F483271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 845 | 342 | 1690 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_89694_c1|nmdc:mga00v17_89694_c1_68_1069 |
| Length | 333 |
| Sequence | MTARSGKGPVRVATPGSQPIGSPAERELAIAEESSLEQVLELVPELRGGDRVVEPLEGGLTNENCKVTVGGNAFVVRRWSDDGELLSIDRDNEHENSVKAAEAGVGAPVVAYLPEHGALVIEFLEGRTLSAEDLRGGFPLDRVADACRRLHSAAPFRDDFDMFATQRAYLRIVTDRGFRLPDGYRDFEPRMEAIETALARAPEPKVPCNNDLLAENFIDAGERLWLIDYEYSGNNEASFELGNIWSESGLSNEQLGELVSAYWGHESPSKVARARLWGLMSKYGWTLWASIQDGVSTIDFDFWAWGMEKYERAVDEFDGPEFDELLARAGEGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.18 |
| Nodule | 0 |
| Rhizoplane | 13.14 |
| Rhizosphere | 85.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga00v17_89694_c1 | 3300050491 | Bacteria | 1929 |
| 2 | SwRhRL3b_contig_773504 | 2162886006 | Bacteria | 2018 |
| 3 | SwRhRL2b_contig_1616711 | 2162886007 | Unclassified | 4198 |
| 4 | JGI25406J46586_10015414 | 3300003203 | Bacteria | 3224 |
| 5 | Ga0065704_10071045 | 3300005289 | Bacteria | 13525 |
| 6 | Ga0065704_10138478 | 3300005289 | Bacteria | 1543 |
| 7 | Ga0065707_10000455 | 3300005295 | Bacteria | 78106 |
| 8 | Ga0065707_10085700 | 3300005295 | Bacteria | 5952 |
| 9 | Ga0065707_10113091 | 3300005295 | Bacteria | 2339 |
| 10 | Ga0070658_10173249 | 3300005327 | Bacteria | 1813 |
| 11 | Ga0070683_100048326 | 3300005329 | Bacteria | 3933 |
| 12 | Ga0070683_100132326 | 3300005329 | Bacteria | 2361 |
| 13 | Ga0070683_100169410 | 3300005329 | Unclassified | 2073 |
| 14 | Ga0070690_100027055 | 3300005330 | Bacteria | 3543 |
| 15 | Ga0070670_100348185 | 3300005331 | Bacteria | 1301 |
| 16 | Ga0070680_100254621 | 3300005336 | Bacteria | 1485 |
| 17 | Ga0070682_100024432 | 3300005337 | Bacteria | 3597 |
| 18 | Ga0070682_100064911 | 3300005337 | Bacteria | 2318 |
| 19 | Ga0070682_100105513 | 3300005337 | Bacteria | 1868 |
| 20 | Ga0070682_100157601 | 3300005337 | Bacteria | 1565 |
| 21 | Ga0068868_100100170 | 3300005338 | Bacteria | 2344 |
| 22 | Ga0068868_100196903 | 3300005338 | Bacteria | 1678 |
| 23 | Ga0070660_100009162 | 3300005339 | Bacteria | 6950 |
| 24 | Ga0070687_100123992 | 3300005343 | Bacteria | 1482 |
| 25 | Ga0070661_100484041 | 3300005344 | Bacteria | 989 |
| 26 | Ga0070692_10016190 | 3300005345 | Bacteria | 3544 |
| 27 | Ga0070692_10040166 | 3300005345 | Bacteria | 2392 |
| 28 | Ga0070668_100046835 | 3300005347 | Bacteria | 3322 |
| 29 | Ga0070669_100094564 | 3300005353 | Bacteria | 2246 |
| 30 | Ga0070675_100082004 | 3300005354 | Bacteria | 2690 |
| 31 | Ga0070674_100087016 | 3300005356 | Bacteria | 2246 |
| 32 | Ga0070674_100171714 | 3300005356 | Bacteria | 1653 |
| 33 | Ga0070674_100226274 | 3300005356 | Bacteria | 1458 |
| 34 | Ga0070673_100298471 | 3300005364 | Bacteria | 1418 |
| 35 | Ga0070688_100015261 | 3300005365 | Bacteria | 4365 |
| 36 | Ga0070659_100021336 | 3300005366 | Bacteria | 4932 |
| 37 | Ga0070659_100023177 | 3300005366 | Bacteria | 4747 |
| 38 | Ga0070659_100023449 | 3300005366 | Bacteria | 4722 |
| 39 | Ga0070659_100071626 | 3300005366 | Bacteria | 2756 |
| 40 | Ga0070667_100062167 | 3300005367 | Bacteria | 3162 |
| 41 | Ga0070667_100297761 | 3300005367 | Bacteria | 1452 |
| 42 | Ga0070703_10033814 | 3300005406 | Bacteria | 1558 |
| 43 | Ga0070714_100090572 | 3300005435 | Bacteria | 2679 |
| 44 | Ga0070714_100100247 | 3300005435 | Bacteria | 2551 |
| 45 | Ga0070714_100122203 | 3300005435 | Bacteria | 2317 |
| 46 | Ga0070714_100160715 | 3300005435 | Bacteria | 2032 |
| 47 | Ga0070714_100448108 | 3300005435 | Bacteria | 1226 |
| 48 | Ga0070713_100042317 | 3300005436 | Bacteria | 3717 |
| 49 | Ga0070713_100074042 | 3300005436 | Bacteria | 2884 |
| 50 | Ga0070713_100135822 | 3300005436 | Bacteria | 2173 |
| 51 | Ga0070713_100215139 | 3300005436 | Bacteria | 1741 |
| 52 | Ga0070713_100291060 | 3300005436 | Bacteria | 1501 |
| 53 | Ga0070710_10019211 | 3300005437 | Bacteria | 3528 |
| 54 | Ga0070710_10030364 | 3300005437 | Bacteria | 2907 |
| 55 | Ga0070711_100159154 | 3300005439 | Bacteria | 1710 |
| 56 | Ga0070700_100029116 | 3300005441 | Bacteria | 3290 |
| 57 | Ga0070700_100099060 | 3300005441 | Unclassified | 1917 |
| 58 | Ga0070700_100341763 | 3300005441 | Bacteria | 1106 |
| 59 | Ga0070663_100021769 | 3300005455 | Bacteria | 4271 |
| 60 | Ga0070663_100052825 | 3300005455 | Bacteria | 2899 |
| 61 | Ga0070663_100121168 | 3300005455 | Bacteria | 1976 |
| 62 | Ga0070678_100018861 | 3300005456 | Bacteria | 4480 |
| 63 | Ga0070678_100141544 | 3300005456 | Bacteria | 1925 |
| 64 | Ga0070662_100096179 | 3300005457 | Bacteria | 2234 |
| 65 | Ga0070681_10006050 | 3300005458 | Bacteria | 11732 |
| 66 | Ga0070681_10133755 | 3300005458 | Bacteria | 2411 |
| 67 | Ga0070685_10066436 | 3300005466 | Bacteria | 2125 |
| 68 | Ga0070685_10122305 | 3300005466 | Bacteria | 1617 |
| 69 | Ga0070707_100346482 | 3300005468 | Unclassified | 1443 |
| 70 | Ga0070707_100406363 | 3300005468 | Unclassified | 1322 |
| 71 | Ga0070707_100433500 | 3300005468 | Bacteria | 1275 |
| 72 | Ga0070698_100162686 | 3300005471 | Bacteria | 2175 |
| 73 | Ga0070698_100260190 | 3300005471 | Bacteria | 1667 |
| 74 | Ga0070698_100340402 | 3300005471 | Bacteria | 1431 |
| 75 | Ga0070679_100024283 | 3300005530 | Bacteria | 5940 |
| 76 | Ga0070679_100087955 | 3300005530 | Bacteria | 3094 |
| 77 | Ga0070684_100014984 | 3300005535 | Bacteria | 6296 |
| 78 | Ga0070684_100015223 | 3300005535 | Bacteria | 6256 |
| 79 | Ga0070684_100049481 | 3300005535 | Bacteria | 3648 |
| 80 | Ga0068853_100272886 | 3300005539 | Bacteria | 1558 |
| 81 | Ga0068853_100448022 | 3300005539 | Bacteria | 1214 |
| 82 | Ga0070672_100341061 | 3300005543 | Bacteria | 1276 |
| 83 | Ga0070686_100050539 | 3300005544 | Bacteria | 2643 |
| 84 | Ga0070686_100092600 | 3300005544 | Bacteria | 2025 |
| 85 | Ga0070695_100000359 | 3300005545 | Bacteria | 23407 |
| 86 | Ga0070696_100093401 | 3300005546 | Bacteria | 2146 |
| 87 | Ga0070665_100207031 | 3300005548 | Bacteria | 1962 |
| 88 | Ga0070704_100334751 | 3300005549 | Bacteria | 1273 |
| 89 | Ga0068855_100130185 | 3300005563 | Bacteria | 2874 |
| 90 | Ga0070664_100063936 | 3300005564 | Bacteria | 3138 |
| 91 | Ga0070664_100133377 | 3300005564 | Bacteria | 2182 |
| 92 | Ga0068857_100114195 | 3300005577 | Bacteria | 2429 |
| 93 | Ga0068857_100180036 | 3300005577 | Bacteria | 1924 |
| 94 | Ga0068857_100185296 | 3300005577 | Bacteria | 1895 |
| 95 | Ga0068854_100045561 | 3300005578 | Bacteria | 3119 |
| 96 | Ga0068856_100006334 | 3300005614 | Bacteria | 11609 |
| 97 | Ga0068856_100105943 | 3300005614 | Bacteria | 2806 |
| 98 | Ga0068856_100111151 | 3300005614 | Bacteria | 2738 |
| 99 | Ga0070702_100016244 | 3300005615 | Bacteria | 3815 |
| 100 | Ga0070702_100017563 | 3300005615 | Bacteria | 3692 |
| 101 | Ga0070702_100021654 | 3300005615 | Bacteria | 3387 |
| 102 | Ga0070702_100119507 | 3300005615 | Bacteria | 1647 |
| 103 | Ga0070702_100249648 | 3300005615 | Bacteria | 1202 |
| 104 | Ga0070702_100283330 | 3300005615 | Bacteria | 1139 |
| 105 | Ga0068852_100044144 | 3300005616 | Bacteria | 3783 |
| 106 | Ga0068852_100400875 | 3300005616 | Bacteria | 1349 |
| 107 | Ga0068859_100048345 | 3300005617 | Bacteria | 4274 |
| 108 | Ga0068859_100090887 | 3300005617 | Bacteria | 3104 |
| 109 | Ga0068859_100099060 | 3300005617 | Bacteria | 2970 |
| 110 | Ga0068864_100084275 | 3300005618 | Bacteria | 2792 |
| 111 | Ga0068864_100085447 | 3300005618 | Bacteria | 2774 |
| 112 | Ga0068864_100228646 | 3300005618 | Bacteria | 1719 |
| 113 | Ga0068866_10003676 | 3300005718 | Bacteria | 6282 |
| 114 | Ga0068861_100029031 | 3300005719 | Bacteria | 4041 |
| 115 | Ga0068861_100364720 | 3300005719 | Bacteria | 1271 |
| 116 | Ga0068870_10030496 | 3300005840 | Bacteria | 2725 |
| 117 | Ga0068863_100106636 | 3300005841 | Bacteria | 2666 |
| 118 | Ga0068858_100028656 | 3300005842 | Bacteria | 5171 |
| 119 | Ga0068858_100129448 | 3300005842 | Bacteria | 2365 |
| 120 | Ga0068858_100148858 | 3300005842 | Bacteria | 2200 |
| 121 | Ga0068858_100167248 | 3300005842 | Bacteria | 2072 |
| 122 | Ga0068860_100245104 | 3300005843 | Bacteria | 1743 |
| 123 | Ga0068860_100335934 | 3300005843 | Bacteria | 1485 |
| 124 | Ga0068862_100504308 | 3300005844 | Bacteria | 1149 |
| 125 | Ga0081455_10038687 | 3300005937 | Bacteria | 4222 |
| 126 | Ga0081455_10059088 | 3300005937 | Bacteria | 3240 |
| 127 | Ga0081538_10000334 | 3300005981 | Bacteria | 53496 |
| 128 | Ga0081538_10010105 | 3300005981 | Bacteria | 7764 |
| 129 | Ga0081539_10000030 | 3300005985 | Bacteria | 317236 |
| 130 | Ga0081539_10003721 | 3300005985 | Bacteria | 18169 |
| 131 | Ga0081539_10006133 | 3300005985 | Bacteria | 11704 |
| 132 | Ga0081539_10106093 | 3300005985 | Bacteria | 1423 |
| 133 | Ga0070717_10003334 | 3300006028 | Bacteria | 11467 |
| 134 | Ga0070717_10012327 | 3300006028 | Bacteria | 6516 |
| 135 | Ga0070717_10012838 | 3300006028 | Bacteria | 6396 |
| 136 | Ga0070717_10041577 | 3300006028 | Bacteria | 3747 |
| 137 | Ga0070717_10060246 | 3300006028 | Bacteria | 3143 |
| 138 | Ga0070717_10298489 | 3300006028 | Bacteria | 1432 |
| 139 | Ga0075365_10035696 | 3300006038 | Bacteria | 3218 |
| 140 | Ga0075365_10046928 | 3300006038 | Bacteria | 2838 |
| 141 | Ga0075363_100050333 | 3300006048 | Bacteria | 2220 |
| 142 | Ga0075363_100081658 | 3300006048 | Bacteria | 1768 |
| 143 | Ga0075364_10022008 | 3300006051 | Bacteria | 4022 |
| 144 | Ga0070715_10003920 | 3300006163 | Bacteria | 4815 |
| 145 | Ga0070716_100133355 | 3300006173 | Bacteria | 1573 |
| 146 | Ga0070712_100004677 | 3300006175 | Bacteria | 8463 |
| 147 | Ga0070712_100023110 | 3300006175 | Bacteria | 4103 |
| 148 | Ga0070712_100325839 | 3300006175 | Bacteria | 1250 |
| 149 | Ga0075367_10011615 | 3300006178 | Bacteria | 4669 |
| 150 | Ga0097621_100005205 | 3300006237 | Bacteria | 9141 |
| 151 | Ga0097621_100260296 | 3300006237 | Bacteria | 1522 |
| 152 | Ga0097621_100456305 | 3300006237 | Bacteria | 1152 |
| 153 | Ga0068871_100055437 | 3300006358 | Bacteria | 3217 |
| 154 | Ga0068871_100090513 | 3300006358 | Bacteria | 2548 |
| 155 | Ga0068871_100362072 | 3300006358 | Bacteria | 1285 |
| 156 | Ga0075428_100012728 | 3300006844 | Bacteria | 9358 |
| 157 | Ga0075428_100018997 | 3300006844 | Bacteria | 7601 |
| 158 | Ga0075428_100164033 | 3300006844 | Unclassified | 2411 |
