F483441
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 850 | 578 | 622 | 441 |
Family's Representative Sequence
| Representative Sequence | 3300053145|Ga0500586_019666|Ga0500586_019666_286_1890 |
| Length | 482 |
| Sequence | MLTPRTRKRRENASAWLFDIHIRNDQGTEPRSGFGMRHQRLRASLTLPRTFIPAALAWQRNAHHLALRHQQTSTGTPTMDVHRRHLLTVSGAGLAAGAFAASSDAARAAPLTSTLGRDATQYGVRPGSQDDQTRVLQRAIDEAARAQVPLALPPGVYRTGTLKLARGSQIIGIRGLTLDGNFAKLPPRRGLLHMVQARELRISDCSITNSGGAGIWLENSAGAITGNTLTNIATTAIVSFDAQGLIVAQNTIAGSSSNGIEILRTAIGDDGTQVIDNRIEDIKAGPGGSGQYGNAINAFRAGNVIVSGNRIRNCDYSAVRGNREVALYSEFAFEAAIIANNTVDGAALGVSVCNFNEGGRIAVVQGNIIRNLIPKRPIGTAPDDDAGIGIYIEADASVTGNVVENAPSFGMIAGWGKYLRFIGIGVSVAPGAGTALVSNNMISGAARGAVVGLDHAKPVTPDLTADGAQRYQQVALSGNTVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 35 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 36 | 2791355199 | |||
| 37 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 38 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 39 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 40 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 41 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 42 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 43 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 44 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 45 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 46 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 47 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 48 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 53 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 54 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 55 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 56 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 57 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 58 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 59 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 60 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 61 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 62 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 63 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 64 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 65 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 66 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 67 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 68 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 69 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 70 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 71 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 72 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 73 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 74 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 75 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 76 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 77 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 78 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 79 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 80 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 81 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 82 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 85 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 86 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 87 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 88 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 89 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 90 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 91 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 92 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 93 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 94 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 95 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 96 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 97 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 98 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 99 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 100 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 101 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 102 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 103 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 104 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 105 | 2904699407 | |||
| 106 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 107 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 108 | 2906610324 | |||
| 109 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 110 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 111 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 112 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 113 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 114 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 115 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 116 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 117 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 118 | 2922368715 | |||
| 119 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 120 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 121 | 2922425934 | |||
| 122 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 123 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 124 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 125 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 126 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 127 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 128 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 129 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 130 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 131 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 132 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 133 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 134 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 135 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 136 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 137 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 138 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 139 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 140 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 141 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 142 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 143 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 144 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 145 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 146 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 147 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 148 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 149 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 150 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 151 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 152 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 153 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 154 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 155 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 156 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 157 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 158 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 159 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 160 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 161 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 162 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 163 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 164 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 165 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 166 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 167 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 168 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 169 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 170 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 171 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 172 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 173 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 174 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 175 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 176 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 177 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 178 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 179 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 180 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 181 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 182 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 183 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 184 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 185 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 186 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 187 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 188 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 189 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 190 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 191 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 192 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 193 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 194 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 195 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 196 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 197 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 198 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 199 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 201 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 202 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 204 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 210 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 216 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 218 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 219 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 220 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 221 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 222 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 223 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 224 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 225 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 226 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 227 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 228 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 229 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 230 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 231 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 232 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 233 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 234 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 236 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 237 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 238 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 239 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 241 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 242 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 243 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 244 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 245 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 247 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 248 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 249 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 268 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 269 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 270 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 271 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 272 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 278 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 280 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 321 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 322 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 323 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 324 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 328 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 329 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 330 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 331 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 332 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 333 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 334 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 335 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 336 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 337 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 338 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 339 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 340 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 341 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 342 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 343 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 344 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 345 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 346 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 347 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 348 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 349 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 350 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 351 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 352 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 353 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 354 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 355 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 356 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 357 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 358 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 359 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 360 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 361 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 362 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 363 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 364 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 365 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 366 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 367 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 368 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 369 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 370 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 371 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 