F483271

General Info

Members Datasets Scaffolds Average Seq Length
845 342 1690 302

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_89694_c1|nmdc:mga00v17_89694_c1_68_1069
Length 333
Sequence MTARSGKGPVRVATPGSQPIGSPAERELAIAEESSLEQVLELVPELRGGDRVVEPLEGGLTNENCKVTVGGNAFVVRRWSDDGELLSIDRDNEHENSVKAAEAGVGAPVVAYLPEHGALVIEFLEGRTLSAEDLRGGFPLDRVADACRRLHSAAPFRDDFDMFATQRAYLRIVTDRGFRLPDGYRDFEPRMEAIETALARAPEPKVPCNNDLLAENFIDAGERLWLIDYEYSGNNEASFELGNIWSESGLSNEQLGELVSAYWGHESPSKVARARLWGLMSKYGWTLWASIQDGVSTIDFDFWAWGMEKYERAVDEFDGPEFDELLARAGEGG

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
168 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
169 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 13.14
Rhizosphere 85.21
Stem 0
Stem Tuber 0
Unclassified 3.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_89694_c1 3300050491 Bacteria 1929
2 SwRhRL3b_contig_773504 2162886006 Bacteria 2018
3 SwRhRL2b_contig_1616711 2162886007 Unclassified 4198
4 JGI25406J46586_10015414 3300003203 Bacteria 3224
5 Ga0065704_10071045 3300005289 Bacteria 13525
6 Ga0065704_10138478 3300005289 Bacteria 1543
7 Ga0065707_10000455 3300005295 Bacteria 78106
8 Ga0065707_10085700 3300005295 Bacteria 5952
9 Ga0065707_10113091 3300005295 Bacteria 2339
10 Ga0070658_10173249 3300005327 Bacteria 1813
11 Ga0070683_100048326 3300005329 Bacteria 3933
12 Ga0070683_100132326 3300005329 Bacteria 2361
13 Ga0070683_100169410 3300005329 Unclassified 2073
14 Ga0070690_100027055 3300005330 Bacteria 3543
15 Ga0070670_100348185 3300005331 Bacteria 1301
16 Ga0070680_100254621 3300005336 Bacteria 1485
17 Ga0070682_100024432 3300005337 Bacteria 3597
18 Ga0070682_100064911 3300005337 Bacteria 2318
19 Ga0070682_100105513 3300005337 Bacteria 1868
20 Ga0070682_100157601 3300005337 Bacteria 1565
21 Ga0068868_100100170 3300005338 Bacteria 2344
22 Ga0068868_100196903 3300005338 Bacteria 1678
23 Ga0070660_100009162 3300005339 Bacteria 6950
24 Ga0070687_100123992 3300005343 Bacteria 1482
25 Ga0070661_100484041 3300005344 Bacteria 989
26 Ga0070692_10016190 3300005345 Bacteria 3544
27 Ga0070692_10040166 3300005345 Bacteria 2392
28 Ga0070668_100046835 3300005347 Bacteria 3322
29 Ga0070669_100094564 3300005353 Bacteria 2246
30 Ga0070675_100082004 3300005354 Bacteria 2690
31 Ga0070674_100087016 3300005356 Bacteria 2246
32 Ga0070674_100171714 3300005356 Bacteria 1653
33 Ga0070674_100226274 3300005356 Bacteria 1458
34 Ga0070673_100298471 3300005364 Bacteria 1418
35 Ga0070688_100015261 3300005365 Bacteria 4365
36 Ga0070659_100021336 3300005366 Bacteria 4932
37 Ga0070659_100023177 3300005366 Bacteria 4747
38 Ga0070659_100023449 3300005366 Bacteria 4722
39 Ga0070659_100071626 3300005366 Bacteria 2756
40 Ga0070667_100062167 3300005367 Bacteria 3162
41 Ga0070667_100297761 3300005367 Bacteria 1452
42 Ga0070703_10033814 3300005406 Bacteria 1558
43 Ga0070714_100090572 3300005435 Bacteria 2679
44 Ga0070714_100100247 3300005435 Bacteria 2551
45 Ga0070714_100122203 3300005435 Bacteria 2317
46 Ga0070714_100160715 3300005435 Bacteria 2032
47 Ga0070714_100448108 3300005435 Bacteria 1226
48 Ga0070713_100042317 3300005436 Bacteria 3717
49 Ga0070713_100074042 3300005436 Bacteria 2884
50 Ga0070713_100135822 3300005436 Bacteria 2173
51 Ga0070713_100215139 3300005436 Bacteria 1741
52 Ga0070713_100291060 3300005436 Bacteria 1501
53 Ga0070710_10019211 3300005437 Bacteria 3528
54 Ga0070710_10030364 3300005437 Bacteria 2907
55 Ga0070711_100159154 3300005439 Bacteria 1710
56 Ga0070700_100029116 3300005441 Bacteria 3290
57 Ga0070700_100099060 3300005441 Unclassified 1917
58 Ga0070700_100341763 3300005441 Bacteria 1106
59 Ga0070663_100021769 3300005455 Bacteria 4271
60 Ga0070663_100052825 3300005455 Bacteria 2899
61 Ga0070663_100121168 3300005455 Bacteria 1976
62 Ga0070678_100018861 3300005456 Bacteria 4480
63 Ga0070678_100141544 3300005456 Bacteria 1925
64 Ga0070662_100096179 3300005457 Bacteria 2234
65 Ga0070681_10006050 3300005458 Bacteria 11732
66 Ga0070681_10133755 3300005458 Bacteria 2411
67 Ga0070685_10066436 3300005466 Bacteria 2125
68 Ga0070685_10122305 3300005466 Bacteria 1617
69 Ga0070707_100346482 3300005468 Unclassified 1443
70 Ga0070707_100406363 3300005468 Unclassified 1322
71 Ga0070707_100433500 3300005468 Bacteria 1275
72 Ga0070698_100162686 3300005471 Bacteria 2175
73 Ga0070698_100260190 3300005471 Bacteria 1667
74 Ga0070698_100340402 3300005471 Bacteria 1431
75 Ga0070679_100024283 3300005530 Bacteria 5940
76 Ga0070679_100087955 3300005530 Bacteria 3094
77 Ga0070684_100014984 3300005535 Bacteria 6296
78 Ga0070684_100015223 3300005535 Bacteria 6256
79 Ga0070684_100049481 3300005535 Bacteria 3648
80 Ga0068853_100272886 3300005539 Bacteria 1558
81 Ga0068853_100448022 3300005539 Bacteria 1214
82 Ga0070672_100341061 3300005543 Bacteria 1276
83 Ga0070686_100050539 3300005544 Bacteria 2643
84 Ga0070686_100092600 3300005544 Bacteria 2025
85 Ga0070695_100000359 3300005545 Bacteria 23407
86 Ga0070696_100093401 3300005546 Bacteria 2146
87 Ga0070665_100207031 3300005548 Bacteria 1962
88 Ga0070704_100334751 3300005549 Bacteria 1273
89 Ga0068855_100130185 3300005563 Bacteria 2874
90 Ga0070664_100063936 3300005564 Bacteria 3138
91 Ga0070664_100133377 3300005564 Bacteria 2182
92 Ga0068857_100114195 3300005577 Bacteria 2429
93 Ga0068857_100180036 3300005577 Bacteria 1924
94 Ga0068857_100185296 3300005577 Bacteria 1895
95 Ga0068854_100045561 3300005578 Bacteria 3119
96 Ga0068856_100006334 3300005614 Bacteria 11609
97 Ga0068856_100105943 3300005614 Bacteria 2806
98 Ga0068856_100111151 3300005614 Bacteria 2738
99 Ga0070702_100016244 3300005615 Bacteria 3815
100 Ga0070702_100017563 3300005615 Bacteria 3692
101 Ga0070702_100021654 3300005615 Bacteria 3387
102 Ga0070702_100119507 3300005615 Bacteria 1647
103 Ga0070702_100249648 3300005615 Bacteria 1202
104 Ga0070702_100283330 3300005615 Bacteria 1139
105 Ga0068852_100044144 3300005616 Bacteria 3783
106 Ga0068852_100400875 3300005616 Bacteria 1349
107 Ga0068859_100048345 3300005617 Bacteria 4274
108 Ga0068859_100090887 3300005617 Bacteria 3104
109 Ga0068859_100099060 3300005617 Bacteria 2970
110 Ga0068864_100084275 3300005618 Bacteria 2792
111 Ga0068864_100085447 3300005618 Bacteria 2774
112 Ga0068864_100228646 3300005618 Bacteria 1719
113 Ga0068866_10003676 3300005718 Bacteria 6282
114 Ga0068861_100029031 3300005719 Bacteria 4041
115 Ga0068861_100364720 3300005719 Bacteria 1271
116 Ga0068870_10030496 3300005840 Bacteria 2725
117 Ga0068863_100106636 3300005841 Bacteria 2666
118 Ga0068858_100028656 3300005842 Bacteria 5171
119 Ga0068858_100129448 3300005842 Bacteria 2365
120 Ga0068858_100148858 3300005842 Bacteria 2200
121 Ga0068858_100167248 3300005842 Bacteria 2072
122 Ga0068860_100245104 3300005843 Bacteria 1743
123 Ga0068860_100335934 3300005843 Bacteria 1485
124 Ga0068862_100504308 3300005844 Bacteria 1149
125 Ga0081455_10038687 3300005937 Bacteria 4222
126 Ga0081455_10059088 3300005937 Bacteria 3240
127 Ga0081538_10000334 3300005981 Bacteria 53496
128 Ga0081538_10010105 3300005981 Bacteria 7764
129 Ga0081539_10000030 3300005985 Bacteria 317236
130 Ga0081539_10003721 3300005985 Bacteria 18169
131 Ga0081539_10006133 3300005985 Bacteria 11704
132 Ga0081539_10106093 3300005985 Bacteria 1423
133 Ga0070717_10003334 3300006028 Bacteria 11467
134 Ga0070717_10012327 3300006028 Bacteria 6516
135 Ga0070717_10012838 3300006028 Bacteria 6396
136 Ga0070717_10041577 3300006028 Bacteria 3747
137 Ga0070717_10060246 3300006028 Bacteria 3143
138 Ga0070717_10298489 3300006028 Bacteria 1432
139 Ga0075365_10035696 3300006038 Bacteria 3218
140 Ga0075365_10046928 3300006038 Bacteria 2838
141 Ga0075363_100050333 3300006048 Bacteria 2220
142 Ga0075363_100081658 3300006048 Bacteria 1768
143 Ga0075364_10022008 3300006051 Bacteria 4022
144 Ga0070715_10003920 3300006163 Bacteria 4815
145 Ga0070716_100133355 3300006173 Bacteria 1573
146 Ga0070712_100004677 3300006175 Bacteria 8463
147 Ga0070712_100023110 3300006175 Bacteria 4103
148 Ga0070712_100325839 3300006175 Bacteria 1250
149 Ga0075367_10011615 3300006178 Bacteria 4669
150 Ga0097621_100005205 3300006237 Bacteria 9141
151 Ga0097621_100260296 3300006237 Bacteria 1522
152 Ga0097621_100456305 3300006237 Bacteria 1152
153 Ga0068871_100055437 3300006358 Bacteria 3217
154 Ga0068871_100090513 3300006358 Bacteria 2548
155 Ga0068871_100362072 3300006358 Bacteria 1285
156 Ga0075428_100012728 3300006844 Bacteria 9358
157 Ga0075428_100018997 3300006844 Bacteria 7601
158 Ga0075428_100164033 3300006844 Unclassified 2411
159 Ga0075428_100186741 3300006844 Bacteria 2242
160 Ga0075428_100191377 3300006844 Bacteria 2212
161 Ga0075430_100001835 3300006846 Bacteria 17383
162 Ga0075430_100017412 3300006846 Bacteria 6120
163 Ga0075430_100195012 3300006846 Bacteria 1683
164 Ga0075431_100002368 3300006847 Bacteria 18107
165 Ga0075431_100065203 3300006847 Bacteria 3760