| 159 | Ga0075428_100186741 | 3300006844 | Bacteria | 2242 |
| 160 | Ga0075428_100191377 | 3300006844 | Bacteria | 2212 |
| 161 | Ga0075430_100001835 | 3300006846 | Bacteria | 17383 |
| 162 | Ga0075430_100017412 | 3300006846 | Bacteria | 6120 |
| 163 | Ga0075430_100195012 | 3300006846 | Bacteria | 1683 |
| 164 | Ga0075431_100002368 | 3300006847 | Bacteria | 18107 |
| 165 | Ga0075431_100065203 | 3300006847 | Bacteria | 3760 |
| 166 | Ga0075433_10171241 | 3300006852 | Bacteria | 1932 |
| 167 | Ga0075433_10280554 | 3300006852 | Bacteria | 1476 |
| 168 | Ga0075434_100005044 | 3300006871 | Bacteria | 11993 |
| 169 | Ga0075434_100017913 | 3300006871 | Bacteria | 6833 |
| 170 | Ga0075434_100034063 | 3300006871 | Bacteria | 5028 |
| 171 | Ga0075434_100128425 | 3300006871 | Bacteria | 2552 |
| 172 | Ga0075429_100002220 | 3300006880 | Bacteria | 16257 |
| 173 | Ga0075429_100053714 | 3300006880 | Unclassified | 3505 |
| 174 | Ga0075429_100056139 | 3300006880 | Bacteria | 3427 |
| 175 | Ga0075429_100106223 | 3300006880 | Bacteria | 2453 |
| 176 | Ga0075429_100115955 | 3300006880 | Unclassified | 2342 |
| 177 | Ga0075429_100181582 | 3300006880 | Bacteria | 1844 |
| 178 | Ga0068865_100020050 | 3300006881 | Bacteria | 4335 |
| 179 | Ga0068865_100036539 | 3300006881 | Bacteria | 3312 |
| 180 | Ga0068865_100047657 | 3300006881 | Bacteria | 2946 |
| 181 | Ga0068865_100123100 | 3300006881 | Bacteria | 1932 |
| 182 | Ga0075436_100026760 | 3300006914 | Bacteria | 3971 |
| 183 | Ga0097620_100048347 | 3300006931 | Bacteria | 4274 |
| 184 | Ga0097620_100090884 | 3300006931 | Bacteria | 3104 |
| 185 | Ga0097620_100099058 | 3300006931 | Bacteria | 2970 |
| 186 | Ga0097620_100195714 | 3300006931 | Unclassified | 2106 |
| 187 | Ga0075435_100009187 | 3300007076 | Bacteria | 7138 |
| 188 | Ga0075435_100025502 | 3300007076 | Bacteria | 4603 |
| 189 | Ga0075435_100027516 | 3300007076 | Bacteria | 4449 |
| 190 | Ga0105251_10088964 | 3300009011 | Bacteria | 1420 |
| 191 | Ga0111539_10009010 | 3300009094 | Bacteria | 12629 |
| 192 | Ga0111539_10021125 | 3300009094 | Bacteria | 8016 |
| 193 | Ga0111539_10182390 | 3300009094 | Bacteria | 2451 |
| 194 | Ga0105245_10006019 | 3300009098 | Bacteria | 10662 |
| 195 | Ga0105245_10240414 | 3300009098 | Bacteria | 1755 |
| 196 | Ga0105245_10554676 | 3300009098 | Bacteria | 1171 |
| 197 | Ga0105247_10026102 | 3300009101 | Bacteria | 3526 |
| 198 | Ga0105247_10031293 | 3300009101 | Bacteria | 3229 |
| 199 | Ga0114129_10030629 | 3300009147 | Bacteria | 7612 |
| 200 | Ga0114129_10037151 | 3300009147 | Bacteria | 6876 |
| 201 | Ga0114129_10052194 | 3300009147 | Bacteria | 5738 |
| 202 | Ga0114129_10105041 | 3300009147 | Unclassified | 3904 |
| 203 | Ga0114129_10117464 | 3300009147 | Unclassified | 3665 |
| 204 | Ga0114129_10359531 | 3300009147 | Bacteria | 1927 |
| 205 | Ga0114129_10390534 | 3300009147 | Bacteria | 1836 |
| 206 | Ga0114129_10687013 | 3300009147 | Unclassified | 1317 |
| 207 | Ga0105243_10047338 | 3300009148 | Bacteria | 3384 |
| 208 | Ga0105243_10065382 | 3300009148 | Bacteria | 2921 |
| 209 | Ga0105243_10166112 | 3300009148 | Bacteria | 1907 |
| 210 | Ga0105241_10183053 | 3300009174 | Bacteria | 1739 |
| 211 | Ga0105241_10186657 | 3300009174 | Bacteria | 1723 |
| 212 | Ga0105242_10042961 | 3300009176 | Bacteria | 3653 |
| 213 | Ga0105248_10099948 | 3300009177 | Bacteria | 3268 |
| 214 | Ga0105248_10166113 | 3300009177 | Bacteria | 2488 |
| 215 | Ga0105248_10233342 | 3300009177 | Bacteria | 2071 |
| 216 | Ga0105248_10588830 | 3300009177 | Bacteria | 1255 |
| 217 | Ga0105237_10043243 | 3300009545 | Bacteria | 4539 |
| 218 | Ga0105238_10026880 | 3300009551 | Bacteria | 5865 |
| 219 | Ga0105238_10151506 | 3300009551 | Bacteria | 2294 |
| 220 | Ga0105238_10292383 | 3300009551 | Bacteria | 1612 |
| 221 | Ga0105249_10031795 | 3300009553 | Bacteria | 4774 |
| 222 | Ga0105249_10047447 | 3300009553 | Bacteria | 3914 |
| 223 | Ga0105249_10115304 | 3300009553 | Bacteria | 2545 |
| 224 | Ga0105249_10405993 | 3300009553 | Bacteria | 1394 |
| 225 | Ga0105239_10014059 | 3300010375 | Bacteria | 8886 |
| 226 | Ga0105239_10033596 | 3300010375 | Bacteria | 5632 |
| 227 | Ga0105239_10079496 | 3300010375 | Bacteria | 3609 |
| 228 | Ga0105239_10146882 | 3300010375 | Bacteria | 2630 |
| 229 | Ga0105239_10285580 | 3300010375 | Bacteria | 1858 |
| 230 | Ga0105239_10393797 | 3300010375 | Bacteria | 1567 |
| 231 | Ga0105246_10002035 | 3300011119 | Bacteria | 12201 |
| 232 | Ga0105246_10143252 | 3300011119 | Bacteria | 1800 |
| 233 | Ga0105246_10306799 | 3300011119 | Bacteria | 1284 |
| 234 | Ga0157369_10005118 | 3300013105 | Bacteria | 15353 |
| 235 | Ga0157369_10007584 | 3300013105 | Bacteria | 12486 |
| 236 | Ga0157369_10254253 | 3300013105 | Bacteria | 1833 |
| 237 | Ga0157369_10294259 | 3300013105 | Bacteria | 1690 |
| 238 | Ga0157374_10019073 | 3300013296 | Bacteria | 6069 |
| 239 | Ga0157374_10030966 | 3300013296 | Bacteria | 4859 |
| 240 | Ga0157378_10016316 | 3300013297 | Bacteria | 6505 |
| 241 | Ga0157378_10459545 | 3300013297 | Bacteria | 1265 |
| 242 | Ga0163162_10036532 | 3300013306 | Bacteria | 4897 |
| 243 | Ga0157372_10034401 | 3300013307 | Bacteria | 5570 |
| 244 | Ga0157372_10074607 | 3300013307 | Bacteria | 3825 |
| 245 | Ga0157372_10212398 | 3300013307 | Bacteria | 2242 |
| 246 | Ga0157375_10046969 | 3300013308 | Bacteria | 4213 |
| 247 | Ga0157375_10076626 | 3300013308 | Bacteria | 3372 |
| 248 | Ga0157375_10153595 | 3300013308 | Bacteria | 2439 |
| 249 | Ga0157375_10592858 | 3300013308 | Bacteria | 1268 |
| 250 | Ga0163163_10144526 | 3300014325 | Bacteria | 2422 |
| 251 | Ga0163163_10454955 | 3300014325 | Bacteria | 1340 |
| 252 | Ga0157380_10169355 | 3300014326 | Bacteria | 1906 |
| 253 | Ga0182008_10119659 | 3300014497 | Bacteria | 1309 |
| 254 | Ga0157377_10232502 | 3300014745 | Bacteria | 1186 |
| 255 | Ga0157379_10020054 | 3300014968 | Bacteria | 5909 |
| 256 | Ga0157379_10111706 | 3300014968 | Bacteria | 2455 |
| 257 | Ga0157376_10035011 | 3300014969 | Bacteria | 4059 |
| 258 | Ga0157376_10140441 | 3300014969 | Bacteria | 2166 |
| 259 | Ga0157376_10205951 | 3300014969 | Bacteria | 1813 |
| 260 | Ga0157376_10224109 | 3300014969 | Bacteria | 1743 |
| 261 | Ga0207653_10051052 | 3300025885 | Bacteria | 1376 |
| 262 | Ga0207642_10092909 | 3300025899 | Bacteria | 1495 |
| 263 | Ga0207642_10165445 | 3300025899 | Bacteria | 1191 |
| 264 | Ga0207710_10021751 | 3300025900 | Bacteria | 2751 |
| 265 | Ga0207688_10006649 | 3300025901 | Bacteria | 6289 |
| 266 | Ga0207688_10033219 | 3300025901 | Bacteria | 2853 |
| 267 | Ga0207688_10084524 | 3300025901 | Bacteria | 1817 |
| 268 | Ga0207688_10106226 | 3300025901 | Bacteria | 1626 |
| 269 | Ga0207680_10268946 | 3300025903 | Bacteria | 1182 |
| 270 | Ga0207685_10005154 | 3300025905 | Bacteria | 3415 |
| 271 | Ga0207685_10036804 | 3300025905 | Bacteria | 1797 |
| 272 | Ga0207699_10060111 | 3300025906 | Bacteria | 2280 |
| 273 | Ga0207699_10217304 | 3300025906 | Bacteria | 1303 |
| 274 | Ga0207699_10256106 | 3300025906 | Bacteria | 1208 |
| 275 | Ga0207645_10082555 | 3300025907 | Bacteria | 2060 |
| 276 | Ga0207645_10118194 | 3300025907 | Bacteria | 1720 |
| 277 | Ga0207643_10006760 | 3300025908 | Bacteria | 6151 |
| 278 | Ga0207643_10040499 | 3300025908 | Bacteria | 2623 |
| 279 | Ga0207705_10085555 | 3300025909 | Bacteria | 2303 |
| 280 | Ga0207654_10061595 | 3300025911 | Bacteria | 2196 |
| 281 | Ga0207707_10064973 | 3300025912 | Unclassified | 3178 |
| 282 | Ga0207707_10089244 | 3300025912 | Bacteria | 2694 |
| 283 | Ga0207671_10023280 | 3300025914 | Bacteria | 4672 |
| 284 | Ga0207693_10000946 | 3300025915 | Bacteria | 26051 |
| 285 | Ga0207693_10008106 | 3300025915 | Bacteria | 8616 |
| 286 | Ga0207693_10132879 | 3300025915 | Bacteria | 1956 |
| 287 | Ga0207693_10148515 | 3300025915 | Bacteria | 1843 |
| 288 | Ga0207663_10010059 | 3300025916 | Bacteria | 5016 |
| 289 | Ga0207663_10012946 | 3300025916 | Bacteria | 4523 |
| 290 | Ga0207660_10162367 | 3300025917 | Bacteria | 1724 |
| 291 | Ga0207662_10096186 | 3300025918 | Bacteria | 1829 |
| 292 | Ga0207657_10000634 | 3300025919 | Bacteria | 37262 |
| 293 | Ga0207657_10002448 | 3300025919 | Bacteria | 20057 |
| 294 | Ga0207657_10003834 | 3300025919 | Bacteria | 15968 |
| 295 | Ga0207652_10127108 | 3300025921 | Bacteria | 2271 |
| 296 | Ga0207652_10131014 | 3300025921 | Bacteria | 2237 |
| 297 | Ga0207652_10220569 | 3300025921 | Bacteria | 1709 |
| 298 | Ga0207646_10000129 | 3300025922 | Bacteria | 102411 |
| 299 | Ga0207694_10095608 | 3300025924 | Bacteria | 2349 |
| 300 | Ga0207694_10210550 | 3300025924 | Bacteria | 1583 |
| 301 | Ga0207650_10082485 | 3300025925 | Bacteria | 2441 |
| 302 | Ga0207687_10004747 | 3300025927 | Bacteria | 9044 |
| 303 | Ga0207687_10017115 | 3300025927 | Bacteria | 4765 |
| 304 | Ga0207687_10379327 | 3300025927 | Bacteria | 1158 |
| 305 | Ga0207700_10030834 | 3300025928 | Bacteria | 3803 |
| 306 | Ga0207700_10098003 | 3300025928 | Bacteria | 2331 |
| 307 | Ga0207700_10117824 | 3300025928 | Bacteria | 2148 |
| 308 | Ga0207700_10208142 | 3300025928 | Bacteria | 1652 |
| 309 | Ga0207664_10022570 | 3300025929 | Bacteria | 4703 |
| 310 | Ga0207664_10024247 | 3300025929 | Bacteria | 4557 |
| 311 | Ga0207664_10176526 | 3300025929 | Bacteria | 1832 |
| 312 | Ga0207664_10391736 | 3300025929 | Bacteria | 1234 |
| 313 | Ga0207690_10024370 | 3300025932 | Bacteria | 3790 |
| 314 | Ga0207706_10038710 | 3300025933 | Bacteria | 4230 |
| 315 | Ga0207706_10199435 | 3300025933 | Bacteria | 1755 |
| 316 | Ga0207706_10313630 | 3300025933 | Bacteria | 1365 |
| 317 | Ga0207686_10002552 | 3300025934 | Bacteria | 9894 |
| 318 | Ga0207709_10038675 | 3300025935 | Bacteria | 2844 |
| 319 | Ga0207709_10048447 | 3300025935 | Bacteria | 2589 |
| 320 | Ga0207670_10188181 | 3300025936 | Bacteria | 1560 |
| 321 | Ga0207669_10102740 | 3300025937 | Bacteria | 1894 |
| 322 | Ga0207704_10038287 | 3300025938 | Bacteria | 2780 |
| 323 | Ga0207704_10057762 | 3300025938 | Bacteria | 2385 |
| 324 | Ga0207665_10003933 | 3300025939 | Bacteria | 9948 |
| 325 | Ga0207665_10110488 | 3300025939 | Bacteria | 1931 |
| 326 | Ga0207691_10145516 | 3300025940 | Bacteria | 2086 |
| 327 | Ga0207691_10274778 | 3300025940 | Bacteria | 1450 |