372 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 373 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 374 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 375 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 376 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 377 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 378 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 379 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 380 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 381 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 439 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 440 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 441 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 442 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 443 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 444 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 447 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 448 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 449 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 450 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 451 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 452 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 453 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 454 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 455 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 456 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 457 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 458 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 459 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 460 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 461 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 462 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 490 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 494 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 496 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 500 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 501 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 502 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 504 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 505 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 506 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 509 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 511 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 512 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 513 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 514 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 515 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 517 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 518 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 519 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 520 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 521 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 522 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 523 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 524 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 527 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 528 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 529 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 531 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 532 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 533 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 534 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 535 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 536 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 537 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 538 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 539 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 541 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 543 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 544 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 545 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 546 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 547 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 548 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 549 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 550 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 551 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 552 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 553 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 554 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 555 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 556 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 557 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 558 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 559 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 560 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 561 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 562 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 563 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 564 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 565 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 566 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 567 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 568 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 569 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 570 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 571 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 572 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 573 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 574 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 575 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 576 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 577 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 578 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.61 |
| Metatranscriptomes | 0 |
| Isolates | 26.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.76 |
| Nodule | 21.06 |
| Rhizoplane | 3.53 |
| Rhizosphere | 49.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000034 | 3300003203 | Bacteria | 64645 |
| 2 | JGI25406J46586_10003494 | 3300003203 | Bacteria | 7382 |
| 3 | JGI25153J46596_10006205 | 3300003215 | Bacteria | 6115 |
| 4 | JGI25153J46596_10008275 | 3300003215 | Bacteria | 4993 |
| 5 | JGI25160J50197_1004954 | 3300003354 | Bacteria | 5654 |
| 6 | JGI25404J52841_10006160 | 3300003659 | Bacteria | 2499 |
| 7 | Ga0055543_1003802 | 3300004625 | Bacteria | 4295 |
| 8 | Ga0065165_1002181 | 3300005262 | Bacteria | 17639 |
| 9 | Ga0065165_1002644 | 3300005262 | Bacteria | 14510 |
| 10 | Ga0065165_1013018 | 3300005262 | Bacteria | 3337 |
| 11 | Ga0070658_10077056 | 3300005327 | Bacteria | 2735 |
| 12 | Ga0070683_100016132 | 3300005329 | Bacteria | 6577 |
| 13 | Ga0070680_100016901 | 3300005336 | Bacteria | 5743 |
| 14 | Ga0070680_100027944 | 3300005336 | Bacteria | 4521 |
| 15 | Ga0070682_100024159 | 3300005337 | Bacteria | 3615 |
| 16 | Ga0068868_100016332 | 3300005338 | Bacteria | 5511 |
| 17 | Ga0070674_100053656 | 3300005356 | Bacteria | 2784 |
| 18 | Ga0070674_100126772 | 3300005356 | Bacteria | 1897 |
| 19 | Ga0070659_100058474 | 3300005366 | Bacteria | 3043 |
| 20 | Ga0070659_100171022 | 3300005366 | Bacteria | 1780 |
| 21 | Ga0070659_100259197 | 3300005366 | Bacteria | 1442 |
| 22 | Ga0070667_100101821 | 3300005367 | Bacteria | 2481 |
| 23 | Ga0070709_10000376 | 3300005434 | Bacteria | 27515 |
| 24 | Ga0070714_100071962 | 3300005435 | Bacteria | 2991 |
| 25 | Ga0070713_100093072 | 3300005436 | Bacteria | 2597 |
| 26 | Ga0070710_10000497 | 3300005437 | Bacteria | 18490 |
| 27 | Ga0070710_10011859 | 3300005437 | Bacteria | 4316 |
| 28 | Ga0070710_10093308 | 3300005437 | Bacteria | 1779 |
| 29 | Ga0070711_100023752 | 3300005439 | Bacteria | 3992 |
| 30 | Ga0070711_100028927 | 3300005439 | Bacteria | 3651 |
| 31 | Ga0070711_100031162 | 3300005439 | Bacteria | 3537 |
| 32 | Ga0070711_100057504 | 3300005439 | Bacteria | 2693 |
| 33 | Ga0070663_100014414 | 3300005455 | Bacteria | 5073 |
| 34 | Ga0070663_100034654 | 3300005455 | Bacteria | 3497 |
| 35 | Ga0070678_100081258 | 3300005456 | Bacteria | 2456 |
| 36 | Ga0070662_100223020 | 3300005457 | Bacteria | 1505 |
| 37 | Ga0070681_10042647 | 3300005458 | Bacteria | 4546 |
| 38 | Ga0070698_100065850 | 3300005471 | Bacteria | 3648 |
| 39 | Ga0070679_100022990 | 3300005530 | Bacteria | 6097 |
| 40 | Ga0070679_100040520 | 3300005530 | Bacteria | 4634 |
| 41 | Ga0070679_100046635 | 3300005530 | Bacteria | 4319 |
| 42 | Ga0070684_100090204 | 3300005535 | Bacteria | 2725 |
| 43 | Ga0068853_100016983 | 3300005539 | Bacteria | 6000 |
| 44 | Ga0068855_100053112 | 3300005563 | Bacteria | 4768 |
| 45 | Ga0068855_100094442 | 3300005563 | Bacteria | 3448 |
| 46 | Ga0068855_100291560 | 3300005563 | Bacteria | 1809 |
| 47 | Ga0068857_100014724 | 3300005577 | Bacteria | 6824 |
| 48 | Ga0068857_100023313 | 3300005577 | Bacteria | 5447 |
| 49 | Ga0068854_100003845 | 3300005578 | Bacteria | 9407 |
| 50 | Ga0068854_100036066 | 3300005578 | Bacteria | 3465 |
| 51 | Ga0068856_100000061 | 3300005614 | Bacteria | 100823 |
| 52 | Ga0068856_100005538 | 3300005614 | Bacteria | 12434 |
| 53 | Ga0068856_100011815 | 3300005614 | Bacteria | 8463 |
| 54 | Ga0068856_100050178 | 3300005614 | Bacteria | 4113 |
| 55 | Ga0068852_100002580 | 3300005616 | Bacteria | 12500 |
| 56 | Ga0068852_100016848 | 3300005616 | Bacteria | 5713 |
| 57 | Ga0068852_100049351 | 3300005616 | Bacteria | 3600 |
| 58 | Ga0068852_100090084 | 3300005616 | Bacteria | 2743 |
| 59 | Ga0068859_100147849 | 3300005617 | Bacteria | 2425 |
| 60 | Ga0068861_100179594 | 3300005719 | Bacteria | 1761 |
| 61 | Ga0068851_10006584 | 3300005834 | Bacteria | 5310 |
| 62 | Ga0068863_100033056 | 3300005841 | Bacteria | 4928 |
| 63 | Ga0068860_100001652 | 3300005843 | Bacteria | 23863 |
| 64 | Ga0068862_100080072 | 3300005844 | Bacteria | 2832 |
| 65 | Ga0081455_10000577 | 3300005937 | Bacteria | 47777 |
| 66 | Ga0081455_10001359 | 3300005937 | Bacteria | 30249 |
| 67 | Ga0081455_10006207 | 3300005937 | Bacteria | 12886 |
| 68 | Ga0081455_10043382 | 3300005937 | Bacteria | 3934 |
| 69 | Ga0081455_10075981 | 3300005937 | Bacteria | 2769 |
| 70 | Ga0081540_1000575 | 3300005983 | Bacteria | 35551 |
| 71 | Ga0081540_1006111 | 3300005983 | Bacteria | 8845 |
| 72 | Ga0081540_1006404 | 3300005983 | Bacteria | 8580 |
| 73 | Ga0081540_1011696 | 3300005983 | Bacteria | 5843 |
| 74 | Ga0081540_1012437 | 3300005983 | Bacteria | 5604 |
| 75 | Ga0081540_1017871 | 3300005983 | Bacteria | 4373 |
| 76 | Ga0081540_1035952 | 3300005983 | Bacteria | 2649 |
| 77 | Ga0081539_10000113 | 3300005985 | Bacteria | 189418 |
| 78 | Ga0081539_10000341 | 3300005985 | Bacteria | 103044 |
| 79 | Ga0081539_10087132 | 3300005985 | Bacteria | 1623 |
| 80 | Ga0070717_10051048 | 3300006028 | Bacteria | 3402 |
| 81 | Ga0070717_10163017 | 3300006028 | Bacteria | 1935 |
| 82 | Ga0070717_10287549 | 3300006028 | Bacteria | 1459 |
| 83 | Ga0075365_10032771 | 3300006038 | Bacteria | 3344 |
| 84 | Ga0075365_10119454 | 3300006038 | Bacteria | 1817 |
| 85 | Ga0075365_10128669 | 3300006038 | Bacteria | 1751 |
| 86 | Ga0075363_100082159 | 3300006048 | Bacteria | 1763 |
| 87 | Ga0075364_10028026 | 3300006051 | Bacteria | 3603 |
| 88 | Ga0070716_100045989 | 3300006173 | Bacteria | 2454 |
| 89 | Ga0070712_100003491 | 3300006175 | Bacteria | 9671 |
| 90 | Ga0070712_100093737 | 3300006175 | Bacteria | 2205 |
| 91 | Ga0075367_10001858 | 3300006178 | Bacteria | 9326 |
| 92 | Ga0075367_10019050 | 3300006178 | Bacteria | 3799 |
| 93 | Ga0075369_10007616 | 3300006186 | Bacteria | 4136 |
| 94 | Ga0075369_10022057 | 3300006186 | Bacteria | 2624 |
| 95 | Ga0075370_10037604 | 3300006353 | Bacteria | 2722 |
| 96 | Ga0075431_100212076 | 3300006847 | Bacteria | 1978 |
| 97 | Ga0068865_100201048 | 3300006881 | Bacteria | 1547 |
| 98 | Ga0097620_100147857 | 3300006931 | Bacteria | 2425 |
| 99 | Ga0099825_1026117 | 3300006941 | Bacteria | 3158 |
| 100 | Ga0099824_1005536 | 3300006942 | Bacteria | 17739 |
| 101 | Ga0099824_1015819 | 3300006942 | Bacteria | 7020 |
| 102 | Ga0099794_10010045 | 3300007265 | Bacteria | 4007 |
| 103 | Ga0099794_10058269 | 3300007265 | Bacteria | 1872 |
| 104 | Ga0105240_10013705 | 3300009093 | Bacteria | 11109 |
| 105 | Ga0105240_10016135 | 3300009093 | Bacteria | 10123 |
| 106 | Ga0105240_10022923 | 3300009093 | Bacteria | 8271 |
| 107 | Ga0105240_10084733 | 3300009093 | Bacteria | 3885 |
| 108 | Ga0111539_10091707 | 3300009094 | Bacteria | 3569 |
| 109 | Ga0105245_10141381 | 3300009098 | Bacteria | 2267 |
| 110 | Ga0114129_10052838 | 3300009147 | Bacteria | 5701 |
| 111 | Ga0105241_10001401 | 3300009174 | Bacteria | 18447 |
| 112 | Ga0105241_10054655 | 3300009174 | Bacteria | 3057 |
| 113 | Ga0105242_10088105 | 3300009176 | Bacteria | 2607 |
| 114 | Ga0105248_10223486 | 3300009177 | Bacteria | 2120 |
| 115 | Ga0105237_10008696 | 3300009545 | Bacteria | 10967 |
| 116 | Ga0105237_10025027 | 3300009545 | Bacteria | 6106 |
| 117 | Ga0105237_10058120 | 3300009545 | Bacteria | 3871 |
| 118 | Ga0105237_10070560 | 3300009545 | Bacteria | 3490 |
| 119 | Ga0105237_10233551 | 3300009545 | Bacteria | 1840 |
| 120 | Ga0105238_10006652 | 3300009551 | Bacteria | 11526 |
| 121 | Ga0105238_10011666 | 3300009551 | Bacteria | 8855 |
| 122 | Ga0105238_10051276 | 3300009551 | Bacteria | 4151 |
| 123 | Ga0105238_10071644 | 3300009551 | Bacteria | 3463 |
| 124 | Ga0105249_10107809 | 3300009553 | Bacteria | 2629 |
| 125 | Ga0105239_10034156 | 3300010375 | Bacteria | 5583 |
| 126 | Ga0105239_10040516 | 3300010375 | Bacteria | 5104 |
| 127 | Ga0105239_10054806 | 3300010375 | Bacteria | 4374 |
| 128 | Ga0105239_10058442 | 3300010375 | Bacteria | 4232 |
| 129 | Ga0157370_10188643 | 3300013104 | Bacteria | 1914 |
| 130 | Ga0157369_10003682 | 3300013105 | Bacteria | 18215 |
| 131 | Ga0157369_10004083 | 3300013105 | Bacteria | 17280 |
| 132 | Ga0157378_10009387 | 3300013297 | Bacteria | 8523 |
| 133 | Ga0157372_10043633 | 3300013307 | Bacteria | 4965 |
| 134 | Ga0157372_10177915 | 3300013307 | Bacteria | 2462 |
| 135 | Ga0157375_10011128 | 3300013308 | Bacteria | 7934 |
| 136 | Ga0157380_10013986 | 3300014326 | Bacteria | 5861 |
| 137 | Ga0157376_10008594 | 3300014969 | Bacteria | 7379 |
| 138 | Ga0214544_1000368 | 3300021320 | Bacteria | 79177 |
| 139 | Ga0214542_1002192 | 3300021321 | Bacteria | 40482 |
| 140 | Ga0214545_1000203 | 3300021324 | Bacteria | 79176 |
| 141 | Ga0214543_1000322 | 3300021327 | Bacteria | 76376 |
| 142 | Ga0213876_10000898 | 3300021384 | Bacteria | 19843 |
| 143 | Ga0209563_100727 | 3300025230 | Bacteria | 10170 |
| 144 | Ga0209677_100437 | 3300025253 | Bacteria | 24430 |
| 145 | Ga0209677_104304 | 3300025253 | Bacteria | 4170 |