166 Ga0075433_10171241 3300006852 Bacteria 1932
167 Ga0075433_10280554 3300006852 Bacteria 1476
168 Ga0075434_100005044 3300006871 Bacteria 11993
169 Ga0075434_100017913 3300006871 Bacteria 6833
170 Ga0075434_100034063 3300006871 Bacteria 5028
171 Ga0075434_100128425 3300006871 Bacteria 2552
172 Ga0075429_100002220 3300006880 Bacteria 16257
173 Ga0075429_100053714 3300006880 Unclassified 3505
174 Ga0075429_100056139 3300006880 Bacteria 3427
175 Ga0075429_100106223 3300006880 Bacteria 2453
176 Ga0075429_100115955 3300006880 Unclassified 2342
177 Ga0075429_100181582 3300006880 Bacteria 1844
178 Ga0068865_100020050 3300006881 Bacteria 4335
179 Ga0068865_100036539 3300006881 Bacteria 3312
180 Ga0068865_100047657 3300006881 Bacteria 2946
181 Ga0068865_100123100 3300006881 Bacteria 1932
182 Ga0075436_100026760 3300006914 Bacteria 3971
183 Ga0097620_100048347 3300006931 Bacteria 4274
184 Ga0097620_100090884 3300006931 Bacteria 3104
185 Ga0097620_100099058 3300006931 Bacteria 2970
186 Ga0097620_100195714 3300006931 Unclassified 2106
187 Ga0075435_100009187 3300007076 Bacteria 7138
188 Ga0075435_100025502 3300007076 Bacteria 4603
189 Ga0075435_100027516 3300007076 Bacteria 4449
190 Ga0105251_10088964 3300009011 Bacteria 1420
191 Ga0111539_10009010 3300009094 Bacteria 12629
192 Ga0111539_10021125 3300009094 Bacteria 8016
193 Ga0111539_10182390 3300009094 Bacteria 2451
194 Ga0105245_10006019 3300009098 Bacteria 10662
195 Ga0105245_10240414 3300009098 Bacteria 1755
196 Ga0105245_10554676 3300009098 Bacteria 1171
197 Ga0105247_10026102 3300009101 Bacteria 3526
198 Ga0105247_10031293 3300009101 Bacteria 3229
199 Ga0114129_10030629 3300009147 Bacteria 7612
200 Ga0114129_10037151 3300009147 Bacteria 6876
201 Ga0114129_10052194 3300009147 Bacteria 5738
202 Ga0114129_10105041 3300009147 Unclassified 3904
203 Ga0114129_10117464 3300009147 Unclassified 3665
204 Ga0114129_10359531 3300009147 Bacteria 1927
205 Ga0114129_10390534 3300009147 Bacteria 1836
206 Ga0114129_10687013 3300009147 Unclassified 1317
207 Ga0105243_10047338 3300009148 Bacteria 3384
208 Ga0105243_10065382 3300009148 Bacteria 2921
209 Ga0105243_10166112 3300009148 Bacteria 1907
210 Ga0105241_10183053 3300009174 Bacteria 1739
211 Ga0105241_10186657 3300009174 Bacteria 1723
212 Ga0105242_10042961 3300009176 Bacteria 3653
213 Ga0105248_10099948 3300009177 Bacteria 3268
214 Ga0105248_10166113 3300009177 Bacteria 2488
215 Ga0105248_10233342 3300009177 Bacteria 2071
216 Ga0105248_10588830 3300009177 Bacteria 1255
217 Ga0105237_10043243 3300009545 Bacteria 4539
218 Ga0105238_10026880 3300009551 Bacteria 5865
219 Ga0105238_10151506 3300009551 Bacteria 2294
220 Ga0105238_10292383 3300009551 Bacteria 1612
221 Ga0105249_10031795 3300009553 Bacteria 4774
222 Ga0105249_10047447 3300009553 Bacteria 3914
223 Ga0105249_10115304 3300009553 Bacteria 2545
224 Ga0105249_10405993 3300009553 Bacteria 1394
225 Ga0105239_10014059 3300010375 Bacteria 8886
226 Ga0105239_10033596 3300010375 Bacteria 5632
227 Ga0105239_10079496 3300010375 Bacteria 3609
228 Ga0105239_10146882 3300010375 Bacteria 2630
229 Ga0105239_10285580 3300010375 Bacteria 1858
230 Ga0105239_10393797 3300010375 Bacteria 1567
231 Ga0105246_10002035 3300011119 Bacteria 12201
232 Ga0105246_10143252 3300011119 Bacteria 1800
233 Ga0105246_10306799 3300011119 Bacteria 1284
234 Ga0157369_10005118 3300013105 Bacteria 15353
235 Ga0157369_10007584 3300013105 Bacteria 12486
236 Ga0157369_10254253 3300013105 Bacteria 1833
237 Ga0157369_10294259 3300013105 Bacteria 1690
238 Ga0157374_10019073 3300013296 Bacteria 6069
239 Ga0157374_10030966 3300013296 Bacteria 4859
240 Ga0157378_10016316 3300013297 Bacteria 6505
241 Ga0157378_10459545 3300013297 Bacteria 1265
242 Ga0163162_10036532 3300013306 Bacteria 4897
243 Ga0157372_10034401 3300013307 Bacteria 5570
244 Ga0157372_10074607 3300013307 Bacteria 3825
245 Ga0157372_10212398 3300013307 Bacteria 2242
246 Ga0157375_10046969 3300013308 Bacteria 4213
247 Ga0157375_10076626 3300013308 Bacteria 3372
248 Ga0157375_10153595 3300013308 Bacteria 2439
249 Ga0157375_10592858 3300013308 Bacteria 1268
250 Ga0163163_10144526 3300014325 Bacteria 2422
251 Ga0163163_10454955 3300014325 Bacteria 1340
252 Ga0157380_10169355 3300014326 Bacteria 1906
253 Ga0182008_10119659 3300014497 Bacteria 1309
254 Ga0157377_10232502 3300014745 Bacteria 1186
255 Ga0157379_10020054 3300014968 Bacteria 5909
256 Ga0157379_10111706 3300014968 Bacteria 2455
257 Ga0157376_10035011 3300014969 Bacteria 4059
258 Ga0157376_10140441 3300014969 Bacteria 2166
259 Ga0157376_10205951 3300014969 Bacteria 1813
260 Ga0157376_10224109 3300014969 Bacteria 1743
261 Ga0207653_10051052 3300025885 Bacteria 1376
262 Ga0207642_10092909 3300025899 Bacteria 1495
263 Ga0207642_10165445 3300025899 Bacteria 1191
264 Ga0207710_10021751 3300025900 Bacteria 2751
265 Ga0207688_10006649 3300025901 Bacteria 6289
266 Ga0207688_10033219 3300025901 Bacteria 2853
267 Ga0207688_10084524 3300025901 Bacteria 1817
268 Ga0207688_10106226 3300025901 Bacteria 1626
269 Ga0207680_10268946 3300025903 Bacteria 1182
270 Ga0207685_10005154 3300025905 Bacteria 3415
271 Ga0207685_10036804 3300025905 Bacteria 1797
272 Ga0207699_10060111 3300025906 Bacteria 2280
273 Ga0207699_10217304 3300025906 Bacteria 1303
274 Ga0207699_10256106 3300025906 Bacteria 1208
275 Ga0207645_10082555 3300025907 Bacteria 2060
276 Ga0207645_10118194 3300025907 Bacteria 1720
277 Ga0207643_10006760 3300025908 Bacteria 6151
278 Ga0207643_10040499 3300025908 Bacteria 2623
279 Ga0207705_10085555 3300025909 Bacteria 2303
280 Ga0207654_10061595 3300025911 Bacteria 2196
281 Ga0207707_10064973 3300025912 Unclassified 3178
282 Ga0207707_10089244 3300025912 Bacteria 2694
283 Ga0207671_10023280 3300025914 Bacteria 4672
284 Ga0207693_10000946 3300025915 Bacteria 26051
285 Ga0207693_10008106 3300025915 Bacteria 8616
286 Ga0207693_10132879 3300025915 Bacteria 1956
287 Ga0207693_10148515 3300025915 Bacteria 1843
288 Ga0207663_10010059 3300025916 Bacteria 5016
289 Ga0207663_10012946 3300025916 Bacteria 4523
290 Ga0207660_10162367 3300025917 Bacteria 1724
291 Ga0207662_10096186 3300025918 Bacteria 1829
292 Ga0207657_10000634 3300025919 Bacteria 37262
293 Ga0207657_10002448 3300025919 Bacteria 20057
294 Ga0207657_10003834 3300025919 Bacteria 15968
295 Ga0207652_10127108 3300025921 Bacteria 2271
296 Ga0207652_10131014 3300025921 Bacteria 2237
297 Ga0207652_10220569 3300025921 Bacteria 1709
298 Ga0207646_10000129 3300025922 Bacteria 102411
299 Ga0207694_10095608 3300025924 Bacteria 2349
300 Ga0207694_10210550 3300025924 Bacteria 1583
301 Ga0207650_10082485 3300025925 Bacteria 2441
302 Ga0207687_10004747 3300025927 Bacteria 9044
303 Ga0207687_10017115 3300025927 Bacteria 4765
304 Ga0207687_10379327 3300025927 Bacteria 1158
305 Ga0207700_10030834 3300025928 Bacteria 3803
306 Ga0207700_10098003 3300025928 Bacteria 2331
307 Ga0207700_10117824 3300025928 Bacteria 2148
308 Ga0207700_10208142 3300025928 Bacteria 1652
309 Ga0207664_10022570 3300025929 Bacteria 4703
310 Ga0207664_10024247 3300025929 Bacteria 4557
311 Ga0207664_10176526 3300025929 Bacteria 1832
312 Ga0207664_10391736 3300025929 Bacteria 1234
313 Ga0207690_10024370 3300025932 Bacteria 3790
314 Ga0207706_10038710 3300025933 Bacteria 4230
315 Ga0207706_10199435 3300025933 Bacteria 1755
316 Ga0207706_10313630 3300025933 Bacteria 1365
317 Ga0207686_10002552 3300025934 Bacteria 9894
318 Ga0207709_10038675 3300025935 Bacteria 2844
319 Ga0207709_10048447 3300025935 Bacteria 2589
320 Ga0207670_10188181 3300025936 Bacteria 1560
321 Ga0207669_10102740 3300025937 Bacteria 1894
322 Ga0207704_10038287 3300025938 Bacteria 2780
323 Ga0207704_10057762 3300025938 Bacteria 2385
324 Ga0207665_10003933 3300025939 Bacteria 9948
325 Ga0207665_10110488 3300025939 Bacteria 1931
326 Ga0207691_10145516 3300025940 Bacteria 2086
327 Ga0207691_10274778 3300025940 Bacteria 1450
328 Ga0207691_10302871 3300025940 Bacteria 1373
329 Ga0207689_10008991 3300025942 Bacteria 8653
330 Ga0207661_10011023 3300025944 Bacteria 6533
331 Ga0207661_10130757 3300025944 Bacteria 2150
332 Ga0207679_10196517 3300025945 Bacteria 1682
333 Ga0207679_10277585 3300025945 Bacteria 1436
334 Ga0207667_10018029 3300025949 Bacteria 7929
335 Ga0207712_10052393 3300025961 Bacteria 2858
336 Ga0207712_10062599 3300025961 Bacteria 2645
337 Ga0207712_10111300 3300025961 Bacteria 2054
338 Ga0207677_10013030 3300026023 Bacteria 4804
339 Ga0207677_10046695 3300026023 Bacteria 2902
340 Ga0207677_10084802 3300026023 Bacteria 2285
341 Ga0207703_10126703 3300026035 Bacteria 2199
342 Ga0207703_10327178 3300026035 Bacteria 1405
343 Ga0207639_10083285 3300026041 Bacteria 2538
344 Ga0207639_10165926 3300026041 Bacteria 1865
345 Ga0207639_10258149 3300026041 Bacteria 1523
346 Ga0207678_10080390 3300026067 Bacteria 2791
