778 430
432 iso_pu_bacteria 2932809354 2932809914 430
433 iso_pu_bacteria 2932818245 2932818343 430
434 iso_pu_bacteria 2932828146 2932828717 430
435 iso_pu_bacteria 2933577622 2933583202 430
436 iso_pu_bacteria 2935608549 2935609736 430
437 iso_pu_bacteria 2935616580 2935619863 430
438 iso_pu_bacteria 2935630451 2935633954 430
439 iso_pu_bacteria 2935638405 2935638845 430
440 iso_pu_bacteria 2935648319 2935654217 430
441 iso_pu_bacteria 2935656913 2935663090 430
442 iso_pu_bacteria 2935665750 2935666305 430
443 iso_pu_bacteria 2935675223 2935676651 430
444 iso_pu_bacteria 2935684952 2935685033 430
445 iso_pu_bacteria 2935694250 2935694729 430
446 iso_pu_bacteria 2935703347 2935703850 430
447 iso_pu_bacteria 2935713505 2935713586 430
448 iso_pu_bacteria 2935722832 2935724206 430
449 iso_pu_bacteria 2935732158 2935733436 430
450 iso_pu_bacteria 2935741537 2935742815 430
451 iso_pu_bacteria 2935750917 2935750998 430
452 iso_pu_bacteria 2935760218 2935760473 430
453 iso_pu_bacteria 2935769743 2935772036 430
454 iso_pu_bacteria 2935777560 2935784211 430
455 iso_pu_bacteria 2935785616 2935787576 430
456 iso_pu_bacteria 2935793552 2935796208 430
457 iso_pu_bacteria 2935801545 2935801987 430
458 iso_pu_bacteria 2935810662 2935810756 430
459 iso_pu_bacteria 2935819856 2935822898 430
460 iso_pu_bacteria 2935827899 2935828339 430
461 iso_pu_bacteria 2935837841 2935839754 430
462 iso_pu_bacteria 2935847175 2935848480 430
463 iso_pu_bacteria 2935855204 2935857822 430
464 iso_pu_bacteria 2935864058 2935868836 430
465 iso_pu_bacteria 2935873716 2935874251 430
466 iso_pu_bacteria 2935883170 2935883852 430
467 iso_pu_bacteria 2935908558 2935909715 430
468 iso_pu_bacteria 2935916978 2935917439 430
469 iso_pu_bacteria 2935926038 2935927196 430
470 iso_pu_bacteria 2935934488 2935936960 430
471 iso_pu_bacteria 2935942939 2935944737 430
472 iso_pu_bacteria 2935951376 2935953174 430
473 iso_pu_bacteria 2935959822 2935961317 430
474 iso_pu_bacteria 2935967501 2935970014 430
475 iso_pu_bacteria 2935975950 2935980299 430
476 iso_pu_bacteria 2935984226 2935986936 430
477 iso_pu_bacteria 2935992306 2935992824 430
478 iso_pu_bacteria 2936002035 2936002737 430
479 iso_pu_bacteria 2936011229 2936017246 430
480 iso_pu_bacteria 2936019824 2936025748 430
481 iso_pu_bacteria 2936028420 2936034597 430
482 iso_pu_bacteria 2936037263 2936037824 430
483 iso_pu_bacteria 2936046547 2936052654 430
484 iso_pu_bacteria 2936055302 2936062063 430
485 iso_pu_bacteria 2940556831 2940558199 430
486 iso_pu_bacteria 2941507105 2941510743 430
487 iso_pu_bacteria 2941515067 2941518127 430
488 iso_pu_bacteria 2941523033 2941527002 430
489 iso_pu_bacteria 2941538514 2941540905 430
490 iso_pu_bacteria 3005474847 3005481149 430
491 iso_pu_bacteria 3005483717 3005484887 430
492 iso_pu_bacteria 3005506211 3005508515 430
493 iso_pu_bacteria 3005594810 3005600202 430
494 iso_pu_bacteria 3005710791 3005715714 430
495 iso_pu_bacteria 3005718088 3005723062 430
496 iso_pu_bacteria 8006926726 8006930885 430
497 iso_pu_bacteria 8006933436 8006939558 430
498 iso_pu_bacteria 8006973647 8006979309 430
499 iso_pu_bacteria 8006984368 8006989202 430
500 iso_pu_bacteria 8016522445 8016528792 430
501 iso_pu_bacteria 8016539877 8016547201 430
502 iso_pu_bacteria 8016548790 8016554928 430
503 iso_pu_bacteria 8016557553 8016563295 430
504 iso_pu_bacteria 8016575299 8016576497 430
505 iso_pu_bacteria 8016583857 8016594204 430
506 iso_pu_bacteria 8016595262 8016601047 430
507 iso_pu_bacteria 8016613128 8016615502 430