| 146 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 147 | Ga0209233_1004255 | 3300025261 | Bacteria | 4900 |
| 148 | Ga0209455_1007803 | 3300025272 | Bacteria | 2979 |
| 149 | Ga0209564_1001937 | 3300025295 | Bacteria | 18414 |
| 150 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 151 | Ga0209758_1000359 | 3300025297 | Bacteria | 81559 |
| 152 | Ga0209758_1000365 | 3300025297 | Bacteria | 80645 |
| 153 | Ga0209758_1000530 | 3300025297 | Bacteria | 60826 |
| 154 | Ga0209758_1004237 | 3300025297 | Bacteria | 12139 |
| 155 | Ga0209758_1005198 | 3300025297 | Bacteria | 10225 |
| 156 | Ga0209758_1027110 | 3300025297 | Bacteria | 2458 |
| 157 | Ga0209256_1003423 | 3300025299 | Bacteria | 11147 |
| 158 | Ga0207426_1000429 | 3300025302 | Bacteria | 68612 |
| 159 | Ga0207426_1000998 | 3300025302 | Bacteria | 27598 |
| 160 | Ga0207426_1020516 | 3300025302 | Bacteria | 2295 |
| 161 | Ga0209257_1001196 | 3300025304 | Bacteria | 32644 |
| 162 | Ga0207692_10000915 | 3300025898 | Bacteria | 10659 |
| 163 | Ga0207692_10075490 | 3300025898 | Bacteria | 1788 |
| 164 | Ga0207688_10049442 | 3300025901 | Bacteria | 2350 |
| 165 | Ga0207647_10022267 | 3300025904 | Bacteria | 4212 |
| 166 | Ga0207647_10118780 | 3300025904 | Bacteria | 1560 |
| 167 | Ga0207699_10001327 | 3300025906 | Bacteria | 11741 |
| 168 | Ga0207699_10010250 | 3300025906 | Bacteria | 4695 |
| 169 | Ga0207699_10019793 | 3300025906 | Bacteria | 3597 |
| 170 | Ga0207705_10057946 | 3300025909 | Bacteria | 2795 |
| 171 | Ga0207684_10086326 | 3300025910 | Bacteria | 2673 |
| 172 | Ga0207654_10000411 | 3300025911 | Bacteria | 24726 |
| 173 | Ga0207707_10001362 | 3300025912 | Bacteria | 22693 |
| 174 | Ga0207707_10016091 | 3300025912 | Bacteria | 6524 |
| 175 | Ga0207707_10109082 | 3300025912 | Bacteria | 2420 |
| 176 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 177 | Ga0207695_10000424 | 3300025913 | Bacteria | 93657 |
| 178 | Ga0207695_10035687 | 3300025913 | Bacteria | 5387 |
| 179 | Ga0207671_10016997 | 3300025914 | Bacteria | 5630 |
| 180 | Ga0207693_10008179 | 3300025915 | Bacteria | 8569 |
| 181 | Ga0207663_10028587 | 3300025916 | Bacteria | 3265 |
| 182 | Ga0207663_10111602 | 3300025916 | Bacteria | 1856 |
| 183 | Ga0207663_10145865 | 3300025916 | Bacteria | 1654 |
| 184 | Ga0207660_10020110 | 3300025917 | Bacteria | 4477 |
| 185 | Ga0207660_10092897 | 3300025917 | Bacteria | 2240 |
| 186 | Ga0207657_10006063 | 3300025919 | Bacteria | 12571 |
| 187 | Ga0207652_10009418 | 3300025921 | Bacteria | 7854 |
| 188 | Ga0207681_10048754 | 3300025923 | Bacteria | 2860 |
| 189 | Ga0207694_10000347 | 3300025924 | Bacteria | 43770 |
| 190 | Ga0207694_10046201 | 3300025924 | Bacteria | 3365 |
| 191 | Ga0207694_10056360 | 3300025924 | Bacteria | 3052 |
| 192 | Ga0207650_10096336 | 3300025925 | Bacteria | 2270 |
| 193 | Ga0207687_10073302 | 3300025927 | Bacteria | 2451 |
| 194 | Ga0207664_10044500 | 3300025929 | Bacteria | 3476 |
| 195 | Ga0207664_10059216 | 3300025929 | Bacteria | 3049 |
| 196 | Ga0207644_10031587 | 3300025931 | Bacteria | 3691 |
| 197 | Ga0207669_10014040 | 3300025937 | Bacteria | 4003 |
| 198 | Ga0207704_10078578 | 3300025938 | Bacteria | 2123 |
| 199 | Ga0207665_10005475 | 3300025939 | Bacteria | 8475 |
| 200 | Ga0207711_10025944 | 3300025941 | Bacteria | 4915 |
| 201 | Ga0207661_10000647 | 3300025944 | Bacteria | 22491 |
| 202 | Ga0207661_10161451 | 3300025944 | Bacteria | 1944 |
| 203 | Ga0207667_10050734 | 3300025949 | Bacteria | 4377 |
| 204 | Ga0207667_10257860 | 3300025949 | Bacteria | 1783 |
| 205 | Ga0207668_10074081 | 3300025972 | Bacteria | 2442 |
| 206 | Ga0207640_10017736 | 3300025981 | Bacteria | 4171 |
| 207 | Ga0207640_10086180 | 3300025981 | Bacteria | 2162 |
| 208 | Ga0207677_10021930 | 3300026023 | Bacteria | 3915 |
| 209 | Ga0207703_10088661 | 3300026035 | Bacteria | 2597 |
| 210 | Ga0207678_10015346 | 3300026067 | Bacteria | 6738 |
| 211 | Ga0207678_10039799 | 3300026067 | Bacteria | 4078 |
| 212 | Ga0207678_10078914 | 3300026067 | Bacteria | 2819 |
| 213 | Ga0207678_10089106 | 3300026067 | Bacteria | 2637 |
| 214 | Ga0207678_10097100 | 3300026067 | Bacteria | 2518 |
| 215 | Ga0207708_10048033 | 3300026075 | Bacteria | 3248 |
| 216 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 217 | Ga0207702_10000243 | 3300026078 | Bacteria | 63718 |
| 218 | Ga0207702_10011407 | 3300026078 | Bacteria | 7409 |
| 219 | Ga0207702_10191830 | 3300026078 | Bacteria | 1888 |
| 220 | Ga0207674_10003854 | 3300026116 | Bacteria | 18276 |
| 221 | Ga0207674_10009561 | 3300026116 | Bacteria | 11063 |
| 222 | Ga0207675_100029871 | 3300026118 | Bacteria | 5074 |
| 223 | Ga0207675_100048223 | 3300026118 | Bacteria | 3977 |
| 224 | Ga0207675_100130941 | 3300026118 | Bacteria | 2379 |
| 225 | Ga0207683_10046044 | 3300026121 | Bacteria | 3815 |
| 226 | Ga0207683_10070990 | 3300026121 | Bacteria | 3078 |
| 227 | Ga0207698_10026014 | 3300026142 | Bacteria | 4134 |
| 228 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 229 | Ga0209389_1000134 | 3300027296 | Bacteria | 65168 |
| 230 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 231 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 232 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 233 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 234 | Ga0209489_119453 | 3300027361 | Bacteria | 2265 |
| 235 | Ga0209489_119748 | 3300027361 | Bacteria | 2139 |
| 236 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 237 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 238 | Ga0268266_10036645 | 3300028379 | Bacteria | 4176 |
| 239 | Ga0268266_10073800 | 3300028379 | Bacteria | 2961 |
| 240 | Ga0268266_10105326 | 3300028379 | Bacteria | 2491 |
| 241 | Ga0268265_10069583 | 3300028380 | Bacteria | 2733 |
| 242 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 243 | Ga0265337_1009505 | 3300028556 | Bacteria | 3467 |
| 244 | Ga0265326_10016163 | 3300028558 | Bacteria | 2158 |
| 245 | Ga0265319_1005194 | 3300028563 | Bacteria | 6291 |
| 246 | Ga0265334_10003849 | 3300028573 | Bacteria | 6776 |
| 247 | Ga0265323_10001021 | 3300028653 | Bacteria | 14579 |
| 248 | Ga0265336_10000397 | 3300028666 | Bacteria | 27403 |
| 249 | Ga0307517_10001507 | 3300028786 | Bacteria | 38891 |
| 250 | Ga0307515_10056013 | 3300028794 | Bacteria | 5742 |
| 251 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 252 | Ga0265325_10015311 | 3300031241 | Bacteria | 4315 |
| 253 | Ga0265340_10001084 | 3300031247 | Bacteria | 15490 |
| 254 | Ga0265339_10020405 | 3300031249 | Bacteria | 3872 |
| 255 | Ga0265331_10016991 | 3300031250 | Bacteria | 3806 |
| 256 | Ga0307509_10143252 | 3300031507 | Bacteria | 2320 |
| 257 | Ga0307508_10000249 | 3300031616 | Bacteria | 65482 |
| 258 | Ga0307508_10107568 | 3300031616 | Bacteria | 2388 |
| 259 | Ga0265314_10014031 | 3300031711 | Bacteria | 6439 |
| 260 | Ga0265342_10003896 | 3300031712 | Bacteria | 11989 |
| 261 | Ga0307516_10005695 | 3300031730 | Bacteria | 14770 |
| 262 | Ga0307516_10055077 | 3300031730 | Bacteria | 3884 |
| 263 | Ga0307516_10089715 | 3300031730 | Bacteria | 2904 |
| 264 | Ga0307405_10047565 | 3300031731 | Bacteria | 2642 |
| 265 | Ga0307405_10105036 | 3300031731 | Bacteria | 1902 |
| 266 | Ga0307507_10080724 | 3300033179 | Bacteria | 2866 |
| 267 | Ga0307510_10008055 | 3300033180 | Bacteria | 12542 |
| 268 | Ga0307510_10017631 | 3300033180 | Bacteria | 8416 |
| 269 | Ga0307510_10024060 | 3300033180 | Bacteria | 7044 |
| 270 | Ga0307510_10133015 | 3300033180 | Bacteria | 2153 |
| 271 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 272 | Ga0373926_0004912 | 3300035083 | Bacteria | 4391 |
| 273 | Ga0373923_0006495 | 3300035111 | Bacteria | 4047 |
| 274 | Ga0373936_0006011 | 3300035113 | Bacteria | 4575 |
| 275 | Ga0373945_0005674 | 3300035116 | Bacteria | 4002 |
| 276 | Ga0373954_0007067 | 3300035118 | Bacteria | 4899 |
| 277 | Ga0373943_0008537 | 3300035170 | Bacteria | 4593 |
| 278 | Ga0373946_0002265 | 3300035171 | Bacteria | 6795 |
| 279 | Ga0373946_0013981 | 3300035171 | Bacteria | 3022 |
| 280 | Ga0373955_0005896 | 3300035172 | Bacteria | 5539 |
| 281 | Ga0373935_0000681 | 3300035692 | Bacteria | 17958 |
| 282 | Ga0373935_0028648 | 3300035692 | Bacteria | 3442 |
| 283 | Ga0373927_0000985 | 3300035695 | Bacteria | 21674 |
| 284 | Ga0373927_0002439 | 3300035695 | Bacteria | 13560 |
| 285 | Ga0373927_0031836 | 3300035695 | Bacteria | 3435 |
| 286 | Ga0373933_0001176 | 3300035724 | Bacteria | 15509 |
| 287 | Ga0373947_0000118 | 3300035725 | Bacteria | 39817 |
| 288 | Ga0373947_0025523 | 3300035725 | Bacteria | 3447 |
| 289 | Ga0373937_0069070 | 3300036401 | Bacteria | 3257 |
| 290 | Ga0373937_0130575 | 3300036401 | Bacteria | 2346 |
| 291 | Ga0373925_0001151 | 3300037068 | Bacteria | 23461 |
| 292 | Ga0373925_0093688 | 3300037068 | Bacteria | 2299 |
| 293 | Ga0395899_0056072 | 3300037312 | Bacteria | 2913 |
| 294 | Ga0395900_0001529 | 3300037418 | Bacteria | 27494 |
| 295 | Ga0395900_0083776 | 3300037418 | Bacteria | 3276 |
| 296 | Ga0395898_0014173 | 3300037466 | Bacteria | 8198 |
| 297 | Ga0395898_0042524 | 3300037466 | Bacteria | 4482 |
| 298 | Ga0395905_0009682 | 3300037471 | Bacteria | 9408 |
| 299 | Ga0395905_0014127 | 3300037471 | Bacteria | 7631 |
| 300 | Ga0436364_1112623 | 3300037853 | Bacteria | 2676 |
| 301 | Ga0395901_0011625 | 3300038443 | Bacteria | 8916 |
| 302 | Ga0395901_0109013 | 3300038443 | Bacteria | 2907 |
| 303 | Ga0395901_0140309 | 3300038443 | Bacteria | 2540 |
| 304 | Ga0436365_0191965 | 3300039437 | Bacteria | 59780 |
| 305 | Ga0436363_0996694 | 3300039450 | Bacteria | 4547 |
| 306 | Ga0439465_0005851 | 3300041413 | Bacteria | 3913 |
| 307 | Ga0466969_0022064 | 3300044656 | Bacteria | 3290 |
| 308 | Ga0466972_0000200 | 3300044658 | Bacteria | 43953 |
| 309 | Ga0466965_0076660 | 3300044683 | Bacteria | 1687 |
| 310 | Ga0466961_0000050 | 3300044693 | Bacteria | 71289 |
| 311 | Ga0466961_0076880 | 3300044693 | Bacteria | 2115 |
| 312 | Ga0466963_0014914 | 3300044694 | Bacteria | 4802 |
| 313 | Ga0466964_0038812 | 3300044706 | Bacteria | 1916 |
| 314 | Ga0466957_0017874 | 3300044842 | Bacteria | 4160 |
| 315 | Ga0466957_0045999 | 3300044842 | Bacteria | 2648 |
| 316 | Ga0466959_0003216 | 3300045049 | Bacteria | 10627 |
| 317 | Ga0466959_0063305 | 3300045049 | Bacteria | 2686 |
| 318 | Ga0466967_0006745 | 3300045976 | Bacteria | 8170 |
| 319 | Ga0466967_0077106 | 3300045976 | Bacteria | 2999 |
| 320 | Ga0495592_0028302 | 3300046454 | Bacteria | 4245 |
| 321 | Ga0495592_0033732 | 3300046454 | Bacteria | 3860 |
| 322 | Ga0495603_0000053 | 3300046455 | Bacteria | 49373 |
| 323 | Ga0495603_0011237 | 3300046455 | Bacteria | 5423 |
| 324 | Ga0495603_0014491 | 3300046455 | Bacteria | 4768 |
| 325 | Ga0495629_0008916 | 3300046459 | Bacteria | 7373 |
| 326 | Ga0495629_0018227 | 3300046459 | Bacteria | 5028 |
| 327 | Ga0495629_0045223 | 3300046459 | Bacteria | 3089 |
| 328 | Ga0495629_0085573 | 3300046459 | Bacteria | 2200 |
| 329 | Ga0495638_0001532 | 3300046460 | Bacteria | 20807 |
| 330 | Ga0495638_0051184 | 3300046460 | Bacteria | 2576 |
| 331 | Ga0495638_0060740 | 3300046460 | Bacteria | 2336 |
| 332 | Ga0495638_0086418 | 3300046460 | Bacteria | 1895 |
| 333 | Ga0495641_0010050 | 3300046461 | Bacteria | 5546 |
| 334 | Ga0495651_0001520 | 3300046462 | Bacteria | 17929 |
| 335 | Ga0495651_0050024 | 3300046462 | Bacteria | 3225 |
| 336 | Ga0495651_0051215 | 3300046462 | Bacteria | 3185 |
| 337 | Ga0495651_0067192 | 3300046462 | Bacteria | 2735 |
| 338 | Ga0495651_0095975 | 3300046462 | Bacteria | 2216 |
| 339 | Ga0495653_0057882 | 3300046463 | Bacteria | 2948 |
| 340 | Ga0495580_0001877 | 3300046472 | Bacteria | 18497 |
| 341 | Ga0495582_0000186 | 3300046473 | Bacteria | 34006 |
| 342 | Ga0495639_0000078 | 3300046475 | Bacteria | 46048 |
| 343 | Ga0495639_0022927 | 3300046475 | Bacteria | 2741 |
| 344 | Ga0495662_0001326 | 3300046476 | Bacteria | 12264 |
| 345 | Ga0495664_0008167 | 3300046477 | Bacteria | 5830 |
| 346 | Ga0495664_0011159 | 3300046477 | Bacteria | 5057 |
| 347 | Ga0495594_0000103 | 3300046499 | Bacteria | 39690 |
| 348 | Ga0495594_0030010 | 3300046499 | Bacteria | 2940 |
| 349 | Ga0495583_0040787 | 3300046506 | Bacteria | 2178 |
| 350 | Ga0495606_0004866 | 3300046507 | Bacteria | 13163 |
| 351 | Ga0495608_0017545 | 3300046511 | Bacteria | 4950 |
| 352 | Ga0495608_0031044 | 3300046511 | Bacteria | 3614 |
| 353 | Ga0495618_0117514 | 3300046514 | Bacteria | 1703 |
| 354 | Ga0495618_0120901 | 3300046514 | Bacteria | 1677 |
| 355 | Ga0495628_0014211 | 3300046516 | Bacteria | 6682 |
| 356 | Ga0495630_0003505 | 3300046517 | Bacteria | 10910 |
| 357 | Ga0495630_0153994 | 3300046517 | Bacteria | 1749 |
| 358 | Ga0495631_0042068 | 3300046518 | Bacteria | 2020 |
| 359 | Ga0495631_0043587 | 3300046518 | Bacteria | 1979 |
| 360 | Ga0495643_0099939 | 3300046522 | Bacteria | 1488 |
| 361 | Ga0495644_0026973 | 3300046523 | Bacteria | 2178 |
| 362 | Ga0495648_0002554 | 3300046524 | Bacteria | 16674 |
| 363 | Ga0495648_0007789 | 3300046524 | Bacteria | 8521 |
| 364 | Ga0495648_0024700 | 3300046524 | Bacteria | 4084 |
| 365 | Ga0495666_0093854 | 3300046526 | Bacteria | 1415 |
| 366 | Ga0495652_0004137 | 3300046529 | Bacteria | 13996 |
| 367 | Ga0495652_0131261 | 3300046529 | Bacteria | 1983 |
| 368 | Ga0495652_0166790 | 3300046529 | Bacteria | 1704 |
| 369 | Ga0495665_0000190 | 3300046531 | Bacteria | 31563 |
| 370 | Ga0495640_0001905 | 3300046533 | Bacteria | 16627 |
| 371 | Ga0495640_0087702 | 3300046533 | Bacteria | 2057 |
| 372 | Ga0495622_0005230 | 3300046557 | Bacteria | 6015 |
| 373 | Ga0495622_0015848 | 3300046557 | Bacteria | 3505 |
| 374 | Ga0495667_0006001 | 3300046559 | Bacteria | 8214 |
| 375 | Ga0495667_0009435 | 3300046559 | Bacteria | 6611 |
| 376 | Ga0495656_0060531 | 3300046615 | Bacteria | 1651 |
| 377 | Ga0495634_0001169 | 3300046642 | Bacteria | 24315 |
| 378 | Ga0495634_0064194 | 3300046642 | Bacteria | 2435 |
| 379 | Ga0495625_0053578 | 3300046660 | Bacteria | 2884 |
| 380 | Ga0495635_0000211 | 3300046663 | Bacteria | 36892 |
| 381 | Ga0495635_0000985 | 3300046663 | Bacteria | 18760 |
| 382 | Ga0495635_0015479 | 3300046663 | Bacteria | 5332 |
| 383 | Ga0495588_0001447 | 3300046674 | Bacteria | 10166 |
| 384 | Ga0495588_0033733 | 3300046674 | Bacteria | 2586 |
| 385 | Ga0495588_0054544 | 3300046674 | Bacteria | 2062 |
| 386 | Ga0495657_0000889 | 3300046675 | Bacteria | 26346 |
| 387 | Ga0495657_0013750 | 3300046675 | Bacteria | 5959 |
| 388 | Ga0495599_0000957 | 3300046678 | Bacteria | 16146 |
| 389 | Ga0495599_0083621 | 3300046678 | Bacteria | 1993 |
| 390 | Ga0495623_0005834 | 3300046679 | Bacteria | 8030 |
| 391 | Ga0495623_0005846 | 3300046679 | Bacteria | 8019 |
| 392 | Ga0495646_0022073 | 3300046680 | Bacteria | 4018 |
| 393 | Ga0495647_0028522 | 3300046681 | Bacteria | 2058 |
| 394 | Ga0495658_0000108 | 3300046683 | Bacteria | 43771 |
| 395 | Ga0495658_0013308 | 3300046683 | Bacteria | 4186 |