347 Ga0207678_10268835 3300026067 Bacteria 1462
348 Ga0207708_10010743 3300026075 Bacteria 6807
349 Ga0207708_10014813 3300026075 Bacteria 5836
350 Ga0207708_10024294 3300026075 Bacteria 4583
351 Ga0207708_10093625 3300026075 Bacteria 2319
352 Ga0207708_10102741 3300026075 Bacteria 2213
353 Ga0207702_10113643 3300026078 Bacteria 2412
354 Ga0207702_10348528 3300026078 Bacteria 1416
355 Ga0207648_10049395 3300026089 Bacteria 3681
356 Ga0207648_10109826 3300026089 Bacteria 2421
357 Ga0207676_10135311 3300026095 Bacteria 2101
358 Ga0207674_10050731 3300026116 Bacteria 4238
359 Ga0207674_10080482 3300026116 Bacteria 3261
360 Ga0207674_10170052 3300026116 Bacteria 2133
361 Ga0207674_10322500 3300026116 Bacteria 1494
362 Ga0207675_100020004 3300026118 Bacteria 6246
363 Ga0207675_100151352 3300026118 Bacteria 2208
364 Ga0207675_100200394 3300026118 Bacteria 1917
365 Ga0207675_100214870 3300026118 Bacteria 1851
366 Ga0207683_10002216 3300026121 Bacteria 17089
367 Ga0207683_10031246 3300026121 Bacteria 4621
368 Ga0207683_10087444 3300026121 Bacteria 2772
369 Ga0207698_10067279 3300026142 Bacteria 2824
370 Ga0207698_10148407 3300026142 Bacteria 2031
371 Ga0207698_10176577 3300026142 Bacteria 1887
372 Ga0207428_10046656 3300027907 Bacteria 3484
373 Ga0207428_10318035 3300027907 Bacteria 1150
374 Ga0268266_10049156 3300028379 Bacteria 3615
375 Ga0265337_1004161 3300028556 Bacteria 6066
376 Ga0265326_10000985 3300028558 Bacteria 10274
377 Ga0265319_1006680 3300028563 Bacteria 5306
378 Ga0265319_1018571 3300028563 Bacteria 2615
379 Ga0265319_1078490 3300028563 Bacteria 1050
380 Ga0265319_1081960 3300028563 Bacteria 1024
381 Ga0265334_10000505 3300028573 Bacteria 20077
382 Ga0265334_10006757 3300028573 Bacteria 4928
383 Ga0265334_10007101 3300028573 Bacteria 4805
384 Ga0265318_10006636 3300028577 Bacteria 5311
385 Ga0265318_10010392 3300028577 Bacteria 4056
386 Ga0265318_10048772 3300028577 Bacteria 1594
387 Ga0265318_10071968 3300028577 Bacteria 1281
388 Ga0265323_10004152 3300028653 Bacteria 6275
389 Ga0265322_10004479 3300028654 Bacteria 4157
390 Ga0265322_10015492 3300028654 Bacteria 2202
391 Ga0265336_10001069 3300028666 Bacteria 13324
392 Ga0265338_10004673 3300028800 Bacteria 18371
393 Ga0265338_10007523 3300028800 Bacteria 13478
394 Ga0265338_10030965 3300028800 Bacteria 5255
395 Ga0265338_10034060 3300028800 Bacteria 4931
396 Ga0265338_10074725 3300028800 Bacteria 2880
397 Ga0265338_10131302 3300028800 Bacteria 1977
398 Ga0265338_10141608 3300028800 Bacteria 1883
399 Ga0265338_10295556 3300028800 Bacteria 1179
400 Ga0265324_10004094 3300029957 Bacteria 6689
401 Ga0265324_10006242 3300029957 Bacteria 5007
402 Ga0265332_10003171 3300031238 Bacteria 8002
403 Ga0265332_10030653 3300031238 Bacteria 2348
404 Ga0265320_10014688 3300031240 Bacteria 4446
405 Ga0265320_10029144 3300031240 Bacteria 2858
406 Ga0265325_10004728 3300031241 Bacteria 8533
407 Ga0265325_10013050 3300031241 Bacteria 4737
408 Ga0265340_10003725 3300031247 Bacteria 8581
409 Ga0265340_10011050 3300031247 Bacteria 4811
410 Ga0265340_10088427 3300031247 Bacteria 1451
411 Ga0265339_10010372 3300031249 Bacteria 5791
412 Ga0265339_10039599 3300031249 Bacteria 2623
413 Ga0265331_10013916 3300031250 Bacteria 4304
414 Ga0265327_10002558 3300031251 Bacteria 18875
415 Ga0265327_10034908 3300031251 Bacteria 2785
416 Ga0265327_10089888 3300031251 Bacteria 1499
417 Ga0265316_10007535 3300031344 Bacteria 10240
418 Ga0265316_10022059 3300031344 Bacteria 5379
419 Ga0265316_10079582 3300031344 Bacteria 2514
420 Ga0265316_10109600 3300031344 Bacteria 2092
421 Ga0265316_10187483 3300031344 Bacteria 1538
422 Ga0265316_10437047 3300031344 Bacteria 940
423 Ga0307408_100189299 3300031548 Bacteria 1657
424 Ga0265313_10003931 3300031595 Bacteria 11697
425 Ga0265313_10016044 3300031595 Bacteria 4329
426 Ga0316575_10029428 3300031665 Unclassified 2145
427 Ga0265314_10004902 3300031711 Bacteria 12237
428 Ga0265314_10042767 3300031711 Bacteria 3227
429 Ga0265314_10049371 3300031711 Bacteria 2946
430 Ga0265314_10136623 3300031711 Bacteria 1521
431 Ga0265342_10004212 3300031712 Bacteria 11419
432 Ga0265342_10026872 3300031712 Bacteria 3603
433 Ga0307405_10024270 3300031731 Bacteria 3461
434 Ga0316577_10012886 3300031733 Bacteria 4562
435 Ga0307413_10012124 3300031824 Bacteria 4276
436 Ga0307410_10004035 3300031852 Bacteria 7504
437 Ga0307407_10010395 3300031903 Bacteria 4388
438 Ga0307409_100248547 3300031995 Bacteria 1624
439 Ga0307416_100409599 3300032002 Bacteria 1396
440 Ga0307411_10019058 3300032005 Bacteria 3953
441 Ga0307415_100012746 3300032126 Bacteria 4874
442 Ga0307415_100043630 3300032126 Bacteria 2993
443 Ga0373944_0055284 3300035089 Bacteria 1260
444 Ga0373923_0067463 3300035111 Bacteria 1530
445 Ga0373932_0105958 3300035112 Unclassified 921
446 Ga0373943_0005519 3300035170 Bacteria 5682
447 Ga0373955_0097350 3300035172 Bacteria 1685
448 Ga0373961_0082404 3300035241 Bacteria 1014
449 Ga0316574_0004746 3300035398 Bacteria 7175
450 Ga0373924_0019130 3300035410 Bacteria 2650
451 Ga0373931_0065209 3300035691 Bacteria 1973
452 Ga0373927_0028909 3300035695 Bacteria 3614
453 Ga0373933_0220276 3300035724 Bacteria 1217
454 Ga0373947_0016400 3300035725 Bacteria 4257
455 Ga0373947_0077678 3300035725 Bacteria 2048
456 Ga0373947_0113478 3300035725 Bacteria 1715
457 Ga0373937_0007821 3300036401 Bacteria 9266
458 Ga0373925_0121036 3300037068 Bacteria 2032
459 Ga0395899_0002792 3300037312 Bacteria 14071
460 Ga0395899_0007525 3300037312 Bacteria 8416
461 Ga0395900_0007157 3300037418 Bacteria 11564
462 Ga0395898_0002275 3300037466 Bacteria 23195
463 Ga0395898_0019557 3300037466 Bacteria 6889
464 Ga0395898_0667273 3300037466 Bacteria 982
465 Ga0395905_0002172 3300037471 Bacteria 22182
466 Ga0395905_0110975 3300037471 Bacteria 2575
467 Ga0316581_0005588 3300037588 Bacteria 3290
468 Ga0436364_0777713 3300037853 Bacteria 6887
469 Ga0395901_0075890 3300038443 Bacteria 3507
470 Ga0395901_0081612 3300038443 Bacteria 3377
471 Ga0395901_0139125 3300038443 Bacteria 2552
472 Ga0395901_0589858 3300038443 Bacteria 1122
473 Ga0436365_0461948 3300039437 Bacteria 1956
474 Ga0453683_0002264 3300044673 Bacteria 15201
475 Ga0466965_0041019 3300044683 Bacteria 2279
476 Ga0466966_0027558 3300044684 Bacteria 3704
477 Ga0466961_0020049 3300044693 Bacteria 4302
478 Ga0466961_0129793 3300044693 Bacteria 1580
479 Ga0466961_0186750 3300044693 Bacteria 1286
480 Ga0466963_0003110 3300044694 Bacteria 9411
481 Ga0466963_0011905 3300044694 Bacteria 5311
482 Ga0466963_0013597 3300044694 Bacteria 5000
483 Ga0466963_0014419 3300044694 Bacteria 4872
484 Ga0466963_0069221 3300044694 Bacteria 2371
485 Ga0466963_0090319 3300044694 Bacteria 2085
486 Ga0466963_0237410 3300044694 Bacteria 1278
487 Ga0466964_0006026 3300044706 Bacteria 4517
488 Ga0466964_0008127 3300044706 Bacteria 3936
489 Ga0466964_0009743 3300044706 Bacteria 3619
490 Ga0466964_0083304 3300044706 Bacteria 1377
491 Ga0466964_0098899 3300044706 Bacteria 1283
492 Ga0453684_0036659 3300044712 Bacteria 6753
493 Ga0466971_0001860 3300044719 Bacteria 8982
494 Ga0466968_0105151 3300044735 Unclassified 1264
495 Ga0466970_0225720 3300044765 Bacteria 1046
496 Ga0466957_0007796 3300044842 Bacteria 6063
497 Ga0466957_0052632 3300044842 Bacteria 2479
498 Ga0466957_0061608 3300044842 Bacteria 2303
499 Ga0466957_0096308 3300044842 Bacteria 1860
500 Ga0466960_0026572 3300044901 Bacteria 2631
501 Ga0466960_0107170 3300044901 Bacteria 1447
502 Ga0466959_0000274 3300045049 Bacteria 31486
503 Ga0466959_0055984 3300045049 Bacteria 2878
504 Ga0466958_0002650 3300045836 Bacteria 9045
505 Ga0466958_0009410 3300045836 Bacteria 5445
506 Ga0466967_0005029 3300045976 Bacteria 9060
507 Ga0466967_0012518 3300045976 Bacteria 6494
508 Ga0466967_0016540 3300045976 Bacteria 5821
509 Ga0466967_0020863 3300045976 Bacteria 5307
510 Ga0466967_0029880 3300045976 Bacteria 4567
511 Ga0466967_0051769 3300045976 Bacteria 3600
512 Ga0466967_0064348 3300045976 Bacteria 3261
513 Ga0466967_0080839 3300045976 Bacteria 2934
514 Ga0466967_0086825 3300045976 Bacteria 2835
515 Ga0466967_0090006 3300045976 Bacteria 2787
516 Ga0466967_0111810 3300045976 Unclassified 2510
517 Ga0466967_0118514 3300045976 Bacteria 2442
518 Ga0466967_0132688 3300045976 Bacteria 2313
519 Ga0466967_0206677 3300045976 Unclassified 1861
520 Ga0466967_0233867 3300045976 Unclassified 1750
521 Ga0466967_0236657 3300045976 Bacteria 1740
522 Ga0466967_0327813 3300045976 Unclassified 1478
523 Ga0466967_0827764 3300045976 Unclassified 919
524 Ga0495603_0084426 3300046455 Bacteria 1859
525 Ga0495590_0025372 3300046457 Bacteria 2084
526 Ga0495629_0034076 3300046459 Bacteria 3600
527 Ga0495641_0028932 3300046461 Bacteria 2676
528 Ga0495651_0034335 3300046462 Bacteria 3953
529 Ga0495651_0071692 3300046462 Bacteria 2633
530 Ga0495653_0074076 3300046463 Bacteria 2538