508 iso_pu_bacteria 8016622563 8016625720 430
509 iso_pu_bacteria 8016630954 8016639281 430
510 iso_pu_bacteria 8017057580 8017064825 430
511 iso_pu_bacteria 8019530166 8019533746 430
512 iso_pu_bacteria 8019538911 8019545922 430
513 iso_pu_bacteria 8019547302 8019552805 430
514 iso_pu_bacteria 8019555841 8019565451 430
515 iso_pu_bacteria 8019565922 8019575543 430
516 iso_pu_bacteria 8019597564 8019599328 430
517 iso_pu_bacteria 8019608314 8019609030 430
518 iso_pu_bacteria 8019619141 8019619718 430
519 iso_pu_bacteria 8019629233 8019633397 430
520 iso_pu_bacteria 8019648815 8019649249 430
521 iso_pu_bacteria 8019659431 8019661281 430
522 iso_pu_bacteria 8019668869 8019670822 430
523 iso_pu_bacteria 8019678201 8019685377 430
524 iso_pu_bacteria 8019687851 8019690969 430
525 iso_pu_bacteria 8055742211 8055745209 430
526 iso_pu_bacteria 8056673599 8056681014 430
527 iso_pu_bacteria 8056681323 8056684905 430
528 iso_pu_bacteria 8056689827 8056693412 430
529 iso_pu_bacteria 8056967851 8056975171 430
530 3300005439 Ga0070711_100031162 Ga0070711_1000311623 431
531 3300005539 Ga0068853_100016983 Ga0068853_1000169834 431
532 3300005563 Ga0068855_100053112 Ga0068855_1000531124 431
533 3300005577 Ga0068857_100014724 Ga0068857_1000147245 431
534 3300005577 Ga0068857_100023313 Ga0068857_1000233135 431
535 3300005578 Ga0068854_100003845 Ga0068854_1000038451 431
536 3300005578 Ga0068854_100036066 Ga0068854_1000360662 431
537 3300005614 Ga0068856_100011815 Ga0068856_1000118157 431
538 3300005614 Ga0068856_100050178 Ga0068856_1000501782 431
539 3300005616 Ga0068852_100002580 Ga0068852_1000025806 431
540 3300005616 Ga0068852_100090084 Ga0068852_1000900841 431
541 3300005834 Ga0068851_10006584 Ga0068851_100065843 431
542 3300009093 Ga0105240_10084733 Ga0105240_100847332 431
543 3300009174 Ga0105241_10001401 Ga0105241_1000140111 431
544 3300009545 Ga0105237_10008696 Ga0105237_100086965 431
545 3300009545 Ga0105237_10233551 Ga0105237_102335512 431
546 3300009551 Ga0105238_10006652 Ga0105238_100066522 431
547 3300009551 Ga0105238_10011666 Ga0105238_100116663 431
548 3300010375 Ga0105239_10054806 Ga0105239_100548064 431
549 3300010375 Ga0105239_10058442 Ga0105239_100584423 431
550 3300025904 Ga0207647_10022267 Ga0207647_100222673 431
551 3300025911 Ga0207654_10000411 Ga0207654_1000041115 431
552 3300025913 Ga0207695_10000424 Ga0207695_1000042455 431
553 3300025924 Ga0207694_10000347 Ga0207694_1000034716 431
554 3300025924 Ga0207694_10046201 Ga0207694_100462013 431
555 3300025949 Ga0207667_10050734 Ga0207667_100507342 431
556 3300025949 Ga0207667_10257860 Ga0207667_102578602 431
557 3300025981 Ga0207640_10017736 Ga0207640_100177363 431
558 3300025981 Ga0207640_10086180 Ga0207640_100861802 431
559 3300026067 Ga0207678_10039799 Ga0207678_100397992 431
560 3300026067 Ga0207678_10097100 Ga0207678_100971002 431
561 3300026078 Ga0207702_10000002 Ga0207702_1000000289 431
562 3300026078 Ga0207702_10011407 Ga0207702_100114071 431
563 3300026116 Ga0207674_10003854 Ga0207674_100038543 431
564 3300026116 Ga0207674_10009561 Ga0207674_100095613 431
565 3300026142 Ga0207698_10026014 Ga0207698_100260142 431
566 3300027296 Ga0209389_1000001 Ga0209389_1000001238 431
567 3300027361 Ga0209489_119748 Ga0209489_1197482 431
568 3300031731 Ga0307405_10105036 Ga0307405_101050362 431
569 3300033179 Ga0307507_10080724 Ga0307507_100807241 431
570 3300035695 Ga0373927_0031836 Ga0373927_0031836_1451_2818 431
571 3300048905 Ga0496102_0008501 Ga0496102_0008501_1638_3008 431