| 396 | Ga0495669_0001878 | 3300046684 | Bacteria | 8615 |
| 397 | Ga0495613_0010887 | 3300046689 | Bacteria | 6750 |
| 398 | Ga0495613_0105927 | 3300046689 | Bacteria | 2029 |
| 399 | Ga0495624_0003469 | 3300046690 | Bacteria | 11689 |
| 400 | Ga0495600_0001856 | 3300046809 | Bacteria | 11854 |
| 401 | Ga0495600_0009971 | 3300046809 | Bacteria | 5886 |
| 402 | Ga0495600_0036170 | 3300046809 | Bacteria | 3208 |
| 403 | Ga0495581_0000501 | 3300047315 | Bacteria | 20012 |
| 404 | Ga0495581_0013051 | 3300047315 | Bacteria | 4815 |
| 405 | Ga0495581_0127441 | 3300047315 | Bacteria | 1482 |
| 406 | Ga0495604_0015222 | 3300047317 | Bacteria | 6139 |
| 407 | Ga0495604_0025993 | 3300047317 | Bacteria | 4662 |
| 408 | Ga0495674_0000228 | 3300047319 | Bacteria | 46998 |
| 409 | Ga0495674_0008379 | 3300047319 | Bacteria | 9850 |
| 410 | Ga0495674_0070755 | 3300047319 | Bacteria | 3014 |
| 411 | Ga0495672_0011909 | 3300047320 | Bacteria | 6101 |
| 412 | Ga0495676_0152454 | 3300047321 | Bacteria | 1643 |
| 413 | Ga0495680_0002530 | 3300047322 | Bacteria | 18695 |
| 414 | Ga0495673_0012247 | 3300047469 | Bacteria | 4561 |
| 415 | Ga0495684_0018149 | 3300047471 | Bacteria | 5422 |
| 416 | Ga0495684_0143545 | 3300047471 | Bacteria | 1789 |
| 417 | Ga0495686_0008845 | 3300047472 | Bacteria | 7331 |
| 418 | Ga0495593_0002763 | 3300047673 | Bacteria | 10557 |
| 419 | Ga0495593_0056534 | 3300047673 | Bacteria | 2062 |
| 420 | Ga0495593_0084435 | 3300047673 | Bacteria | 1639 |
| 421 | Ga0495602_0003401 | 3300048088 | Bacteria | 16456 |
| 422 | Ga0496100_0041350 | 3300048903 | Bacteria | 2938 |
| 423 | Ga0496101_0039152 | 3300048904 | Bacteria | 3370 |
| 424 | Ga0496101_0081029 | 3300048904 | Bacteria | 2399 |
| 425 | Ga0496102_0008501 | 3300048905 | Bacteria | 8801 |
| 426 | Ga0496103_0016380 | 3300048906 | Bacteria | 4423 |
| 427 | Ga0496103_0157513 | 3300048906 | Bacteria | 1456 |
| 428 | Ga0496104_0000281 | 3300048907 | Bacteria | 45166 |
| 429 | Ga0496104_0005754 | 3300048907 | Bacteria | 10852 |
| 430 | Ga0496104_0008421 | 3300048907 | Bacteria | 9169 |
| 431 | Ga0496104_0025549 | 3300048907 | Bacteria | 5446 |
| 432 | Ga0496105_0011220 | 3300048908 | Bacteria | 7069 |
| 433 | Ga0496105_0043844 | 3300048908 | Bacteria | 3689 |
| 434 | Ga0496106_0005076 | 3300048909 | Bacteria | 9744 |
| 435 | Ga0496106_0131349 | 3300048909 | Bacteria | 1964 |
| 436 | Ga0496107_0070819 | 3300048910 | Bacteria | 2533 |
| 437 | Ga0496108_0000845 | 3300048911 | Bacteria | 23854 |
| 438 | Ga0496109_0000592 | 3300048912 | Bacteria | 30336 |
| 439 | Ga0496109_0298042 | 3300048912 | Bacteria | 1520 |
| 440 | Ga0496110_0011293 | 3300048913 | Bacteria | 7302 |
| 441 | Ga0496110_0023231 | 3300048913 | Bacteria | 5272 |
| 442 | Ga0496110_0245293 | 3300048913 | Bacteria | 1630 |
| 443 | Ga0496111_0031284 | 3300048914 | Bacteria | 3791 |
| 444 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 445 | Ga0496112_0001178 | 3300048915 | Bacteria | 19598 |
| 446 | Ga0496112_0079384 | 3300048915 | Bacteria | 3246 |
| 447 | Ga0496113_0011677 | 3300048916 | Bacteria | 5875 |
| 448 | Ga0496113_0053320 | 3300048916 | Bacteria | 3024 |
| 449 | Ga0496115_0022242 | 3300048918 | Bacteria | 4910 |
| 450 | Ga0496116_0022752 | 3300048919 | Bacteria | 4687 |
| 451 | Ga0496116_0054476 | 3300048919 | Bacteria | 2635 |
| 452 | Ga0496116_0130238 | 3300048919 | Bacteria | 1436 |
| 453 | Ga0496117_0132713 | 3300048920 | Bacteria | 1506 |
| 454 | Ga0496118_0003113 | 3300048921 | Bacteria | 21268 |
| 455 | Ga0496118_0053861 | 3300048921 | Bacteria | 3052 |
| 456 | Ga0496118_0126482 | 3300048921 | Bacteria | 1652 |
| 457 | Ga0496119_0005325 | 3300048922 | Bacteria | 12378 |
| 458 | Ga0496119_0049769 | 3300048922 | Bacteria | 2588 |
| 459 | Ga0496120_0001511 | 3300048923 | Bacteria | 27505 |
| 460 | Ga0496120_0055680 | 3300048923 | Bacteria | 2235 |
| 461 | Ga0496121_0000886 | 3300048924 | Bacteria | 54049 |
| 462 | Ga0496121_0002017 | 3300048924 | Bacteria | 32207 |
| 463 | Ga0496121_0002694 | 3300048924 | Bacteria | 26563 |
| 464 | Ga0496121_0013709 | 3300048924 | Bacteria | 8688 |
| 465 | Ga0496121_0017276 | 3300048924 | Bacteria | 7381 |
| 466 | Ga0496121_0026234 | 3300048924 | Bacteria | 5498 |
| 467 | Ga0496121_0041651 | 3300048924 | Bacteria | 4011 |
| 468 | Ga0496121_0042521 | 3300048924 | Bacteria | 3950 |
| 469 | Ga0496121_0056125 | 3300048924 | Bacteria | 3274 |
| 470 | Ga0496121_0081237 | 3300048924 | Bacteria | 2566 |
| 471 | Ga0496122_0014132 | 3300048925 | Bacteria | 7742 |
| 472 | Ga0496122_0079207 | 3300048925 | Bacteria | 2297 |
| 473 | Ga0496123_0068394 | 3300048926 | Bacteria | 2237 |
| 474 | Ga0496124_0096800 | 3300048927 | Bacteria | 2397 |
| 475 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 476 | Ga0496125_0002027 | 3300048928 | Bacteria | 27438 |
| 477 | Ga0496125_0005006 | 3300048928 | Bacteria | 14960 |
| 478 | Ga0496125_0054179 | 3300048928 | Bacteria | 3280 |
| 479 | Ga0496126_0008257 | 3300048929 | Bacteria | 11246 |
| 480 | Ga0496126_0017486 | 3300048929 | Bacteria | 7141 |
| 481 | Ga0496126_0025006 | 3300048929 | Bacteria | 5755 |
| 482 | Ga0496126_0028691 | 3300048929 | Bacteria | 5299 |
| 483 | Ga0496126_0046030 | 3300048929 | Bacteria | 4006 |
| 484 | Ga0496126_0058006 | 3300048929 | Bacteria | 3491 |
| 485 | Ga0496126_0062123 | 3300048929 | Bacteria | 3353 |
| 486 | Ga0496126_0121969 | 3300048929 | Bacteria | 2259 |
| 487 | Ga0496126_0205544 | 3300048929 | Bacteria | 1660 |
| 488 | Ga0501031_0010139 | 3300049568 | Bacteria | 6140 |
| 489 | Ga0501032_0007050 | 3300049569 | Bacteria | 8245 |
| 490 | Ga0501032_0027533 | 3300049569 | Bacteria | 3906 |
| 491 | Ga0501032_0113009 | 3300049569 | Bacteria | 1796 |
| 492 | Ga0501032_0123021 | 3300049569 | Bacteria | 1714 |
| 493 | Ga0501033_0000250 | 3300049570 | Bacteria | 51978 |
| 494 | Ga0501033_0000553 | 3300049570 | Bacteria | 34827 |
| 495 | Ga0501033_0050247 | 3300049570 | Bacteria | 3094 |
| 496 | Ga0501034_0000892 | 3300049571 | Bacteria | 43725 |
| 497 | Ga0501036_0000267 | 3300049572 | Bacteria | 35613 |
| 498 | Ga0501036_0016285 | 3300049572 | Bacteria | 6211 |
| 499 | Ga0501036_0065694 | 3300049572 | Bacteria | 3069 |
| 500 | Ga0501037_0000257 | 3300049573 | Bacteria | 45676 |
| 501 | Ga0501037_0006617 | 3300049573 | Bacteria | 8472 |
| 502 | Ga0501038_0001535 | 3300049574 | Bacteria | 21306 |
| 503 | Ga0501038_0004912 | 3300049574 | Bacteria | 12421 |
| 504 | Ga0501038_0014599 | 3300049574 | Bacteria | 7158 |
| 505 | Ga0501038_0059534 | 3300049574 | Bacteria | 3271 |
| 506 | Ga0501039_0000488 | 3300049575 | Bacteria | 28748 |
| 507 | Ga0501039_0002930 | 3300049575 | Bacteria | 12771 |
| 508 | Ga0501042_0021357 | 3300049578 | Bacteria | 4511 |
| 509 | Ga0501042_0025726 | 3300049578 | Bacteria | 4135 |
| 510 | Ga0501043_0001660 | 3300049579 | Bacteria | 19307 |
| 511 | Ga0501043_0003909 | 3300049579 | Bacteria | 12219 |
| 512 | Ga0501043_0005331 | 3300049579 | Bacteria | 10393 |
| 513 | Ga0501043_0006924 | 3300049579 | Bacteria | 9041 |
| 514 | Ga0501043_0101724 | 3300049579 | Bacteria | 2258 |
| 515 | Ga0501046_0006487 | 3300049580 | Bacteria | 10349 |
| 516 | Ga0501046_0024923 | 3300049580 | Bacteria | 4900 |
| 517 | Ga0501046_0039030 | 3300049580 | Bacteria | 3806 |
| 518 | Ga0501046_0081404 | 3300049580 | Bacteria | 2500 |
| 519 | Ga0501047_0000123 | 3300049581 | Bacteria | 95016 |
| 520 | Ga0501047_0019457 | 3300049581 | Bacteria | 6512 |
| 521 | Ga0501048_0000108 | 3300049582 | Bacteria | 46455 |
| 522 | Ga0501048_0092763 | 3300049582 | Bacteria | 2130 |
| 523 | Ga0501067_0000267 | 3300049583 | Bacteria | 28494 |
| 524 | Ga0501068_0007488 | 3300049584 | Bacteria | 6042 |
| 525 | Ga0501068_0112976 | 3300049584 | Bacteria | 1690 |
| 526 | Ga0501069_0002404 | 3300049585 | Bacteria | 9510 |
| 527 | Ga0501069_0075288 | 3300049585 | Bacteria | 1896 |
| 528 | Ga0501070_0016149 | 3300049586 | Bacteria | 6275 |
| 529 | Ga0501070_0024041 | 3300049586 | Bacteria | 5109 |
| 530 | Ga0501071_0041215 | 3300049587 | Bacteria | 3307 |
| 531 | Ga0501072_0000898 | 3300049588 | Bacteria | 21826 |
| 532 | Ga0501073_0000014 | 3300049589 | Bacteria | 159719 |
| 533 | Ga0501073_0008879 | 3300049589 | Bacteria | 7430 |
| 534 | Ga0501074_0009185 | 3300049590 | Bacteria | 7181 |
| 535 | Ga0501076_0165258 | 3300049592 | Bacteria | 1804 |
| 536 | Ga0501080_0018899 | 3300049742 | Bacteria | 6381 |
| 537 | Ga0501080_0031341 | 3300049742 | Bacteria | 4954 |
| 538 | Ga0501080_0204945 | 3300049742 | Bacteria | 1809 |
| 539 | Ga0501083_0000289 | 3300049744 | Bacteria | 31855 |
| 540 | Ga0501083_0018277 | 3300049744 | Bacteria | 4886 |
| 541 | Ga0501035_0000608 | 3300049822 | Bacteria | 39520 |
| 542 | Ga0501035_0115601 | 3300049822 | Bacteria | 2348 |
| 543 | Ga0501035_0143976 | 3300049822 | Bacteria | 2071 |
| 544 | Ga0501044_0000344 | 3300049823 | Bacteria | 58547 |
| 545 | Ga0501044_0070406 | 3300049823 | Bacteria | 3557 |
| 546 | Ga0501044_0146266 | 3300049823 | Bacteria | 2348 |
| 547 | Ga0501045_0005228 | 3300049824 | Bacteria | 8978 |
| 548 | nmdc:mga06z11_1297_c1 | 3300050494 | Bacteria | 9247 |
| 549 | nmdc:mga06z11_53375_c1 | 3300050494 | Bacteria | 2079 |
| 550 | nmdc:mga05p37_52659_c1 | 3300050507 | Bacteria | 5004 |
| 551 | nmdc:mga08y16_65892_c1 | 3300050511 | Bacteria | 3780 |
| 552 | nmdc:mga0rr50_165411_c1 | 3300050513 | Bacteria | 1798 |
| 553 | nmdc:mga0sz30_43742_c1 | 3300050516 | Bacteria | 1886 |
| 554 | Ga0495612_0023374 | 3300053078 | Bacteria | 2480 |
| 555 | Ga0500635_0003054 | 3300053080 | Bacteria | 4182 |
| 556 | Ga0495595_0079663 | 3300053084 | Bacteria | 1558 |
| 557 | Ga0495619_0014968 | 3300053085 | Bacteria | 4901 |
| 558 | Ga0495619_0061030 | 3300053085 | Bacteria | 2507 |
| 559 | Ga0500643_000319 | 3300053087 | Bacteria | 38698 |
| 560 | Ga0500646_0007605 | 3300053090 | Bacteria | 2769 |
| 561 | Ga0500583_0026742 | 3300053092 | Bacteria | 2482 |
| 562 | Ga0500651_0001711 | 3300053093 | Bacteria | 11216 |
| 563 | Ga0500566_0000117 | 3300053094 | Bacteria | 41371 |
| 564 | Ga0500566_0001715 | 3300053094 | Bacteria | 12869 |
| 565 | Ga0500640_000141 | 3300053095 | Bacteria | 13874 |
| 566 | Ga0500641_0059093 | 3300053096 | Bacteria | 1593 |
| 567 | Ga0500641_0067055 | 3300053096 | Bacteria | 1503 |
| 568 | Ga0500554_000617 | 3300053102 | Bacteria | 7222 |
| 569 | Ga0500555_003231 | 3300053103 | Bacteria | 4642 |
| 570 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 571 | Ga0500556_0009163 | 3300053104 | Bacteria | 2870 |
| 572 | Ga0500557_000162 | 3300053105 | Bacteria | 14804 |
| 573 | Ga0500572_000828 | 3300053111 | Bacteria | 9757 |
| 574 | Ga0500572_001082 | 3300053111 | Bacteria | 8023 |
| 575 | Ga0500592_007011 | 3300053116 | Bacteria | 1792 |
| 576 | Ga0500595_001406 | 3300053119 | Bacteria | 12911 |
| 577 | Ga0500595_001750 | 3300053119 | Bacteria | 11313 |
| 578 | Ga0500595_023301 | 3300053119 | Bacteria | 2178 |
| 579 | Ga0500608_043407 | 3300053122 | Bacteria | 2159 |
| 580 | Ga0500614_000264 | 3300053123 | Bacteria | 13542 |
| 581 | Ga0500618_003608 | 3300053125 | Bacteria | 5251 |
| 582 | Ga0500642_0000057 | 3300053130 | Bacteria | 67011 |
| 583 | Ga0500642_0000876 | 3300053130 | Bacteria | 8748 |
| 584 | Ga0500652_000965 | 3300053131 | Bacteria | 9504 |
| 585 | Ga0500658_0035161 | 3300053134 | Bacteria | 1981 |
| 586 | Ga0500559_0000242 | 3300053136 | Bacteria | 43285 |
| 587 | Ga0500559_0002978 | 3300053136 | Bacteria | 8498 |
| 588 | Ga0500559_0012427 | 3300053136 | Bacteria | 3618 |
| 589 | Ga0500568_0001500 | 3300053139 | Bacteria | 14911 |
| 590 | Ga0500568_0013309 | 3300053139 | Bacteria | 3752 |
| 591 | Ga0500568_0024271 | 3300053139 | Bacteria | 2569 |
| 592 | Ga0500577_0000095 | 3300053142 | Bacteria | 21049 |
| 593 | Ga0500586_019666 | 3300053145 | Bacteria | 2103 |
| 594 | Ga0500590_035432 | 3300053148 | Bacteria | 2583 |
| 595 | Ga0500603_000306 | 3300053150 | Bacteria | 12834 |
| 596 | Ga0500603_000586 | 3300053150 | Bacteria | 9099 |
| 597 | Ga0500604_0003637 | 3300053151 | Bacteria | 4145 |
| 598 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 599 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 600 | Ga0500622_0005168 | 3300053156 | Bacteria | 7911 |
| 601 | Ga0500622_0042459 | 3300053156 | Bacteria | 2362 |
| 602 | Ga0500630_000221 | 3300053159 | Bacteria | 22394 |
| 603 | Ga0500639_000041 | 3300053163 | Bacteria | 61893 |
| 604 | Ga0500636_0000614 | 3300053177 | Bacteria | 19317 |
| 605 | Ga0500636_0082173 | 3300053177 | Bacteria | 1854 |
| 606 | Ga0500637_0000282 | 3300053178 | Bacteria | 18981 |
| 607 | Ga0500637_0076481 | 3300053178 | Bacteria | 1930 |
| 608 | Ga0500570_065323 | 3300053724 | Bacteria | 1734 |
| 609 | Ga0500576_041784 | 3300053725 | Bacteria | 2061 |
| 610 | Ga0500625_001494 | 3300053729 | Bacteria | 8078 |
| 611 | Ga0500645_006818 | 3300053730 | Bacteria | 4037 |
| 612 | Ga0500645_019623 | 3300053730 | Bacteria | 2101 |
| 613 | Ga0500609_004321 | 3300053731 | Bacteria | 1970 |
| 614 | Ga0500596_001100 | 3300053735 | Bacteria | 5443 |
| 615 | Ga0500599_000137 | 3300053736 | Bacteria | 6696 |
| 616 | Ga0500601_000052 | 3300053737 | Bacteria | 24522 |
| 617 | Ga0500601_002092 | 3300053737 | Bacteria | 2141 |
| 618 | Ga0501084_0001855 | 3300054114 | Bacteria | 16855 |
| 619 | Ga0500661_000108 | 3300055283 | Bacteria | 13387 |
| 620 | Ga0501082_0006680 | 3300060353 | Bacteria | 9981 |
| 621 | Ga0501082_0085494 | 3300060353 | Bacteria | 2720 |
| 622 | Ga0466962_0038186 | 3300061719 | Bacteria | 2300 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046506 | Ga0495583_0040787 | Ga0495583_0040787_22_1188 | 351 |
| 2 | iso_pu_bacteria | 2824704595 | 2824714581 | 365 |
| 3 | 3300053725 | Ga0500576_041784 | Ga0500576_041784_11_1213 | 377 |
| 4 | iso_pu_bacteria | 2824661429 | 2824671226 | 378 |
| 5 | iso_pu_bacteria | 2824644064 | 2824652921 | 379 |
| 6 | iso_pu_bacteria | 2824714736 | 2824723674 | 382 |
| 7 | iso_pu_bacteria | 2824723954 | 2824732780 | 384 |
| 8 | 3300049584 | Ga0501068_0112976 | Ga0501068_0112976_41_1345 | 387 |
| 9 | iso_pu_bacteria | 2824635225 | 2824643956 | 388 |
| 10 | 3300050494 | nmdc:mga06z11_1297_c1 | nmdc:mga06z11_1297_c1_2016_3389 | 389 |
| 11 | iso_pu_bacteria | 2824653114 | 2824661363 | 389 |
| 12 | 3300009545 | Ga0105237_10025027 | Ga0105237_100250276 | 390 |
| 13 | 3300047471 | Ga0495684_0018149 | Ga0495684_0018149_4172_5410 | 390 |
| 14 | 3300025914 | Ga0207671_10016997 | Ga0207671_100169976 | 392 |
| 15 | 3300053125 | Ga0500618_003608 | Ga0500618_003608_1541_2911 | 394 |
| 16 | 3300053177 | Ga0500636_0000614 | Ga0500636_0000614_2761_4131 | 394 |
| 17 | 3300031712 | Ga0265342_10003896 | Ga0265342_100038968 | 398 |
| 18 | 3300049585 | Ga0501069_0075288 | Ga0501069_0075288_72_1445 | 399 |
| 19 | iso_pu_bacteria | 2824617872 | 2824621915 | 399 |
| 20 | 3300006178 | Ga0075367_10001858 | Ga0075367_100018586 | 400 |
| 21 | 3300053142 | Ga0500577_0000095 | Ga0500577_0000095_15596_16966 | 400 |
| 22 | iso_pu_bacteria | 2903768456 | 2903775891 | 400 |