| 328 | Ga0207691_10302871 | 3300025940 | Bacteria | 1373 |
| 329 | Ga0207689_10008991 | 3300025942 | Bacteria | 8653 |
| 330 | Ga0207661_10011023 | 3300025944 | Bacteria | 6533 |
| 331 | Ga0207661_10130757 | 3300025944 | Bacteria | 2150 |
| 332 | Ga0207679_10196517 | 3300025945 | Bacteria | 1682 |
| 333 | Ga0207679_10277585 | 3300025945 | Bacteria | 1436 |
| 334 | Ga0207667_10018029 | 3300025949 | Bacteria | 7929 |
| 335 | Ga0207712_10052393 | 3300025961 | Bacteria | 2858 |
| 336 | Ga0207712_10062599 | 3300025961 | Bacteria | 2645 |
| 337 | Ga0207712_10111300 | 3300025961 | Bacteria | 2054 |
| 338 | Ga0207677_10013030 | 3300026023 | Bacteria | 4804 |
| 339 | Ga0207677_10046695 | 3300026023 | Bacteria | 2902 |
| 340 | Ga0207677_10084802 | 3300026023 | Bacteria | 2285 |
| 341 | Ga0207703_10126703 | 3300026035 | Bacteria | 2199 |
| 342 | Ga0207703_10327178 | 3300026035 | Bacteria | 1405 |
| 343 | Ga0207639_10083285 | 3300026041 | Bacteria | 2538 |
| 344 | Ga0207639_10165926 | 3300026041 | Bacteria | 1865 |
| 345 | Ga0207639_10258149 | 3300026041 | Bacteria | 1523 |
| 346 | Ga0207678_10080390 | 3300026067 | Bacteria | 2791 |
| 347 | Ga0207678_10268835 | 3300026067 | Bacteria | 1462 |
| 348 | Ga0207708_10010743 | 3300026075 | Bacteria | 6807 |
| 349 | Ga0207708_10014813 | 3300026075 | Bacteria | 5836 |
| 350 | Ga0207708_10024294 | 3300026075 | Bacteria | 4583 |
| 351 | Ga0207708_10093625 | 3300026075 | Bacteria | 2319 |
| 352 | Ga0207708_10102741 | 3300026075 | Bacteria | 2213 |
| 353 | Ga0207702_10113643 | 3300026078 | Bacteria | 2412 |
| 354 | Ga0207702_10348528 | 3300026078 | Bacteria | 1416 |
| 355 | Ga0207648_10049395 | 3300026089 | Bacteria | 3681 |
| 356 | Ga0207648_10109826 | 3300026089 | Bacteria | 2421 |
| 357 | Ga0207676_10135311 | 3300026095 | Bacteria | 2101 |
| 358 | Ga0207674_10050731 | 3300026116 | Bacteria | 4238 |
| 359 | Ga0207674_10080482 | 3300026116 | Bacteria | 3261 |
| 360 | Ga0207674_10170052 | 3300026116 | Bacteria | 2133 |
| 361 | Ga0207674_10322500 | 3300026116 | Bacteria | 1494 |
| 362 | Ga0207675_100020004 | 3300026118 | Bacteria | 6246 |
| 363 | Ga0207675_100151352 | 3300026118 | Bacteria | 2208 |
| 364 | Ga0207675_100200394 | 3300026118 | Bacteria | 1917 |
| 365 | Ga0207675_100214870 | 3300026118 | Bacteria | 1851 |
| 366 | Ga0207683_10002216 | 3300026121 | Bacteria | 17089 |
| 367 | Ga0207683_10031246 | 3300026121 | Bacteria | 4621 |
| 368 | Ga0207683_10087444 | 3300026121 | Bacteria | 2772 |
| 369 | Ga0207698_10067279 | 3300026142 | Bacteria | 2824 |
| 370 | Ga0207698_10148407 | 3300026142 | Bacteria | 2031 |
| 371 | Ga0207698_10176577 | 3300026142 | Bacteria | 1887 |
| 372 | Ga0207428_10046656 | 3300027907 | Bacteria | 3484 |
| 373 | Ga0207428_10318035 | 3300027907 | Bacteria | 1150 |
| 374 | Ga0268266_10049156 | 3300028379 | Bacteria | 3615 |
| 375 | Ga0265337_1004161 | 3300028556 | Bacteria | 6066 |
| 376 | Ga0265326_10000985 | 3300028558 | Bacteria | 10274 |
| 377 | Ga0265319_1006680 | 3300028563 | Bacteria | 5306 |
| 378 | Ga0265319_1018571 | 3300028563 | Bacteria | 2615 |
| 379 | Ga0265319_1078490 | 3300028563 | Bacteria | 1050 |
| 380 | Ga0265319_1081960 | 3300028563 | Bacteria | 1024 |
| 381 | Ga0265334_10000505 | 3300028573 | Bacteria | 20077 |
| 382 | Ga0265334_10006757 | 3300028573 | Bacteria | 4928 |
| 383 | Ga0265334_10007101 | 3300028573 | Bacteria | 4805 |
| 384 | Ga0265318_10006636 | 3300028577 | Bacteria | 5311 |
| 385 | Ga0265318_10010392 | 3300028577 | Bacteria | 4056 |
| 386 | Ga0265318_10048772 | 3300028577 | Bacteria | 1594 |
| 387 | Ga0265318_10071968 | 3300028577 | Bacteria | 1281 |
| 388 | Ga0265323_10004152 | 3300028653 | Bacteria | 6275 |
| 389 | Ga0265322_10004479 | 3300028654 | Bacteria | 4157 |
| 390 | Ga0265322_10015492 | 3300028654 | Bacteria | 2202 |
| 391 | Ga0265336_10001069 | 3300028666 | Bacteria | 13324 |
| 392 | Ga0265338_10004673 | 3300028800 | Bacteria | 18371 |
| 393 | Ga0265338_10007523 | 3300028800 | Bacteria | 13478 |
| 394 | Ga0265338_10030965 | 3300028800 | Bacteria | 5255 |
| 395 | Ga0265338_10034060 | 3300028800 | Bacteria | 4931 |
| 396 | Ga0265338_10074725 | 3300028800 | Bacteria | 2880 |
| 397 | Ga0265338_10131302 | 3300028800 | Bacteria | 1977 |
| 398 | Ga0265338_10141608 | 3300028800 | Bacteria | 1883 |
| 399 | Ga0265338_10295556 | 3300028800 | Bacteria | 1179 |
| 400 | Ga0265324_10004094 | 3300029957 | Bacteria | 6689 |
| 401 | Ga0265324_10006242 | 3300029957 | Bacteria | 5007 |
| 402 | Ga0265332_10003171 | 3300031238 | Bacteria | 8002 |
| 403 | Ga0265332_10030653 | 3300031238 | Bacteria | 2348 |
| 404 | Ga0265320_10014688 | 3300031240 | Bacteria | 4446 |
| 405 | Ga0265320_10029144 | 3300031240 | Bacteria | 2858 |
| 406 | Ga0265325_10004728 | 3300031241 | Bacteria | 8533 |
| 407 | Ga0265325_10013050 | 3300031241 | Bacteria | 4737 |
| 408 | Ga0265340_10003725 | 3300031247 | Bacteria | 8581 |
| 409 | Ga0265340_10011050 | 3300031247 | Bacteria | 4811 |
| 410 | Ga0265340_10088427 | 3300031247 | Bacteria | 1451 |
| 411 | Ga0265339_10010372 | 3300031249 | Bacteria | 5791 |
| 412 | Ga0265339_10039599 | 3300031249 | Bacteria | 2623 |
| 413 | Ga0265331_10013916 | 3300031250 | Bacteria | 4304 |
| 414 | Ga0265327_10002558 | 3300031251 | Bacteria | 18875 |
| 415 | Ga0265327_10034908 | 3300031251 | Bacteria | 2785 |
| 416 | Ga0265327_10089888 | 3300031251 | Bacteria | 1499 |
| 417 | Ga0265316_10007535 | 3300031344 | Bacteria | 10240 |
| 418 | Ga0265316_10022059 | 3300031344 | Bacteria | 5379 |
| 419 | Ga0265316_10079582 | 3300031344 | Bacteria | 2514 |
| 420 | Ga0265316_10109600 | 3300031344 | Bacteria | 2092 |
| 421 | Ga0265316_10187483 | 3300031344 | Bacteria | 1538 |
| 422 | Ga0265316_10437047 | 3300031344 | Bacteria | 940 |
| 423 | Ga0307408_100189299 | 3300031548 | Bacteria | 1657 |
| 424 | Ga0265313_10003931 | 3300031595 | Bacteria | 11697 |
| 425 | Ga0265313_10016044 | 3300031595 | Bacteria | 4329 |
| 426 | Ga0316575_10029428 | 3300031665 | Unclassified | 2145 |
| 427 | Ga0265314_10004902 | 3300031711 | Bacteria | 12237 |
| 428 | Ga0265314_10042767 | 3300031711 | Bacteria | 3227 |
| 429 | Ga0265314_10049371 | 3300031711 | Bacteria | 2946 |
| 430 | Ga0265314_10136623 | 3300031711 | Bacteria | 1521 |
| 431 | Ga0265342_10004212 | 3300031712 | Bacteria | 11419 |
| 432 | Ga0265342_10026872 | 3300031712 | Bacteria | 3603 |
| 433 | Ga0307405_10024270 | 3300031731 | Bacteria | 3461 |
| 434 | Ga0316577_10012886 | 3300031733 | Bacteria | 4562 |
| 435 | Ga0307413_10012124 | 3300031824 | Bacteria | 4276 |
| 436 | Ga0307410_10004035 | 3300031852 | Bacteria | 7504 |
| 437 | Ga0307407_10010395 | 3300031903 | Bacteria | 4388 |
| 438 | Ga0307409_100248547 | 3300031995 | Bacteria | 1624 |
| 439 | Ga0307416_100409599 | 3300032002 | Bacteria | 1396 |
| 440 | Ga0307411_10019058 | 3300032005 | Bacteria | 3953 |
| 441 | Ga0307415_100012746 | 3300032126 | Bacteria | 4874 |
| 442 | Ga0307415_100043630 | 3300032126 | Bacteria | 2993 |
| 443 | Ga0373944_0055284 | 3300035089 | Bacteria | 1260 |
| 444 | Ga0373923_0067463 | 3300035111 | Bacteria | 1530 |
| 445 | Ga0373932_0105958 | 3300035112 | Unclassified | 921 |
| 446 | Ga0373943_0005519 | 3300035170 | Bacteria | 5682 |
| 447 | Ga0373955_0097350 | 3300035172 | Bacteria | 1685 |
| 448 | Ga0373961_0082404 | 3300035241 | Bacteria | 1014 |
| 449 | Ga0316574_0004746 | 3300035398 | Bacteria | 7175 |
| 450 | Ga0373924_0019130 | 3300035410 | Bacteria | 2650 |
| 451 | Ga0373931_0065209 | 3300035691 | Bacteria | 1973 |
| 452 | Ga0373927_0028909 | 3300035695 | Bacteria | 3614 |
| 453 | Ga0373933_0220276 | 3300035724 | Bacteria | 1217 |
| 454 | Ga0373947_0016400 | 3300035725 | Bacteria | 4257 |
| 455 | Ga0373947_0077678 | 3300035725 | Bacteria | 2048 |
| 456 | Ga0373947_0113478 | 3300035725 | Bacteria | 1715 |
| 457 | Ga0373937_0007821 | 3300036401 | Bacteria | 9266 |
| 458 | Ga0373925_0121036 | 3300037068 | Bacteria | 2032 |
| 459 | Ga0395899_0002792 | 3300037312 | Bacteria | 14071 |
| 460 | Ga0395899_0007525 | 3300037312 | Bacteria | 8416 |
| 461 | Ga0395900_0007157 | 3300037418 | Bacteria | 11564 |
| 462 | Ga0395898_0002275 | 3300037466 | Bacteria | 23195 |
| 463 | Ga0395898_0019557 | 3300037466 | Bacteria | 6889 |
| 464 | Ga0395898_0667273 | 3300037466 | Bacteria | 982 |
| 465 | Ga0395905_0002172 | 3300037471 | Bacteria | 22182 |
| 466 | Ga0395905_0110975 | 3300037471 | Bacteria | 2575 |
| 467 | Ga0316581_0005588 | 3300037588 | Bacteria | 3290 |
| 468 | Ga0436364_0777713 | 3300037853 | Bacteria | 6887 |
| 469 | Ga0395901_0075890 | 3300038443 | Bacteria | 3507 |
| 470 | Ga0395901_0081612 | 3300038443 | Bacteria | 3377 |
| 471 | Ga0395901_0139125 | 3300038443 | Bacteria | 2552 |
| 472 | Ga0395901_0589858 | 3300038443 | Bacteria | 1122 |
| 473 | Ga0436365_0461948 | 3300039437 | Bacteria | 1956 |
| 474 | Ga0453683_0002264 | 3300044673 | Bacteria | 15201 |
| 475 | Ga0466965_0041019 | 3300044683 | Bacteria | 2279 |
| 476 | Ga0466966_0027558 | 3300044684 | Bacteria | 3704 |
| 477 | Ga0466961_0020049 | 3300044693 | Bacteria | 4302 |
| 478 | Ga0466961_0129793 | 3300044693 | Bacteria | 1580 |
| 479 | Ga0466961_0186750 | 3300044693 | Bacteria | 1286 |
| 480 | Ga0466963_0003110 | 3300044694 | Bacteria | 9411 |
| 481 | Ga0466963_0011905 | 3300044694 | Bacteria | 5311 |
| 482 | Ga0466963_0013597 | 3300044694 | Bacteria | 5000 |
| 483 | Ga0466963_0014419 | 3300044694 | Bacteria | 4872 |
| 484 | Ga0466963_0069221 | 3300044694 | Bacteria | 2371 |
| 485 | Ga0466963_0090319 | 3300044694 | Bacteria | 2085 |
| 486 | Ga0466963_0237410 | 3300044694 | Bacteria | 1278 |
| 487 | Ga0466964_0006026 | 3300044706 | Bacteria | 4517 |
| 488 | Ga0466964_0008127 | 3300044706 | Bacteria | 3936 |
| 489 | Ga0466964_0009743 | 3300044706 | Bacteria | 3619 |
| 490 | Ga0466964_0083304 | 3300044706 | Bacteria | 1377 |
| 491 | Ga0466964_0098899 | 3300044706 | Bacteria | 1283 |
| 492 | Ga0453684_0036659 | 3300044712 | Bacteria | 6753 |
| 493 | Ga0466971_0001860 | 3300044719 | Bacteria | 8982 |
| 494 | Ga0466968_0105151 | 3300044735 | Unclassified | 1264 |
| 495 | Ga0466970_0225720 | 3300044765 | Bacteria | 1046 |
| 496 | Ga0466957_0007796 | 3300044842 | Bacteria | 6063 |
| 497 | Ga0466957_0052632 | 3300044842 | Bacteria | 2479 |
| 498 | Ga0466957_0061608 | 3300044842 | Bacteria | 2303 |