572 3300048907 Ga0496104_0005754 Ga0496104_0005754_6666_8036 431
573 3300048908 Ga0496105_0043844 Ga0496105_0043844_377_1747 431
574 3300048909 Ga0496106_0131349 Ga0496106_0131349_352_1722 431
575 3300048913 Ga0496110_0023231 Ga0496110_0023231_2982_4352 431
576 3300048914 Ga0496111_0031284 Ga0496111_0031284_1039_2409 431
577 3300048915 Ga0496112_0000017 Ga0496112_0000017_54607_55977 431
578 3300048916 Ga0496113_0053320 Ga0496113_0053320_652_2022 431
579 3300048924 Ga0496121_0000886 Ga0496121_0000886_41439_42809 431
580 3300048924 Ga0496121_0056125 Ga0496121_0056125_397_1767 431
581 3300048929 Ga0496126_0205544 Ga0496126_0205544_166_1557 431
582 3300050494 nmdc:mga06z11_53375_c1 nmdc:mga06z11_53375_c1_105_1475 431
583 3300053119 Ga0500595_001750 Ga0500595_001750_5514_6884 431
584 3300053119 Ga0500595_023301 Ga0500595_023301_206_1573 431
585 3300053139 Ga0500568_0013309 Ga0500568_0013309_461_1831 431
586 3300053178 Ga0500637_0076481 Ga0500637_0076481_11_1378 431
587 3300053731 Ga0500609_004321 Ga0500609_004321_330_1700 431
588 3300003215 JGI25153J46596_10008275 JGI25153J46596_100082754 432
589 3300005262 Ga0065165_1013018 Ga0065165_10130182 432
590 3300005983 Ga0081540_1011696 Ga0081540_10116965 432
591 3300006028 Ga0070717_10287549 Ga0070717_102875491 432
592 3300009093 Ga0105240_10016135 Ga0105240_100161359 432
593 3300010375 Ga0105239_10034156 Ga0105239_100341563 432
594 3300025297 Ga0209758_1000011 Ga0209758_1000011218 432
595 3300025297 Ga0209758_1000359 Ga0209758_100035973 432
596 3300025304 Ga0209257_1001196 Ga0209257_100119622 432
597 3300025913 Ga0207695_10000008 Ga0207695_10000008701 432
598 3300025927 Ga0207687_10073302 Ga0207687_100733022 432
599 3300027361 Ga0209489_119453 Ga0209489_1194532 432
600 3300027363 Ga0209700_100007 Ga0209700_100007187 432
601 3300028794 Ga0307515_10056013 Ga0307515_100560133 432
602 3300031616 Ga0307508_10000249 Ga0307508_1000024919 432
603 3300031730 Ga0307516_10005695 Ga0307516_1000569513 432
604 3300036401 Ga0373937_0130575 Ga0373937_0130575_836_2209 432
605 3300037312 Ga0395899_0056072 Ga0395899_0056072_24_1394 432
606 3300037418 Ga0395900_0001529 Ga0395900_0001529_21599_22969 432
607 3300037466 Ga0395898_0014173 Ga0395898_0014173_3755_5125 432
608 3300038443 Ga0395901_0011625 Ga0395901_0011625_470_1840 432
609 3300046462 Ga0495651_0051215 Ga0495651_0051215_229_1596 432
610 3300046462 Ga0495651_0095975 Ga0495651_0095975_541_1914 432
611 3300046529 Ga0495652_0166790 Ga0495652_0166790_130_1497 432
612 3300046809 Ga0495600_0009971 Ga0495600_0009971_3731_5098 432
613 3300048928 Ga0496125_0054179 Ga0496125_0054179_1833_3203 432
614 3300049569 Ga0501032_0113009 Ga0501032_0113009_232_1599 432
615 3300049572 Ga0501036_0016285 Ga0501036_0016285_314_1687 432
616 3300049579 Ga0501043_0003909 Ga0501043_0003909_10813_12186 432
617 3300049582 Ga0501048_0092763 Ga0501048_0092763_422_1789 432
618 3300049742 Ga0501080_0204945 Ga0501080_0204945_169_1536 432
619 3300049822 Ga0501035_0115601 Ga0501035_0115601_919_2292 432
620 3300049823 Ga0501044_0070406 Ga0501044_0070406_140_1513 432
621 3300049823 Ga0501044_0146266 Ga0501044_0146266_172_1539 432
622 3300053119 Ga0500595_001406 Ga0500595_001406_9990_11354 432
623 3300053178 Ga0500637_0000282 Ga0500637_0000282_15814_17178 432
624 3300055283 Ga0500661_000108 Ga0500661_000108_3796_5160 432
625 iso_pu_bacteria 2903748898 2903749032 432
626 iso_pu_bacteria 2908739725 2908741788 432
627 3300005439 Ga0070711_100057504 Ga0070711_1000575043 433