| 23 | iso_pu_bacteria | 2885383462 | 2885388296 | 401 |
| 24 | 3300025297 | Ga0209758_1027110 | Ga0209758_10271103 | 402 |
| 25 | 3300033180 | Ga0307510_10133015 | Ga0307510_101330152 | 402 |
| 26 | 3300013104 | Ga0157370_10188643 | Ga0157370_101886431 | 403 |
| 27 | 3300037471 | Ga0395905_0009682 | Ga0395905_0009682_1377_2747 | 403 |
| 28 | 3300048910 | Ga0496107_0070819 | Ga0496107_0070819_641_2005 | 403 |
| 29 | 3300048924 | Ga0496121_0002694 | Ga0496121_0002694_2614_3978 | 403 |
| 30 | 3300048929 | Ga0496126_0062123 | Ga0496126_0062123_1235_2599 | 403 |
| 31 | 3300053145 | Ga0500586_019666 | Ga0500586_019666_286_1890 | 403 |
| 32 | 3300053156 | Ga0500622_0042459 | Ga0500622_0042459_589_1959 | 403 |
| 33 | 3300053177 | Ga0500636_0082173 | Ga0500636_0082173_408_1781 | 403 |
| 34 | 3300053736 | Ga0500599_000137 | Ga0500599_000137_2716_4086 | 403 |
| 35 | 3300025929 | Ga0207664_10059216 | Ga0207664_100592162 | 404 |
| 36 | 3300033180 | Ga0307510_10017631 | Ga0307510_100176314 | 404 |
| 37 | 3300046507 | Ga0495606_0004866 | Ga0495606_0004866_7983_9383 | 404 |
| 38 | 3300053116 | Ga0500592_007011 | Ga0500592_007011_274_1644 | 404 |
| 39 | 3300005985 | Ga0081539_10087132 | Ga0081539_100871321 | 405 |
| 40 | 3300009551 | Ga0105238_10051276 | Ga0105238_100512763 | 405 |
| 41 | 3300025924 | Ga0207694_10056360 | Ga0207694_100563603 | 405 |
| 42 | 3300046460 | Ga0495638_0001532 | Ga0495638_0001532_6668_8038 | 405 |
| 43 | 3300053130 | Ga0500642_0000057 | Ga0500642_0000057_21720_23090 | 405 |
| 44 | 3300053729 | Ga0500625_001494 | Ga0500625_001494_1095_2465 | 405 |
| 45 | 3300031507 | Ga0307509_10143252 | Ga0307509_101432521 | 406 |
| 46 | 3300049587 | Ga0501071_0041215 | Ga0501071_0041215_12_1316 | 406 |
| 47 | 3300004625 | Ga0055543_1003802 | Ga0055543_10038023 | 407 |
| 48 | 3300005262 | Ga0065165_1002181 | Ga0065165_10021814 | 407 |
| 49 | 3300007265 | Ga0099794_10058269 | Ga0099794_100582692 | 407 |
| 50 | 3300025302 | Ga0207426_1020516 | Ga0207426_10205162 | 407 |
| 51 | 3300006038 | Ga0075365_10128669 | Ga0075365_101286691 | 408 |
| 52 | 3300046518 | Ga0495631_0043587 | Ga0495631_0043587_348_1718 | 408 |
| 53 | 3300046660 | Ga0495625_0053578 | Ga0495625_0053578_352_1722 | 408 |
| 54 | 3300048921 | Ga0496118_0126482 | Ga0496118_0126482_230_1600 | 408 |
| 55 | 3300048928 | Ga0496125_0005006 | Ga0496125_0005006_1519_2889 | 408 |
| 56 | 3300049568 | Ga0501031_0010139 | Ga0501031_0010139_4109_5476 | 408 |
| 57 | 3300049569 | Ga0501032_0027533 | Ga0501032_0027533_2341_3708 | 408 |
| 58 | 3300049570 | Ga0501033_0000250 | Ga0501033_0000250_45742_47109 | 408 |
| 59 | 3300049572 | Ga0501036_0065694 | Ga0501036_0065694_34_1401 | 408 |
| 60 | 3300049573 | Ga0501037_0006617 | Ga0501037_0006617_2540_3907 | 408 |
| 61 | 3300049575 | Ga0501039_0002930 | Ga0501039_0002930_6696_8063 | 408 |
| 62 | 3300049578 | Ga0501042_0025726 | Ga0501042_0025726_1503_2870 | 408 |
| 63 | 3300049579 | Ga0501043_0001660 | Ga0501043_0001660_15051_16418 | 408 |
| 64 | 3300049580 | Ga0501046_0081404 | Ga0501046_0081404_757_2124 | 408 |
| 65 | 3300005983 | Ga0081540_1006111 | Ga0081540_10061112 | 409 |
| 66 | 3300006038 | Ga0075365_10032771 | Ga0075365_100327711 | 409 |
| 67 | 3300046459 | Ga0495629_0085573 | Ga0495629_0085573_99_1394 | 409 |
| 68 | iso_pu_bacteria | 8006994254 | 8006994814 | 409 |
| 69 | 3300005366 | Ga0070659_100171022 | Ga0070659_1001710222 | 410 |
| 70 | 3300005563 | Ga0068855_100094442 | Ga0068855_1000944424 | 410 |
| 71 | 3300005616 | Ga0068852_100016848 | Ga0068852_1000168484 | 410 |
| 72 | 3300035724 | Ga0373933_0001176 | Ga0373933_0001176_9534_10904 | 410 |
| 73 | 3300046524 | Ga0495648_0002554 | Ga0495648_0002554_14633_16003 | 410 |
| 74 | 3300046524 | Ga0495648_0024700 | Ga0495648_0024700_871_2241 | 411 |
| 75 | 3300048919 | Ga0496116_0022752 | Ga0496116_0022752_490_1860 | 411 |
| 76 | 3300048921 | Ga0496118_0053861 | Ga0496118_0053861_1160_2530 | 411 |
| 77 | 3300048927 | Ga0496124_0096800 | Ga0496124_0096800_685_2055 | 411 |
| 78 | 3300053156 | Ga0500622_0005168 | Ga0500622_0005168_5914_7284 | 411 |
| 79 | 3300053730 | Ga0500645_019623 | Ga0500645_019623_719_2089 | 411 |
| 80 | 3300005614 | Ga0068856_100005538 | Ga0068856_1000055384 | 412 |
| 81 | 3300006175 | Ga0070712_100093737 | Ga0070712_1000937372 | 412 |
| 82 | 3300025915 | Ga0207693_10008179 | Ga0207693_100081792 | 412 |
| 83 | 3300026078 | Ga0207702_10191830 | Ga0207702_101918302 | 412 |
| 84 | 3300049580 | Ga0501046_0039030 | Ga0501046_0039030_368_1735 | 412 |
| 85 | 3300049742 | Ga0501080_0031341 | Ga0501080_0031341_3195_4562 | 412 |
| 86 | 3300053724 | Ga0500570_065323 | Ga0500570_065323_25_1395 | 412 |
| 87 | 3300005455 | Ga0070663_100014414 | Ga0070663_1000144144 | 413 |
| 88 | 3300006038 | Ga0075365_10119454 | Ga0075365_101194541 | 413 |
| 89 | 3300006847 | Ga0075431_100212076 | Ga0075431_1002120762 | 413 |
| 90 | 3300026067 | Ga0207678_10015346 | Ga0207678_100153466 | 413 |
| 91 | 3300046522 | Ga0495643_0099939 | Ga0495643_0099939_70_1467 | 413 |
| 92 | 3300048923 | Ga0496120_0055680 | Ga0496120_0055680_23_1393 | 413 |
| 93 | 3300053130 | Ga0500642_0000876 | Ga0500642_0000876_665_2035 | 413 |
| 94 | 3300053139 | Ga0500568_0001500 | Ga0500568_0001500_546_1916 | 413 |
| 95 | 3300053151 | Ga0500604_0003637 | Ga0500604_0003637_1160_2530 | 413 |
| 96 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_3874_5244 | 413 |
| 97 | 3300006178 | Ga0075367_10019050 | Ga0075367_100190501 | 414 |
| 98 | 3300048924 | Ga0496121_0013709 | Ga0496121_0013709_640_2010 | 414 |
| 99 | 3300035118 | Ga0373954_0007067 | Ga0373954_0007067_12_1325 | 415 |
| 100 | 3300046454 | Ga0495592_0028302 | Ga0495592_0028302_437_1807 | 415 |
| 101 | 3300046462 | Ga0495651_0001520 | Ga0495651_0001520_12704_14074 | 415 |
| 102 | 3300046511 | Ga0495608_0017545 | Ga0495608_0017545_1920_3290 | 415 |
| 103 | 3300046516 | Ga0495628_0014211 | Ga0495628_0014211_5182_6552 | 415 |
| 104 | 3300046529 | Ga0495652_0004137 | Ga0495652_0004137_7310_8680 | 415 |
| 105 | 3300046559 | Ga0495667_0006001 | Ga0495667_0006001_581_1951 | 415 |
| 106 | 3300046642 | Ga0495634_0064194 | Ga0495634_0064194_604_1974 | 415 |
| 107 | 3300046675 | Ga0495657_0000889 | Ga0495657_0000889_9199_10569 | 415 |
| 108 | 3300046678 | Ga0495599_0083621 | Ga0495599_0083621_251_1621 | 415 |
| 109 | 3300046679 | Ga0495623_0005846 | Ga0495623_0005846_1146_2516 | 415 |
| 110 | 3300046809 | Ga0495600_0001856 | Ga0495600_0001856_4403_5773 | 415 |
| 111 | 3300047319 | Ga0495674_0008379 | Ga0495674_0008379_2299_3669 | 415 |
| 112 | 3300047322 | Ga0495680_0002530 | Ga0495680_0002530_8751_10121 | 415 |
| 113 | 3300048088 | Ga0495602_0003401 | Ga0495602_0003401_9086_10456 | 415 |
| 114 | 3300005434 | Ga0070709_10000376 | Ga0070709_100003769 | 416 |
| 115 | 3300005435 | Ga0070714_100071962 | Ga0070714_1000719623 | 416 |
| 116 | 3300005437 | Ga0070710_10000497 | Ga0070710_100004977 | 416 |
| 117 | 3300005439 | Ga0070711_100023752 | Ga0070711_1000237521 | 416 |
| 118 | 3300005841 | Ga0068863_100033056 | Ga0068863_1000330563 | 416 |
| 119 | 3300006028 | Ga0070717_10051048 | Ga0070717_100510482 | 416 |
| 120 | 3300006173 | Ga0070716_100045989 | Ga0070716_1000459892 | 416 |
| 121 | 3300025230 | Ga0209563_100727 | Ga0209563_1007279 | 416 |
| 122 | 3300025253 | Ga0209677_104304 | Ga0209677_1043044 | 416 |
| 123 | 3300025898 | Ga0207692_10000915 | Ga0207692_100009152 | 416 |
| 124 | 3300025906 | Ga0207699_10001327 | Ga0207699_100013276 | 416 |
| 125 | 3300025916 | Ga0207663_10145865 | Ga0207663_101458651 | 416 |
| 126 | 3300025929 | Ga0207664_10044500 | Ga0207664_100445003 | 416 |
| 127 | 3300031616 | Ga0307508_10107568 | Ga0307508_101075681 | 416 |
| 128 | 3300041413 | Ga0439465_0005851 | Ga0439465_0005851_1752_3122 | 416 |
| 129 | 3300046460 | Ga0495638_0060740 | Ga0495638_0060740_557_1927 | 416 |
| 130 | 3300048924 | Ga0496121_0042521 | Ga0496121_0042521_82_1452 | 416 |
| 131 | 3300048925 | Ga0496122_0079207 | Ga0496122_0079207_487_1857 | 416 |
| 132 | 3300048926 | Ga0496123_0068394 | Ga0496123_0068394_729_2099 | 416 |
| 133 | 3300048929 | Ga0496126_0058006 | Ga0496126_0058006_1667_3037 | 416 |
| 134 | 3300053090 | Ga0500646_0007605 | Ga0500646_0007605_1006_2376 | 416 |
| 135 | 3300053094 | Ga0500566_0001715 | Ga0500566_0001715_3743_5113 | 416 |
| 136 | 3300005366 | Ga0070659_100259197 | Ga0070659_1002591971 | 417 |
| 137 | 3300026067 | Ga0207678_10089106 | Ga0207678_100891062 | 417 |
| 138 | 3300028379 | Ga0268266_10036645 | Ga0268266_100366453 | 417 |
| 139 | 3300003203 | JGI25406J46586_10003494 | JGI25406J46586_100034945 | 418 |
| 140 | 3300005437 | Ga0070710_10093308 | Ga0070710_100933081 | 418 |
| 141 | 3300005843 | Ga0068860_100001652 | Ga0068860_10000165219 | 418 |
| 142 | 3300005985 | Ga0081539_10000341 | Ga0081539_1000034144 | 418 |
| 143 | 3300006028 | Ga0070717_10163017 | Ga0070717_101630171 | 418 |
| 144 | 3300025898 | Ga0207692_10075490 | Ga0207692_100754901 | 418 |
| 145 | 3300025906 | Ga0207699_10019793 | Ga0207699_100197934 | 418 |
| 146 | 3300025916 | Ga0207663_10028587 | Ga0207663_100285871 | 418 |
| 147 | 3300028381 | Ga0268264_10000048 | Ga0268264_10000048158 | 418 |
| 148 | 3300047315 | Ga0495581_0127441 | Ga0495581_0127441_33_1358 | 418 |
| 149 | 3300048919 | Ga0496116_0130238 | Ga0496116_0130238_99_1424 | 418 |
| 150 | 3300013307 | Ga0157372_10043633 | Ga0157372_100436333 | 419 |
| 151 | 3300028556 | Ga0265337_1009505 | Ga0265337_10095052 | 419 |
| 152 | 3300028558 | Ga0265326_10016163 | Ga0265326_100161632 | 419 |
| 153 | 3300028563 | Ga0265319_1005194 | Ga0265319_10051944 | 419 |
| 154 | 3300028573 | Ga0265334_10003849 | Ga0265334_100038495 | 419 |
| 155 | 3300028653 | Ga0265323_10001021 | Ga0265323_100010218 | 419 |
| 156 | 3300028666 | Ga0265336_10000397 | Ga0265336_1000039724 | 419 |
| 157 | 3300028800 | Ga0265338_10000034 | Ga0265338_10000034102 | 419 |
| 158 | 3300031241 | Ga0265325_10015311 | Ga0265325_100153111 | 419 |
| 159 | 3300037418 | Ga0395900_0083776 | Ga0395900_0083776_1466_2839 | 419 |
| 160 | 3300046517 | Ga0495630_0003505 | Ga0495630_0003505_15_1340 | 419 |
| 161 | 3300053092 | Ga0500583_0026742 | Ga0500583_0026742_1010_2380 | 419 |
| 162 | 3300053096 | Ga0500641_0059093 | Ga0500641_0059093_120_1490 | 419 |
| 163 | 3300053103 | Ga0500555_003231 | Ga0500555_003231_583_1953 | 419 |
| 164 | 3300053139 | Ga0500568_0024271 | Ga0500568_0024271_117_1487 | 419 |
| 165 | 3300009094 | Ga0111539_10091707 | Ga0111539_100917073 | 420 |
| 166 | 3300021384 | Ga0213876_10000898 | Ga0213876_100008986 | 420 |
| 167 | 3300025910 | Ga0207684_10086326 | Ga0207684_100863262 | 420 |
| 168 | 3300039437 | Ga0436365_0191965 | Ga0436365_0191965_29290_30723 | 420 |
| 169 | 3300048924 | Ga0496121_0081237 | Ga0496121_0081237_429_1799 | 420 |
| 170 | 3300053136 | Ga0500559_0012427 | Ga0500559_0012427_1371_2741 | 420 |
| 171 | 3300005937 | Ga0081455_10001359 | Ga0081455_1000135922 | 421 |
| 172 | 3300006353 | Ga0075370_10037604 | Ga0075370_100376042 | 421 |
| 173 | 3300044656 | Ga0466969_0022064 | Ga0466969_0022064_1523_2893 | 421 |
| 174 | 3300044693 | Ga0466961_0000050 | Ga0466961_0000050_5381_6751 | 421 |
| 175 | 3300045049 | Ga0466959_0003216 | Ga0466959_0003216_492_1862 | 421 |
| 176 | 3300026121 | Ga0207683_10046044 | Ga0207683_100460442 | 422 |
| 177 | 3300031711 | Ga0265314_10014031 | Ga0265314_100140317 | 422 |
| 178 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_122385_123755 | 422 |
| 179 | 3300005617 | Ga0068859_100147849 | Ga0068859_1001478492 | 423 |
| 180 | 3300006931 | Ga0097620_100147857 | Ga0097620_1001478572 | 423 |
| 181 | 3300025297 | Ga0209758_1000530 | Ga0209758_100053020 | 423 |
| 182 | 3300025302 | Ga0207426_1000429 | Ga0207426_100042920 | 423 |
| 183 | 3300031731 | Ga0307405_10047565 | Ga0307405_100475652 | 423 |
| 184 | 3300046518 | Ga0495631_0042068 | Ga0495631_0042068_152_1522 | 423 |
| 185 | 3300048922 | Ga0496119_0049769 | Ga0496119_0049769_313_1683 | 423 |
| 186 | 3300048924 | Ga0496121_0017276 | Ga0496121_0017276_4653_6017 | 423 |
| 187 | 3300048929 | Ga0496126_0121969 | Ga0496126_0121969_13_1383 | 423 |
| 188 | 3300050516 | nmdc:mga0sz30_43742_c1 | nmdc:mga0sz30_43742_c1_33_1403 | 423 |
| 189 | 3300005329 | Ga0070683_100016132 | Ga0070683_1000161323 | 424 |
| 190 | 3300005535 | Ga0070684_100090204 | Ga0070684_1000902042 | 424 |
| 191 | 3300025944 | Ga0207661_10000647 | Ga0207661_100006479 | 424 |
| 192 | 3300037471 | Ga0395905_0014127 | Ga0395905_0014127_1247_2617 | 424 |
| 193 | 3300048928 | Ga0496125_0002027 | Ga0496125_0002027_500_1870 | 424 |
| 194 | 3300049822 | Ga0501035_0143976 | Ga0501035_0143976_14_1387 | 424 |
| 195 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_218396_219781 | 424 |
| 196 | 3300025901 | Ga0207688_10049442 | Ga0207688_100494422 | 425 |
| 197 | 3300031250 | Ga0265331_10016991 | Ga0265331_100169913 | 425 |
| 198 | 3300047472 | Ga0495686_0008845 | Ga0495686_0008845_4494_5861 | 425 |
| 199 | 3300048929 | Ga0496126_0017486 | Ga0496126_0017486_4498_5865 | 425 |
| 200 | 3300049569 | Ga0501032_0123021 | Ga0501032_0123021_301_1668 | 425 |
| 201 | 3300049574 | Ga0501038_0014599 | Ga0501038_0014599_4236_5603 | 425 |
| 202 | 3300053093 | Ga0500651_0001711 | Ga0500651_0001711_7139_8503 | 425 |
| 203 | iso_pu_bacteria | 2513237141 | 2513891366 | 425 |
| 204 | 3300005262 | Ga0065165_1002644 | Ga0065165_100264413 | 426 |
| 205 | 3300005367 | Ga0070667_100101821 | Ga0070667_1001018212 | 426 |
| 206 | 3300006942 | Ga0099824_1015819 | Ga0099824_10158194 | 426 |
| 207 | 3300025302 | Ga0207426_1000998 | Ga0207426_10009986 | 426 |
| 208 | 3300025904 | Ga0207647_10118780 | Ga0207647_101187801 | 426 |
| 209 | 3300025919 | Ga0207657_10006063 | Ga0207657_100060638 | 426 |
| 210 | 3300027296 | Ga0209389_1000134 | Ga0209389_100013432 | 426 |
| 211 | 3300027357 | Ga0209589_1000033 | Ga0209589_100003394 | 426 |
| 212 | 3300027361 | Ga0209489_100040 | Ga0209489_10004056 | 426 |
| 213 | 3300028379 | Ga0268266_10105326 | Ga0268266_101053263 | 426 |
| 214 | 3300035695 | Ga0373927_0000985 | Ga0373927_0000985_17863_19233 | 426 |
| 215 | 3300038443 | Ga0395901_0109013 | Ga0395901_0109013_1219_2592 | 426 |
| 216 | 3300046460 | Ga0495638_0051184 | Ga0495638_0051184_557_1927 | 426 |
| 217 | 3300048906 | Ga0496103_0157513 | Ga0496103_0157513_46_1416 | 426 |
| 218 | 3300049570 | Ga0501033_0050247 | Ga0501033_0050247_884_2251 | 426 |
| 219 | 3300049574 | Ga0501038_0001535 | Ga0501038_0001535_2151_3518 | 426 |
| 220 | 3300049574 | Ga0501038_0059534 | Ga0501038_0059534_1342_2709 | 426 |
| 221 | 3300049579 | Ga0501043_0006924 | Ga0501043_0006924_5467_6834 | 426 |
| 222 | 3300049579 | Ga0501043_0101724 | Ga0501043_0101724_478_1845 | 426 |
| 223 | 3300049581 | Ga0501047_0019457 | Ga0501047_0019457_4185_5552 | 426 |
| 224 | 3300049584 | Ga0501068_0007488 | Ga0501068_0007488_4620_5987 | 426 |
| 225 | 3300049589 | Ga0501073_0008879 | Ga0501073_0008879_4747_6114 | 426 |
| 226 | 3300049592 | Ga0501076_0165258 | Ga0501076_0165258_33_1400 | 426 |