531 Ga0495653_0118924 3300046463 Bacteria 1886
532 Ga0495653_0125419 3300046463 Bacteria 1824
533 Ga0495580_0075171 3300046472 Bacteria 2357
534 Ga0495582_0021686 3300046473 Bacteria 3515
535 Ga0495582_0055219 3300046473 Bacteria 2189
536 Ga0495639_0008657 3300046475 Bacteria 4363
537 Ga0495662_0010651 3300046476 Bacteria 4497
538 Ga0495664_0106011 3300046477 Bacteria 1694
539 Ga0495584_0086503 3300046491 Bacteria 1579
540 Ga0495608_0016627 3300046511 Bacteria 5091
541 Ga0495616_0073829 3300046513 Bacteria 1645
542 Ga0495586_0014967 3300046535 Bacteria 4123
543 Ga0495587_0093857 3300046536 Bacteria 1732
544 Ga0495609_0071897 3300046538 Bacteria 1519
545 Ga0495645_0163713 3300046543 Bacteria 1536
546 Ga0495667_0009117 3300046559 Bacteria 6737
547 Ga0495611_0044973 3300046648 Bacteria 1976
548 Ga0495635_0056643 3300046663 Bacteria 2698
549 Ga0495635_0126191 3300046663 Bacteria 1745
550 Ga0495588_0032337 3300046674 Bacteria 2636
551 Ga0495588_0160201 3300046674 Bacteria 1190
552 Ga0495657_0006699 3300046675 Bacteria 8990
553 Ga0495599_0123478 3300046678 Bacteria 1609
554 Ga0495623_0031118 3300046679 Bacteria 3433
555 Ga0495646_0096997 3300046680 Bacteria 1694
556 Ga0495658_0012267 3300046683 Bacteria 4334
557 Ga0495658_0032274 3300046683 Bacteria 2859
558 Ga0495658_0067904 3300046683 Bacteria 2063
559 Ga0495658_0262205 3300046683 Bacteria 1088
560 Ga0495613_0010326 3300046689 Bacteria 6934
561 Ga0495624_0028442 3300046690 Bacteria 3653
562 Ga0495624_0049977 3300046690 Bacteria 2650
563 Ga0495600_0027068 3300046809 Bacteria 3705
564 Ga0495600_0045697 3300046809 Bacteria 2857
565 Ga0495581_0010425 3300047315 Bacteria 5374
566 Ga0495604_0139739 3300047317 Bacteria 1731
567 Ga0495636_0132136 3300047318 Bacteria 1111
568 Ga0495674_0057075 3300047319 Bacteria 3417
569 Ga0495674_0067820 3300047319 Bacteria 3089
570 Ga0495674_0078011 3300047319 Bacteria 2847
571 Ga0495676_0053261 3300047321 Bacteria 3226
572 Ga0495676_0160122 3300047321 Bacteria 1593
573 Ga0495676_0273810 3300047321 Bacteria 1145
574 Ga0495680_0003705 3300047322 Bacteria 14928
575 Ga0495680_0015616 3300047322 Bacteria 6547
576 Ga0495680_0035090 3300047322 Bacteria 4044
577 Ga0495680_0255389 3300047322 Bacteria 1241
578 Ga0495677_0024864 3300047445 Bacteria 2173
579 Ga0495679_035378 3300047446 Bacteria 1583
580 Ga0495684_0003191 3300047471 Bacteria 12859
581 Ga0495684_0082012 3300047471 Bacteria 2447
582 Ga0495602_0102391 3300048088 Bacteria 2347
583 Ga0496100_0002144 3300048903 Bacteria 9928
584 Ga0496100_0005920 3300048903 Bacteria 6627
585 Ga0496100_0018474 3300048903 Bacteria 4136
586 Ga0496100_0021732 3300048903 Bacteria 3870
587 Ga0496100_0164152 3300048903 Unclassified 1594
588 Ga0496101_0007308 3300048904 Bacteria 7149
589 Ga0496101_0012833 3300048904 Bacteria 5602
590 Ga0496101_0016106 3300048904 Bacteria 5047
591 Ga0496101_0038878 3300048904 Bacteria 3380
592 Ga0496101_0123275 3300048904 Bacteria 1961
593 Ga0496101_0182004 3300048904 Bacteria 1618
594 Ga0496101_0374000 3300048904 Bacteria 1121
595 Ga0496102_0005821 3300048905 Bacteria 10484
596 Ga0496102_0013576 3300048905 Bacteria 7059
597 Ga0496102_0014623 3300048905 Bacteria 6822
598 Ga0496102_0019411 3300048905 Bacteria 5988
599 Ga0496102_0041363 3300048905 Bacteria 4172
600 Ga0496102_0141947 3300048905 Bacteria 2252
601 Ga0496103_0059367 3300048906 Bacteria 2376
602 Ga0496103_0080940 3300048906 Bacteria 2043
603 Ga0496103_0089313 3300048906 Bacteria 1944
604 Ga0496103_0116002 3300048906 Bacteria 1703
605 Ga0496104_0007404 3300048907 Bacteria 9697
606 Ga0496104_0015825 3300048907 Bacteria 6843
607 Ga0496104_0020044 3300048907 Bacteria 6125
608 Ga0496104_0026874 3300048907 Bacteria 5320
609 Ga0496104_0048106 3300048907 Bacteria 4021
610 Ga0496104_0291432 3300048907 Bacteria 1544
611 Ga0496105_0028666 3300048908 Bacteria 4553
612 Ga0496105_0034477 3300048908 Unclassified 4163
613 Ga0496105_0039272 3300048908 Bacteria 3901
614 Ga0496105_0069486 3300048908 Bacteria 2910
615 Ga0496105_0116927 3300048908 Bacteria 2199
616 Ga0496105_0124110 3300048908 Bacteria 2128
617 Ga0496105_0151428 3300048908 Bacteria 1906
618 Ga0496105_0179468 3300048908 Bacteria 1734
619 Ga0496105_0226841 3300048908 Bacteria 1519
620 Ga0496105_0240465 3300048908 Bacteria 1469
621 Ga0496106_0000080 3300048909 Bacteria 76997
622 Ga0496106_0001316 3300048909 Bacteria 18624
623 Ga0496106_0010221 3300048909 Bacteria 6935
624 Ga0496106_0013692 3300048909 Bacteria 5990
625 Ga0496106_0019007 3300048909 Bacteria 5092
626 Ga0496106_0327597 3300048909 Bacteria 1229
627 Ga0496107_0010815 3300048910 Bacteria 6349
628 Ga0496107_0018508 3300048910 Bacteria 4905
629 Ga0496107_0022840 3300048910 Bacteria 4422
630 Ga0496107_0039785 3300048910 Bacteria 3373
631 Ga0496107_0122661 3300048910 Bacteria 1914
632 Ga0496108_0003406 3300048911 Bacteria 12766
633 Ga0496108_0003783 3300048911 Bacteria 12111
634 Ga0496108_0013929 3300048911 Bacteria 6558
635 Ga0496108_0031358 3300048911 Bacteria 4410
636 Ga0496108_0041807 3300048911 Bacteria 3827
637 Ga0496108_0049530 3300048911 Bacteria 3513
638 Ga0496108_0229307 3300048911 Bacteria 1615
639 Ga0496108_0331367 3300048911 Bacteria 1327
640 Ga0496109_0001203 3300048912 Bacteria 21542
641 Ga0496109_0001585 3300048912 Bacteria 18980
642 Ga0496109_0005647 3300048912 Bacteria 10464
643 Ga0496109_0010259 3300048912 Bacteria 7997
644 Ga0496109_0012500 3300048912 Bacteria 7329
645 Ga0496109_0013104 3300048912 Bacteria 7173
646 Ga0496109_0027339 3300048912 Bacteria 5093
647 Ga0496109_0036300 3300048912 Bacteria 4448
648 Ga0496109_0120266 3300048912 Bacteria 2446
649 Ga0496109_0131059 3300048912 Bacteria 2340
650 Ga0496109_0184220 3300048912 Bacteria 1962
651 Ga0496110_0001093 3300048913 Bacteria 19108
652 Ga0496110_0002291 3300048913 Bacteria 14310
653 Ga0496110_0015618 3300048913 Bacteria 6324
654 Ga0496110_0015732 3300048913 Bacteria 6304
655 Ga0496110_0037101 3300048913 Bacteria 4235
656 Ga0496110_0038103 3300048913 Bacteria 4181
657 Ga0496110_0142742 3300048913 Bacteria 2165
658 Ga0496110_0158551 3300048913 Bacteria 2051
659 Ga0496110_0241632 3300048913 Bacteria 1643
660 Ga0496110_0314616 3300048913 Bacteria 1426
661 Ga0496111_0003077 3300048914 Bacteria 10247
662 Ga0496111_0013160 3300048914 Bacteria 5623
663 Ga0496111_0036922 3300048914 Bacteria 3494
664 Ga0496111_0044219 3300048914 Bacteria 3201
665 Ga0496111_0071296 3300048914 Bacteria 2529
666 Ga0496111_0129001 3300048914 Bacteria 1870
667 Ga0496111_0283011 3300048914 Bacteria 1230
668 Ga0496112_0004191 3300048915 Bacteria 12149
669 Ga0496112_0004222 3300048915 Bacteria 12122
670 Ga0496112_0018153 3300048915 Bacteria 6620
671 Ga0496112_0133241 3300048915 Bacteria 2456
672 Ga0496112_0152173 3300048915 Bacteria 2281
673 Ga0496112_0159036 3300048915 Bacteria 2225
674 Ga0496112_0314609 3300048915 Unclassified 1510
675 Ga0496113_0000452 3300048916 Bacteria 19933
676 Ga0496113_0025484 3300048916 Bacteria 4216
677 Ga0496113_0048163 3300048916 Bacteria 3171
678 Ga0496113_0096664 3300048916 Unclassified 2284
679 Ga0496113_0121687 3300048916 Bacteria 2041
680 Ga0496113_0134125 3300048916 Bacteria 1945
681 Ga0496113_0146579 3300048916 Bacteria 1860
682 Ga0496114_0004118 3300048917 Bacteria 11248
683 Ga0496114_0015747 3300048917 Bacteria 6084
684 Ga0496114_0033657 3300048917 Bacteria 4224
685 Ga0496114_0059060 3300048917 Bacteria 3203
686 Ga0496114_0074053 3300048917 Bacteria 2867
687 Ga0496114_0288753 3300048917 Unclassified 1447
688 Ga0496114_0315282 3300048917 Bacteria 1381
689 Ga0496115_0037227 3300048918 Bacteria 3855
690 Ga0496115_0038027 3300048918 Bacteria 3817
691 Ga0496115_0045528 3300048918 Bacteria 3503
692 Ga0496115_0072251 3300048918 Bacteria 2799
693 Ga0496115_0084719 3300048918 Bacteria 2584
694 Ga0496126_0054909 3300048929 Bacteria 3606
695 Ga0496126_0256991 3300048929 Bacteria 1454
696 Ga0501031_0000045 3300049568 Bacteria 66639
697 Ga0501031_0055710 3300049568 Bacteria 2576
698 Ga0501031_0086571 3300049568 Bacteria 2043
699 Ga0501032_0001065 3300049569 Bacteria 21928
700 Ga0501032_0016286 3300049569 Bacteria 5231
701 Ga0501032_0208686 3300049569 Bacteria 1274
702 Ga0501033_0000194 3300049570 Bacteria 58635
703 Ga0501034_0016074 3300049571 Bacteria 7679
704 Ga0501036_0000186 3300049572 Bacteria 41220
705 Ga0501036_0004350 3300049572 Bacteria 11430
706 Ga0501036_0198701 3300049572 Bacteria 1686
707 Ga0501037_0000348 3300049573 Bacteria 38976
708 Ga0501038_0000412 3300049574 Bacteria 37074
709 Ga0501038_0058059 3300049574 Bacteria 3319
710 Ga0501039_0000100 3300049575 Bacteria 60151
711 Ga0501039_0005387 3300049575 Bacteria 9673
712 Ga0501040_0000151 3300049576 Bacteria 38289
713 Ga0501040_0000487 3300049576 Bacteria 23684
714 Ga0501040_0007327 3300049576 Bacteria 7147
715 Ga0501040_0019205 3300049576 Bacteria 4545
716 Ga0501040_0073156 3300049576 Bacteria 2368
717 Ga0501041_0000395 3300049577 Bacteria 21921
718 Ga0501041_0021162 3300049577 Bacteria 3897
719 Ga0501041_0030661 3300049577 Bacteria 3246
720 Ga0501042_0000021 3300049578 Bacteria 50302
721 Ga0501042_0010198 3300049578 Bacteria 6287
722 Ga0501042_0026455 3300049578 Bacteria 4076
723 Ga0501042_0293185 3300049578 Unclassified 1175
724 Ga0501043_0000992 3300049579 Bacteria 25034
725 Ga0501043_0021574 3300049579 Bacteria 5050
726 Ga0501043_0055445 3300049579 Bacteria 3114
727 Ga0501046_0000425 3300049580 Bacteria 42189
728 Ga0501046_0041830 3300049580 Bacteria 3655
729 Ga0501047_0000723 3300049581 Bacteria 34341
730 Ga0501047_0056135 3300049581 Bacteria 3807
731 Ga0501048_0000086 3300049582 Bacteria 48595
732 Ga0501048_0014680 3300049582 Bacteria 5795
733 Ga0501048_0049442 3300049582 Bacteria 2996
734 Ga0501067_0000180 3300049583 Bacteria 35722
735 Ga0501067_0000248 3300049583 Bacteria 29669
736 Ga0501067_0000584 3300049583 Bacteria 19724
737 Ga0501067_0006085 3300049583 Bacteria 6691
738 Ga0501067_0009627 3300049583 Bacteria 5351
739 Ga0501067_0015067 3300049583 Bacteria 4278
740 Ga0501067_0037375 3300049583 Bacteria 2697
741 Ga0501067_0122391 3300049583 Bacteria 1448
742 Ga0501068_0000049 3300049584 Bacteria 46113
743 Ga0501068_0000079 3300049584 Bacteria 39387
744 Ga0501068_0312105 3300049584 Bacteria 1007
745 Ga0501069_0000049 3300049585 Bacteria 71453
746 Ga0501069_0000256 3300049585 Bacteria 24083
747 Ga0501069_0000884 3300049585 Bacteria 14281
748 Ga0501069_0003725 3300049585 Bacteria 7836
749 Ga0501069_0017598 3300049585 Bacteria 3850
750 Ga0501069_0024869 3300049585 Bacteria 3269
751 Ga0501069_0031670 3300049585 Bacteria 2910
752 Ga0501069_0047566 3300049585 Bacteria 2381
753 Ga0501069_0067515 3300049585 Bacteria 2001
754 Ga0501070_0168345 3300049586 Bacteria 1805
755 Ga0501070_0223561 3300049586 Bacteria 1543
756 Ga0501071_0000014 3300049587 Bacteria 60053
757 Ga0501071_0007459 3300049587 Bacteria 7185
758 Ga0501071_0058083 3300049587 Bacteria 2796
759 Ga0501071_0069473 3300049587 Bacteria 2565
760 Ga0501072_0000306 3300049588 Bacteria 34847
761 Ga0501072_0000351 3300049588 Bacteria 32834
762 Ga0501072_0006009 3300049588 Bacteria 9253
763 Ga0501072_0015721 3300049588 Bacteria 5801
764 Ga0501072_0068146 3300049588 Bacteria 2809
765 Ga0501073_0109995 3300049589 Bacteria 1911
766 Ga0501074_0000458 3300049590 Bacteria 24552
767 Ga0501075_0000159 3300049591 Bacteria 34415
768 Ga0501075_0001107 3300049591 Bacteria 17365
769 Ga0501075_0021407 3300049591 Bacteria 4713
770 Ga0501075_0029003 3300049591 Bacteria 4090
771 Ga0501075_0052252 3300049591 Bacteria 3073
772 Ga0501075_0179989 3300049591 Bacteria 1613
773 Ga0501076_0000240 3300049592 Bacteria 33579
774 Ga0501076_0000359 3300049592 Bacteria 28235
775 Ga0501076_0004149 3300049592 Bacteria 10250
776 Ga0501076_0005858 3300049592 Bacteria 8862
777 Ga0501076_0103120 3300049592 Bacteria 2301
778 Ga0501077_0000107 3300049593 Bacteria 43983
779 Ga0501077_0017125 3300049593 Bacteria 4570
780 Ga0501077_0088857 3300049593 Bacteria 1958
781 Ga0501079_0000349 3300049741 Bacteria 29438
782 Ga0501079_0002359 3300049741 Bacteria 13712
783 Ga0501079_0011610 3300049741 Bacteria 6726
784 Ga0501079_0015406 3300049741 Bacteria 5832
785 Ga0501079_0018428 3300049741 Bacteria 5334
786 Ga0501079_0079441 3300049741 Bacteria 2537
787 Ga0501080_0000771 3300049742 Bacteria 26032
788 Ga0501081_0000009 3300049743 Bacteria 70386
789 Ga0501081_0020137 3300049743 Bacteria 4447
790 Ga0501081_0032088 3300049743 Bacteria 3561
791 Ga0501083_0000077 3300049744 Bacteria 65581
792 Ga0501035_0000298 3300049822 Bacteria 58731
793 Ga0501044_0001267 3300049823 Bacteria 29849
794 Ga0501045_0000190 3300049824 Bacteria 34526
795 Ga0501045_0001200 3300049824 Bacteria 17258
796 Ga0501045_0014852 3300049824 Bacteria 5522
797 Ga0501045_0133648 3300049824 Bacteria 1844
798 nmdc:mga03n38_238124_c1 3300050490 Bacteria 957
799 nmdc:mga03n38_43139_c1 3300050490 Bacteria 1975
800 nmdc:mga06z11_14431_c1 3300050494 Bacteria 3499
801 nmdc:mga05p37_106063_c1 3300050507 Bacteria 3456
802 nmdc:mga05p37_124252_c1 3300050507 Bacteria 3170
803 nmdc:mga05p37_316501_c1 3300050507 Bacteria 1848
804 nmdc:mga05p37_3398_c1 3300050507 Bacteria 18576
805 nmdc:mga05p37_507082_c1 3300050507 Bacteria 1383
806 nmdc:mga05p37_519382_c1 3300050507 Unclassified 1362
807 nmdc:mga05p37_524522_c1 3300050507 Bacteria 1354
808 nmdc:mga05p37_800965_c1 3300050507 Unclassified 1031
809 nmdc:mga09592_148688_c1 3300050508 Bacteria 2020
810 nmdc:mga09592_2379_c1 3300050508 Bacteria 15184
811 nmdc:mga09592_74279_c1 3300050508 Bacteria 2889
812 nmdc:mga0qj67_120407_c1 3300050509 Bacteria 2123
813 nmdc:mga0qj67_4998_c1 3300050509 Bacteria 9638
814 nmdc:mga06r32_7043_c1 3300050510 Bacteria 10114
815 nmdc:mga08y16_115627_c1 3300050511 Bacteria 2793
816 nmdc:mga08y16_147750_c1 3300050511 Bacteria 2443
817 nmdc:mga0n895_125795_c1 3300050512 Bacteria 2587
818 nmdc:mga0n895_15586_c1 3300050512 Bacteria 6937
819 nmdc:mga0n895_21161_c1 3300050512 Bacteria 6079
820 nmdc:mga0n895_41301_c1 3300050512 Bacteria 4483
821 nmdc:mga0n895_45838_c1 3300050512 Bacteria 4269
822 nmdc:mga0n895_637060_c1 3300050512 Bacteria 1066
823 nmdc:mga0rr50_1709_c1 3300050513 Bacteria 12111
824 nmdc:mga0a205_221493_c1 3300050515 Bacteria 1777
825 nmdc:mga0a205_231569_c1 3300050515 Bacteria 1730
826 Ga0495601_0063661 3300053077 Bacteria 2344
827 Ga0495601_0066624 3300053077 Bacteria 2292
828 Ga0495601_0093211 3300053077 Bacteria 1940
829 Ga0495601_0333734 3300053077 Bacteria 987
830 Ga0495612_0048689 3300053078 Bacteria 1738
831 Ga0495612_0071925 3300053078 Bacteria 1443
832 Ga0495655_0018929 3300053083 Bacteria 1521
833 Ga0495595_0058673 3300053084 Bacteria 1798
834 Ga0495619_0066225 3300053085 Bacteria 2410
835 Ga0501084_0000378 3300054114 Bacteria 34200
836 Ga0501084_0012981 3300054114 Bacteria 6894
837 Ga0501082_0000426 3300060353 Bacteria 37339
838 Ga0501082_0001908 3300060353 Bacteria 18327
839 Ga0501082_0010294 3300060353 Bacteria 8050
840 Ga0530510_0000256 3300061734 Bacteria 33416
841 Ga0530510_0001232 3300061734 Bacteria 17066
842 Ga0530510_0011023 3300061734 Bacteria 6340
843 Ga0530510_0014673 3300061734 Bacteria 5531
844 Ga0530510_0024733 3300061734 Bacteria 4289
845 Ga0530510_0129451 3300061734 Bacteria 1856
846 nmdc:mga00v17_89694_c1
847 SwRhRL3b_contig_773504
848 SwRhRL2b_contig_1616711
849 JGI25406J46586_10015414
850 Ga0065704_10071045
851 Ga0065704_10138478
852 Ga0065707_10000455
853 Ga0065707_10085700
854 Ga0065707_10113091
855 Ga0070658_10173249
856 Ga0070683_100048326
857 Ga0070683_100132326
858 Ga0070683_100169410
859 Ga0070690_100027055
860 Ga0070670_100348185
861 Ga0070680_100254621
862 Ga0070682_100024432
863 Ga0070682_100064911
864 Ga0070682_100105513
865 Ga0070682_100157601
866 Ga0068868_100100170
867 Ga0068868_100196903
868 Ga0070660_100009162
869 Ga0070687_100123992
870 Ga0070661_100484041
871 Ga0070692_10016190
872 Ga0070692_10040166
873 Ga0070668_100046835
874 Ga0070669_100094564
875 Ga0070675_100082004
876 Ga0070674_100087016
877 Ga0070674_100171714
878 Ga0070674_100226274
879 Ga0070673_100298471
880 Ga0070688_100015261
881 Ga0070659_100021336
882 Ga0070659_100023177
883 Ga0070659_100023449
884 Ga0070659_100071626
885 Ga0070667_100062167
886 Ga0070667_100297761
887 Ga0070703_10033814
888 Ga0070714_100090572
889 Ga0070714_100100247
890 Ga0070714_100122203
891 Ga0070714_100160715
892 Ga0070714_100448108
893 Ga0070713_100042317
894 Ga0070713_100074042
895 Ga0070713_100135822
896 Ga0070713_100215139
897 Ga0070713_100291060
898 Ga0070710_10019211
899 Ga0070710_10030364
900 Ga0070711_100159154
901 Ga0070700_100029116
902 Ga0070700_100099060
903 Ga0070700_100341763
904 Ga0070663_100021769
905 Ga0070663_100052825
906 Ga0070663_100121168
907 Ga0070678_100018861
908 Ga0070678_100141544
909 Ga0070662_100096179
910 Ga0070681_10006050
911 Ga0070681_10133755
912 Ga0070685_10066436
913 Ga0070685_10122305
914 Ga0070707_100346482
915 Ga0070707_100406363
916 Ga0070707_100433500
917 Ga0070698_100162686
918 Ga0070698_100260190
919 Ga0070698_100340402
920 Ga0070679_100024283
921 Ga0070679_100087955
922 Ga0070684_100014984
923 Ga0070684_100015223
924 Ga0070684_100049481
925 Ga0068853_100272886
926 Ga0068853_100448022
927 Ga0070672_100341061
928 Ga0070686_100050539
929 Ga0070686_100092600
930 Ga0070695_100000359
931 Ga0070696_100093401
932 Ga0070665_100207031
933 Ga0070704_100334751
934 Ga0068855_100130185
935 Ga0070664_100063936
936 Ga0070664_100133377
937 Ga0068857_100114195
938 Ga0068857_100180036
939 Ga0068857_100185296
940 Ga0068854_100045561
941 Ga0068856_100006334
942 Ga0068856_100105943
943 Ga0068856_100111151
944 Ga0070702_100016244
945 Ga0070702_100017563
946 Ga0070702_100021654
947 Ga0070702_100119507
948 Ga0070702_100249648
949 Ga0070702_100283330
950 Ga0068852_100044144
951 Ga0068852_100400875
952 Ga0068859_100048345
953 Ga0068859_100090887
954 Ga0068859_100099060
955 Ga0068864_100084275
956 Ga0068864_100085447
957 Ga0068864_100228646
958 Ga0068866_10003676
959 Ga0068861_100029031
960 Ga0068861_100364720
961 Ga0068870_10030496
962 Ga0068863_100106636
963 Ga0068858_100028656
964 Ga0068858_100129448
965 Ga0068858_100148858
966 Ga0068858_100167248
967 Ga0068860_100245104
968 Ga0068860_100335934
969 Ga0068862_100504308
970 Ga0081455_10038687
971 Ga0081455_10059088
972 Ga0081538_10000334
973 Ga0081538_10010105
974 Ga0081539_10000030
975 Ga0081539_10003721
976 Ga0081539_10006133
977 Ga0081539_10106093
978 Ga0070717_10003334
979 Ga0070717_10012327
980 Ga0070717_10012838
981 Ga0070717_10041577
982 Ga0070717_10060246
983 Ga0070717_10298489
984 Ga0075365_10035696
985 Ga0075365_10046928
986 Ga0075363_100050333
987 Ga0075363_100081658
988 Ga0075364_10022008
989 Ga0070715_10003920
990 Ga0070716_100133355
991 Ga0070712_100004677
992 Ga0070712_100023110
993 Ga0070712_100325839
994 Ga0075367_10011615
995 Ga0097621_100005205
996 Ga0097621_100260296
997 Ga0097621_100456305
998 Ga0068871_100055437
999 Ga0068871_100090513
1000 Ga0068871_100362072
1001 Ga0075428_100012728
1002 Ga0075428_100018997
1003 Ga0075428_100164033
1004 Ga0075428_100186741
1005 Ga0075428_100191377
1006 Ga0075430_100001835
1007 Ga0075430_100017412
1008 Ga0075430_100195012
1009 Ga0075431_100002368
1010 Ga0075431_100065203
1011 Ga0075433_10171241
1012 Ga0075433_10280554
1013 Ga0075434_100005044
1014 Ga0075434_100017913
1015 Ga0075434_100034063
1016 Ga0075434_100128425
1017 Ga0075429_100002220
1018 Ga0075429_100053714
1019 Ga0075429_100056139
1020 Ga0075429_100106223
1021 Ga0075429_100115955
1022 Ga0075429_100181582
1023 Ga0068865_100020050
1024 Ga0068865_100036539
1025 Ga0068865_100047657
1026 Ga0068865_100123100
1027 Ga0075436_100026760
1028 Ga0097620_100048347
1029 Ga0097620_100090884
1030 Ga0097620_100099058
1031 Ga0097620_100195714
1032 Ga0075435_100009187
1033 Ga0075435_100025502
1034 Ga0075435_100027516
1035 Ga0105251_10088964
1036 Ga0111539_10009010
1037 Ga0111539_10021125
1038 Ga0111539_10182390
1039 Ga0105245_10006019
1040 Ga0105245_10240414
1041 Ga0105245_10554676
1042 Ga0105247_10026102
1043 Ga0105247_10031293
1044 Ga0114129_10030629
1045 Ga0114129_10037151
1046 Ga0114129_10052194
1047 Ga0114129_10105041
1048 Ga0114129_10117464
1049 Ga0114129_10359531
1050 Ga0114129_10390534
1051 Ga0114129_10687013
1052 Ga0105243_10047338
1053 Ga0105243_10065382
1054 Ga0105243_10166112
1055 Ga0105241_10183053
1056 Ga0105241_10186657
1057 Ga0105242_10042961
1058 Ga0105248_10099948
1059 Ga0105248_10166113
1060 Ga0105248_10233342
1061 Ga0105248_10588830
1062 Ga0105237_10043243
1063 Ga0105238_10026880
1064 Ga0105238_10151506
1065 Ga0105238_10292383
1066 Ga0105249_10031795
1067 Ga0105249_10047447
1068 Ga0105249_10115304
1069 Ga0105249_10405993
1070 Ga0105239_10014059
1071 Ga0105239_10033596
1072 Ga0105239_10079496
1073 Ga0105239_10146882
1074 Ga0105239_10285580
1075 Ga0105239_10393797
1076 Ga0105246_10002035
1077 Ga0105246_10143252
1078 Ga0105246_10306799
1079 Ga0157369_10005118
1080 Ga0157369_10007584
1081 Ga0157369_10254253
1082 Ga0157369_10294259
1083 Ga0157374_10019073
1084 Ga0157374_10030966
1085 Ga0157378_10016316
1086 Ga0157378_10459545
1087 Ga0163162_10036532
1088 Ga0157372_10034401
1089 Ga0157372_10074607
1090 Ga0157372_10212398
1091 Ga0157375_10046969
1092 Ga0157375_10076626
1093 Ga0157375_10153595
1094 Ga0157375_10592858
1095 Ga0163163_10144526
1096 Ga0163163_10454955
1097 Ga0157380_10169355
1098 Ga0182008_10119659
1099 Ga0157377_10232502
1100 Ga0157379_10020054
1101 Ga0157379_10111706
1102 Ga0157376_10035011
1103 Ga0157376_10140441
1104 Ga0157376_10205951
1105 Ga0157376_10224109
1106 Ga0207653_10051052
1107 Ga0207642_10092909
1108 Ga0207642_10165445
1109 Ga0207710_10021751
1110 Ga0207688_10006649
1111 Ga0207688_10033219
1112 Ga0207688_10084524
1113 Ga0207688_10106226
1114 Ga0207680_10268946
1115 Ga0207685_10005154
1116 Ga0207685_10036804
1117 Ga0207699_10060111
1118 Ga0207699_10217304
1119 Ga0207699_10256106
1120 Ga0207645_10082555
1121 Ga0207645_10118194
1122 Ga0207643_10006760
1123 Ga0207643_10040499
1124 Ga0207705_10085555
1125 Ga0207654_10061595
1126 Ga0207707_10064973
1127 Ga0207707_10089244
1128 Ga0207671_10023280
1129 Ga0207693_10000946
1130 Ga0207693_10008106
1131 Ga0207693_10132879
1132 Ga0207693_10148515
1133 Ga0207663_10010059
1134 Ga0207663_10012946
1135 Ga0207660_10162367
1136 Ga0207662_10096186
1137 Ga0207657_10000634
1138 Ga0207657_10002448
1139 Ga0207657_10003834
1140 Ga0207652_10127108
1141 Ga0207652_10131014
1142 Ga0207652_10220569
1143 Ga0207646_10000129
1144 Ga0207694_10095608
1145 Ga0207694_10210550
1146 Ga0207650_10082485
1147 Ga0207687_10004747
1148 Ga0207687_10017115
1149 Ga0207687_10379327
1150 Ga0207700_10030834
1151 Ga0207700_10098003
1152 Ga0207700_10117824
1153 Ga0207700_10208142
1154 Ga0207664_10022570
1155 Ga0207664_10024247
1156 Ga0207664_10176526
1157 Ga0207664_10391736
1158 Ga0207690_10024370
1159 Ga0207706_10038710
1160 Ga0207706_10199435
1161 Ga0207706_10313630
1162 Ga0207686_10002552
1163 Ga0207709_10038675
1164 Ga0207709_10048447
1165 Ga0207670_10188181
1166 Ga0207669_10102740
1167 Ga0207704_10038287
1168 Ga0207704_10057762
1169 Ga0207665_10003933
1170 Ga0207665_10110488
1171 Ga0207691_10145516
1172 Ga0207691_10274778
1173 Ga0207691_10302871
1174 Ga0207689_10008991
1175 Ga0207661_10011023
1176 Ga0207661_10130757
1177 Ga0207679_10196517
1178 Ga0207679_10277585
1179 Ga0207667_10018029
1180 Ga0207712_10052393
1181 Ga0207712_10062599
1182 Ga0207712_10111300
1183 Ga0207677_10013030
1184 Ga0207677_10046695
1185 Ga0207677_10084802
1186 Ga0207703_10126703
1187 Ga0207703_10327178
1188 Ga0207639_10083285
1189 Ga0207639_10165926
1190 Ga0207639_10258149
1191 Ga0207678_10080390
1192 Ga0207678_10268835
1193 Ga0207708_10010743
1194 Ga0207708_10014813
1195 Ga0207708_10024294
1196 Ga0207708_10093625
1197 Ga0207708_10102741
1198 Ga0207702_10113643
1199 Ga0207702_10348528
1200 Ga0207648_10049395
1201 Ga0207648_10109826
1202 Ga0207676_10135311
1203 Ga0207674_10050731
1204 Ga0207674_10080482
1205 Ga0207674_10170052
1206 Ga0207674_10322500
1207 Ga0207675_100020004
1208 Ga0207675_100151352
1209 Ga0207675_100200394
1210 Ga0207675_100214870
1211 Ga0207683_10002216
1212 Ga0207683_10031246
1213 Ga0207683_10087444
1214 Ga0207698_10067279
1215 Ga0207698_10148407
1216 Ga0207698_10176577
1217 Ga0207428_10046656
1218 Ga0207428_10318035
1219 Ga0268266_10049156
1220 Ga0265337_1004161
1221 Ga0265326_10000985
1222 Ga0265319_1006680
1223 Ga0265319_1018571
1224 Ga0265319_1078490
1225 Ga0265319_1081960
1226 Ga0265334_10000505
1227 Ga0265334_10006757
1228 Ga0265334_10007101
1229 Ga0265318_10006636
1230 Ga0265318_10010392
1231 Ga0265318_10048772
1232 Ga0265318_10071968
1233 Ga0265323_10004152
1234 Ga0265322_10004479
1235 Ga0265322_10015492
1236 Ga0265336_10001069
1237 Ga0265338_10004673
1238 Ga0265338_10007523
1239 Ga0265338_10030965
1240 Ga0265338_10034060
1241 Ga0265338_10074725
1242 Ga0265338_10131302
1243 Ga0265338_10141608
1244 Ga0265338_10295556
1245 Ga0265324_10004094
1246 Ga0265324_10006242
1247 Ga0265332_10003171
1248 Ga0265332_10030653
1249 Ga0265320_10014688
1250 Ga0265320_10029144
1251 Ga0265325_10004728
1252 Ga0265325_10013050
1253 Ga0265340_10003725
1254 Ga0265340_10011050
1255 Ga0265340_10088427
1256 Ga0265339_10010372
1257 Ga0265339_10039599
1258 Ga0265331_10013916
1259 Ga0265327_10002558
1260 Ga0265327_10034908
1261 Ga0265327_10089888
1262 Ga0265316_10007535
1263 Ga0265316_10022059
1264 Ga0265316_10079582
1265 Ga0265316_10109600
1266 Ga0265316_10187483
1267 Ga0265316_10437047
1268 Ga0307408_100189299
1269 Ga0265313_10003931
1270 Ga0265313_10016044
1271 Ga0316575_10029428
1272 Ga0265314_10004902
1273 Ga0265314_10042767
1274 Ga0265314_10049371
1275 Ga0265314_10136623
1276 Ga0265342_10004212
1277 Ga0265342_10026872
1278 Ga0307405_10024270
1279 Ga0316577_10012886
1280 Ga0307413_10012124
1281 Ga0307410_10004035
1282 Ga0307407_10010395
1283 Ga0307409_100248547
1284 Ga0307416_100409599
1285 Ga0307411_10019058
1286 Ga0307415_100012746
1287 Ga0307415_100043630
1288 Ga0373944_0055284
1289 Ga0373923_0067463
1290 Ga0373932_0105958
1291 Ga0373943_0005519
1292 Ga0373955_0097350
1293 Ga0373961_0082404
1294 Ga0316574_0004746
1295 Ga0373924_0019130
1296 Ga0373931_0065209
1297 Ga0373927_0028909
1298 Ga0373933_0220276
1299 Ga0373947_0016400
1300 Ga0373947_0077678
1301 Ga0373947_0113478
1302 Ga0373937_0007821
1303 Ga0373925_0121036
1304 Ga0395899_0002792
1305 Ga0395899_0007525
1306 Ga0395900_0007157
1307 Ga0395898_0002275
1308 Ga0395898_0019557
1309 Ga0395898_0667273
1310 Ga0395905_0002172
1311 Ga0395905_0110975
1312 Ga0316581_0005588
1313 Ga0436364_0777713
1314 Ga0395901_0075890
1315 Ga0395901_0081612
1316 Ga0395901_0139125
1317 Ga0395901_0589858
1318 Ga0436365_0461948
1319 Ga0453683_0002264
1320 Ga0466965_0041019
1321 Ga0466966_0027558
1322 Ga0466961_0020049
1323 Ga0466961_0129793
1324 Ga0466961_0186750
1325 Ga0466963_0003110
1326 Ga0466963_0011905
1327 Ga0466963_0013597
1328 Ga0466963_0014419
1329 Ga0466963_0069221
1330 Ga0466963_0090319
1331 Ga0466963_0237410
1332 Ga0466964_0006026
1333 Ga0466964_0008127
1334 Ga0466964_0009743
1335 Ga0466964_0083304
1336 Ga0466964_0098899
1337 Ga0453684_0036659
1338 Ga0466971_0001860
1339 Ga0466968_0105151
1340 Ga0466970_0225720
1341 Ga0466957_0007796
1342 Ga0466957_0052632
1343 Ga0466957_0061608
1344 Ga0466957_0096308
1345 Ga0466960_0026572
1346 Ga0466960_0107170
1347 Ga0466959_0000274
1348 Ga0466959_0055984
1349 Ga0466958_0002650
1350 Ga0466958_0009410
1351 Ga0466967_0005029
1352 Ga0466967_0012518
1353 Ga0466967_0016540
1354 Ga0466967_0020863
1355 Ga0466967_0029880
1356 Ga0466967_0051769
1357 Ga0466967_0064348
1358 Ga0466967_0080839
1359 Ga0466967_0086825
1360 Ga0466967_0090006
1361 Ga0466967_0111810
1362 Ga0466967_0118514
1363 Ga0466967_0132688
1364 Ga0466967_0206677
1365 Ga0466967_0233867
1366 Ga0466967_0236657
1367 Ga0466967_0327813
1368 Ga0466967_0827764
1369 Ga0495603_0084426
1370 Ga0495590_0025372
1371 Ga0495629_0034076
1372 Ga0495641_0028932
1373 Ga0495651_0034335
1374 Ga0495651_0071692
1375 Ga0495653_0074076
1376 Ga0495653_0118924
1377 Ga0495653_0125419
1378 Ga0495580_0075171
1379 Ga0495582_0021686
1380 Ga0495582_0055219
1381 Ga0495639_0008657
1382 Ga0495662_0010651
1383 Ga0495664_0106011
1384 Ga0495584_0086503
1385 Ga0495608_0016627
1386 Ga0495616_0073829
1387 Ga0495586_0014967
1388 Ga0495587_0093857
1389 Ga0495609_0071897
1390 Ga0495645_0163713
1391 Ga0495667_0009117
1392 Ga0495611_0044973
1393 Ga0495635_0056643
1394 Ga0495635_0126191
1395 Ga0495588_0032337
1396 Ga0495588_0160201
1397 Ga0495657_0006699
1398 Ga0495599_0123478
1399 Ga0495623_0031118
1400 Ga0495646_0096997
1401 Ga0495658_0012267
1402 Ga0495658_0032274
1403 Ga0495658_0067904
1404 Ga0495658_0262205
1405 Ga0495613_0010326
1406 Ga0495624_0028442
1407 Ga0495624_0049977
1408 Ga0495600_0027068
1409 Ga0495600_0045697
1410 Ga0495581_0010425
1411 Ga0495604_0139739
1412 Ga0495636_0132136
1413 Ga0495674_0057075
1414 Ga0495674_0067820
1415 Ga0495674_0078011
1416 Ga0495676_0053261
1417 Ga0495676_0160122
1418 Ga0495676_0273810
1419 Ga0495680_0003705
1420 Ga0495680_0015616
1421 Ga0495680_0035090
1422 Ga0495680_0255389
1423 Ga0495677_0024864
1424 Ga0495679_035378
1425 Ga0495684_0003191
1426 Ga0495684_0082012
1427 Ga0495602_0102391
1428 Ga0496100_0002144
1429 Ga0496100_0005920
1430 Ga0496100_0018474
1431 Ga0496100_0021732
1432 Ga0496100_0164152
1433 Ga0496101_0007308
1434 Ga0496101_0012833
1435 Ga0496101_0016106
1436 Ga0496101_0038878
1437 Ga0496101_0123275
1438 Ga0496101_0182004
1439 Ga0496101_0374000
1440 Ga0496102_0005821
1441 Ga0496102_0013576
1442 Ga0496102_0014623
1443 Ga0496102_0019411
1444 Ga0496102_0041363
1445 Ga0496102_0141947
1446 Ga0496103_0059367
1447 Ga0496103_0080940
1448 Ga0496103_0089313
1449 Ga0496103_0116002
1450 Ga0496104_0007404
1451 Ga0496104_0015825
1452 Ga0496104_0020044
1453 Ga0496104_0026874
1454 Ga0496104_0048106
1455 Ga0496104_0291432
1456 Ga0496105_0028666
1457 Ga0496105_0034477
1458 Ga0496105_0039272
1459 Ga0496105_0069486
1460 Ga0496105_0116927
1461 Ga0496105_0124110
1462 Ga0496105_0151428
1463 Ga0496105_0179468
1464 Ga0496105_0226841
1465 Ga0496105_0240465
1466 Ga0496106_0000080
1467 Ga0496106_0001316
1468 Ga0496106_0010221
1469 Ga0496106_0013692
1470 Ga0496106_0019007
1471 Ga0496106_0327597
1472 Ga0496107_0010815
1473 Ga0496107_0018508
1474 Ga0496107_0022840
1475 Ga0496107_0039785
1476 Ga0496107_0122661
1477 Ga0496108_0003406
1478 Ga0496108_0003783
1479 Ga0496108_0013929
1480 Ga0496108_0031358
1481 Ga0496108_0041807
1482 Ga0496108_0049530
1483 Ga0496108_0229307
1484 Ga0496108_0331367
1485 Ga0496109_0001203
1486 Ga0496109_0001585
1487 Ga0496109_0005647
1488 Ga0496109_0010259
1489 Ga0496109_0012500
1490 Ga0496109_0013104
1491 Ga0496109_0027339
1492 Ga0496109_0036300
1493 Ga0496109_0120266
1494 Ga0496109_0131059
1495 Ga0496109_0184220
1496 Ga0496110_0001093
1497 Ga0496110_0002291
1498 Ga0496110_0015618
1499 Ga0496110_0015732
1500 Ga0496110_0037101
1501 Ga0496110_0038103
1502 Ga0496110_0142742
1503 Ga0496110_0158551
1504 Ga0496110_0241632
1505 Ga0496110_0314616
1506 Ga0496111_0003077
1507 Ga0496111_0013160
1508 Ga0496111_0036922
1509 Ga0496111_0044219
1510 Ga0496111_0071296
1511 Ga0496111_0129001
1512 Ga0496111_0283011
1513 Ga0496112_0004191
1514 Ga0496112_0004222
1515 Ga0496112_0018153
1516 Ga0496112_0133241
1517 Ga0496112_0152173
1518 Ga0496112_0159036
1519 Ga0496112_0314609
1520 Ga0496113_0000452
1521 Ga0496113_0025484
1522 Ga0496113_0048163
1523 Ga0496113_0096664
1524 Ga0496113_0121687
1525 Ga0496113_0134125
1526 Ga0496113_0146579
1527 Ga0496114_0004118
1528 Ga0496114_0015747
1529 Ga0496114_0033657
1530 Ga0496114_0059060
1531 Ga0496114_0074053
1532 Ga0496114_0288753
1533 Ga0496114_0315282
1534 Ga0496115_0037227
1535 Ga0496115_0038027
1536 Ga0496115_0045528
1537 Ga0496115_0072251
1538 Ga0496115_0084719
1539 Ga0496126_0054909
1540 Ga0496126_0256991
1541 Ga0501031_0000045
1542 Ga0501031_0055710
1543 Ga0501031_0086571
1544 Ga0501032_0001065
1545 Ga0501032_0016286
1546 Ga0501032_0208686
1547 Ga0501033_0000194
1548 Ga0501034_0016074
1549 Ga0501036_0000186
1550 Ga0501036_0004350
1551 Ga0501036_0198701
1552 Ga0501037_0000348
1553 Ga0501038_0000412
1554 Ga0501038_0058059
1555 Ga0501039_0000100
1556 Ga0501039_0005387
1557 Ga0501040_0000151
1558 Ga0501040_0000487
1559 Ga0501040_0007327
1560 Ga0501040_0019205
1561 Ga0501040_0073156
1562 Ga0501041_0000395
1563 Ga0501041_0021162
1564 Ga0501041_0030661
1565 Ga0501042_0000021
1566 Ga0501042_0010198
1567 Ga0501042_0026455
1568 Ga0501042_0293185
1569 Ga0501043_0000992
1570 Ga0501043_0021574
1571 Ga0501043_0055445
1572 Ga0501046_0000425
1573 Ga0501046_0041830
1574 Ga0501047_0000723
1575 Ga0501047_0056135
1576 Ga0501048_0000086
1577 Ga0501048_0014680
1578 Ga0501048_0049442
1579 Ga0501067_0000180
1580 Ga0501067_0000248
1581 Ga0501067_0000584
1582 Ga0501067_0006085
1583 Ga0501067_0009627
1584 Ga0501067_0015067
1585 Ga0501067_0037375
1586 Ga0501067_0122391
1587 Ga0501068_0000049
1588 Ga0501068_0000079
1589 Ga0501068_0312105
1590 Ga0501069_0000049
1591 Ga0501069_0000256
1592 Ga0501069_0000884
1593 Ga0501069_0003725
1594 Ga0501069_0017598
1595 Ga0501069_0024869
1596 Ga0501069_0031670
1597 Ga0501069_0047566
1598 Ga0501069_0067515
1599 Ga0501070_0168345
1600 Ga0501070_0223561
1601 Ga0501071_0000014
1602 Ga0501071_0007459
1603 Ga0501071_0058083
1604 Ga0501071_0069473
1605 Ga0501072_0000306
1606 Ga0501072_0000351
1607 Ga0501072_0006009
1608 Ga0501072_0015721
1609 Ga0501072_0068146
1610 Ga0501073_0109995
1611 Ga0501074_0000458
1612 Ga0501075_0000159
1613 Ga0501075_0001107
1614 Ga0501075_0021407
1615 Ga0501075_0029003
1616 Ga0501075_0052252
1617 Ga0501075_0179989
1618 Ga0501076_0000240
1619 Ga0501076_0000359
1620 Ga0501076_0004149
1621 Ga0501076_0005858
1622 Ga0501076_0103120
1623 Ga0501077_0000107
1624 Ga0501077_0017125
1625 Ga0501077_0088857
1626 Ga0501079_0000349
1627 Ga0501079_0002359
1628 Ga0501079_0011610
1629 Ga0501079_0015406
1630 Ga0501079_0018428
1631 Ga0501079_0079441
1632 Ga0501080_0000771
1633 Ga0501081_0000009
1634 Ga0501081_0020137
1635 Ga0501081_0032088
1636 Ga0501083_0000077
1637 Ga0501035_0000298
1638 Ga0501044_0001267
1639 Ga0501045_0000190
1640 Ga0501045_0001200
1641 Ga0501045_0014852
1642 Ga0501045_0133648
1643 nmdc:mga03n38_238124_c1
1644 nmdc:mga03n38_43139_c1
1645 nmdc:mga06z11_14431_c1
1646 nmdc:mga05p37_106063_c1
1647 nmdc:mga05p37_124252_c1
1648 nmdc:mga05p37_316501_c1
1649 nmdc:mga05p37_3398_c1
1650 nmdc:mga05p37_507082_c1
1651 nmdc:mga05p37_519382_c1
1652 nmdc:mga05p37_524522_c1
1653 nmdc:mga05p37_800965_c1
1654 nmdc:mga09592_148688_c1
1655 nmdc:mga09592_2379_c1
1656 nmdc:mga09592_74279_c1
1657 nmdc:mga0qj67_120407_c1
1658 nmdc:mga0qj67_4998_c1
1659 nmdc:mga06r32_7043_c1
1660 nmdc:mga08y16_115627_c1
1661 nmdc:mga08y16_147750_c1
1662 nmdc:mga0n895_125795_c1
1663 nmdc:mga0n895_15586_c1
1664 nmdc:mga0n895_21161_c1
1665 nmdc:mga0n895_41301_c1
1666 nmdc:mga0n895_45838_c1
1667 nmdc:mga0n895_637060_c1
1668 nmdc:mga0rr50_1709_c1
1669 nmdc:mga0a205_221493_c1
1670 nmdc:mga0a205_231569_c1
1671 Ga0495601_0063661
1672 Ga0495601_0066624
1673 Ga0495601_0093211
1674 Ga0495601_0333734
1675 Ga0495612_0048689
1676 Ga0495612_0071925
1677 Ga0495655_0018929
1678 Ga0495595_0058673
1679 Ga0495619_0066225
1680 Ga0501084_0000378
1681 Ga0501084_0012981
1682 Ga0501082_0000426
1683 Ga0501082_0001908
1684 Ga0501082_0010294
1685 Ga0530510_0000256
1686 Ga0530510_0001232
1687 Ga0530510_0011023
1688 Ga0530510_0014673
1689 Ga0530510_0024733
1690 Ga0530510_0129451

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01633

Choline_kinase

Choline/ethanolamine kinase

71

262

0.85

PF01636

APH

Phosphotransferase enzyme family

52

277

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxq-assembly2.cif.gz_B crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.901 4 298
3dxq-assembly1.cif.gz_A crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.8919 4 298
3dxq-assembly2.cif.gz_B crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.8779 4 298
3dxq-assembly1.cif.gz_A crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution 0.8776 4 298
4r77-assembly3.cif.gz_A crystal structure of choline kinase lica from streptococcus pneumoniae 0.8655 4 283
ID Description Score Start End Superfamily
3dxqA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9096 97 299 3.90.1200.10
3dxqA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8926 97 299 3.90.1200.10
af_D3ZRW8_130_378_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.844 66 284 3.90.1200.10
af_Q5JMB6_72_367_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8424 42 285 3.90.1200.10
af_A0A1D6NDZ6_107_380_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8318 63 284 3.90.1200.10
ID Description Score Start End GO Terms
AF-A0A388Q736-F1-model_v4 Ethanolamine kinase 2 0.9958 16 299 GO:0004305
GO:0005737
GO:0006646
AF-A0A3L7XP22-F1-model_v4 LPS biosynthesis choline kinase 0.9953 4 264 GO:0004305
GO:0005737
GO:0006646
AF-A0A1F8TS70-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.9946 1 217 GO:0004305
GO:0005737
GO:0006646
AF-A0A0P9DCF9-F1-model_v4 Choline kinase 0.9909 1 299 GO:0004305
GO:0005737
GO:0006646
AF-A0A1F8TS70-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.99 1 217 GO:0004305
GO:0005737
GO:0006646

Map