628 3300005456 Ga0070678_100081258 Ga0070678_1000812582 433
629 3300005471 Ga0070698_100065850 Ga0070698_1000658501 433
630 3300005530 Ga0070679_100046635 Ga0070679_1000466352 433
631 3300005844 Ga0068862_100080072 Ga0068862_1000800723 433
632 3300005937 Ga0081455_10000577 Ga0081455_1000057734 433
633 3300005983 Ga0081540_1006404 Ga0081540_10064043 433
634 3300006186 Ga0075369_10022057 Ga0075369_100220571 433
635 3300006941 Ga0099825_1026117 Ga0099825_10261173 433
636 3300006942 Ga0099824_1005536 Ga0099824_10055365 433
637 3300009176 Ga0105242_10088105 Ga0105242_100881052 433
638 3300009177 Ga0105248_10223486 Ga0105248_102234862 433
639 3300009545 Ga0105237_10070560 Ga0105237_100705602 433
640 3300014326 Ga0157380_10013986 Ga0157380_100139863 433
641 3300025253 Ga0209677_100437 Ga0209677_10043723 433
642 3300025299 Ga0209256_1003423 Ga0209256_10034239 433
643 3300025912 Ga0207707_10016091 Ga0207707_100160915 433
644 3300025916 Ga0207663_10111602 Ga0207663_101116022 433
645 3300025944 Ga0207661_10161451 Ga0207661_101614512 433
646 3300025972 Ga0207668_10074081 Ga0207668_100740812 433
647 3300026067 Ga0207678_10078914 Ga0207678_100789141 433
648 3300026118 Ga0207675_100048223 Ga0207675_1000482233 433
649 3300026121 Ga0207683_10070990 Ga0207683_100709903 433
650 3300027357 Ga0209589_1000014 Ga0209589_100001499 433
651 3300027361 Ga0209489_100014 Ga0209489_10001499 433
652 3300027363 Ga0209700_100024 Ga0209700_10002499 433
653 3300028379 Ga0268266_10073800 Ga0268266_100738001 433
654 3300028380 Ga0268265_10069583 Ga0268265_100695832 433
655 3300031247 Ga0265340_10001084 Ga0265340_100010841 433
656 3300031730 Ga0307516_10055077 Ga0307516_100550773 433
657 3300035695 Ga0373927_0002439 Ga0373927_0002439_4525_5982 433
658 3300035725 Ga0373947_0025523 Ga0373947_0025523_31_1488 433
659 3300038443 Ga0395901_0140309 Ga0395901_0140309_257_1627 433
660 3300044693 Ga0466961_0076880 Ga0466961_0076880_108_1478 433
661 3300044694 Ga0466963_0014914 Ga0466963_0014914_3245_4615 433
662 3300044706 Ga0466964_0038812 Ga0466964_0038812_511_1881 433
663 3300045049 Ga0466959_0063305 Ga0466959_0063305_497_1867 433
664 3300045976 Ga0466967_0006745 Ga0466967_0006745_234_1604 433
665 3300046455 Ga0495603_0011237 Ga0495603_0011237_3176_4546 433
666 3300046455 Ga0495603_0014491 Ga0495603_0014491_2184_3602 433
667 3300046460 Ga0495638_0086418 Ga0495638_0086418_499_1869 433
668 3300046499 Ga0495594_0030010 Ga0495594_0030010_819_2264 433
669 3300046674 Ga0495588_0001447 Ga0495588_0001447_5857_7302 433
670 3300046680 Ga0495646_0022073 Ga0495646_0022073_1536_2903 433
671 3300048903 Ga0496100_0041350 Ga0496100_0041350_1470_2840 433
672 3300048912 Ga0496109_0298042 Ga0496109_0298042_77_1483 433
673 3300048921 Ga0496118_0003113 Ga0496118_0003113_11758_13125 433
674 3300048924 Ga0496121_0002017 Ga0496121_0002017_24862_26229 433
675 3300048925 Ga0496122_0014132 Ga0496122_0014132_4452_5822 433
676 3300048929 Ga0496126_0008257 Ga0496126_0008257_1134_2504 433
677 3300048929 Ga0496126_0028691 Ga0496126_0028691_183_1553 433
678 3300048929 Ga0496126_0046030 Ga0496126_0046030_1558_2928 433
679 3300049569 Ga0501032_0007050 Ga0501032_0007050_5896_7263 433
680 3300049570 Ga0501033_0000553 Ga0501033_0000553_8339_9706 433
681 3300049571 Ga0501034_0000892 Ga0501034_0000892_37265_38632 433
682 3300049572 Ga0501036_0000267 Ga0501036_0000267_9126_10493 433
683 3300049573 Ga0501037_0000257 Ga0501037_0000257_24821_26188 433
684 3300049574 Ga0501038_0004912 Ga0501038_0004912_589_1956 433