| 227 | 3300053096 | Ga0500641_0067055 | Ga0500641_0067055_55_1425 | 426 |
| 228 | 3300053131 | Ga0500652_000965 | Ga0500652_000965_7474_8844 | 426 |
| 229 | 3300060353 | Ga0501082_0085494 | Ga0501082_0085494_1074_2441 | 426 |
| 230 | 3300005356 | Ga0070674_100053656 | Ga0070674_1000536563 | 427 |
| 231 | 3300005366 | Ga0070659_100058474 | Ga0070659_1000584743 | 427 |
| 232 | 3300005563 | Ga0068855_100291560 | Ga0068855_1002915601 | 427 |
| 233 | 3300005719 | Ga0068861_100179594 | Ga0068861_1001795942 | 427 |
| 234 | 3300009093 | Ga0105240_10013705 | Ga0105240_100137052 | 427 |
| 235 | 3300009098 | Ga0105245_10141381 | Ga0105245_101413812 | 427 |
| 236 | 3300009553 | Ga0105249_10107809 | Ga0105249_101078092 | 427 |
| 237 | 3300013105 | Ga0157369_10004083 | Ga0157369_1000408317 | 427 |
| 238 | 3300025297 | Ga0209758_1005198 | Ga0209758_10051983 | 427 |
| 239 | 3300025937 | Ga0207669_10014040 | Ga0207669_100140402 | 427 |
| 240 | 3300026075 | Ga0207708_10048033 | Ga0207708_100480332 | 427 |
| 241 | 3300026118 | Ga0207675_100029871 | Ga0207675_1000298713 | 427 |
| 242 | 3300044658 | Ga0466972_0000200 | Ga0466972_0000200_3580_4950 | 427 |
| 243 | 3300044683 | Ga0466965_0076660 | Ga0466965_0076660_14_1384 | 427 |
| 244 | 3300044842 | Ga0466957_0017874 | Ga0466957_0017874_1758_3164 | 427 |
| 245 | 3300046459 | Ga0495629_0008916 | Ga0495629_0008916_2106_3476 | 427 |
| 246 | 3300046462 | Ga0495651_0067192 | Ga0495651_0067192_216_1586 | 427 |
| 247 | 3300046463 | Ga0495653_0057882 | Ga0495653_0057882_1107_2477 | 427 |
| 248 | 3300046511 | Ga0495608_0031044 | Ga0495608_0031044_211_1581 | 427 |
| 249 | 3300046514 | Ga0495618_0120901 | Ga0495618_0120901_268_1638 | 427 |
| 250 | 3300046557 | Ga0495622_0005230 | Ga0495622_0005230_2477_3847 | 427 |
| 251 | 3300046663 | Ga0495635_0015479 | Ga0495635_0015479_1030_2400 | 427 |
| 252 | 3300046675 | Ga0495657_0013750 | Ga0495657_0013750_4510_5880 | 427 |
| 253 | 3300046684 | Ga0495669_0001878 | Ga0495669_0001878_3290_4660 | 427 |
| 254 | 3300046689 | Ga0495613_0010887 | Ga0495613_0010887_4043_5413 | 427 |
| 255 | 3300046809 | Ga0495600_0036170 | Ga0495600_0036170_705_2075 | 427 |
| 256 | 3300047317 | Ga0495604_0015222 | Ga0495604_0015222_2006_3376 | 427 |
| 257 | 3300047471 | Ga0495684_0143545 | Ga0495684_0143545_292_1662 | 427 |
| 258 | 3300047673 | Ga0495593_0084435 | Ga0495593_0084435_151_1521 | 427 |
| 259 | 3300048904 | Ga0496101_0039152 | Ga0496101_0039152_861_2324 | 427 |
| 260 | 3300048907 | Ga0496104_0000281 | Ga0496104_0000281_16394_17764 | 427 |
| 261 | 3300048907 | Ga0496104_0025549 | Ga0496104_0025549_2335_3798 | 427 |
| 262 | 3300048908 | Ga0496105_0011220 | Ga0496105_0011220_197_1567 | 427 |
| 263 | 3300048909 | Ga0496106_0005076 | Ga0496106_0005076_3878_5341 | 427 |
| 264 | 3300048911 | Ga0496108_0000845 | Ga0496108_0000845_8606_10069 | 427 |
| 265 | 3300048912 | Ga0496109_0000592 | Ga0496109_0000592_17567_19030 | 427 |
| 266 | 3300048913 | Ga0496110_0011293 | Ga0496110_0011293_3264_4727 | 427 |
| 267 | 3300048915 | Ga0496112_0001178 | Ga0496112_0001178_3171_4634 | 427 |
| 268 | 3300048916 | Ga0496113_0011677 | Ga0496113_0011677_2588_3958 | 427 |
| 269 | 3300048922 | Ga0496119_0005325 | Ga0496119_0005325_4174_5544 | 427 |
| 270 | 3300048923 | Ga0496120_0001511 | Ga0496120_0001511_22774_24144 | 427 |
| 271 | 3300048929 | Ga0496126_0025006 | Ga0496126_0025006_2396_3766 | 427 |
| 272 | 3300053087 | Ga0500643_000319 | Ga0500643_000319_19773_21143 | 427 |
| 273 | 3300053737 | Ga0500601_000052 | Ga0500601_000052_12529_13899 | 427 |
| 274 | iso_pu_bacteria | 3005587118 | 3005587166 | 427 |
| 275 | 3300005327 | Ga0070658_10077056 | Ga0070658_100770563 | 428 |
| 276 | 3300005937 | Ga0081455_10075981 | Ga0081455_100759813 | 428 |
| 277 | 3300021320 | Ga0214544_1000368 | Ga0214544_100036847 | 428 |
| 278 | 3300021321 | Ga0214542_1002192 | Ga0214542_100219221 | 428 |
| 279 | 3300021324 | Ga0214545_1000203 | Ga0214545_100020347 | 428 |
| 280 | 3300021327 | Ga0214543_1000322 | Ga0214543_100032247 | 428 |
| 281 | 3300025261 | Ga0209233_1004255 | Ga0209233_10042555 | 428 |
| 282 | 3300025909 | Ga0207705_10057946 | Ga0207705_100579462 | 428 |
| 283 | 3300025923 | Ga0207681_10048754 | Ga0207681_100487542 | 428 |
| 284 | 3300049580 | Ga0501046_0024923 | Ga0501046_0024923_1309_2676 | 428 |
| 285 | 3300049744 | Ga0501083_0018277 | Ga0501083_0018277_413_1780 | 428 |
| 286 | iso_pu_bacteria | 2508501128 | 2509149397 | 428 |
| 287 | iso_pu_bacteria | 2643221651 | 2644291394 | 428 |
| 288 | 3300003659 | JGI25404J52841_10006160 | JGI25404J52841_100061602 | 429 |
| 289 | 3300005937 | Ga0081455_10043382 | Ga0081455_100433822 | 429 |
| 290 | 3300005983 | Ga0081540_1012437 | Ga0081540_10124374 | 429 |
| 291 | 3300005983 | Ga0081540_1017871 | Ga0081540_10178714 | 429 |
| 292 | 3300005983 | Ga0081540_1035952 | Ga0081540_10359522 | 429 |
| 293 | 3300006048 | Ga0075363_100082159 | Ga0075363_1000821591 | 429 |
| 294 | 3300025295 | Ga0209564_1001937 | Ga0209564_10019372 | 429 |
| 295 | 3300025297 | Ga0209758_1004237 | Ga0209758_10042376 | 429 |
| 296 | 3300050513 | nmdc:mga0rr50_165411_c1 | nmdc:mga0rr50_165411_c1_196_1566 | 429 |
| 297 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_127235_128605 | 429 |
| 298 | 3300053735 | Ga0500596_001100 | Ga0500596_001100_3809_5176 | 429 |
| 299 | iso_pu_bacteria | 2602042107 | 2603861427 | 429 |
| 300 | iso_pu_bacteria | 2857524615 | 2857530202 | 429 |
| 301 | iso_pu_bacteria | 2881665667 | 2881671847 | 429 |
| 302 | iso_pu_bacteria | 2893066018 | 2893066092 | 429 |
| 303 | iso_pu_bacteria | 2919073203 | 2919079527 | 429 |
| 304 | iso_pu_bacteria | 2941531003 | 2941531107 | 429 |
| 305 | 3300003215 | JGI25153J46596_10006205 | JGI25153J46596_100062053 | 430 |
| 306 | 3300005338 | Ga0068868_100016332 | Ga0068868_1000163323 | 430 |
| 307 | 3300005457 | Ga0070662_100223020 | Ga0070662_1002230201 | 430 |
| 308 | 3300005616 | Ga0068852_100049351 | Ga0068852_1000493513 | 430 |
| 309 | 3300005983 | Ga0081540_1000575 | Ga0081540_10005753 | 430 |
| 310 | 3300006881 | Ga0068865_100201048 | Ga0068865_1002010481 | 430 |
| 311 | 3300009545 | Ga0105237_10058120 | Ga0105237_100581203 | 430 |
| 312 | 3300013308 | Ga0157375_10011128 | Ga0157375_100111286 | 430 |
| 313 | 3300014969 | Ga0157376_10008594 | Ga0157376_100085944 | 430 |
| 314 | 3300025297 | Ga0209758_1000365 | Ga0209758_100036566 | 430 |
| 315 | 3300025925 | Ga0207650_10096336 | Ga0207650_100963362 | 430 |
| 316 | 3300025931 | Ga0207644_10031587 | Ga0207644_100315873 | 430 |
| 317 | 3300026023 | Ga0207677_10021930 | Ga0207677_100219304 | 430 |
| 318 | 3300039450 | Ga0436363_0996694 | Ga0436363_0996694_1282_2652 | 430 |
| 319 | 3300046524 | Ga0495648_0007789 | Ga0495648_0007789_6429_7799 | 430 |
| 320 | 3300046615 | Ga0495656_0060531 | Ga0495656_0060531_71_1441 | 430 |
| 321 | 3300048904 | Ga0496101_0081029 | Ga0496101_0081029_989_2359 | 430 |
| 322 | 3300048906 | Ga0496103_0016380 | Ga0496103_0016380_2198_3568 | 430 |
| 323 | 3300048907 | Ga0496104_0008421 | Ga0496104_0008421_6843_8213 | 430 |
| 324 | 3300048918 | Ga0496115_0022242 | Ga0496115_0022242_2404_3774 | 430 |
| 325 | 3300048924 | Ga0496121_0041651 | Ga0496121_0041651_1056_2453 | 430 |
| 326 | 3300053085 | Ga0495619_0014968 | Ga0495619_0014968_3304_4674 | 430 |
| 327 | iso_pu_bacteria | 2507262055 | 2507507751 | 430 |
| 328 | iso_pu_bacteria | 2508501009 | 2508541875 | 430 |
| 329 | iso_pu_bacteria | 2508501042 | 2508692582 | 430 |
| 330 | iso_pu_bacteria | 2511231028 | 2511398956 | 430 |
| 331 | iso_pu_bacteria | 2513237092 | 2513622962 | 430 |
| 332 | iso_pu_bacteria | 2513237094 | 2513642879 | 430 |
| 333 | iso_pu_bacteria | 2513237095 | 2513647421 | 430 |
| 334 | iso_pu_bacteria | 2513237096 | 2513653981 | 430 |
| 335 | iso_pu_bacteria | 2513237098 | 2513676254 | 430 |
| 336 | iso_pu_bacteria | 2513237101 | 2513695806 | 430 |
| 337 | iso_pu_bacteria | 2513237102 | 2513699540 | 430 |
| 338 | iso_pu_bacteria | 2513237104 | 2513719389 | 430 |
| 339 | iso_pu_bacteria | 2513237137 | 2513856417 | 430 |
| 340 | iso_pu_bacteria | 2513237139 | 2513878428 | 430 |
| 341 | iso_pu_bacteria | 2513237145 | 2513918321 | 430 |
| 342 | iso_pu_bacteria | 2513237161 | 2514009525 | 430 |
| 343 | iso_pu_bacteria | 2515154112 | 2515625991 | 430 |
| 344 | iso_pu_bacteria | 2517093001 | 2517104059 | 430 |
| 345 | iso_pu_bacteria | 2517572143 | 2517891449 | 430 |
| 346 | iso_pu_bacteria | 2524023205 | 2524436380 | 430 |
| 347 | iso_pu_bacteria | 2524023210 | 2524470290 | 430 |
| 348 | iso_pu_bacteria | 2524023228 | 2524538377 | 430 |
| 349 | iso_pu_bacteria | 2528768022 | 2528849082 | 430 |
| 350 | iso_pu_bacteria | 2617270735 | 2617346706 | 430 |
| 351 | iso_pu_bacteria | 2617270741 | 2617372634 | 430 |
| 352 | iso_pu_bacteria | 2667528175 | 2671118786 | 430 |
| 353 | iso_pu_bacteria | 2721755755 | 2723847271 | 430 |
| 354 | iso_pu_bacteria | 2728368998 | 2728750143 | 430 |
| 355 | iso_pu_bacteria | 2744054633 | 2745080666 | 430 |
| 356 | iso_pu_bacteria | 2791355196 | 2793064446 | 430 |
| 357 | iso_pu_bacteria | 2791355197 | 2793066813 | 430 |
| 358 | iso_pu_bacteria | 2791355199 | 2793084138 | 430 |
| 359 | iso_pu_bacteria | 2802429603 | 2805919149 | 430 |
| 360 | iso_pu_bacteria | 2816332527 | 2818236457 | 430 |
| 361 | iso_pu_bacteria | 2824600985 | 2824608238 | 430 |
| 362 | iso_pu_bacteria | 2824609381 | 2824612960 | 430 |
| 363 | iso_pu_bacteria | 2824626560 | 2824631617 | 430 |
| 364 | iso_pu_bacteria | 2824671348 | 2824679504 | 430 |
| 365 | iso_pu_bacteria | 2824679649 | 2824687787 | 430 |
| 366 | iso_pu_bacteria | 2824687955 | 2824695855 | 430 |
| 367 | iso_pu_bacteria | 2824696289 | 2824701773 | 430 |
| 368 | iso_pu_bacteria | 2824746037 | 2824749796 | 430 |
| 369 | iso_pu_bacteria | 2824753945 | 2824762400 | 430 |
| 370 | iso_pu_bacteria | 2824763712 | 2824772694 | 430 |
| 371 | iso_pu_bacteria | 2824773399 | 2824775221 | 430 |
| 372 | iso_pu_bacteria | 2838122688 | 2838128893 | 430 |
| 373 | iso_pu_bacteria | 2841941048 | 2841944960 | 430 |
| 374 | iso_pu_bacteria | 2841949485 | 2841953383 | 430 |
| 375 | iso_pu_bacteria | 2841957949 | 2841959789 | 430 |
| 376 | iso_pu_bacteria | 2841966195 | 2841972145 | 430 |
| 377 | iso_pu_bacteria | 2841974524 | 2841978109 | 430 |
| 378 | iso_pu_bacteria | 2841983080 | 2841986268 | 430 |
| 379 | iso_pu_bacteria | 2842038055 | 2842040557 | 430 |
| 380 | iso_pu_bacteria | 2842045827 | 2842046497 | 430 |
| 381 | iso_pu_bacteria | 2844315083 | 2844319923 | 430 |
| 382 | iso_pu_bacteria | 2847930680 | 2847937232 | 430 |
| 383 | iso_pu_bacteria | 2847939898 | 2847947646 | 430 |
| 384 | iso_pu_bacteria | 2849076700 | 2849078499 | 430 |
| 385 | iso_pu_bacteria | 2857509624 | 2857512858 | 430 |
| 386 | iso_pu_bacteria | 2874590934 | 2874598860 | 430 |
| 387 | iso_pu_bacteria | 2874604998 | 2874607290 | 430 |
| 388 | iso_pu_bacteria | 2874612657 | 2874614670 | 430 |
| 389 | iso_pu_bacteria | 2874620515 | 2874627984 | 430 |
| 390 | iso_pu_bacteria | 2874628541 | 2874635127 | 430 |
| 391 | iso_pu_bacteria | 2874645413 | 2874652316 | 430 |
| 392 | iso_pu_bacteria | 2876761206 | 2876766189 | 430 |
| 393 | iso_pu_bacteria | 2876771140 | 2876778899 | 430 |
| 394 | iso_pu_bacteria | 2876808645 | 2876814526 | 430 |
| 395 | iso_pu_bacteria | 2876818435 | 2876824206 | 430 |
| 396 | iso_pu_bacteria | 2879074833 | 2879082692 | 430 |
| 397 | iso_pu_bacteria | 2879083081 | 2879088459 | 430 |
| 398 | iso_pu_bacteria | 2879099564 | 2879107039 | 430 |
| 399 | iso_pu_bacteria | 2879110137 | 2879114622 | 430 |
| 400 | iso_pu_bacteria | 2879127579 | 2879132147 | 430 |
| 401 | iso_pu_bacteria | 2879142872 | 2879148326 | 430 |
| 402 | iso_pu_bacteria | 2881364244 | 2881371551 | 430 |
| 403 | iso_pu_bacteria | 2885366525 | 2885369878 | 430 |
| 404 | iso_pu_bacteria | 2885374607 | 2885378295 | 430 |
| 405 | iso_pu_bacteria | 2885409591 | 2885412285 | 430 |
| 406 | iso_pu_bacteria | 2888378607 | 2888385356 | 430 |
| 407 | iso_pu_bacteria | 2888388044 | 2888392894 | 430 |
| 408 | iso_pu_bacteria | 2888419890 | 2888425494 | 430 |
| 409 | iso_pu_bacteria | 2903727486 | 2903730404 | 430 |
| 410 | iso_pu_bacteria | 2904666416 | 2904674398 | 430 |
| 411 | iso_pu_bacteria | 2904690495 | 2904691292 | 430 |
| 412 | iso_pu_bacteria | 2904699407 | 2904704887 | 430 |
| 413 | iso_pu_bacteria | 2904711408 | 2904712077 | 430 |
| 414 | iso_pu_bacteria | 2906602504 | 2906604663 | 430 |
| 415 | iso_pu_bacteria | 2906610324 | 2906616621 | 430 |
| 416 | iso_pu_bacteria | 2906626472 | 2906627439 | 430 |
| 417 | iso_pu_bacteria | 2906635258 | 2906635405 | 430 |
| 418 | iso_pu_bacteria | 2906643746 | 2906649357 | 430 |
| 419 | iso_pu_bacteria | 2906660503 | 2906666951 | 430 |
| 420 | iso_pu_bacteria | 2908756301 | 2908759067 | 430 |
| 421 | iso_pu_bacteria | 2908775508 | 2908781080 | 430 |
| 422 | iso_pu_bacteria | 2922361189 | 2922368583 | 430 |
| 423 | iso_pu_bacteria | 2922368715 | 2922372508 | 430 |
| 424 | iso_pu_bacteria | 2922386360 | 2922387444 | 430 |
| 425 | iso_pu_bacteria | 2922393267 | 2922397161 | 430 |
| 426 | iso_pu_bacteria | 2922425934 | 2922431358 | 430 |
| 427 | iso_pu_bacteria | 2929615660 | 2929620928 | 430 |
| 428 | iso_pu_bacteria | 2929624759 | 2929626241 | 430 |
| 429 | iso_pu_bacteria | 2932784394 | 2932784880 | 430 |
| 430 | iso_pu_bacteria | 2932794094 | 2932795247 | 430 |
| 431 | iso_pu_bacteria | 2932801729 | 2932805778 | 430 |
| 432 | iso_pu_bacteria | 2932809354 | 2932809914 | 430 |
| 433 | iso_pu_bacteria | 2932818245 | 2932818343 | 430 |
| 434 | iso_pu_bacteria | 2932828146 | 2932828717 | 430 |
| 435 | iso_pu_bacteria | 2933577622 | 2933583202 | 430 |
| 436 | iso_pu_bacteria | 2935608549 | 2935609736 | 430 |
| 437 | iso_pu_bacteria | 2935616580 | 2935619863 | 430 |
| 438 | iso_pu_bacteria | 2935630451 | 2935633954 | 430 |
| 439 | iso_pu_bacteria | 2935638405 | 2935638845 | 430 |
| 440 | iso_pu_bacteria | 2935648319 | 2935654217 | 430 |
| 441 | iso_pu_bacteria | 2935656913 | 2935663090 | 430 |
| 442 | iso_pu_bacteria | 2935665750 | 2935666305 | 430 |
| 443 | iso_pu_bacteria | 2935675223 | 2935676651 | 430 |
| 444 | iso_pu_bacteria | 2935684952 | 2935685033 | 430 |
| 445 | iso_pu_bacteria | 2935694250 | 2935694729 | 430 |
| 446 | iso_pu_bacteria | 2935703347 | 2935703850 | 430 |
| 447 | iso_pu_bacteria | 2935713505 | 2935713586 | 430 |
| 448 | iso_pu_bacteria | 2935722832 | 2935724206 | 430 |
| 449 | iso_pu_bacteria | 2935732158 | 2935733436 | 430 |
| 450 | iso_pu_bacteria | 2935741537 | 2935742815 | 430 |
| 451 | iso_pu_bacteria | 2935750917 | 2935750998 | 430 |
| 452 | iso_pu_bacteria | 2935760218 | 2935760473 | 430 |
| 453 | iso_pu_bacteria | 2935769743 | 2935772036 | 430 |
| 454 | iso_pu_bacteria | 2935777560 | 2935784211 | 430 |
| 455 | iso_pu_bacteria | 2935785616 | 2935787576 | 430 |
| 456 | iso_pu_bacteria | 2935793552 | 2935796208 | 430 |
| 457 | iso_pu_bacteria | 2935801545 | 2935801987 | 430 |