| 499 | Ga0466957_0096308 | 3300044842 | Bacteria | 1860 |
| 500 | Ga0466960_0026572 | 3300044901 | Bacteria | 2631 |
| 501 | Ga0466960_0107170 | 3300044901 | Bacteria | 1447 |
| 502 | Ga0466959_0000274 | 3300045049 | Bacteria | 31486 |
| 503 | Ga0466959_0055984 | 3300045049 | Bacteria | 2878 |
| 504 | Ga0466958_0002650 | 3300045836 | Bacteria | 9045 |
| 505 | Ga0466958_0009410 | 3300045836 | Bacteria | 5445 |
| 506 | Ga0466967_0005029 | 3300045976 | Bacteria | 9060 |
| 507 | Ga0466967_0012518 | 3300045976 | Bacteria | 6494 |
| 508 | Ga0466967_0016540 | 3300045976 | Bacteria | 5821 |
| 509 | Ga0466967_0020863 | 3300045976 | Bacteria | 5307 |
| 510 | Ga0466967_0029880 | 3300045976 | Bacteria | 4567 |
| 511 | Ga0466967_0051769 | 3300045976 | Bacteria | 3600 |
| 512 | Ga0466967_0064348 | 3300045976 | Bacteria | 3261 |
| 513 | Ga0466967_0080839 | 3300045976 | Bacteria | 2934 |
| 514 | Ga0466967_0086825 | 3300045976 | Bacteria | 2835 |
| 515 | Ga0466967_0090006 | 3300045976 | Bacteria | 2787 |
| 516 | Ga0466967_0111810 | 3300045976 | Unclassified | 2510 |
| 517 | Ga0466967_0118514 | 3300045976 | Bacteria | 2442 |
| 518 | Ga0466967_0132688 | 3300045976 | Bacteria | 2313 |
| 519 | Ga0466967_0206677 | 3300045976 | Unclassified | 1861 |
| 520 | Ga0466967_0233867 | 3300045976 | Unclassified | 1750 |
| 521 | Ga0466967_0236657 | 3300045976 | Bacteria | 1740 |
| 522 | Ga0466967_0327813 | 3300045976 | Unclassified | 1478 |
| 523 | Ga0466967_0827764 | 3300045976 | Unclassified | 919 |
| 524 | Ga0495603_0084426 | 3300046455 | Bacteria | 1859 |
| 525 | Ga0495590_0025372 | 3300046457 | Bacteria | 2084 |
| 526 | Ga0495629_0034076 | 3300046459 | Bacteria | 3600 |
| 527 | Ga0495641_0028932 | 3300046461 | Bacteria | 2676 |
| 528 | Ga0495651_0034335 | 3300046462 | Bacteria | 3953 |
| 529 | Ga0495651_0071692 | 3300046462 | Bacteria | 2633 |
| 530 | Ga0495653_0074076 | 3300046463 | Bacteria | 2538 |
| 531 | Ga0495653_0118924 | 3300046463 | Bacteria | 1886 |
| 532 | Ga0495653_0125419 | 3300046463 | Bacteria | 1824 |
| 533 | Ga0495580_0075171 | 3300046472 | Bacteria | 2357 |
| 534 | Ga0495582_0021686 | 3300046473 | Bacteria | 3515 |
| 535 | Ga0495582_0055219 | 3300046473 | Bacteria | 2189 |
| 536 | Ga0495639_0008657 | 3300046475 | Bacteria | 4363 |
| 537 | Ga0495662_0010651 | 3300046476 | Bacteria | 4497 |
| 538 | Ga0495664_0106011 | 3300046477 | Bacteria | 1694 |
| 539 | Ga0495584_0086503 | 3300046491 | Bacteria | 1579 |
| 540 | Ga0495608_0016627 | 3300046511 | Bacteria | 5091 |
| 541 | Ga0495616_0073829 | 3300046513 | Bacteria | 1645 |
| 542 | Ga0495586_0014967 | 3300046535 | Bacteria | 4123 |
| 543 | Ga0495587_0093857 | 3300046536 | Bacteria | 1732 |
| 544 | Ga0495609_0071897 | 3300046538 | Bacteria | 1519 |
| 545 | Ga0495645_0163713 | 3300046543 | Bacteria | 1536 |
| 546 | Ga0495667_0009117 | 3300046559 | Bacteria | 6737 |
| 547 | Ga0495611_0044973 | 3300046648 | Bacteria | 1976 |
| 548 | Ga0495635_0056643 | 3300046663 | Bacteria | 2698 |
| 549 | Ga0495635_0126191 | 3300046663 | Bacteria | 1745 |
| 550 | Ga0495588_0032337 | 3300046674 | Bacteria | 2636 |
| 551 | Ga0495588_0160201 | 3300046674 | Bacteria | 1190 |
| 552 | Ga0495657_0006699 | 3300046675 | Bacteria | 8990 |
| 553 | Ga0495599_0123478 | 3300046678 | Bacteria | 1609 |
| 554 | Ga0495623_0031118 | 3300046679 | Bacteria | 3433 |
| 555 | Ga0495646_0096997 | 3300046680 | Bacteria | 1694 |
| 556 | Ga0495658_0012267 | 3300046683 | Bacteria | 4334 |
| 557 | Ga0495658_0032274 | 3300046683 | Bacteria | 2859 |
| 558 | Ga0495658_0067904 | 3300046683 | Bacteria | 2063 |
| 559 | Ga0495658_0262205 | 3300046683 | Bacteria | 1088 |
| 560 | Ga0495613_0010326 | 3300046689 | Bacteria | 6934 |
| 561 | Ga0495624_0028442 | 3300046690 | Bacteria | 3653 |
| 562 | Ga0495624_0049977 | 3300046690 | Bacteria | 2650 |
| 563 | Ga0495600_0027068 | 3300046809 | Bacteria | 3705 |
| 564 | Ga0495600_0045697 | 3300046809 | Bacteria | 2857 |
| 565 | Ga0495581_0010425 | 3300047315 | Bacteria | 5374 |
| 566 | Ga0495604_0139739 | 3300047317 | Bacteria | 1731 |
| 567 | Ga0495636_0132136 | 3300047318 | Bacteria | 1111 |
| 568 | Ga0495674_0057075 | 3300047319 | Bacteria | 3417 |
| 569 | Ga0495674_0067820 | 3300047319 | Bacteria | 3089 |
| 570 | Ga0495674_0078011 | 3300047319 | Bacteria | 2847 |
| 571 | Ga0495676_0053261 | 3300047321 | Bacteria | 3226 |
| 572 | Ga0495676_0160122 | 3300047321 | Bacteria | 1593 |
| 573 | Ga0495676_0273810 | 3300047321 | Bacteria | 1145 |
| 574 | Ga0495680_0003705 | 3300047322 | Bacteria | 14928 |
| 575 | Ga0495680_0015616 | 3300047322 | Bacteria | 6547 |
| 576 | Ga0495680_0035090 | 3300047322 | Bacteria | 4044 |
| 577 | Ga0495680_0255389 | 3300047322 | Bacteria | 1241 |
| 578 | Ga0495677_0024864 | 3300047445 | Bacteria | 2173 |
| 579 | Ga0495679_035378 | 3300047446 | Bacteria | 1583 |
| 580 | Ga0495684_0003191 | 3300047471 | Bacteria | 12859 |
| 581 | Ga0495684_0082012 | 3300047471 | Bacteria | 2447 |
| 582 | Ga0495602_0102391 | 3300048088 | Bacteria | 2347 |
| 583 | Ga0496100_0002144 | 3300048903 | Bacteria | 9928 |
| 584 | Ga0496100_0005920 | 3300048903 | Bacteria | 6627 |
| 585 | Ga0496100_0018474 | 3300048903 | Bacteria | 4136 |
| 586 | Ga0496100_0021732 | 3300048903 | Bacteria | 3870 |
| 587 | Ga0496100_0164152 | 3300048903 | Unclassified | 1594 |
| 588 | Ga0496101_0007308 | 3300048904 | Bacteria | 7149 |
| 589 | Ga0496101_0012833 | 3300048904 | Bacteria | 5602 |
| 590 | Ga0496101_0016106 | 3300048904 | Bacteria | 5047 |
| 591 | Ga0496101_0038878 | 3300048904 | Bacteria | 3380 |
| 592 | Ga0496101_0123275 | 3300048904 | Bacteria | 1961 |
| 593 | Ga0496101_0182004 | 3300048904 | Bacteria | 1618 |
| 594 | Ga0496101_0374000 | 3300048904 | Bacteria | 1121 |
| 595 | Ga0496102_0005821 | 3300048905 | Bacteria | 10484 |
| 596 | Ga0496102_0013576 | 3300048905 | Bacteria | 7059 |
| 597 | Ga0496102_0014623 | 3300048905 | Bacteria | 6822 |
| 598 | Ga0496102_0019411 | 3300048905 | Bacteria | 5988 |
| 599 | Ga0496102_0041363 | 3300048905 | Bacteria | 4172 |
| 600 | Ga0496102_0141947 | 3300048905 | Bacteria | 2252 |
| 601 | Ga0496103_0059367 | 3300048906 | Bacteria | 2376 |
| 602 | Ga0496103_0080940 | 3300048906 | Bacteria | 2043 |
| 603 | Ga0496103_0089313 | 3300048906 | Bacteria | 1944 |
| 604 | Ga0496103_0116002 | 3300048906 | Bacteria | 1703 |
| 605 | Ga0496104_0007404 | 3300048907 | Bacteria | 9697 |
| 606 | Ga0496104_0015825 | 3300048907 | Bacteria | 6843 |
| 607 | Ga0496104_0020044 | 3300048907 | Bacteria | 6125 |
| 608 | Ga0496104_0026874 | 3300048907 | Bacteria | 5320 |
| 609 | Ga0496104_0048106 | 3300048907 | Bacteria | 4021 |
| 610 | Ga0496104_0291432 | 3300048907 | Bacteria | 1544 |
| 611 | Ga0496105_0028666 | 3300048908 | Bacteria | 4553 |
| 612 | Ga0496105_0034477 | 3300048908 | Unclassified | 4163 |
| 613 | Ga0496105_0039272 | 3300048908 | Bacteria | 3901 |
| 614 | Ga0496105_0069486 | 3300048908 | Bacteria | 2910 |
| 615 | Ga0496105_0116927 | 3300048908 | Bacteria | 2199 |
| 616 | Ga0496105_0124110 | 3300048908 | Bacteria | 2128 |
| 617 | Ga0496105_0151428 | 3300048908 | Bacteria | 1906 |
| 618 | Ga0496105_0179468 | 3300048908 | Bacteria | 1734 |
| 619 | Ga0496105_0226841 | 3300048908 | Bacteria | 1519 |
| 620 | Ga0496105_0240465 | 3300048908 | Bacteria | 1469 |
| 621 | Ga0496106_0000080 | 3300048909 | Bacteria | 76997 |
| 622 | Ga0496106_0001316 | 3300048909 | Bacteria | 18624 |
| 623 | Ga0496106_0010221 | 3300048909 | Bacteria | 6935 |
| 624 | Ga0496106_0013692 | 3300048909 | Bacteria | 5990 |
| 625 | Ga0496106_0019007 | 3300048909 | Bacteria | 5092 |
| 626 | Ga0496106_0327597 | 3300048909 | Bacteria | 1229 |
| 627 | Ga0496107_0010815 | 3300048910 | Bacteria | 6349 |
| 628 | Ga0496107_0018508 | 3300048910 | Bacteria | 4905 |
| 629 | Ga0496107_0022840 | 3300048910 | Bacteria | 4422 |
| 630 | Ga0496107_0039785 | 3300048910 | Bacteria | 3373 |
| 631 | Ga0496107_0122661 | 3300048910 | Bacteria | 1914 |
| 632 | Ga0496108_0003406 | 3300048911 | Bacteria | 12766 |
| 633 | Ga0496108_0003783 | 3300048911 | Bacteria | 12111 |
| 634 | Ga0496108_0013929 | 3300048911 | Bacteria | 6558 |
| 635 | Ga0496108_0031358 | 3300048911 | Bacteria | 4410 |
| 636 | Ga0496108_0041807 | 3300048911 | Bacteria | 3827 |
| 637 | Ga0496108_0049530 | 3300048911 | Bacteria | 3513 |
| 638 | Ga0496108_0229307 | 3300048911 | Bacteria | 1615 |
| 639 | Ga0496108_0331367 | 3300048911 | Bacteria | 1327 |
| 640 | Ga0496109_0001203 | 3300048912 | Bacteria | 21542 |
| 641 | Ga0496109_0001585 | 3300048912 | Bacteria | 18980 |
| 642 | Ga0496109_0005647 | 3300048912 | Bacteria | 10464 |
| 643 | Ga0496109_0010259 | 3300048912 | Bacteria | 7997 |
| 644 | Ga0496109_0012500 | 3300048912 | Bacteria | 7329 |
| 645 | Ga0496109_0013104 | 3300048912 | Bacteria | 7173 |
| 646 | Ga0496109_0027339 | 3300048912 | Bacteria | 5093 |
| 647 | Ga0496109_0036300 | 3300048912 | Bacteria | 4448 |
| 648 | Ga0496109_0120266 | 3300048912 | Bacteria | 2446 |
| 649 | Ga0496109_0131059 | 3300048912 | Bacteria | 2340 |
| 650 | Ga0496109_0184220 | 3300048912 | Bacteria | 1962 |
| 651 | Ga0496110_0001093 | 3300048913 | Bacteria | 19108 |
| 652 | Ga0496110_0002291 | 3300048913 | Bacteria | 14310 |
| 653 | Ga0496110_0015618 | 3300048913 | Bacteria | 6324 |
| 654 | Ga0496110_0015732 | 3300048913 | Bacteria | 6304 |
| 655 | Ga0496110_0037101 | 3300048913 | Bacteria | 4235 |
| 656 | Ga0496110_0038103 | 3300048913 | Bacteria | 4181 |
| 657 | Ga0496110_0142742 | 3300048913 | Bacteria | 2165 |
| 658 | Ga0496110_0158551 | 3300048913 | Bacteria | 2051 |
| 659 | Ga0496110_0241632 | 3300048913 | Bacteria | 1643 |
| 660 | Ga0496110_0314616 | 3300048913 | Bacteria | 1426 |
| 661 | Ga0496111_0003077 | 3300048914 | Bacteria | 10247 |
| 662 | Ga0496111_0013160 | 3300048914 | Bacteria | 5623 |
| 663 | Ga0496111_0036922 | 3300048914 | Bacteria | 3494 |
| 664 | Ga0496111_0044219 | 3300048914 | Bacteria | 3201 |
| 665 | Ga0496111_0071296 | 3300048914 | Bacteria | 2529 |
| 666 | Ga0496111_0129001 | 3300048914 | Bacteria | 1870 |
| 667 | Ga0496111_0283011 | 3300048914 | Bacteria | 1230 |
| 668 | Ga0496112_0004191 | 3300048915 | Bacteria | 12149 |
| 669 | Ga0496112_0004222 | 3300048915 | Bacteria | 12122 |
| 670 | Ga0496112_0018153 | 3300048915 | Bacteria | 6620 |