685 3300049575 Ga0501039_0000488 Ga0501039_0000488_25122_26489 433
686 3300049578 Ga0501042_0021357 Ga0501042_0021357_1983_3350 433
687 3300049579 Ga0501043_0005331 Ga0501043_0005331_6747_8114 433
688 3300049580 Ga0501046_0006487 Ga0501046_0006487_2364_3731 433
689 3300049581 Ga0501047_0000123 Ga0501047_0000123_4969_6336 433
690 3300049582 Ga0501048_0000108 Ga0501048_0000108_19864_21231 433
691 3300049583 Ga0501067_0000267 Ga0501067_0000267_591_1958 433
692 3300049585 Ga0501069_0002404 Ga0501069_0002404_1692_3059 433
693 3300049586 Ga0501070_0016149 Ga0501070_0016149_204_1571 433
694 3300049586 Ga0501070_0024041 Ga0501070_0024041_401_1768 433
695 3300049588 Ga0501072_0000898 Ga0501072_0000898_12562_13929 433
696 3300049589 Ga0501073_0000014 Ga0501073_0000014_133050_134417 433
697 3300049590 Ga0501074_0009185 Ga0501074_0009185_5292_6659 433
698 3300049742 Ga0501080_0018899 Ga0501080_0018899_4749_6116 433
699 3300049744 Ga0501083_0000289 Ga0501083_0000289_5407_6774 433
700 3300049822 Ga0501035_0000608 Ga0501035_0000608_17541_18908 433
701 3300049823 Ga0501044_0000344 Ga0501044_0000344_36624_37991 433
702 3300049824 Ga0501045_0005228 Ga0501045_0005228_5386_6753 433
703 3300050511 nmdc:mga08y16_65892_c1 nmdc:mga08y16_65892_c1_278_1696 433
704 3300053094 Ga0500566_0000117 Ga0500566_0000117_32095_33465 433
705 3300053095 Ga0500640_000141 Ga0500640_000141_5263_6633 433
706 3300053104 Ga0500556_0009163 Ga0500556_0009163_1419_2789 433
707 3300053105 Ga0500557_000162 Ga0500557_000162_1039_2409 433
708 3300053111 Ga0500572_000828 Ga0500572_000828_3138_4508 433
709 3300053122 Ga0500608_043407 Ga0500608_043407_363_1733 433
710 3300053123 Ga0500614_000264 Ga0500614_000264_10759_12129 433
711 3300053134 Ga0500658_0035161 Ga0500658_0035161_124_1494 433
712 3300053136 Ga0500559_0002978 Ga0500559_0002978_6550_7920 433
713 3300053148 Ga0500590_035432 Ga0500590_035432_113_1483 433
714 3300053150 Ga0500603_000306 Ga0500603_000306_4612_5982 433
715 3300053159 Ga0500630_000221 Ga0500630_000221_1641_3011 433
716 3300053163 Ga0500639_000041 Ga0500639_000041_24781_26151 433
717 3300053737 Ga0500601_002092 Ga0500601_002092_181_1560 433
718 3300054114 Ga0501084_0001855 Ga0501084_0001855_12313_13680 433
719 3300060353 Ga0501082_0006680 Ga0501082_0006680_7552_8919 433
720 3300061719 Ga0466962_0038186 Ga0466962_0038186_329_1699 433
721 3300003203 JGI25406J46586_10000034 JGI25406J46586_100000342 434
722 3300003354 JGI25160J50197_1004954 JGI25160J50197_10049542 434
723 3300005336 Ga0070680_100016901 Ga0070680_1000169012 434
724 3300005336 Ga0070680_100027944 Ga0070680_1000279445 434
725 3300005337 Ga0070682_100024159 Ga0070682_1000241591 434
726 3300005356 Ga0070674_100126772 Ga0070674_1001267721 434
727 3300005436 Ga0070713_100093072 Ga0070713_1000930722 434
728 3300005437 Ga0070710_10011859 Ga0070710_100118593 434
729 3300005439 Ga0070711_100028927 Ga0070711_1000289273 434
730 3300005455 Ga0070663_100034654 Ga0070663_1000346543 434
731 3300005458 Ga0070681_10042647 Ga0070681_100426475 434
732 3300005530 Ga0070679_100022990 Ga0070679_1000229903 434
733 3300005530 Ga0070679_100040520 Ga0070679_1000405203 434
734 3300005614 Ga0068856_100000061 Ga0068856_10000006165 434
735 3300005937 Ga0081455_10006207 Ga0081455_1000620710 434
736 3300005985 Ga0081539_10000113 Ga0081539_1000011356 434
737 3300006051 Ga0075364_10028026 Ga0075364_100280263 434
738 3300006175 Ga0070712_100003491 Ga0070712_1000034914 434
739 3300006186 Ga0075369_10007616 Ga0075369_100076163 434
740 3300007265 Ga0099794_10010045 Ga0099794_100100453 434
741 3300009093 Ga0105240_10022923 Ga0105240_100229233 434
742 3300009147 Ga0114129_10052838 Ga0114129_100528383 434
743 3300009174 Ga0105241_10054655 Ga0105241_100546551 434
744 3300009551 Ga0105238_10071644 Ga0105238_100716444 434
745 3300010375 Ga0105239_10040516 Ga0105239_100405164 434
746 3300013105 Ga0157369_10003682 Ga0157369_1000368216 434
747 3300013297 Ga0157378_10009387 Ga0157378_100093873 434
748 3300013307 Ga0157372_10177915 Ga0157372_101779152 434
749 3300025254 Ga0209148_1000180 Ga0209148_10001803 434
750 3300025272 Ga0209455_1007803 Ga0209455_10078032 434
751 3300025906 Ga0207699_10010250 Ga0207699_100102503 434
752 3300025912 Ga0207707_10001362 Ga0207707_100013625 434
753 3300025912 Ga0207707_10109082 Ga0207707_101090822 434
754 3300025913 Ga0207695_10035687 Ga0207695_100356874 434
755 3300025917 Ga0207660_10020110 Ga0207660_100201103 434
756 3300025917 Ga0207660_10092897 Ga0207660_100928972 434
757 3300025921 Ga0207652_10009418 Ga0207652_100094185 434
758 3300025938 Ga0207704_10078578 Ga0207704_100785782 434
759 3300025939 Ga0207665_10005475 Ga0207665_100054756 434
760 3300025941 Ga0207711_10025944 Ga0207711_100259444 434
761 3300026035 Ga0207703_10088661 Ga0207703_100886613 434
762 3300026078 Ga0207702_10000243 Ga0207702_100002437 434
763 3300026118 Ga0207675_100130941 Ga0207675_1001309413 434
764 3300028786 Ga0307517_10001507 Ga0307517_1000150715 434
765 3300031249 Ga0265339_10020405 Ga0265339_100204052 434
766 3300031730 Ga0307516_10089715 Ga0307516_100897152 434
767 3300033180 Ga0307510_10008055 Ga0307510_100080553 434
768 3300033180 Ga0307510_10024060 Ga0307510_100240602 434
769 3300033442 Ga0315911_1000002 Ga0315911_1000002240 434
770 3300035083 Ga0373926_0004912 Ga0373926_0004912_1417_2787 434
771 3300035111 Ga0373923_0006495 Ga0373923_0006495_2056_3426 434
772 3300035113 Ga0373936_0006011 Ga0373936_0006011_2819_4189 434
773 3300035116 Ga0373945_0005674 Ga0373945_0005674_1768_3138 434
774 3300035170 Ga0373943_0008537 Ga0373943_0008537_1420_2790 434
775 3300035171 Ga0373946_0002265 Ga0373946_0002265_1573_2943 434
776 3300035171 Ga0373946_0013981 Ga0373946_0013981_1081_2451 434
777 3300035172 Ga0373955_0005896 Ga0373955_0005896_162_1532 434
778 3300035692 Ga0373935_0000681 Ga0373935_0000681_9500_10870 434
779 3300035692 Ga0373935_0028648 Ga0373935_0028648_276_1646 434
780 3300035725 Ga0373947_0000118 Ga0373947_0000118_24767_26137 434
781 3300036401 Ga0373937_0069070 Ga0373937_0069070_317_1687 434
782 3300037068 Ga0373925_0001151 Ga0373925_0001151_20805_22175 434
783 3300037068 Ga0373925_0093688 Ga0373925_0093688_804_2183 434
784 3300037466 Ga0395898_0042524 Ga0395898_0042524_1222_2592 434
785 3300037853 Ga0436364_1112623 Ga0436364_1112623_90_1460 434
786 3300044842 Ga0466957_0045999 Ga0466957_0045999_927_2297 434
787 3300045976 Ga0466967_0077106 Ga0466967_0077106_1454_2824 434
788 3300046454 Ga0495592_0033732 Ga0495592_0033732_1045_2415 434
789 3300046455 Ga0495603_0000053 Ga0495603_0000053_45367_46737 434
790 3300046459 Ga0495629_0018227 Ga0495629_0018227_1120_2490 434
791 3300046459 Ga0495629_0045223 Ga0495629_0045223_1216_2586 434
792 3300046461 Ga0495641_0010050 Ga0495641_0010050_2057_3427 434
793 3300046462 Ga0495651_0050024 Ga0495651_0050024_1758_3128 434
794 3300046472 Ga0495580_0001877 Ga0495580_0001877_16772_18142 434
795 3300046473 Ga0495582_0000186 Ga0495582_0000186_28869_30239 434
796 3300046475 Ga0495639_0000078 Ga0495639_0000078_21103_22473 434
797 3300046475 Ga0495639_0022927 Ga0495639_0022927_1098_2468 434
798 3300046476 Ga0495662_0001326 Ga0495662_0001326_6706_8076 434
799 3300046477 Ga0495664_0008167 Ga0495664_0008167_1340_2710 434
800 3300046477 Ga0495664_0011159 Ga0495664_0011159_3585_4955 434
801 3300046499 Ga0495594_0000103 Ga0495594_0000103_27077_28447 434
802 3300046514 Ga0495618_0117514 Ga0495618_0117514_101_1471 434
803 3300046517 Ga0495630_0153994 Ga0495630_0153994_207_1577 434
804 3300046523 Ga0495644_0026973 Ga0495644_0026973_210_1580 434
805 3300046526 Ga0495666_0093854 Ga0495666_0093854_29_1399 434
806 3300046529 Ga0495652_0131261 Ga0495652_0131261_321_1691 434
807 3300046531 Ga0495665_0000190 Ga0495665_0000190_4898_6268 434
808 3300046533 Ga0495640_0001905 Ga0495640_0001905_9485_10855 434
809 3300046533 Ga0495640_0087702 Ga0495640_0087702_357_1727 434
810 3300046557 Ga0495622_0015848 Ga0495622_0015848_203_1573 434
811 3300046559 Ga0495667_0009435 Ga0495667_0009435_5088_6458 434
812 3300046642 Ga0495634_0001169 Ga0495634_0001169_8077_9447 434
813 3300046663 Ga0495635_0000211 Ga0495635_0000211_290_1660 434
814 3300046663 Ga0495635_0000985 Ga0495635_0000985_108_1478 434
815 3300046674 Ga0495588_0033733 Ga0495588_0033733_908_2278 434
816 3300046674 Ga0495588_0054544 Ga0495588_0054544_511_1881 434
817 3300046678 Ga0495599_0000957 Ga0495599_0000957_14336_15706 434
818 3300046679 Ga0495623_0005834 Ga0495623_0005834_6138_7508 434
819 3300046681 Ga0495647_0028522 Ga0495647_0028522_647_2017 434
820 3300046683 Ga0495658_0000108 Ga0495658_0000108_32980_34350 434
821 3300046683 Ga0495658_0013308 Ga0495658_0013308_2112_3482 434
822 3300046689 Ga0495613_0105927 Ga0495613_0105927_242_1612 434
823 3300046690 Ga0495624_0003469 Ga0495624_0003469_3947_5317 434
824 3300047315 Ga0495581_0000501 Ga0495581_0000501_2638_4008 434
825 3300047315 Ga0495581_0013051 Ga0495581_0013051_2627_3997 434
826 3300047317 Ga0495604_0025993 Ga0495604_0025993_332_1702 434
827 3300047319 Ga0495674_0000228 Ga0495674_0000228_43027_44397 434
828 3300047319 Ga0495674_0070755 Ga0495674_0070755_838_2208 434
829 3300047320 Ga0495672_0011909 Ga0495672_0011909_1886_3256 434
830 3300047321 Ga0495676_0152454 Ga0495676_0152454_19_1389 434
831 3300047469 Ga0495673_0012247 Ga0495673_0012247_1741_3132 434
832 3300047673 Ga0495593_0002763 Ga0495593_0002763_7333_8703 434
833 3300047673 Ga0495593_0056534 Ga0495593_0056534_503_1873 434
834 3300048913 Ga0496110_0245293 Ga0496110_0245293_58_1428 434
835 3300048915 Ga0496112_0079384 Ga0496112_0079384_704_2074 434
836 3300048919 Ga0496116_0054476 Ga0496116_0054476_232_1602 434
837 3300048920 Ga0496117_0132713 Ga0496117_0132713_45_1415 434
838 3300048924 Ga0496121_0026234 Ga0496121_0026234_3424_4794 434
839 3300050507 nmdc:mga05p37_52659_c1 nmdc:mga05p37_52659_c1_2730_4100 434
840 3300053078 Ga0495612_0023374 Ga0495612_0023374_19_1389 434
841 3300053080 Ga0500635_0003054 Ga0500635_0003054_2500_3870 434
842 3300053084 Ga0495595_0079663 Ga0495595_0079663_91_1461 434
843 3300053085 Ga0495619_0061030 Ga0495619_0061030_40_1410 434
844 3300053102 Ga0500554_000617 Ga0500554_000617_2572_3942 434
845 3300053111 Ga0500572_001082 Ga0500572_001082_5421_6794 434
846 3300053136 Ga0500559_0000242 Ga0500559_0000242_34636_36009 434
847 3300053150 Ga0500603_000586 Ga0500603_000586_2594_3964 434
848 3300053730 Ga0500645_006818 Ga0500645_006818_1901_3307 434
849 iso_pu_bacteria 2889033259 2889038115 434
850 iso_pu_bacteria 8006964411 8006968366 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05048

NosD

Periplasmic copper-binding protein (NosD)

164

300

0.85

PF13229

Beta_helix

Right handed beta helix region

165

267

0.83

PF13229

Beta_helix

Right handed beta helix region

213

454

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c7d-assembly2.cif.gz_B crystal structure of the catalytic unit of thermostable gh87 alpha-1,3-glucanase from streptomyces thermodiastaticus strain hf3-3 0.6718 38 434
5lw3-assembly1.cif.gz_A azotobacter vinelandii mannuronan c-5 epimerase alge6 a-module 0.6699 38 434
5lw3-assembly1.cif.gz_A azotobacter vinelandii mannuronan c-5 epimerase alge6 a-module 0.6634 38 434
4nk8-assembly1.cif.gz_A crystal structure of the periplasmic alginate epimerase algg d317a mutant 0.6287 68 434
6k0m-assembly1.cif.gz_A catalytic domain of gh87 alpha-1,3-glucanase from paenibacillus glycanilyticus fh11 0.6221 46 430
ID Description Score Start End Superfamily
4nk8A00 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6292 70 434 2.160.20.10
af_A0A0R0G6S6_12_359_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.6234 38 357 2.160.20.10
af_P9WFD9_1_145_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5926 55 82 3.40.50.620
af_A0A0R0G6S6_12_359_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.5779 38 357 2.160.20.10
3gq9A01 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.5766 39 401 2.160.20.10
ID Description Score Start End GO Terms
AF-A0A3C1NEA4-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9664 46 260
AF-A0A529U5T8-F1-model_v4 deleted 0.9595 39 151
AF-A0A532AJ08-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9503 145 247
AF-A0A3C1NEA4-F1-model_v4 TIGR03808 family TAT-translocated repetitive protein 0.9446 46 260
AF-A0A352VVS1-F1-model_v4 Rhamnogalacturonase A/B/Epimerase-like pectate lyase domain-containing protein 0.9435 39 80

Feature Viewer

pLDDT pTM Quality
79.46 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map