| 458 | iso_pu_bacteria | 2935810662 | 2935810756 | 430 |
| 459 | iso_pu_bacteria | 2935819856 | 2935822898 | 430 |
| 460 | iso_pu_bacteria | 2935827899 | 2935828339 | 430 |
| 461 | iso_pu_bacteria | 2935837841 | 2935839754 | 430 |
| 462 | iso_pu_bacteria | 2935847175 | 2935848480 | 430 |
| 463 | iso_pu_bacteria | 2935855204 | 2935857822 | 430 |
| 464 | iso_pu_bacteria | 2935864058 | 2935868836 | 430 |
| 465 | iso_pu_bacteria | 2935873716 | 2935874251 | 430 |
| 466 | iso_pu_bacteria | 2935883170 | 2935883852 | 430 |
| 467 | iso_pu_bacteria | 2935908558 | 2935909715 | 430 |
| 468 | iso_pu_bacteria | 2935916978 | 2935917439 | 430 |
| 469 | iso_pu_bacteria | 2935926038 | 2935927196 | 430 |
| 470 | iso_pu_bacteria | 2935934488 | 2935936960 | 430 |
| 471 | iso_pu_bacteria | 2935942939 | 2935944737 | 430 |
| 472 | iso_pu_bacteria | 2935951376 | 2935953174 | 430 |
| 473 | iso_pu_bacteria | 2935959822 | 2935961317 | 430 |
| 474 | iso_pu_bacteria | 2935967501 | 2935970014 | 430 |
| 475 | iso_pu_bacteria | 2935975950 | 2935980299 | 430 |
| 476 | iso_pu_bacteria | 2935984226 | 2935986936 | 430 |
| 477 | iso_pu_bacteria | 2935992306 | 2935992824 | 430 |
| 478 | iso_pu_bacteria | 2936002035 | 2936002737 | 430 |
| 479 | iso_pu_bacteria | 2936011229 | 2936017246 | 430 |
| 480 | iso_pu_bacteria | 2936019824 | 2936025748 | 430 |
| 481 | iso_pu_bacteria | 2936028420 | 2936034597 | 430 |
| 482 | iso_pu_bacteria | 2936037263 | 2936037824 | 430 |
| 483 | iso_pu_bacteria | 2936046547 | 2936052654 | 430 |
| 484 | iso_pu_bacteria | 2936055302 | 2936062063 | 430 |
| 485 | iso_pu_bacteria | 2940556831 | 2940558199 | 430 |
| 486 | iso_pu_bacteria | 2941507105 | 2941510743 | 430 |
| 487 | iso_pu_bacteria | 2941515067 | 2941518127 | 430 |
| 488 | iso_pu_bacteria | 2941523033 | 2941527002 | 430 |
| 489 | iso_pu_bacteria | 2941538514 | 2941540905 | 430 |
| 490 | iso_pu_bacteria | 3005474847 | 3005481149 | 430 |
| 491 | iso_pu_bacteria | 3005483717 | 3005484887 | 430 |
| 492 | iso_pu_bacteria | 3005506211 | 3005508515 | 430 |
| 493 | iso_pu_bacteria | 3005594810 | 3005600202 | 430 |
| 494 | iso_pu_bacteria | 3005710791 | 3005715714 | 430 |
| 495 | iso_pu_bacteria | 3005718088 | 3005723062 | 430 |
| 496 | iso_pu_bacteria | 8006926726 | 8006930885 | 430 |
| 497 | iso_pu_bacteria | 8006933436 | 8006939558 | 430 |
| 498 | iso_pu_bacteria | 8006973647 | 8006979309 | 430 |
| 499 | iso_pu_bacteria | 8006984368 | 8006989202 | 430 |
| 500 | iso_pu_bacteria | 8016522445 | 8016528792 | 430 |
| 501 | iso_pu_bacteria | 8016539877 | 8016547201 | 430 |
| 502 | iso_pu_bacteria | 8016548790 | 8016554928 | 430 |
| 503 | iso_pu_bacteria | 8016557553 | 8016563295 | 430 |
| 504 | iso_pu_bacteria | 8016575299 | 8016576497 | 430 |
| 505 | iso_pu_bacteria | 8016583857 | 8016594204 | 430 |
| 506 | iso_pu_bacteria | 8016595262 | 8016601047 | 430 |
| 507 | iso_pu_bacteria | 8016613128 | 8016615502 | 430 |
| 508 | iso_pu_bacteria | 8016622563 | 8016625720 | 430 |
| 509 | iso_pu_bacteria | 8016630954 | 8016639281 | 430 |
| 510 | iso_pu_bacteria | 8017057580 | 8017064825 | 430 |
| 511 | iso_pu_bacteria | 8019530166 | 8019533746 | 430 |
| 512 | iso_pu_bacteria | 8019538911 | 8019545922 | 430 |
| 513 | iso_pu_bacteria | 8019547302 | 8019552805 | 430 |
| 514 | iso_pu_bacteria | 8019555841 | 8019565451 | 430 |
| 515 | iso_pu_bacteria | 8019565922 | 8019575543 | 430 |
| 516 | iso_pu_bacteria | 8019597564 | 8019599328 | 430 |
| 517 | iso_pu_bacteria | 8019608314 | 8019609030 | 430 |
| 518 | iso_pu_bacteria | 8019619141 | 8019619718 | 430 |
| 519 | iso_pu_bacteria | 8019629233 | 8019633397 | 430 |
| 520 | iso_pu_bacteria | 8019648815 | 8019649249 | 430 |
| 521 | iso_pu_bacteria | 8019659431 | 8019661281 | 430 |
| 522 | iso_pu_bacteria | 8019668869 | 8019670822 | 430 |
| 523 | iso_pu_bacteria | 8019678201 | 8019685377 | 430 |
| 524 | iso_pu_bacteria | 8019687851 | 8019690969 | 430 |
| 525 | iso_pu_bacteria | 8055742211 | 8055745209 | 430 |
| 526 | iso_pu_bacteria | 8056673599 | 8056681014 | 430 |
| 527 | iso_pu_bacteria | 8056681323 | 8056684905 | 430 |
| 528 | iso_pu_bacteria | 8056689827 | 8056693412 | 430 |
| 529 | iso_pu_bacteria | 8056967851 | 8056975171 | 430 |
| 530 | 3300005439 | Ga0070711_100031162 | Ga0070711_1000311623 | 431 |
| 531 | 3300005539 | Ga0068853_100016983 | Ga0068853_1000169834 | 431 |
| 532 | 3300005563 | Ga0068855_100053112 | Ga0068855_1000531124 | 431 |
| 533 | 3300005577 | Ga0068857_100014724 | Ga0068857_1000147245 | 431 |
| 534 | 3300005577 | Ga0068857_100023313 | Ga0068857_1000233135 | 431 |
| 535 | 3300005578 | Ga0068854_100003845 | Ga0068854_1000038451 | 431 |
| 536 | 3300005578 | Ga0068854_100036066 | Ga0068854_1000360662 | 431 |
| 537 | 3300005614 | Ga0068856_100011815 | Ga0068856_1000118157 | 431 |
| 538 | 3300005614 | Ga0068856_100050178 | Ga0068856_1000501782 | 431 |
| 539 | 3300005616 | Ga0068852_100002580 | Ga0068852_1000025806 | 431 |
| 540 | 3300005616 | Ga0068852_100090084 | Ga0068852_1000900841 | 431 |
| 541 | 3300005834 | Ga0068851_10006584 | Ga0068851_100065843 | 431 |
| 542 | 3300009093 | Ga0105240_10084733 | Ga0105240_100847332 | 431 |
| 543 | 3300009174 | Ga0105241_10001401 | Ga0105241_1000140111 | 431 |
| 544 | 3300009545 | Ga0105237_10008696 | Ga0105237_100086965 | 431 |
| 545 | 3300009545 | Ga0105237_10233551 | Ga0105237_102335512 | 431 |
| 546 | 3300009551 | Ga0105238_10006652 | Ga0105238_100066522 | 431 |
| 547 | 3300009551 | Ga0105238_10011666 | Ga0105238_100116663 | 431 |
| 548 | 3300010375 | Ga0105239_10054806 | Ga0105239_100548064 | 431 |
| 549 | 3300010375 | Ga0105239_10058442 | Ga0105239_100584423 | 431 |
| 550 | 3300025904 | Ga0207647_10022267 | Ga0207647_100222673 | 431 |
| 551 | 3300025911 | Ga0207654_10000411 | Ga0207654_1000041115 | 431 |
| 552 | 3300025913 | Ga0207695_10000424 | Ga0207695_1000042455 | 431 |
| 553 | 3300025924 | Ga0207694_10000347 | Ga0207694_1000034716 | 431 |
| 554 | 3300025924 | Ga0207694_10046201 | Ga0207694_100462013 | 431 |
| 555 | 3300025949 | Ga0207667_10050734 | Ga0207667_100507342 | 431 |
| 556 | 3300025949 | Ga0207667_10257860 | Ga0207667_102578602 | 431 |
| 557 | 3300025981 | Ga0207640_10017736 | Ga0207640_100177363 | 431 |
| 558 | 3300025981 | Ga0207640_10086180 | Ga0207640_100861802 | 431 |
| 559 | 3300026067 | Ga0207678_10039799 | Ga0207678_100397992 | 431 |
| 560 | 3300026067 | Ga0207678_10097100 | Ga0207678_100971002 | 431 |
| 561 | 3300026078 | Ga0207702_10000002 | Ga0207702_1000000289 | 431 |
| 562 | 3300026078 | Ga0207702_10011407 | Ga0207702_100114071 | 431 |
| 563 | 3300026116 | Ga0207674_10003854 | Ga0207674_100038543 | 431 |
| 564 | 3300026116 | Ga0207674_10009561 | Ga0207674_100095613 | 431 |
| 565 | 3300026142 | Ga0207698_10026014 | Ga0207698_100260142 | 431 |
| 566 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001238 | 431 |
| 567 | 3300027361 | Ga0209489_119748 | Ga0209489_1197482 | 431 |
| 568 | 3300031731 | Ga0307405_10105036 | Ga0307405_101050362 | 431 |
| 569 | 3300033179 | Ga0307507_10080724 | Ga0307507_100807241 | 431 |
| 570 | 3300035695 | Ga0373927_0031836 | Ga0373927_0031836_1451_2818 | 431 |
| 571 | 3300048905 | Ga0496102_0008501 | Ga0496102_0008501_1638_3008 | 431 |
| 572 | 3300048907 | Ga0496104_0005754 | Ga0496104_0005754_6666_8036 | 431 |
| 573 | 3300048908 | Ga0496105_0043844 | Ga0496105_0043844_377_1747 | 431 |
| 574 | 3300048909 | Ga0496106_0131349 | Ga0496106_0131349_352_1722 | 431 |
| 575 | 3300048913 | Ga0496110_0023231 | Ga0496110_0023231_2982_4352 | 431 |
| 576 | 3300048914 | Ga0496111_0031284 | Ga0496111_0031284_1039_2409 | 431 |
| 577 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_54607_55977 | 431 |
| 578 | 3300048916 | Ga0496113_0053320 | Ga0496113_0053320_652_2022 | 431 |
| 579 | 3300048924 | Ga0496121_0000886 | Ga0496121_0000886_41439_42809 | 431 |
| 580 | 3300048924 | Ga0496121_0056125 | Ga0496121_0056125_397_1767 | 431 |
| 581 | 3300048929 | Ga0496126_0205544 | Ga0496126_0205544_166_1557 | 431 |
| 582 | 3300050494 | nmdc:mga06z11_53375_c1 | nmdc:mga06z11_53375_c1_105_1475 | 431 |
| 583 | 3300053119 | Ga0500595_001750 | Ga0500595_001750_5514_6884 | 431 |
| 584 | 3300053119 | Ga0500595_023301 | Ga0500595_023301_206_1573 | 431 |
| 585 | 3300053139 | Ga0500568_0013309 | Ga0500568_0013309_461_1831 | 431 |
| 586 | 3300053178 | Ga0500637_0076481 | Ga0500637_0076481_11_1378 | 431 |
| 587 | 3300053731 | Ga0500609_004321 | Ga0500609_004321_330_1700 | 431 |
| 588 | 3300003215 | JGI25153J46596_10008275 | JGI25153J46596_100082754 | 432 |
| 589 | 3300005262 | Ga0065165_1013018 | Ga0065165_10130182 | 432 |
| 590 | 3300005983 | Ga0081540_1011696 | Ga0081540_10116965 | 432 |
| 591 | 3300006028 | Ga0070717_10287549 | Ga0070717_102875491 | 432 |
| 592 | 3300009093 | Ga0105240_10016135 | Ga0105240_100161359 | 432 |
| 593 | 3300010375 | Ga0105239_10034156 | Ga0105239_100341563 | 432 |
| 594 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011218 | 432 |
| 595 | 3300025297 | Ga0209758_1000359 | Ga0209758_100035973 | 432 |
| 596 | 3300025304 | Ga0209257_1001196 | Ga0209257_100119622 | 432 |
| 597 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008701 | 432 |
| 598 | 3300025927 | Ga0207687_10073302 | Ga0207687_100733022 | 432 |
| 599 | 3300027361 | Ga0209489_119453 | Ga0209489_1194532 | 432 |
| 600 | 3300027363 | Ga0209700_100007 | Ga0209700_100007187 | 432 |
| 601 | 3300028794 | Ga0307515_10056013 | Ga0307515_100560133 | 432 |
| 602 | 3300031616 | Ga0307508_10000249 | Ga0307508_1000024919 | 432 |
| 603 | 3300031730 | Ga0307516_10005695 | Ga0307516_1000569513 | 432 |
| 604 | 3300036401 | Ga0373937_0130575 | Ga0373937_0130575_836_2209 | 432 |
| 605 | 3300037312 | Ga0395899_0056072 | Ga0395899_0056072_24_1394 | 432 |
| 606 | 3300037418 | Ga0395900_0001529 | Ga0395900_0001529_21599_22969 | 432 |
| 607 | 3300037466 | Ga0395898_0014173 | Ga0395898_0014173_3755_5125 | 432 |
| 608 | 3300038443 | Ga0395901_0011625 | Ga0395901_0011625_470_1840 | 432 |
| 609 | 3300046462 | Ga0495651_0051215 | Ga0495651_0051215_229_1596 | 432 |
| 610 | 3300046462 | Ga0495651_0095975 | Ga0495651_0095975_541_1914 | 432 |
| 611 | 3300046529 | Ga0495652_0166790 | Ga0495652_0166790_130_1497 | 432 |
| 612 | 3300046809 | Ga0495600_0009971 | Ga0495600_0009971_3731_5098 | 432 |
| 613 | 3300048928 | Ga0496125_0054179 | Ga0496125_0054179_1833_3203 | 432 |
| 614 | 3300049569 | Ga0501032_0113009 | Ga0501032_0113009_232_1599 | 432 |
| 615 | 3300049572 | Ga0501036_0016285 | Ga0501036_0016285_314_1687 | 432 |
| 616 | 3300049579 | Ga0501043_0003909 | Ga0501043_0003909_10813_12186 | 432 |
| 617 | 3300049582 | Ga0501048_0092763 | Ga0501048_0092763_422_1789 | 432 |
| 618 | 3300049742 | Ga0501080_0204945 | Ga0501080_0204945_169_1536 | 432 |
| 619 | 3300049822 | Ga0501035_0115601 | Ga0501035_0115601_919_2292 | 432 |
| 620 | 3300049823 | Ga0501044_0070406 | Ga0501044_0070406_140_1513 | 432 |
| 621 | 3300049823 | Ga0501044_0146266 | Ga0501044_0146266_172_1539 | 432 |
| 622 | 3300053119 | Ga0500595_001406 | Ga0500595_001406_9990_11354 | 432 |
| 623 | 3300053178 | Ga0500637_0000282 | Ga0500637_0000282_15814_17178 | 432 |
| 624 | 3300055283 | Ga0500661_000108 | Ga0500661_000108_3796_5160 | 432 |
| 625 | iso_pu_bacteria | 2903748898 | 2903749032 | 432 |
| 626 | iso_pu_bacteria | 2908739725 | 2908741788 | 432 |
| 627 | 3300005439 | Ga0070711_100057504 | Ga0070711_1000575043 | 433 |
| 628 | 3300005456 | Ga0070678_100081258 | Ga0070678_1000812582 | 433 |
| 629 | 3300005471 | Ga0070698_100065850 | Ga0070698_1000658501 | 433 |
| 630 | 3300005530 | Ga0070679_100046635 | Ga0070679_1000466352 | 433 |
| 631 | 3300005844 | Ga0068862_100080072 | Ga0068862_1000800723 | 433 |
| 632 | 3300005937 | Ga0081455_10000577 | Ga0081455_1000057734 | 433 |
| 633 | 3300005983 | Ga0081540_1006404 | Ga0081540_10064043 | 433 |
| 634 | 3300006186 | Ga0075369_10022057 | Ga0075369_100220571 | 433 |
| 635 | 3300006941 | Ga0099825_1026117 | Ga0099825_10261173 | 433 |
| 636 | 3300006942 | Ga0099824_1005536 | Ga0099824_10055365 | 433 |
| 637 | 3300009176 | Ga0105242_10088105 | Ga0105242_100881052 | 433 |
| 638 | 3300009177 | Ga0105248_10223486 | Ga0105248_102234862 | 433 |
| 639 | 3300009545 | Ga0105237_10070560 | Ga0105237_100705602 | 433 |
| 640 | 3300014326 | Ga0157380_10013986 | Ga0157380_100139863 | 433 |
| 641 | 3300025253 | Ga0209677_100437 | Ga0209677_10043723 | 433 |
| 642 | 3300025299 | Ga0209256_1003423 | Ga0209256_10034239 | 433 |
| 643 | 3300025912 | Ga0207707_10016091 | Ga0207707_100160915 | 433 |
| 644 | 3300025916 | Ga0207663_10111602 | Ga0207663_101116022 | 433 |
| 645 | 3300025944 | Ga0207661_10161451 | Ga0207661_101614512 | 433 |
| 646 | 3300025972 | Ga0207668_10074081 | Ga0207668_100740812 | 433 |
| 647 | 3300026067 | Ga0207678_10078914 | Ga0207678_100789141 | 433 |
| 648 | 3300026118 | Ga0207675_100048223 | Ga0207675_1000482233 | 433 |
| 649 | 3300026121 | Ga0207683_10070990 | Ga0207683_100709903 | 433 |
| 650 | 3300027357 | Ga0209589_1000014 | Ga0209589_100001499 | 433 |
| 651 | 3300027361 | Ga0209489_100014 | Ga0209489_10001499 | 433 |
| 652 | 3300027363 | Ga0209700_100024 | Ga0209700_10002499 | 433 |
| 653 | 3300028379 | Ga0268266_10073800 | Ga0268266_100738001 | 433 |
| 654 | 3300028380 | Ga0268265_10069583 | Ga0268265_100695832 | 433 |
| 655 | 3300031247 | Ga0265340_10001084 | Ga0265340_100010841 | 433 |
| 656 | 3300031730 | Ga0307516_10055077 | Ga0307516_100550773 | 433 |
| 657 | 3300035695 | Ga0373927_0002439 | Ga0373927_0002439_4525_5982 | 433 |
| 658 | 3300035725 | Ga0373947_0025523 | Ga0373947_0025523_31_1488 | 433 |
| 659 | 3300038443 | Ga0395901_0140309 | Ga0395901_0140309_257_1627 | 433 |
| 660 | 3300044693 | Ga0466961_0076880 | Ga0466961_0076880_108_1478 | 433 |
| 661 | 3300044694 | Ga0466963_0014914 | Ga0466963_0014914_3245_4615 | 433 |
| 662 | 3300044706 | Ga0466964_0038812 | Ga0466964_0038812_511_1881 | 433 |
| 663 | 3300045049 | Ga0466959_0063305 | Ga0466959_0063305_497_1867 | 433 |
| 664 | 3300045976 | Ga0466967_0006745 | Ga0466967_0006745_234_1604 | 433 |
| 665 | 3300046455 | Ga0495603_0011237 | Ga0495603_0011237_3176_4546 | 433 |
| 666 | 3300046455 | Ga0495603_0014491 | Ga0495603_0014491_2184_3602 | 433 |
| 667 | 3300046460 | Ga0495638_0086418 | Ga0495638_0086418_499_1869 | 433 |
| 668 | 3300046499 | Ga0495594_0030010 | Ga0495594_0030010_819_2264 | 433 |
| 669 | 3300046674 | Ga0495588_0001447 | Ga0495588_0001447_5857_7302 | 433 |
| 670 | 3300046680 | Ga0495646_0022073 | Ga0495646_0022073_1536_2903 | 433 |
| 671 | 3300048903 | Ga0496100_0041350 | Ga0496100_0041350_1470_2840 | 433 |
| 672 | 3300048912 | Ga0496109_0298042 | Ga0496109_0298042_77_1483 | 433 |
| 673 | 3300048921 | Ga0496118_0003113 | Ga0496118_0003113_11758_13125 | 433 |
| 674 | 3300048924 | Ga0496121_0002017 | Ga0496121_0002017_24862_26229 | 433 |
| 675 | 3300048925 | Ga0496122_0014132 | Ga0496122_0014132_4452_5822 | 433 |
| 676 | 3300048929 | Ga0496126_0008257 | Ga0496126_0008257_1134_2504 | 433 |
| 677 | 3300048929 | Ga0496126_0028691 | Ga0496126_0028691_183_1553 | 433 |