| 671 | Ga0496112_0133241 | 3300048915 | Bacteria | 2456 |
| 672 | Ga0496112_0152173 | 3300048915 | Bacteria | 2281 |
| 673 | Ga0496112_0159036 | 3300048915 | Bacteria | 2225 |
| 674 | Ga0496112_0314609 | 3300048915 | Unclassified | 1510 |
| 675 | Ga0496113_0000452 | 3300048916 | Bacteria | 19933 |
| 676 | Ga0496113_0025484 | 3300048916 | Bacteria | 4216 |
| 677 | Ga0496113_0048163 | 3300048916 | Bacteria | 3171 |
| 678 | Ga0496113_0096664 | 3300048916 | Unclassified | 2284 |
| 679 | Ga0496113_0121687 | 3300048916 | Bacteria | 2041 |
| 680 | Ga0496113_0134125 | 3300048916 | Bacteria | 1945 |
| 681 | Ga0496113_0146579 | 3300048916 | Bacteria | 1860 |
| 682 | Ga0496114_0004118 | 3300048917 | Bacteria | 11248 |
| 683 | Ga0496114_0015747 | 3300048917 | Bacteria | 6084 |
| 684 | Ga0496114_0033657 | 3300048917 | Bacteria | 4224 |
| 685 | Ga0496114_0059060 | 3300048917 | Bacteria | 3203 |
| 686 | Ga0496114_0074053 | 3300048917 | Bacteria | 2867 |
| 687 | Ga0496114_0288753 | 3300048917 | Unclassified | 1447 |
| 688 | Ga0496114_0315282 | 3300048917 | Bacteria | 1381 |
| 689 | Ga0496115_0037227 | 3300048918 | Bacteria | 3855 |
| 690 | Ga0496115_0038027 | 3300048918 | Bacteria | 3817 |
| 691 | Ga0496115_0045528 | 3300048918 | Bacteria | 3503 |
| 692 | Ga0496115_0072251 | 3300048918 | Bacteria | 2799 |
| 693 | Ga0496115_0084719 | 3300048918 | Bacteria | 2584 |
| 694 | Ga0496126_0054909 | 3300048929 | Bacteria | 3606 |
| 695 | Ga0496126_0256991 | 3300048929 | Bacteria | 1454 |
| 696 | Ga0501031_0000045 | 3300049568 | Bacteria | 66639 |
| 697 | Ga0501031_0055710 | 3300049568 | Bacteria | 2576 |
| 698 | Ga0501031_0086571 | 3300049568 | Bacteria | 2043 |
| 699 | Ga0501032_0001065 | 3300049569 | Bacteria | 21928 |
| 700 | Ga0501032_0016286 | 3300049569 | Bacteria | 5231 |
| 701 | Ga0501032_0208686 | 3300049569 | Bacteria | 1274 |
| 702 | Ga0501033_0000194 | 3300049570 | Bacteria | 58635 |
| 703 | Ga0501034_0016074 | 3300049571 | Bacteria | 7679 |
| 704 | Ga0501036_0000186 | 3300049572 | Bacteria | 41220 |
| 705 | Ga0501036_0004350 | 3300049572 | Bacteria | 11430 |
| 706 | Ga0501036_0198701 | 3300049572 | Bacteria | 1686 |
| 707 | Ga0501037_0000348 | 3300049573 | Bacteria | 38976 |
| 708 | Ga0501038_0000412 | 3300049574 | Bacteria | 37074 |
| 709 | Ga0501038_0058059 | 3300049574 | Bacteria | 3319 |
| 710 | Ga0501039_0000100 | 3300049575 | Bacteria | 60151 |
| 711 | Ga0501039_0005387 | 3300049575 | Bacteria | 9673 |
| 712 | Ga0501040_0000151 | 3300049576 | Bacteria | 38289 |
| 713 | Ga0501040_0000487 | 3300049576 | Bacteria | 23684 |
| 714 | Ga0501040_0007327 | 3300049576 | Bacteria | 7147 |
| 715 | Ga0501040_0019205 | 3300049576 | Bacteria | 4545 |
| 716 | Ga0501040_0073156 | 3300049576 | Bacteria | 2368 |
| 717 | Ga0501041_0000395 | 3300049577 | Bacteria | 21921 |
| 718 | Ga0501041_0021162 | 3300049577 | Bacteria | 3897 |
| 719 | Ga0501041_0030661 | 3300049577 | Bacteria | 3246 |
| 720 | Ga0501042_0000021 | 3300049578 | Bacteria | 50302 |
| 721 | Ga0501042_0010198 | 3300049578 | Bacteria | 6287 |
| 722 | Ga0501042_0026455 | 3300049578 | Bacteria | 4076 |
| 723 | Ga0501042_0293185 | 3300049578 | Unclassified | 1175 |
| 724 | Ga0501043_0000992 | 3300049579 | Bacteria | 25034 |
| 725 | Ga0501043_0021574 | 3300049579 | Bacteria | 5050 |
| 726 | Ga0501043_0055445 | 3300049579 | Bacteria | 3114 |
| 727 | Ga0501046_0000425 | 3300049580 | Bacteria | 42189 |
| 728 | Ga0501046_0041830 | 3300049580 | Bacteria | 3655 |
| 729 | Ga0501047_0000723 | 3300049581 | Bacteria | 34341 |
| 730 | Ga0501047_0056135 | 3300049581 | Bacteria | 3807 |
| 731 | Ga0501048_0000086 | 3300049582 | Bacteria | 48595 |
| 732 | Ga0501048_0014680 | 3300049582 | Bacteria | 5795 |
| 733 | Ga0501048_0049442 | 3300049582 | Bacteria | 2996 |
| 734 | Ga0501067_0000180 | 3300049583 | Bacteria | 35722 |
| 735 | Ga0501067_0000248 | 3300049583 | Bacteria | 29669 |
| 736 | Ga0501067_0000584 | 3300049583 | Bacteria | 19724 |
| 737 | Ga0501067_0006085 | 3300049583 | Bacteria | 6691 |
| 738 | Ga0501067_0009627 | 3300049583 | Bacteria | 5351 |
| 739 | Ga0501067_0015067 | 3300049583 | Bacteria | 4278 |
| 740 | Ga0501067_0037375 | 3300049583 | Bacteria | 2697 |
| 741 | Ga0501067_0122391 | 3300049583 | Bacteria | 1448 |
| 742 | Ga0501068_0000049 | 3300049584 | Bacteria | 46113 |
| 743 | Ga0501068_0000079 | 3300049584 | Bacteria | 39387 |
| 744 | Ga0501068_0312105 | 3300049584 | Bacteria | 1007 |
| 745 | Ga0501069_0000049 | 3300049585 | Bacteria | 71453 |
| 746 | Ga0501069_0000256 | 3300049585 | Bacteria | 24083 |
| 747 | Ga0501069_0000884 | 3300049585 | Bacteria | 14281 |
| 748 | Ga0501069_0003725 | 3300049585 | Bacteria | 7836 |
| 749 | Ga0501069_0017598 | 3300049585 | Bacteria | 3850 |
| 750 | Ga0501069_0024869 | 3300049585 | Bacteria | 3269 |
| 751 | Ga0501069_0031670 | 3300049585 | Bacteria | 2910 |
| 752 | Ga0501069_0047566 | 3300049585 | Bacteria | 2381 |
| 753 | Ga0501069_0067515 | 3300049585 | Bacteria | 2001 |
| 754 | Ga0501070_0168345 | 3300049586 | Bacteria | 1805 |
| 755 | Ga0501070_0223561 | 3300049586 | Bacteria | 1543 |
| 756 | Ga0501071_0000014 | 3300049587 | Bacteria | 60053 |
| 757 | Ga0501071_0007459 | 3300049587 | Bacteria | 7185 |
| 758 | Ga0501071_0058083 | 3300049587 | Bacteria | 2796 |
| 759 | Ga0501071_0069473 | 3300049587 | Bacteria | 2565 |
| 760 | Ga0501072_0000306 | 3300049588 | Bacteria | 34847 |
| 761 | Ga0501072_0000351 | 3300049588 | Bacteria | 32834 |
| 762 | Ga0501072_0006009 | 3300049588 | Bacteria | 9253 |
| 763 | Ga0501072_0015721 | 3300049588 | Bacteria | 5801 |
| 764 | Ga0501072_0068146 | 3300049588 | Bacteria | 2809 |
| 765 | Ga0501073_0109995 | 3300049589 | Bacteria | 1911 |
| 766 | Ga0501074_0000458 | 3300049590 | Bacteria | 24552 |
| 767 | Ga0501075_0000159 | 3300049591 | Bacteria | 34415 |
| 768 | Ga0501075_0001107 | 3300049591 | Bacteria | 17365 |
| 769 | Ga0501075_0021407 | 3300049591 | Bacteria | 4713 |
| 770 | Ga0501075_0029003 | 3300049591 | Bacteria | 4090 |
| 771 | Ga0501075_0052252 | 3300049591 | Bacteria | 3073 |
| 772 | Ga0501075_0179989 | 3300049591 | Bacteria | 1613 |
| 773 | Ga0501076_0000240 | 3300049592 | Bacteria | 33579 |
| 774 | Ga0501076_0000359 | 3300049592 | Bacteria | 28235 |
| 775 | Ga0501076_0004149 | 3300049592 | Bacteria | 10250 |
| 776 | Ga0501076_0005858 | 3300049592 | Bacteria | 8862 |
| 777 | Ga0501076_0103120 | 3300049592 | Bacteria | 2301 |
| 778 | Ga0501077_0000107 | 3300049593 | Bacteria | 43983 |
| 779 | Ga0501077_0017125 | 3300049593 | Bacteria | 4570 |
| 780 | Ga0501077_0088857 | 3300049593 | Bacteria | 1958 |
| 781 | Ga0501079_0000349 | 3300049741 | Bacteria | 29438 |
| 782 | Ga0501079_0002359 | 3300049741 | Bacteria | 13712 |
| 783 | Ga0501079_0011610 | 3300049741 | Bacteria | 6726 |
| 784 | Ga0501079_0015406 | 3300049741 | Bacteria | 5832 |
| 785 | Ga0501079_0018428 | 3300049741 | Bacteria | 5334 |
| 786 | Ga0501079_0079441 | 3300049741 | Bacteria | 2537 |
| 787 | Ga0501080_0000771 | 3300049742 | Bacteria | 26032 |
| 788 | Ga0501081_0000009 | 3300049743 | Bacteria | 70386 |
| 789 | Ga0501081_0020137 | 3300049743 | Bacteria | 4447 |
| 790 | Ga0501081_0032088 | 3300049743 | Bacteria | 3561 |
| 791 | Ga0501083_0000077 | 3300049744 | Bacteria | 65581 |
| 792 | Ga0501035_0000298 | 3300049822 | Bacteria | 58731 |
| 793 | Ga0501044_0001267 | 3300049823 | Bacteria | 29849 |
| 794 | Ga0501045_0000190 | 3300049824 | Bacteria | 34526 |
| 795 | Ga0501045_0001200 | 3300049824 | Bacteria | 17258 |
| 796 | Ga0501045_0014852 | 3300049824 | Bacteria | 5522 |
| 797 | Ga0501045_0133648 | 3300049824 | Bacteria | 1844 |
| 798 | nmdc:mga03n38_238124_c1 | 3300050490 | Bacteria | 957 |
| 799 | nmdc:mga03n38_43139_c1 | 3300050490 | Bacteria | 1975 |
| 800 | nmdc:mga06z11_14431_c1 | 3300050494 | Bacteria | 3499 |
| 801 | nmdc:mga05p37_106063_c1 | 3300050507 | Bacteria | 3456 |
| 802 | nmdc:mga05p37_124252_c1 | 3300050507 | Bacteria | 3170 |
| 803 | nmdc:mga05p37_316501_c1 | 3300050507 | Bacteria | 1848 |
| 804 | nmdc:mga05p37_3398_c1 | 3300050507 | Bacteria | 18576 |
| 805 | nmdc:mga05p37_507082_c1 | 3300050507 | Bacteria | 1383 |
| 806 | nmdc:mga05p37_519382_c1 | 3300050507 | Unclassified | 1362 |
| 807 | nmdc:mga05p37_524522_c1 | 3300050507 | Bacteria | 1354 |
| 808 | nmdc:mga05p37_800965_c1 | 3300050507 | Unclassified | 1031 |
| 809 | nmdc:mga09592_148688_c1 | 3300050508 | Bacteria | 2020 |
| 810 | nmdc:mga09592_2379_c1 | 3300050508 | Bacteria | 15184 |
| 811 | nmdc:mga09592_74279_c1 | 3300050508 | Bacteria | 2889 |
| 812 | nmdc:mga0qj67_120407_c1 | 3300050509 | Bacteria | 2123 |
| 813 | nmdc:mga0qj67_4998_c1 | 3300050509 | Bacteria | 9638 |
| 814 | nmdc:mga06r32_7043_c1 | 3300050510 | Bacteria | 10114 |
| 815 | nmdc:mga08y16_115627_c1 | 3300050511 | Bacteria | 2793 |
| 816 | nmdc:mga08y16_147750_c1 | 3300050511 | Bacteria | 2443 |
| 817 | nmdc:mga0n895_125795_c1 | 3300050512 | Bacteria | 2587 |
| 818 | nmdc:mga0n895_15586_c1 | 3300050512 | Bacteria | 6937 |
| 819 | nmdc:mga0n895_21161_c1 | 3300050512 | Bacteria | 6079 |
| 820 | nmdc:mga0n895_41301_c1 | 3300050512 | Bacteria | 4483 |
| 821 | nmdc:mga0n895_45838_c1 | 3300050512 | Bacteria | 4269 |
| 822 | nmdc:mga0n895_637060_c1 | 3300050512 | Bacteria | 1066 |
| 823 | nmdc:mga0rr50_1709_c1 | 3300050513 | Bacteria | 12111 |
| 824 | nmdc:mga0a205_221493_c1 | 3300050515 | Bacteria | 1777 |
| 825 | nmdc:mga0a205_231569_c1 | 3300050515 | Bacteria | 1730 |
| 826 | Ga0495601_0063661 | 3300053077 | Bacteria | 2344 |
| 827 | Ga0495601_0066624 | 3300053077 | Bacteria | 2292 |
| 828 | Ga0495601_0093211 | 3300053077 | Bacteria | 1940 |
| 829 | Ga0495601_0333734 | 3300053077 | Bacteria | 987 |
| 830 | Ga0495612_0048689 | 3300053078 | Bacteria | 1738 |
| 831 | Ga0495612_0071925 | 3300053078 | Bacteria | 1443 |
| 832 | Ga0495655_0018929 | 3300053083 | Bacteria | 1521 |
| 833 | Ga0495595_0058673 | 3300053084 | Bacteria | 1798 |
| 834 | Ga0495619_0066225 | 3300053085 | Bacteria | 2410 |
| 835 | Ga0501084_0000378 | 3300054114 | Bacteria | 34200 |
| 836 | Ga0501084_0012981 | 3300054114 | Bacteria | 6894 |
| 837 | Ga0501082_0000426 | 3300060353 | Bacteria | 37339 |
| 838 | Ga0501082_0001908 | 3300060353 | Bacteria | 18327 |
| 839 | Ga0501082_0010294 | 3300060353 | Bacteria | 8050 |
| 840 | Ga0530510_0000256 | 3300061734 | Bacteria | 33416 |
| 841 | Ga0530510_0001232 | 3300061734 | Bacteria | 17066 |
| 842 | Ga0530510_0011023 | 3300061734 | Bacteria | 6340 |
| 843 | Ga0530510_0014673 | 3300061734 | Bacteria | 5531 |
| 844 | Ga0530510_0024733 | 3300061734 | Bacteria | 4289 |
| 845 | Ga0530510_0129451 | 3300061734 | Bacteria | 1856 |
| 846 | nmdc:mga00v17_89694_c1 | |||
| 847 | SwRhRL3b_contig_773504 | |||
| 848 | SwRhRL2b_contig_1616711 | |||
| 849 | JGI25406J46586_10015414 | |||
| 850 | Ga0065704_10071045 | |||
| 851 | Ga0065704_10138478 | |||
| 852 | Ga0065707_10000455 | |||
| 853 | Ga0065707_10085700 | |||
| 854 | Ga0065707_10113091 | |||
| 855 | Ga0070658_10173249 | |||
| 856 | Ga0070683_100048326 | |||
| 857 | Ga0070683_100132326 | |||
| 858 | Ga0070683_100169410 | |||
| 859 | Ga0070690_100027055 | |||
| 860 | Ga0070670_100348185 | |||
| 861 | Ga0070680_100254621 | |||
| 862 | Ga0070682_100024432 | |||
| 863 | Ga0070682_100064911 | |||
| 864 | Ga0070682_100105513 | |||
| 865 | Ga0070682_100157601 | |||
| 866 | Ga0068868_100100170 | |||
| 867 | Ga0068868_100196903 | |||
| 868 | Ga0070660_100009162 | |||
| 869 | Ga0070687_100123992 | |||
| 870 | Ga0070661_100484041 | |||
| 871 | Ga0070692_10016190 | |||
| 872 | Ga0070692_10040166 | |||
| 873 | Ga0070668_100046835 | |||
| 874 | Ga0070669_100094564 | |||
| 875 | Ga0070675_100082004 | |||
| 876 | Ga0070674_100087016 | |||
| 877 | Ga0070674_100171714 | |||
| 878 | Ga0070674_100226274 | |||
| 879 | Ga0070673_100298471 | |||
| 880 | Ga0070688_100015261 | |||
| 881 | Ga0070659_100021336 | |||
| 882 | Ga0070659_100023177 | |||
| 883 | Ga0070659_100023449 | |||
| 884 | Ga0070659_100071626 | |||
| 885 | Ga0070667_100062167 | |||
| 886 | Ga0070667_100297761 | |||
| 887 | Ga0070703_10033814 | |||
| 888 | Ga0070714_100090572 | |||
| 889 | Ga0070714_100100247 | |||
| 890 | Ga0070714_100122203 | |||
| 891 | Ga0070714_100160715 | |||
| 892 | Ga0070714_100448108 | |||
| 893 | Ga0070713_100042317 | |||
| 894 | Ga0070713_100074042 | |||
| 895 | Ga0070713_100135822 | |||
| 896 | Ga0070713_100215139 | |||
| 897 | Ga0070713_100291060 | |||
| 898 | Ga0070710_10019211 | |||
| 899 | Ga0070710_10030364 | |||
| 900 | Ga0070711_100159154 | |||
| 901 | Ga0070700_100029116 | |||
| 902 | Ga0070700_100099060 | |||
| 903 | Ga0070700_100341763 | |||
| 904 | Ga0070663_100021769 | |||
| 905 | Ga0070663_100052825 | |||
| 906 | Ga0070663_100121168 | |||
| 907 | Ga0070678_100018861 | |||
| 908 | Ga0070678_100141544 | |||
| 909 | Ga0070662_100096179 | |||
| 910 | Ga0070681_10006050 | |||
| 911 | Ga0070681_10133755 | |||
| 912 | Ga0070685_10066436 | |||
| 913 | Ga0070685_10122305 | |||
| 914 | Ga0070707_100346482 | |||
| 915 | Ga0070707_100406363 | |||
| 916 | Ga0070707_100433500 | |||
| 917 | Ga0070698_100162686 | |||
| 918 | Ga0070698_100260190 | |||
| 919 | Ga0070698_100340402 | |||
| 920 | Ga0070679_100024283 | |||
| 921 | Ga0070679_100087955 | |||
| 922 | Ga0070684_100014984 | |||
| 923 | Ga0070684_100015223 | |||
| 924 | Ga0070684_100049481 | |||
| 925 | Ga0068853_100272886 | |||
| 926 | Ga0068853_100448022 | |||
| 927 | Ga0070672_100341061 | |||
| 928 | Ga0070686_100050539 | |||
| 929 | Ga0070686_100092600 | |||
| 930 | Ga0070695_100000359 | |||
| 931 | Ga0070696_100093401 | |||
| 932 | Ga0070665_100207031 | |||
| 933 | Ga0070704_100334751 | |||
| 934 | Ga0068855_100130185 | |||
| 935 | Ga0070664_100063936 | |||
| 936 | Ga0070664_100133377 | |||
| 937 | Ga0068857_100114195 | |||
| 938 | Ga0068857_100180036 | |||
| 939 | Ga0068857_100185296 | |||
| 940 | Ga0068854_100045561 | |||
| 941 | Ga0068856_100006334 | |||
| 942 | Ga0068856_100105943 | |||
| 943 | Ga0068856_100111151 | |||
| 944 | Ga0070702_100016244 | |||
| 945 | Ga0070702_100017563 | |||
| 946 | Ga0070702_100021654 | |||
| 947 | Ga0070702_100119507 | |||
| 948 | Ga0070702_100249648 | |||
| 949 | Ga0070702_100283330 | |||
| 950 | Ga0068852_100044144 | |||
| 951 | Ga0068852_100400875 | |||
| 952 | Ga0068859_100048345 | |||
| 953 | Ga0068859_100090887 | |||
| 954 | Ga0068859_100099060 | |||
| 955 | Ga0068864_100084275 | |||
| 956 | Ga0068864_100085447 | |||
| 957 | Ga0068864_100228646 | |||
| 958 | Ga0068866_10003676 | |||
| 959 | Ga0068861_100029031 | |||
| 960 | Ga0068861_100364720 | |||
| 961 | Ga0068870_10030496 | |||
| 962 | Ga0068863_100106636 | |||
| 963 | Ga0068858_100028656 | |||
| 964 | Ga0068858_100129448 | |||
| 965 | Ga0068858_100148858 | |||
| 966 | Ga0068858_100167248 | |||
| 967 | Ga0068860_100245104 | |||
| 968 | Ga0068860_100335934 | |||
| 969 | Ga0068862_100504308 | |||
| 970 | Ga0081455_10038687 | |||
| 971 | Ga0081455_10059088 | |||
| 972 | Ga0081538_10000334 | |||
| 973 | Ga0081538_10010105 | |||
| 974 | Ga0081539_10000030 | |||
| 975 | Ga0081539_10003721 | |||
| 976 | Ga0081539_10006133 | |||
| 977 | Ga0081539_10106093 | |||
| 978 | Ga0070717_10003334 | |||
| 979 | Ga0070717_10012327 | |||
| 980 | Ga0070717_10012838 | |||
| 981 | Ga0070717_10041577 | |||
| 982 | Ga0070717_10060246 | |||
| 983 | Ga0070717_10298489 | |||
| 984 | Ga0075365_10035696 | |||
| 985 | Ga0075365_10046928 | |||
| 986 | Ga0075363_100050333 | |||
| 987 | Ga0075363_100081658 | |||
| 988 | Ga0075364_10022008 | |||
| 989 | Ga0070715_10003920 | |||
| 990 | Ga0070716_100133355 | |||
| 991 | Ga0070712_100004677 | |||
| 992 | Ga0070712_100023110 | |||
| 993 | Ga0070712_100325839 | |||
| 994 | Ga0075367_10011615 | |||
| 995 | Ga0097621_100005205 | |||
| 996 | Ga0097621_100260296 | |||
| 997 | Ga0097621_100456305 | |||
| 998 | Ga0068871_100055437 | |||
| 999 | Ga0068871_100090513 | |||
| 1000 | Ga0068871_100362072 | |||
| 1001 | Ga0075428_100012728 | |||
| 1002 | Ga0075428_100018997 | |||
| 1003 | Ga0075428_100164033 | |||
| 1004 | Ga0075428_100186741 | |||
| 1005 | Ga0075428_100191377 | |||
| 1006 | Ga0075430_100001835 | |||
| 1007 | Ga0075430_100017412 | |||
| 1008 | Ga0075430_100195012 | |||
| 1009 | Ga0075431_100002368 | |||
| 1010 | Ga0075431_100065203 | |||
| 1011 | Ga0075433_10171241 | |||
| 1012 | Ga0075433_10280554 | |||
| 1013 | Ga0075434_100005044 | |||
| 1014 | Ga0075434_100017913 | |||
| 1015 | Ga0075434_100034063 | |||
| 1016 | Ga0075434_100128425 | |||
| 1017 | Ga0075429_100002220 | |||
| 1018 | Ga0075429_100053714 | |||
| 1019 | Ga0075429_100056139 | |||
| 1020 | Ga0075429_100106223 | |||
| 1021 | Ga0075429_100115955 | |||
| 1022 | Ga0075429_100181582 | |||
| 1023 | Ga0068865_100020050 | |||
| 1024 | Ga0068865_100036539 | |||
| 1025 | Ga0068865_100047657 | |||
| 1026 | Ga0068865_100123100 | |||
| 1027 | Ga0075436_100026760 | |||
| 1028 | Ga0097620_100048347 | |||
| 1029 | Ga0097620_100090884 | |||
| 1030 | Ga0097620_100099058 | |||
| 1031 | Ga0097620_100195714 | |||
| 1032 | Ga0075435_100009187 | |||
| 1033 | Ga0075435_100025502 | |||
| 1034 | Ga0075435_100027516 | |||
| 1035 | Ga0105251_10088964 | |||
| 1036 | Ga0111539_10009010 | |||
| 1037 | Ga0111539_10021125 | |||
| 1038 | Ga0111539_10182390 | |||
| 1039 | Ga0105245_10006019 | |||
| 1040 | Ga0105245_10240414 | |||
| 1041 | Ga0105245_10554676 | |||
| 1042 | Ga0105247_10026102 | |||
| 1043 | Ga0105247_10031293 | |||
| 1044 | Ga0114129_10030629 | |||
| 1045 | Ga0114129_10037151 | |||
| 1046 | Ga0114129_10052194 | |||
| 1047 | Ga0114129_10105041 | |||
| 1048 | Ga0114129_10117464 | |||
| 1049 | Ga0114129_10359531 | |||
| 1050 | Ga0114129_10390534 | |||
| 1051 | Ga0114129_10687013 | |||
| 1052 | Ga0105243_10047338 | |||
| 1053 | Ga0105243_10065382 | |||
| 1054 | Ga0105243_10166112 | |||
| 1055 | Ga0105241_10183053 | |||
| 1056 | Ga0105241_10186657 | |||
| 1057 | Ga0105242_10042961 | |||
| 1058 | Ga0105248_10099948 | |||
| 1059 | Ga0105248_10166113 | |||
| 1060 | Ga0105248_10233342 | |||
| 1061 | Ga0105248_10588830 | |||
| 1062 | Ga0105237_10043243 | |||
| 1063 | Ga0105238_10026880 | |||
| 1064 | Ga0105238_10151506 | |||
| 1065 | Ga0105238_10292383 | |||
| 1066 | Ga0105249_10031795 | |||
| 1067 | Ga0105249_10047447 | |||
| 1068 | Ga0105249_10115304 | |||
| 1069 | Ga0105249_10405993 | |||
| 1070 | Ga0105239_10014059 | |||
| 1071 | Ga0105239_10033596 | |||
| 1072 | Ga0105239_10079496 | |||
| 1073 | Ga0105239_10146882 | |||
| 1074 | Ga0105239_10285580 | |||
| 1075 | Ga0105239_10393797 | |||
| 1076 | Ga0105246_10002035 | |||
| 1077 | Ga0105246_10143252 | |||
| 1078 | Ga0105246_10306799 | |||
| 1079 | Ga0157369_10005118 | |||
| 1080 | Ga0157369_10007584 | |||
| 1081 | Ga0157369_10254253 | |||
| 1082 | Ga0157369_10294259 | |||
| 1083 | Ga0157374_10019073 | |||
| 1084 | Ga0157374_10030966 | |||
| 1085 | Ga0157378_10016316 | |||
| 1086 | Ga0157378_10459545 | |||
| 1087 | Ga0163162_10036532 | |||
| 1088 | Ga0157372_10034401 | |||
| 1089 | Ga0157372_10074607 | |||
| 1090 | Ga0157372_10212398 | |||
| 1091 | Ga0157375_10046969 | |||
| 1092 | Ga0157375_10076626 | |||
| 1093 | Ga0157375_10153595 | |||
| 1094 | Ga0157375_10592858 | |||
| 1095 | Ga0163163_10144526 | |||
| 1096 | Ga0163163_10454955 | |||
| 1097 | Ga0157380_10169355 | |||
| 1098 | Ga0182008_10119659 | |||
| 1099 | Ga0157377_10232502 | |||
| 1100 | Ga0157379_10020054 | |||
| 1101 | Ga0157379_10111706 | |||
| 1102 | Ga0157376_10035011 | |||
| 1103 | Ga0157376_10140441 | |||
| 1104 | Ga0157376_10205951 | |||
| 1105 | Ga0157376_10224109 | |||
| 1106 | Ga0207653_10051052 | |||
| 1107 | Ga0207642_10092909 | |||
| 1108 | Ga0207642_10165445 | |||
| 1109 | Ga0207710_10021751 | |||
| 1110 | Ga0207688_10006649 | |||
| 1111 | Ga0207688_10033219 | |||
| 1112 | Ga0207688_10084524 | |||
| 1113 | Ga0207688_10106226 | |||
| 1114 | Ga0207680_10268946 | |||
| 1115 | Ga0207685_10005154 | |||
| 1116 | Ga0207685_10036804 | |||
| 1117 | Ga0207699_10060111 | |||
| 1118 | Ga0207699_10217304 | |||
| 1119 | Ga0207699_10256106 | |||
| 1120 | Ga0207645_10082555 | |||
| 1121 | Ga0207645_10118194 | |||
| 1122 | Ga0207643_10006760 | |||
| 1123 | Ga0207643_10040499 | |||
| 1124 | Ga0207705_10085555 | |||
| 1125 | Ga0207654_10061595 | |||
| 1126 | Ga0207707_10064973 | |||
| 1127 | Ga0207707_10089244 | |||
| 1128 | Ga0207671_10023280 | |||
| 1129 | Ga0207693_10000946 | |||
| 1130 | Ga0207693_10008106 | |||
| 1131 | Ga0207693_10132879 | |||
| 1132 | Ga0207693_10148515 | |||
| 1133 | Ga0207663_10010059 | |||
| 1134 | Ga0207663_10012946 | |||
| 1135 | Ga0207660_10162367 | |||
| 1136 | Ga0207662_10096186 | |||
| 1137 | Ga0207657_10000634 | |||
| 1138 | Ga0207657_10002448 | |||
| 1139 | Ga0207657_10003834 | |||
| 1140 | Ga0207652_10127108 | |||
| 1141 | Ga0207652_10131014 | |||
| 1142 | Ga0207652_10220569 | |||
| 1143 | Ga0207646_10000129 | |||
| 1144 | Ga0207694_10095608 | |||
| 1145 | Ga0207694_10210550 | |||
| 1146 | Ga0207650_10082485 | |||
| 1147 | Ga0207687_10004747 | |||
| 1148 | Ga0207687_10017115 | |||
| 1149 | Ga0207687_10379327 | |||
| 1150 | Ga0207700_10030834 | |||
| 1151 | Ga0207700_10098003 | |||
| 1152 | Ga0207700_10117824 | |||
| 1153 | Ga0207700_10208142 | |||
| 1154 | Ga0207664_10022570 | |||
| 1155 | Ga0207664_10024247 | |||
| 1156 | Ga0207664_10176526 | |||
| 1157 | Ga0207664_10391736 | |||
| 1158 | Ga0207690_10024370 | |||
| 1159 | Ga0207706_10038710 | |||
| 1160 | Ga0207706_10199435 | |||
| 1161 | Ga0207706_10313630 | |||
| 1162 | Ga0207686_10002552 | |||
| 1163 | Ga0207709_10038675 | |||
| 1164 | Ga0207709_10048447 | |||
| 1165 | Ga0207670_10188181 | |||
| 1166 | Ga0207669_10102740 | |||
| 1167 | Ga0207704_10038287 | |||
| 1168 | Ga0207704_10057762 | |||
| 1169 | Ga0207665_10003933 | |||
| 1170 | Ga0207665_10110488 | |||
| 1171 | Ga0207691_10145516 | |||
| 1172 | Ga0207691_10274778 | |||
| 1173 | Ga0207691_10302871 | |||
| 1174 | Ga0207689_10008991 | |||
| 1175 | Ga0207661_10011023 | |||
| 1176 | Ga0207661_10130757 | |||
| 1177 | Ga0207679_10196517 | |||
| 1178 | Ga0207679_10277585 | |||
| 1179 | Ga0207667_10018029 | |||
| 1180 | Ga0207712_10052393 | |||
| 1181 | Ga0207712_10062599 | |||
| 1182 | Ga0207712_10111300 | |||
| 1183 | Ga0207677_10013030 | |||
| 1184 | Ga0207677_10046695 | |||
| 1185 | Ga0207677_10084802 | |||
| 1186 | Ga0207703_10126703 | |||
| 1187 | Ga0207703_10327178 | |||
| 1188 | Ga0207639_10083285 | |||
| 1189 | Ga0207639_10165926 | |||
| 1190 | Ga0207639_10258149 | |||
| 1191 | Ga0207678_10080390 | |||
| 1192 | Ga0207678_10268835 | |||
| 1193 | Ga0207708_10010743 | |||
| 1194 | Ga0207708_10014813 | |||
| 1195 | Ga0207708_10024294 | |||
| 1196 | Ga0207708_10093625 | |||
| 1197 | Ga0207708_10102741 | |||
| 1198 | Ga0207702_10113643 | |||
| 1199 | Ga0207702_10348528 | |||
| 1200 | Ga0207648_10049395 | |||
| 1201 | Ga0207648_10109826 | |||
| 1202 | Ga0207676_10135311 | |||
| 1203 | Ga0207674_10050731 | |||
| 1204 | Ga0207674_10080482 | |||
| 1205 | Ga0207674_10170052 | |||
| 1206 | Ga0207674_10322500 | |||
| 1207 | Ga0207675_100020004 | |||
| 1208 | Ga0207675_100151352 | |||
| 1209 | Ga0207675_100200394 | |||
| 1210 | Ga0207675_100214870 | |||
| 1211 | Ga0207683_10002216 | |||
| 1212 | Ga0207683_10031246 | |||
| 1213 | Ga0207683_10087444 | |||
| 1214 | Ga0207698_10067279 | |||
| 1215 | Ga0207698_10148407 | |||
| 1216 | Ga0207698_10176577 | |||
| 1217 | Ga0207428_10046656 | |||
| 1218 | Ga0207428_10318035 | |||
| 1219 | Ga0268266_10049156 | |||
| 1220 | Ga0265337_1004161 | |||
| 1221 | Ga0265326_10000985 | |||
| 1222 | Ga0265319_1006680 | |||
| 1223 | Ga0265319_1018571 | |||
| 1224 | Ga0265319_1078490 | |||
| 1225 | Ga0265319_1081960 | |||
| 1226 | Ga0265334_10000505 | |||
| 1227 | Ga0265334_10006757 | |||
| 1228 | Ga0265334_10007101 | |||
| 1229 | Ga0265318_10006636 | |||
| 1230 | Ga0265318_10010392 | |||
| 1231 | Ga0265318_10048772 | |||
| 1232 | Ga0265318_10071968 | |||
| 1233 | Ga0265323_10004152 | |||
| 1234 | Ga0265322_10004479 | |||
| 1235 | Ga0265322_10015492 | |||
| 1236 | Ga0265336_10001069 | |||
| 1237 | Ga0265338_10004673 | |||
| 1238 | Ga0265338_10007523 | |||
| 1239 | Ga0265338_10030965 | |||
| 1240 | Ga0265338_10034060 | |||
| 1241 | Ga0265338_10074725 | |||
| 1242 | Ga0265338_10131302 | |||
| 1243 | Ga0265338_10141608 | |||
| 1244 | Ga0265338_10295556 | |||
| 1245 | Ga0265324_10004094 | |||
| 1246 | Ga0265324_10006242 | |||
| 1247 | Ga0265332_10003171 | |||
| 1248 | Ga0265332_10030653 | |||
| 1249 | Ga0265320_10014688 | |||
| 1250 | Ga0265320_10029144 | |||
| 1251 | Ga0265325_10004728 | |||
| 1252 | Ga0265325_10013050 | |||
| 1253 | Ga0265340_10003725 | |||
| 1254 | Ga0265340_10011050 | |||
| 1255 | Ga0265340_10088427 | |||
| 1256 | Ga0265339_10010372 | |||
| 1257 | Ga0265339_10039599 | |||
| 1258 | Ga0265331_10013916 | |||
| 1259 | Ga0265327_10002558 | |||
| 1260 | Ga0265327_10034908 | |||
| 1261 | Ga0265327_10089888 | |||
| 1262 | Ga0265316_10007535 | |||
| 1263 | Ga0265316_10022059 | |||
| 1264 | Ga0265316_10079582 | |||
| 1265 | Ga0265316_10109600 | |||
| 1266 | Ga0265316_10187483 | |||
| 1267 | Ga0265316_10437047 | |||
| 1268 | Ga0307408_100189299 | |||
| 1269 | Ga0265313_10003931 | |||
| 1270 | Ga0265313_10016044 | |||
| 1271 | Ga0316575_10029428 | |||
| 1272 | Ga0265314_10004902 | |||
| 1273 | Ga0265314_10042767 | |||
| 1274 | Ga0265314_10049371 | |||
| 1275 | Ga0265314_10136623 | |||
| 1276 | Ga0265342_10004212 | |||
| 1277 | Ga0265342_10026872 | |||
| 1278 | Ga0307405_10024270 | |||
| 1279 | Ga0316577_10012886 | |||
| 1280 | Ga0307413_10012124 | |||
| 1281 | Ga0307410_10004035 | |||
| 1282 | Ga0307407_10010395 | |||
| 1283 | Ga0307409_100248547 | |||
| 1284 | Ga0307416_100409599 | |||
| 1285 | Ga0307411_10019058 | |||
| 1286 | Ga0307415_100012746 | |||
| 1287 | Ga0307415_100043630 | |||
| 1288 | Ga0373944_0055284 | |||
| 1289 | Ga0373923_0067463 | |||
| 1290 | Ga0373932_0105958 | |||
| 1291 | Ga0373943_0005519 | |||
| 1292 | Ga0373955_0097350 | |||
| 1293 | Ga0373961_0082404 | |||
| 1294 | Ga0316574_0004746 | |||
| 1295 | Ga0373924_0019130 | |||
| 1296 | Ga0373931_0065209 | |||
| 1297 | Ga0373927_0028909 | |||
| 1298 | Ga0373933_0220276 | |||
| 1299 | Ga0373947_0016400 | |||
| 1300 | Ga0373947_0077678 | |||
| 1301 | Ga0373947_0113478 | |||
| 1302 | Ga0373937_0007821 | |||
| 1303 | Ga0373925_0121036 | |||
| 1304 | Ga0395899_0002792 | |||
| 1305 | Ga0395899_0007525 | |||
| 1306 | Ga0395900_0007157 | |||
| 1307 | Ga0395898_0002275 | |||
| 1308 | Ga0395898_0019557 | |||
| 1309 | Ga0395898_0667273 | |||
| 1310 | Ga0395905_0002172 | |||
| 1311 | Ga0395905_0110975 | |||
| 1312 | Ga0316581_0005588 | |||
| 1313 | Ga0436364_0777713 | |||
| 1314 | Ga0395901_0075890 | |||
| 1315 | Ga0395901_0081612 | |||
| 1316 | Ga0395901_0139125 | |||
| 1317 | Ga0395901_0589858 | |||
| 1318 | Ga0436365_0461948 | |||
| 1319 | Ga0453683_0002264 | |||
| 1320 | Ga0466965_0041019 | |||
| 1321 | Ga0466966_0027558 | |||
| 1322 | Ga0466961_0020049 | |||
| 1323 | Ga0466961_0129793 | |||
| 1324 | Ga0466961_0186750 | |||
| 1325 | Ga0466963_0003110 | |||
| 1326 | Ga0466963_0011905 | |||
| 1327 | Ga0466963_0013597 | |||
| 1328 | Ga0466963_0014419 | |||
| 1329 | Ga0466963_0069221 | |||
| 1330 | Ga0466963_0090319 | |||
| 1331 | Ga0466963_0237410 | |||
| 1332 | Ga0466964_0006026 | |||
| 1333 | Ga0466964_0008127 | |||
| 1334 | Ga0466964_0009743 | |||
| 1335 | Ga0466964_0083304 | |||
| 1336 | Ga0466964_0098899 | |||
| 1337 | Ga0453684_0036659 | |||
| 1338 | Ga0466971_0001860 | |||
| 1339 | Ga0466968_0105151 | |||
| 1340 | Ga0466970_0225720 | |||
| 1341 | Ga0466957_0007796 | |||
| 1342 | Ga0466957_0052632 | |||
| 1343 | Ga0466957_0061608 | |||
| 1344 | Ga0466957_0096308 | |||
| 1345 | Ga0466960_0026572 | |||
| 1346 | Ga0466960_0107170 | |||
| 1347 | Ga0466959_0000274 | |||
| 1348 | Ga0466959_0055984 | |||
| 1349 | Ga0466958_0002650 | |||
| 1350 | Ga0466958_0009410 | |||
| 1351 | Ga0466967_0005029 | |||
| 1352 | Ga0466967_0012518 | |||
| 1353 | Ga0466967_0016540 | |||
| 1354 | Ga0466967_0020863 | |||
| 1355 | Ga0466967_0029880 | |||
| 1356 | Ga0466967_0051769 | |||
| 1357 | Ga0466967_0064348 | |||
| 1358 | Ga0466967_0080839 | |||
| 1359 | Ga0466967_0086825 | |||
| 1360 | Ga0466967_0090006 | |||
| 1361 | Ga0466967_0111810 | |||
| 1362 | Ga0466967_0118514 | |||
| 1363 | Ga0466967_0132688 | |||
| 1364 | Ga0466967_0206677 | |||
| 1365 | Ga0466967_0233867 | |||
| 1366 | Ga0466967_0236657 | |||
| 1367 | Ga0466967_0327813 | |||
| 1368 | Ga0466967_0827764 | |||
| 1369 | Ga0495603_0084426 | |||
| 1370 | Ga0495590_0025372 | |||
| 1371 | Ga0495629_0034076 | |||
| 1372 | Ga0495641_0028932 | |||
| 1373 | Ga0495651_0034335 | |||
| 1374 | Ga0495651_0071692 | |||
| 1375 | Ga0495653_0074076 | |||
| 1376 | Ga0495653_0118924 | |||
| 1377 | Ga0495653_0125419 | |||
| 1378 | Ga0495580_0075171 | |||
| 1379 | Ga0495582_0021686 | |||
| 1380 | Ga0495582_0055219 | |||
| 1381 | Ga0495639_0008657 | |||
| 1382 | Ga0495662_0010651 | |||
| 1383 | Ga0495664_0106011 | |||
| 1384 | Ga0495584_0086503 | |||
| 1385 | Ga0495608_0016627 | |||
| 1386 | Ga0495616_0073829 | |||
| 1387 | Ga0495586_0014967 | |||
| 1388 | Ga0495587_0093857 | |||
| 1389 | Ga0495609_0071897 | |||
| 1390 | Ga0495645_0163713 | |||
| 1391 | Ga0495667_0009117 | |||
| 1392 | Ga0495611_0044973 | |||
| 1393 | Ga0495635_0056643 | |||
| 1394 | Ga0495635_0126191 | |||
| 1395 | Ga0495588_0032337 | |||
| 1396 | Ga0495588_0160201 | |||
| 1397 | Ga0495657_0006699 | |||
| 1398 | Ga0495599_0123478 | |||
| 1399 | Ga0495623_0031118 | |||
| 1400 | Ga0495646_0096997 | |||
| 1401 | Ga0495658_0012267 | |||
| 1402 | Ga0495658_0032274 | |||
| 1403 | Ga0495658_0067904 | |||
| 1404 | Ga0495658_0262205 | |||
| 1405 | Ga0495613_0010326 | |||
| 1406 | Ga0495624_0028442 | |||
| 1407 | Ga0495624_0049977 | |||
| 1408 | Ga0495600_0027068 | |||
| 1409 | Ga0495600_0045697 | |||
| 1410 | Ga0495581_0010425 | |||
| 1411 | Ga0495604_0139739 | |||
| 1412 | Ga0495636_0132136 | |||
| 1413 | Ga0495674_0057075 | |||
| 1414 | Ga0495674_0067820 | |||
| 1415 | Ga0495674_0078011 | |||
| 1416 | Ga0495676_0053261 | |||
| 1417 | Ga0495676_0160122 | |||
| 1418 | Ga0495676_0273810 | |||
| 1419 | Ga0495680_0003705 | |||
| 1420 | Ga0495680_0015616 | |||
| 1421 | Ga0495680_0035090 | |||
| 1422 | Ga0495680_0255389 | |||
| 1423 | Ga0495677_0024864 | |||
| 1424 | Ga0495679_035378 | |||
| 1425 | Ga0495684_0003191 | |||
| 1426 | Ga0495684_0082012 | |||
| 1427 | Ga0495602_0102391 | |||
| 1428 | Ga0496100_0002144 | |||
| 1429 | Ga0496100_0005920 | |||
| 1430 | Ga0496100_0018474 | |||
| 1431 | Ga0496100_0021732 | |||
| 1432 | Ga0496100_0164152 | |||
| 1433 | Ga0496101_0007308 | |||
| 1434 | Ga0496101_0012833 | |||
| 1435 | Ga0496101_0016106 | |||
| 1436 | Ga0496101_0038878 | |||
| 1437 | Ga0496101_0123275 | |||
| 1438 | Ga0496101_0182004 | |||
| 1439 | Ga0496101_0374000 | |||
| 1440 | Ga0496102_0005821 | |||
| 1441 | Ga0496102_0013576 | |||
| 1442 | Ga0496102_0014623 | |||
| 1443 | Ga0496102_0019411 | |||
| 1444 | Ga0496102_0041363 | |||
| 1445 | Ga0496102_0141947 | |||
| 1446 | Ga0496103_0059367 | |||
| 1447 | Ga0496103_0080940 | |||
| 1448 | Ga0496103_0089313 | |||
| 1449 | Ga0496103_0116002 | |||
| 1450 | Ga0496104_0007404 | |||
| 1451 | Ga0496104_0015825 | |||
| 1452 | Ga0496104_0020044 | |||
| 1453 | Ga0496104_0026874 | |||
| 1454 | Ga0496104_0048106 | |||
| 1455 | Ga0496104_0291432 | |||
| 1456 | Ga0496105_0028666 | |||
| 1457 | Ga0496105_0034477 | |||
| 1458 | Ga0496105_0039272 | |||
| 1459 | Ga0496105_0069486 | |||
| 1460 | Ga0496105_0116927 | |||
| 1461 | Ga0496105_0124110 | |||
| 1462 | Ga0496105_0151428 | |||
| 1463 | Ga0496105_0179468 | |||
| 1464 | Ga0496105_0226841 | |||
| 1465 | Ga0496105_0240465 | |||
| 1466 | Ga0496106_0000080 | |||
| 1467 | Ga0496106_0001316 | |||
| 1468 | Ga0496106_0010221 | |||
| 1469 | Ga0496106_0013692 | |||
| 1470 | Ga0496106_0019007 | |||
| 1471 | Ga0496106_0327597 | |||
| 1472 | Ga0496107_0010815 | |||
| 1473 | Ga0496107_0018508 | |||
| 1474 | Ga0496107_0022840 | |||
| 1475 | Ga0496107_0039785 | |||
| 1476 | Ga0496107_0122661 | |||
| 1477 | Ga0496108_0003406 | |||
| 1478 | Ga0496108_0003783 | |||
| 1479 | Ga0496108_0013929 | |||
| 1480 | Ga0496108_0031358 | |||
| 1481 | Ga0496108_0041807 | |||
| 1482 | Ga0496108_0049530 | |||
| 1483 | Ga0496108_0229307 | |||
| 1484 | Ga0496108_0331367 | |||
| 1485 | Ga0496109_0001203 | |||
| 1486 | Ga0496109_0001585 | |||
| 1487 | Ga0496109_0005647 | |||
| 1488 | Ga0496109_0010259 | |||
| 1489 | Ga0496109_0012500 | |||
| 1490 | Ga0496109_0013104 | |||
| 1491 | Ga0496109_0027339 | |||
| 1492 | Ga0496109_0036300 | |||
| 1493 | Ga0496109_0120266 | |||
| 1494 | Ga0496109_0131059 | |||
| 1495 | Ga0496109_0184220 | |||
| 1496 | Ga0496110_0001093 | |||
| 1497 | Ga0496110_0002291 | |||
| 1498 | Ga0496110_0015618 | |||
| 1499 | Ga0496110_0015732 | |||
| 1500 | Ga0496110_0037101 | |||
| 1501 | Ga0496110_0038103 | |||
| 1502 | Ga0496110_0142742 | |||
| 1503 | Ga0496110_0158551 | |||
| 1504 | Ga0496110_0241632 | |||
| 1505 | Ga0496110_0314616 | |||
| 1506 | Ga0496111_0003077 | |||
| 1507 | Ga0496111_0013160 | |||
| 1508 | Ga0496111_0036922 | |||
| 1509 | Ga0496111_0044219 | |||
| 1510 | Ga0496111_0071296 | |||
| 1511 | Ga0496111_0129001 | |||
| 1512 | Ga0496111_0283011 | |||
| 1513 | Ga0496112_0004191 | |||
| 1514 | Ga0496112_0004222 | |||
| 1515 | Ga0496112_0018153 | |||
| 1516 | Ga0496112_0133241 | |||
| 1517 | Ga0496112_0152173 | |||
| 1518 | Ga0496112_0159036 | |||
| 1519 | Ga0496112_0314609 | |||
| 1520 | Ga0496113_0000452 | |||
| 1521 | Ga0496113_0025484 | |||
| 1522 | Ga0496113_0048163 | |||
| 1523 | Ga0496113_0096664 | |||
| 1524 | Ga0496113_0121687 | |||
| 1525 | Ga0496113_0134125 | |||
| 1526 | Ga0496113_0146579 | |||
| 1527 | Ga0496114_0004118 | |||
| 1528 | Ga0496114_0015747 | |||
| 1529 | Ga0496114_0033657 | |||
| 1530 | Ga0496114_0059060 | |||
| 1531 | Ga0496114_0074053 | |||
| 1532 | Ga0496114_0288753 | |||
| 1533 | Ga0496114_0315282 | |||
| 1534 | Ga0496115_0037227 | |||
| 1535 | Ga0496115_0038027 | |||
| 1536 | Ga0496115_0045528 | |||
| 1537 | Ga0496115_0072251 | |||
| 1538 | Ga0496115_0084719 | |||
| 1539 | Ga0496126_0054909 | |||
| 1540 | Ga0496126_0256991 | |||
| 1541 | Ga0501031_0000045 | |||
| 1542 | Ga0501031_0055710 | |||
| 1543 | Ga0501031_0086571 | |||
| 1544 | Ga0501032_0001065 | |||
| 1545 | Ga0501032_0016286 | |||
| 1546 | Ga0501032_0208686 | |||
| 1547 | Ga0501033_0000194 | |||
| 1548 | Ga0501034_0016074 | |||
| 1549 | Ga0501036_0000186 | |||
| 1550 | Ga0501036_0004350 | |||
| 1551 | Ga0501036_0198701 | |||
| 1552 | Ga0501037_0000348 | |||
| 1553 | Ga0501038_0000412 | |||
| 1554 | Ga0501038_0058059 | |||
| 1555 | Ga0501039_0000100 | |||
| 1556 | Ga0501039_0005387 | |||
| 1557 | Ga0501040_0000151 | |||
| 1558 | Ga0501040_0000487 | |||
| 1559 | Ga0501040_0007327 | |||
| 1560 | Ga0501040_0019205 | |||
| 1561 | Ga0501040_0073156 | |||
| 1562 | Ga0501041_0000395 | |||
| 1563 | Ga0501041_0021162 | |||
| 1564 | Ga0501041_0030661 | |||
| 1565 | Ga0501042_0000021 | |||
| 1566 | Ga0501042_0010198 | |||
| 1567 | Ga0501042_0026455 | |||
| 1568 | Ga0501042_0293185 | |||
| 1569 | Ga0501043_0000992 | |||
| 1570 | Ga0501043_0021574 | |||
| 1571 | Ga0501043_0055445 | |||
| 1572 | Ga0501046_0000425 | |||
| 1573 | Ga0501046_0041830 | |||
| 1574 | Ga0501047_0000723 | |||
| 1575 | Ga0501047_0056135 | |||
| 1576 | Ga0501048_0000086 | |||
| 1577 | Ga0501048_0014680 | |||
| 1578 | Ga0501048_0049442 | |||
| 1579 | Ga0501067_0000180 | |||
| 1580 | Ga0501067_0000248 | |||
| 1581 | Ga0501067_0000584 | |||
| 1582 | Ga0501067_0006085 | |||
| 1583 | Ga0501067_0009627 | |||
| 1584 | Ga0501067_0015067 | |||
| 1585 | Ga0501067_0037375 | |||
| 1586 | Ga0501067_0122391 | |||
| 1587 | Ga0501068_0000049 | |||
| 1588 | Ga0501068_0000079 | |||
| 1589 | Ga0501068_0312105 | |||
| 1590 | Ga0501069_0000049 | |||
| 1591 | Ga0501069_0000256 | |||
| 1592 | Ga0501069_0000884 | |||
| 1593 | Ga0501069_0003725 | |||
| 1594 | Ga0501069_0017598 | |||
| 1595 | Ga0501069_0024869 | |||
| 1596 | Ga0501069_0031670 | |||
| 1597 | Ga0501069_0047566 | |||
| 1598 | Ga0501069_0067515 | |||
| 1599 | Ga0501070_0168345 | |||
| 1600 | Ga0501070_0223561 | |||
| 1601 | Ga0501071_0000014 | |||
| 1602 | Ga0501071_0007459 | |||
| 1603 | Ga0501071_0058083 | |||
| 1604 | Ga0501071_0069473 | |||
| 1605 | Ga0501072_0000306 | |||
| 1606 | Ga0501072_0000351 | |||
| 1607 | Ga0501072_0006009 | |||
| 1608 | Ga0501072_0015721 | |||
| 1609 | Ga0501072_0068146 | |||
| 1610 | Ga0501073_0109995 | |||
| 1611 | Ga0501074_0000458 | |||
| 1612 | Ga0501075_0000159 | |||
| 1613 | Ga0501075_0001107 | |||
| 1614 | Ga0501075_0021407 | |||
| 1615 | Ga0501075_0029003 | |||
| 1616 | Ga0501075_0052252 | |||
| 1617 | Ga0501075_0179989 | |||
| 1618 | Ga0501076_0000240 | |||
| 1619 | Ga0501076_0000359 | |||
| 1620 | Ga0501076_0004149 | |||
| 1621 | Ga0501076_0005858 | |||
| 1622 | Ga0501076_0103120 | |||
| 1623 | Ga0501077_0000107 | |||
| 1624 | Ga0501077_0017125 | |||
| 1625 | Ga0501077_0088857 | |||
| 1626 | Ga0501079_0000349 | |||
| 1627 | Ga0501079_0002359 | |||
| 1628 | Ga0501079_0011610 | |||
| 1629 | Ga0501079_0015406 | |||
| 1630 | Ga0501079_0018428 | |||
| 1631 | Ga0501079_0079441 | |||
| 1632 | Ga0501080_0000771 | |||
| 1633 | Ga0501081_0000009 | |||
| 1634 | Ga0501081_0020137 | |||
| 1635 | Ga0501081_0032088 | |||
| 1636 | Ga0501083_0000077 | |||
| 1637 | Ga0501035_0000298 | |||
| 1638 | Ga0501044_0001267 | |||
| 1639 | Ga0501045_0000190 | |||
| 1640 | Ga0501045_0001200 | |||
| 1641 | Ga0501045_0014852 | |||
| 1642 | Ga0501045_0133648 | |||
| 1643 | nmdc:mga03n38_238124_c1 | |||
| 1644 | nmdc:mga03n38_43139_c1 | |||
| 1645 | nmdc:mga06z11_14431_c1 | |||
| 1646 | nmdc:mga05p37_106063_c1 | |||
| 1647 | nmdc:mga05p37_124252_c1 | |||
| 1648 | nmdc:mga05p37_316501_c1 | |||
| 1649 | nmdc:mga05p37_3398_c1 | |||
| 1650 | nmdc:mga05p37_507082_c1 | |||
| 1651 | nmdc:mga05p37_519382_c1 | |||
| 1652 | nmdc:mga05p37_524522_c1 | |||
| 1653 | nmdc:mga05p37_800965_c1 | |||
| 1654 | nmdc:mga09592_148688_c1 | |||
| 1655 | nmdc:mga09592_2379_c1 | |||
| 1656 | nmdc:mga09592_74279_c1 | |||
| 1657 | nmdc:mga0qj67_120407_c1 | |||
| 1658 | nmdc:mga0qj67_4998_c1 | |||
| 1659 | nmdc:mga06r32_7043_c1 | |||
| 1660 | nmdc:mga08y16_115627_c1 | |||
| 1661 | nmdc:mga08y16_147750_c1 | |||
| 1662 | nmdc:mga0n895_125795_c1 | |||
| 1663 | nmdc:mga0n895_15586_c1 | |||
| 1664 | nmdc:mga0n895_21161_c1 | |||
| 1665 | nmdc:mga0n895_41301_c1 | |||
| 1666 | nmdc:mga0n895_45838_c1 | |||
| 1667 | nmdc:mga0n895_637060_c1 | |||
| 1668 | nmdc:mga0rr50_1709_c1 | |||
| 1669 | nmdc:mga0a205_221493_c1 | |||
| 1670 | nmdc:mga0a205_231569_c1 | |||
| 1671 | Ga0495601_0063661 | |||
| 1672 | Ga0495601_0066624 | |||
| 1673 | Ga0495601_0093211 | |||
| 1674 | Ga0495601_0333734 | |||
| 1675 | Ga0495612_0048689 | |||
| 1676 | Ga0495612_0071925 | |||
| 1677 | Ga0495655_0018929 | |||
| 1678 | Ga0495595_0058673 | |||
| 1679 | Ga0495619_0066225 | |||
| 1680 | Ga0501084_0000378 | |||
| 1681 | Ga0501084_0012981 | |||
| 1682 | Ga0501082_0000426 | |||
| 1683 | Ga0501082_0001908 | |||
| 1684 | Ga0501082_0010294 | |||
| 1685 | Ga0530510_0000256 | |||
| 1686 | Ga0530510_0001232 | |||
| 1687 | Ga0530510_0011023 | |||
| 1688 | Ga0530510_0014673 | |||
| 1689 | Ga0530510_0024733 | |||
| 1690 | Ga0530510_0129451 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dxq-assembly2.cif.gz_B | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.901 | 4 | 298 |
| 3dxq-assembly1.cif.gz_A | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.8919 | 4 | 298 |
| 3dxq-assembly2.cif.gz_B | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.8779 | 4 | 298 |
| 3dxq-assembly1.cif.gz_A | crystal structure of choline/ethanolamine kinase family protein (np_106042.1) from mesorhizobium loti at 2.55 a resolution | 0.8776 | 4 | 298 |
| 4r77-assembly3.cif.gz_A | crystal structure of choline kinase lica from streptococcus pneumoniae | 0.8655 | 4 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dxqA02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.9096 | 97 | 299 | 3.90.1200.10 |
| 3dxqA02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8926 | 97 | 299 | 3.90.1200.10 |
| af_D3ZRW8_130_378_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.844 | 66 | 284 | 3.90.1200.10 |
| af_Q5JMB6_72_367_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8424 | 42 | 285 | 3.90.1200.10 |
| af_A0A1D6NDZ6_107_380_3.90.1200.10 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8318 | 63 | 284 | 3.90.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A388Q736-F1-model_v4 | Ethanolamine kinase 2 | 0.9958 | 16 | 299 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A3L7XP22-F1-model_v4 | LPS biosynthesis choline kinase | 0.9953 | 4 | 264 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A1F8TS70-F1-model_v4 | Aminoglycoside phosphotransferase domain-containing protein | 0.9946 | 1 | 217 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A0P9DCF9-F1-model_v4 | Choline kinase | 0.9909 | 1 | 299 |
GO:0004305
GO:0005737 GO:0006646 |
| AF-A0A1F8TS70-F1-model_v4 | Aminoglycoside phosphotransferase domain-containing protein | 0.99 | 1 | 217 |
GO:0004305
GO:0005737 GO:0006646 |