| 678 | 3300048929 | Ga0496126_0046030 | Ga0496126_0046030_1558_2928 | 433 |
| 679 | 3300049569 | Ga0501032_0007050 | Ga0501032_0007050_5896_7263 | 433 |
| 680 | 3300049570 | Ga0501033_0000553 | Ga0501033_0000553_8339_9706 | 433 |
| 681 | 3300049571 | Ga0501034_0000892 | Ga0501034_0000892_37265_38632 | 433 |
| 682 | 3300049572 | Ga0501036_0000267 | Ga0501036_0000267_9126_10493 | 433 |
| 683 | 3300049573 | Ga0501037_0000257 | Ga0501037_0000257_24821_26188 | 433 |
| 684 | 3300049574 | Ga0501038_0004912 | Ga0501038_0004912_589_1956 | 433 |
| 685 | 3300049575 | Ga0501039_0000488 | Ga0501039_0000488_25122_26489 | 433 |
| 686 | 3300049578 | Ga0501042_0021357 | Ga0501042_0021357_1983_3350 | 433 |
| 687 | 3300049579 | Ga0501043_0005331 | Ga0501043_0005331_6747_8114 | 433 |
| 688 | 3300049580 | Ga0501046_0006487 | Ga0501046_0006487_2364_3731 | 433 |
| 689 | 3300049581 | Ga0501047_0000123 | Ga0501047_0000123_4969_6336 | 433 |
| 690 | 3300049582 | Ga0501048_0000108 | Ga0501048_0000108_19864_21231 | 433 |
| 691 | 3300049583 | Ga0501067_0000267 | Ga0501067_0000267_591_1958 | 433 |
| 692 | 3300049585 | Ga0501069_0002404 | Ga0501069_0002404_1692_3059 | 433 |
| 693 | 3300049586 | Ga0501070_0016149 | Ga0501070_0016149_204_1571 | 433 |
| 694 | 3300049586 | Ga0501070_0024041 | Ga0501070_0024041_401_1768 | 433 |
| 695 | 3300049588 | Ga0501072_0000898 | Ga0501072_0000898_12562_13929 | 433 |
| 696 | 3300049589 | Ga0501073_0000014 | Ga0501073_0000014_133050_134417 | 433 |
| 697 | 3300049590 | Ga0501074_0009185 | Ga0501074_0009185_5292_6659 | 433 |
| 698 | 3300049742 | Ga0501080_0018899 | Ga0501080_0018899_4749_6116 | 433 |
| 699 | 3300049744 | Ga0501083_0000289 | Ga0501083_0000289_5407_6774 | 433 |
| 700 | 3300049822 | Ga0501035_0000608 | Ga0501035_0000608_17541_18908 | 433 |
| 701 | 3300049823 | Ga0501044_0000344 | Ga0501044_0000344_36624_37991 | 433 |
| 702 | 3300049824 | Ga0501045_0005228 | Ga0501045_0005228_5386_6753 | 433 |
| 703 | 3300050511 | nmdc:mga08y16_65892_c1 | nmdc:mga08y16_65892_c1_278_1696 | 433 |
| 704 | 3300053094 | Ga0500566_0000117 | Ga0500566_0000117_32095_33465 | 433 |
| 705 | 3300053095 | Ga0500640_000141 | Ga0500640_000141_5263_6633 | 433 |
| 706 | 3300053104 | Ga0500556_0009163 | Ga0500556_0009163_1419_2789 | 433 |
| 707 | 3300053105 | Ga0500557_000162 | Ga0500557_000162_1039_2409 | 433 |
| 708 | 3300053111 | Ga0500572_000828 | Ga0500572_000828_3138_4508 | 433 |
| 709 | 3300053122 | Ga0500608_043407 | Ga0500608_043407_363_1733 | 433 |
| 710 | 3300053123 | Ga0500614_000264 | Ga0500614_000264_10759_12129 | 433 |
| 711 | 3300053134 | Ga0500658_0035161 | Ga0500658_0035161_124_1494 | 433 |
| 712 | 3300053136 | Ga0500559_0002978 | Ga0500559_0002978_6550_7920 | 433 |
| 713 | 3300053148 | Ga0500590_035432 | Ga0500590_035432_113_1483 | 433 |
| 714 | 3300053150 | Ga0500603_000306 | Ga0500603_000306_4612_5982 | 433 |
| 715 | 3300053159 | Ga0500630_000221 | Ga0500630_000221_1641_3011 | 433 |
| 716 | 3300053163 | Ga0500639_000041 | Ga0500639_000041_24781_26151 | 433 |
| 717 | 3300053737 | Ga0500601_002092 | Ga0500601_002092_181_1560 | 433 |
| 718 | 3300054114 | Ga0501084_0001855 | Ga0501084_0001855_12313_13680 | 433 |
| 719 | 3300060353 | Ga0501082_0006680 | Ga0501082_0006680_7552_8919 | 433 |
| 720 | 3300061719 | Ga0466962_0038186 | Ga0466962_0038186_329_1699 | 433 |
| 721 | 3300003203 | JGI25406J46586_10000034 | JGI25406J46586_100000342 | 434 |
| 722 | 3300003354 | JGI25160J50197_1004954 | JGI25160J50197_10049542 | 434 |
| 723 | 3300005336 | Ga0070680_100016901 | Ga0070680_1000169012 | 434 |
| 724 | 3300005336 | Ga0070680_100027944 | Ga0070680_1000279445 | 434 |
| 725 | 3300005337 | Ga0070682_100024159 | Ga0070682_1000241591 | 434 |
| 726 | 3300005356 | Ga0070674_100126772 | Ga0070674_1001267721 | 434 |
| 727 | 3300005436 | Ga0070713_100093072 | Ga0070713_1000930722 | 434 |
| 728 | 3300005437 | Ga0070710_10011859 | Ga0070710_100118593 | 434 |
| 729 | 3300005439 | Ga0070711_100028927 | Ga0070711_1000289273 | 434 |
| 730 | 3300005455 | Ga0070663_100034654 | Ga0070663_1000346543 | 434 |
| 731 | 3300005458 | Ga0070681_10042647 | Ga0070681_100426475 | 434 |
| 732 | 3300005530 | Ga0070679_100022990 | Ga0070679_1000229903 | 434 |
| 733 | 3300005530 | Ga0070679_100040520 | Ga0070679_1000405203 | 434 |
| 734 | 3300005614 | Ga0068856_100000061 | Ga0068856_10000006165 | 434 |
| 735 | 3300005937 | Ga0081455_10006207 | Ga0081455_1000620710 | 434 |
| 736 | 3300005985 | Ga0081539_10000113 | Ga0081539_1000011356 | 434 |
| 737 | 3300006051 | Ga0075364_10028026 | Ga0075364_100280263 | 434 |
| 738 | 3300006175 | Ga0070712_100003491 | Ga0070712_1000034914 | 434 |
| 739 | 3300006186 | Ga0075369_10007616 | Ga0075369_100076163 | 434 |
| 740 | 3300007265 | Ga0099794_10010045 | Ga0099794_100100453 | 434 |
| 741 | 3300009093 | Ga0105240_10022923 | Ga0105240_100229233 | 434 |
| 742 | 3300009147 | Ga0114129_10052838 | Ga0114129_100528383 | 434 |
| 743 | 3300009174 | Ga0105241_10054655 | Ga0105241_100546551 | 434 |
| 744 | 3300009551 | Ga0105238_10071644 | Ga0105238_100716444 | 434 |
| 745 | 3300010375 | Ga0105239_10040516 | Ga0105239_100405164 | 434 |
| 746 | 3300013105 | Ga0157369_10003682 | Ga0157369_1000368216 | 434 |
| 747 | 3300013297 | Ga0157378_10009387 | Ga0157378_100093873 | 434 |
| 748 | 3300013307 | Ga0157372_10177915 | Ga0157372_101779152 | 434 |
| 749 | 3300025254 | Ga0209148_1000180 | Ga0209148_10001803 | 434 |
| 750 | 3300025272 | Ga0209455_1007803 | Ga0209455_10078032 | 434 |
| 751 | 3300025906 | Ga0207699_10010250 | Ga0207699_100102503 | 434 |
| 752 | 3300025912 | Ga0207707_10001362 | Ga0207707_100013625 | 434 |
| 753 | 3300025912 | Ga0207707_10109082 | Ga0207707_101090822 | 434 |
| 754 | 3300025913 | Ga0207695_10035687 | Ga0207695_100356874 | 434 |
| 755 | 3300025917 | Ga0207660_10020110 | Ga0207660_100201103 | 434 |
| 756 | 3300025917 | Ga0207660_10092897 | Ga0207660_100928972 | 434 |
| 757 | 3300025921 | Ga0207652_10009418 | Ga0207652_100094185 | 434 |
| 758 | 3300025938 | Ga0207704_10078578 | Ga0207704_100785782 | 434 |
| 759 | 3300025939 | Ga0207665_10005475 | Ga0207665_100054756 | 434 |
| 760 | 3300025941 | Ga0207711_10025944 | Ga0207711_100259444 | 434 |
| 761 | 3300026035 | Ga0207703_10088661 | Ga0207703_100886613 | 434 |
| 762 | 3300026078 | Ga0207702_10000243 | Ga0207702_100002437 | 434 |
| 763 | 3300026118 | Ga0207675_100130941 | Ga0207675_1001309413 | 434 |
| 764 | 3300028786 | Ga0307517_10001507 | Ga0307517_1000150715 | 434 |
| 765 | 3300031249 | Ga0265339_10020405 | Ga0265339_100204052 | 434 |
| 766 | 3300031730 | Ga0307516_10089715 | Ga0307516_100897152 | 434 |
| 767 | 3300033180 | Ga0307510_10008055 | Ga0307510_100080553 | 434 |
| 768 | 3300033180 | Ga0307510_10024060 | Ga0307510_100240602 | 434 |
| 769 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002240 | 434 |
| 770 | 3300035083 | Ga0373926_0004912 | Ga0373926_0004912_1417_2787 | 434 |
| 771 | 3300035111 | Ga0373923_0006495 | Ga0373923_0006495_2056_3426 | 434 |
| 772 | 3300035113 | Ga0373936_0006011 | Ga0373936_0006011_2819_4189 | 434 |
| 773 | 3300035116 | Ga0373945_0005674 | Ga0373945_0005674_1768_3138 | 434 |
| 774 | 3300035170 | Ga0373943_0008537 | Ga0373943_0008537_1420_2790 | 434 |
| 775 | 3300035171 | Ga0373946_0002265 | Ga0373946_0002265_1573_2943 | 434 |
| 776 | 3300035171 | Ga0373946_0013981 | Ga0373946_0013981_1081_2451 | 434 |
| 777 | 3300035172 | Ga0373955_0005896 | Ga0373955_0005896_162_1532 | 434 |
| 778 | 3300035692 | Ga0373935_0000681 | Ga0373935_0000681_9500_10870 | 434 |
| 779 | 3300035692 | Ga0373935_0028648 | Ga0373935_0028648_276_1646 | 434 |
| 780 | 3300035725 | Ga0373947_0000118 | Ga0373947_0000118_24767_26137 | 434 |
| 781 | 3300036401 | Ga0373937_0069070 | Ga0373937_0069070_317_1687 | 434 |
| 782 | 3300037068 | Ga0373925_0001151 | Ga0373925_0001151_20805_22175 | 434 |
| 783 | 3300037068 | Ga0373925_0093688 | Ga0373925_0093688_804_2183 | 434 |
| 784 | 3300037466 | Ga0395898_0042524 | Ga0395898_0042524_1222_2592 | 434 |
| 785 | 3300037853 | Ga0436364_1112623 | Ga0436364_1112623_90_1460 | 434 |
| 786 | 3300044842 | Ga0466957_0045999 | Ga0466957_0045999_927_2297 | 434 |
| 787 | 3300045976 | Ga0466967_0077106 | Ga0466967_0077106_1454_2824 | 434 |
| 788 | 3300046454 | Ga0495592_0033732 | Ga0495592_0033732_1045_2415 | 434 |
| 789 | 3300046455 | Ga0495603_0000053 | Ga0495603_0000053_45367_46737 | 434 |
| 790 | 3300046459 | Ga0495629_0018227 | Ga0495629_0018227_1120_2490 | 434 |
| 791 | 3300046459 | Ga0495629_0045223 | Ga0495629_0045223_1216_2586 | 434 |
| 792 | 3300046461 | Ga0495641_0010050 | Ga0495641_0010050_2057_3427 | 434 |
| 793 | 3300046462 | Ga0495651_0050024 | Ga0495651_0050024_1758_3128 | 434 |
| 794 | 3300046472 | Ga0495580_0001877 | Ga0495580_0001877_16772_18142 | 434 |
| 795 | 3300046473 | Ga0495582_0000186 | Ga0495582_0000186_28869_30239 | 434 |
| 796 | 3300046475 | Ga0495639_0000078 | Ga0495639_0000078_21103_22473 | 434 |
| 797 | 3300046475 | Ga0495639_0022927 | Ga0495639_0022927_1098_2468 | 434 |
| 798 | 3300046476 | Ga0495662_0001326 | Ga0495662_0001326_6706_8076 | 434 |
| 799 | 3300046477 | Ga0495664_0008167 | Ga0495664_0008167_1340_2710 | 434 |
| 800 | 3300046477 | Ga0495664_0011159 | Ga0495664_0011159_3585_4955 | 434 |
| 801 | 3300046499 | Ga0495594_0000103 | Ga0495594_0000103_27077_28447 | 434 |
| 802 | 3300046514 | Ga0495618_0117514 | Ga0495618_0117514_101_1471 | 434 |
| 803 | 3300046517 | Ga0495630_0153994 | Ga0495630_0153994_207_1577 | 434 |
| 804 | 3300046523 | Ga0495644_0026973 | Ga0495644_0026973_210_1580 | 434 |
| 805 | 3300046526 | Ga0495666_0093854 | Ga0495666_0093854_29_1399 | 434 |
| 806 | 3300046529 | Ga0495652_0131261 | Ga0495652_0131261_321_1691 | 434 |
| 807 | 3300046531 | Ga0495665_0000190 | Ga0495665_0000190_4898_6268 | 434 |
| 808 | 3300046533 | Ga0495640_0001905 | Ga0495640_0001905_9485_10855 | 434 |
| 809 | 3300046533 | Ga0495640_0087702 | Ga0495640_0087702_357_1727 | 434 |
| 810 | 3300046557 | Ga0495622_0015848 | Ga0495622_0015848_203_1573 | 434 |
| 811 | 3300046559 | Ga0495667_0009435 | Ga0495667_0009435_5088_6458 | 434 |
| 812 | 3300046642 | Ga0495634_0001169 | Ga0495634_0001169_8077_9447 | 434 |
| 813 | 3300046663 | Ga0495635_0000211 | Ga0495635_0000211_290_1660 | 434 |
| 814 | 3300046663 | Ga0495635_0000985 | Ga0495635_0000985_108_1478 | 434 |
| 815 | 3300046674 | Ga0495588_0033733 | Ga0495588_0033733_908_2278 | 434 |
| 816 | 3300046674 | Ga0495588_0054544 | Ga0495588_0054544_511_1881 | 434 |
| 817 | 3300046678 | Ga0495599_0000957 | Ga0495599_0000957_14336_15706 | 434 |
| 818 | 3300046679 | Ga0495623_0005834 | Ga0495623_0005834_6138_7508 | 434 |
| 819 | 3300046681 | Ga0495647_0028522 | Ga0495647_0028522_647_2017 | 434 |
| 820 | 3300046683 | Ga0495658_0000108 | Ga0495658_0000108_32980_34350 | 434 |
| 821 | 3300046683 | Ga0495658_0013308 | Ga0495658_0013308_2112_3482 | 434 |
| 822 | 3300046689 | Ga0495613_0105927 | Ga0495613_0105927_242_1612 | 434 |
| 823 | 3300046690 | Ga0495624_0003469 | Ga0495624_0003469_3947_5317 | 434 |
| 824 | 3300047315 | Ga0495581_0000501 | Ga0495581_0000501_2638_4008 | 434 |
| 825 | 3300047315 | Ga0495581_0013051 | Ga0495581_0013051_2627_3997 | 434 |
| 826 | 3300047317 | Ga0495604_0025993 | Ga0495604_0025993_332_1702 | 434 |
| 827 | 3300047319 | Ga0495674_0000228 | Ga0495674_0000228_43027_44397 | 434 |
| 828 | 3300047319 | Ga0495674_0070755 | Ga0495674_0070755_838_2208 | 434 |
| 829 | 3300047320 | Ga0495672_0011909 | Ga0495672_0011909_1886_3256 | 434 |
| 830 | 3300047321 | Ga0495676_0152454 | Ga0495676_0152454_19_1389 | 434 |
| 831 | 3300047469 | Ga0495673_0012247 | Ga0495673_0012247_1741_3132 | 434 |
| 832 | 3300047673 | Ga0495593_0002763 | Ga0495593_0002763_7333_8703 | 434 |
| 833 | 3300047673 | Ga0495593_0056534 | Ga0495593_0056534_503_1873 | 434 |
| 834 | 3300048913 | Ga0496110_0245293 | Ga0496110_0245293_58_1428 | 434 |
| 835 | 3300048915 | Ga0496112_0079384 | Ga0496112_0079384_704_2074 | 434 |
| 836 | 3300048919 | Ga0496116_0054476 | Ga0496116_0054476_232_1602 | 434 |
| 837 | 3300048920 | Ga0496117_0132713 | Ga0496117_0132713_45_1415 | 434 |
| 838 | 3300048924 | Ga0496121_0026234 | Ga0496121_0026234_3424_4794 | 434 |
| 839 | 3300050507 | nmdc:mga05p37_52659_c1 | nmdc:mga05p37_52659_c1_2730_4100 | 434 |
| 840 | 3300053078 | Ga0495612_0023374 | Ga0495612_0023374_19_1389 | 434 |
| 841 | 3300053080 | Ga0500635_0003054 | Ga0500635_0003054_2500_3870 | 434 |
| 842 | 3300053084 | Ga0495595_0079663 | Ga0495595_0079663_91_1461 | 434 |
| 843 | 3300053085 | Ga0495619_0061030 | Ga0495619_0061030_40_1410 | 434 |
| 844 | 3300053102 | Ga0500554_000617 | Ga0500554_000617_2572_3942 | 434 |
| 845 | 3300053111 | Ga0500572_001082 | Ga0500572_001082_5421_6794 | 434 |
| 846 | 3300053136 | Ga0500559_0000242 | Ga0500559_0000242_34636_36009 | 434 |
| 847 | 3300053150 | Ga0500603_000586 | Ga0500603_000586_2594_3964 | 434 |
| 848 | 3300053730 | Ga0500645_006818 | Ga0500645_006818_1901_3307 | 434 |
| 849 | iso_pu_bacteria | 2889033259 | 2889038115 | 434 |
| 850 | iso_pu_bacteria | 8006964411 | 8006968366 | 434 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7c7d-assembly2.cif.gz_B | crystal structure of the catalytic unit of thermostable gh87 alpha-1,3-glucanase from streptomyces thermodiastaticus strain hf3-3 | 0.6718 | 38 | 434 |
| 5lw3-assembly1.cif.gz_A | azotobacter vinelandii mannuronan c-5 epimerase alge6 a-module | 0.6699 | 38 | 434 |
| 5lw3-assembly1.cif.gz_A | azotobacter vinelandii mannuronan c-5 epimerase alge6 a-module | 0.6634 | 38 | 434 |
| 4nk8-assembly1.cif.gz_A | crystal structure of the periplasmic alginate epimerase algg d317a mutant | 0.6287 | 68 | 434 |
| 6k0m-assembly1.cif.gz_A | catalytic domain of gh87 alpha-1,3-glucanase from paenibacillus glycanilyticus fh11 | 0.6221 | 46 | 430 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nk8A00 | Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like | 0.6292 | 70 | 434 | 2.160.20.10 |
| af_A0A0R0G6S6_12_359_2.160.20.10 | Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like | 0.6234 | 38 | 357 | 2.160.20.10 |
| af_P9WFD9_1_145_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.5926 | 55 | 82 | 3.40.50.620 |
| af_A0A0R0G6S6_12_359_2.160.20.10 | Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like | 0.5779 | 38 | 357 | 2.160.20.10 |
| 3gq9A01 | Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like | 0.5766 | 39 | 401 | 2.160.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1NEA4-F1-model_v4 | TIGR03808 family TAT-translocated repetitive protein | 0.9664 | 46 | 260 |
|
| AF-A0A529U5T8-F1-model_v4 | deleted | 0.9595 | 39 | 151 |
|
| AF-A0A532AJ08-F1-model_v4 | TIGR03808 family TAT-translocated repetitive protein | 0.9503 | 145 | 247 |
|
| AF-A0A3C1NEA4-F1-model_v4 | TIGR03808 family TAT-translocated repetitive protein | 0.9446 | 46 | 260 |
|
| AF-A0A352VVS1-F1-model_v4 | Rhamnogalacturonase A/B/Epimerase-like pectate lyase domain-containing protein | 0.9435 | 39 | 80 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar