F483231

General Info

Members Datasets Scaffolds Average Seq Length
844 390 820 108

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0218260|Ga0500568_0218260_37_357
Length 106
Sequence MGSTTPVTDDTFTAEVLNSDKPVLVDFWAEWCGPCKMVGPVLEEIAAEHDSIRIVKLNIDENPEIARKYGIMSIPTMSVFVGGEVAKSIVGAKPKAALLRDLADFV

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2527291627 Frankia casuarinae Thr Isolate Nodule
3 2527291629 Frankia sp. BMG5.23 Isolate Nodule
4 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
5 2576861822 Frankia sp. CeD Isolate Nodule
6 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
7 2619618881 Frankia sp. ACN1ag Isolate Unclassified
8 2619619003 Frankia sp. CpI1-P Isolate Nodule
9 2626541554 Frankia sp. AvcI.1 Isolate Nodule
10 2671180195 Frankia sp. CcI49 Isolate Nodule
11 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
12 2684623036 Frankia sp. CgIM4 Isolate Nodule
13 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
14 2710264753 Frankia sp. KB5 Isolate Nodule
15 2773857922 Frankia sp. CcI49 Isolate Nodule
16 2773857924 Frankia sp. CgIS1 Isolate Nodule
17 2773857933 Frankia sp. BMG5.30 Isolate Nodule
18 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
19 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
20 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
35 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
38 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
142 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
143 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
164 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
172 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
243 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
246 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
250 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
251 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
254 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
260 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
261 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
262 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
263 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
264 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
265 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
266 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
267 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
276 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
277 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
278 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
279 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
280 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
281 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
282 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
283 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
284 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
285 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
286 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
287 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
288 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
291 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
292 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
293 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
294 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
299 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
300 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
387 637000116 Frankia casuarinae CcI3 Isolate Nodule
388 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
389 8054920844 Frankia tisae Agncl-8 Isolate Nodule
390 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.65
Metatranscriptomes 13.51
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 2.01
Rhizoplane 8.65
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1021311 3300001915 Bacteria 1012
2 JGI24752J21851_1006979 3300001976 Bacteria 1476
3 JGI24746J21847_1014990 3300001977 Bacteria 1116
4 JGI24740J21852_10092970 3300001979 Bacteria 776
5 JGI24740J21852_10168524 3300001979 Bacteria 543
6 JGI24033J26618_1030347 3300002155 Bacteria 725
7 JGI24751J29686_10009980 3300002459 Bacteria 1955
8 Ga0006778J45830_1015158 3300003162 Bacteria 1288
9 Ga0006777J48905_1093645 3300003308 Bacteria 609
10 Ga0007417J51691_1093063 3300003544 Bacteria 506
11 Ga0007416J51690_1121851 3300003577 Bacteria 770
12 Ga0007429J51699_1045772 3300003579 Bacteria 523
13 Ga0032354_1024214 3300003693 Bacteria 1584
14 Ga0032354_1080657 3300003693 Bacteria 853
15 Ga0058858_1430783 3300004785 Bacteria 577
16 Ga0058858_1435338 3300004785 Bacteria 1101
17 Ga0058859_11831860 3300004798 Bacteria 736
18 Ga0058863_11752507 3300004799 Bacteria 517
19 Ga0058863_11795119 3300004799 Bacteria 577
20 Ga0058863_11969637 3300004799 Bacteria 664
21 Ga0058861_10038173 3300004800 Bacteria 719
22 Ga0058861_10053673 3300004800 Bacteria 1547
23 Ga0058860_12223939 3300004801 Bacteria 688
24 Ga0058862_10004410 3300004803 Bacteria 864
25 Ga0058862_10052241 3300004803 Bacteria 963
26 Ga0058862_12662569 3300004803 Bacteria 626
27 Ga0058862_12834696 3300004803 Bacteria 684
28 Ga0070658_10140252 3300005327 Bacteria 2019
29 Ga0070658_10160401 3300005327 Bacteria 1886
30 Ga0070676_10453536 3300005328 Bacteria 902
31 Ga0070683_100709508 3300005329 Bacteria 963
32 Ga0070683_100854729 3300005329 Bacteria 872
33 Ga0070690_100061856 3300005330 Bacteria 2413
34 Ga0070690_100088821 3300005330 Bacteria 2032
35 Ga0070670_100013557 3300005331 Bacteria 6986
36 Ga0070670_100259383 3300005331 Bacteria 1515
37 Ga0068869_100004413 3300005334 Bacteria 8744
38 Ga0068869_100276573 3300005334 Bacteria 1349
39 Ga0070666_10012116 3300005335 Bacteria 5430
40 Ga0070666_10081633 3300005335 Bacteria 2210
41 Ga0070666_10928554 3300005335 Bacteria 644
42 Ga0070680_100016246 3300005336 Bacteria 5855
43 Ga0070680_100242630 3300005336 Bacteria 1523
44 Ga0070682_100003294 3300005337 Bacteria 8953
45 Ga0070682_100008216 3300005337 Bacteria 5884
46 Ga0070682_100037889 3300005337 Bacteria 2954
47 Ga0070682_100194688 3300005337 Bacteria 1426
48 Ga0070682_100729476 3300005337 Bacteria 798
49 Ga0070682_100766130 3300005337 Bacteria 781
50 Ga0070682_101518458 3300005337 Bacteria 577
51 Ga0068868_100008441 3300005338 Bacteria 7376
52 Ga0068868_100155395 3300005338 Bacteria 1886
53 Ga0070660_100006740 3300005339 Bacteria 7967
54 Ga0070689_100068893 3300005340 Bacteria 2760
55 Ga0070689_100128592 3300005340 Bacteria 2030
56 Ga0070689_100211674 3300005340 Bacteria 1587
57 Ga0070691_10008108 3300005341 Bacteria 4809
58 Ga0070691_10194959 3300005341 Bacteria 1061
59 Ga0070687_100065344 3300005343 Bacteria 1935
60 Ga0070687_100730420 3300005343 Bacteria 695
61 Ga0070661_100145236 3300005344 Bacteria 1790
62 Ga0070661_101134917 3300005344 Bacteria 652
63 Ga0070661_101364047 3300005344 Bacteria 596
64 Ga0070692_10002095 3300005345 Bacteria 7614
65 Ga0070692_10022846 3300005345 Bacteria 3059
66 Ga0070692_10324671 3300005345 Bacteria 948
67 Ga0070668_100587720 3300005347 Bacteria 973
68 Ga0070668_101034674 3300005347 Bacteria 739
69 Ga0070675_100015059 3300005354 Bacteria 6108
70 Ga0070671_100006414 3300005355 Bacteria 9398
71 Ga0070671_100008056 3300005355 Bacteria 8435
72 Ga0070671_100034922 3300005355 Bacteria 4164
73 Ga0070671_101538629 3300005355 Bacteria 589
74 Ga0070674_100070094 3300005356 Bacteria 2476
75 Ga0070674_100187609 3300005356 Bacteria 1588
76 Ga0070674_101514688 3300005356 Bacteria 603
77 Ga0070673_100031198 3300005364 Bacteria 3997
78 Ga0070673_100178389 3300005364 Bacteria 1817
79 Ga0070688_100545011 3300005365 Bacteria 881
80 Ga0070659_100052882 3300005366 Bacteria 3195
81 Ga0070659_100291745 3300005366 Bacteria 1358
82 Ga0070659_101341381 3300005366 Bacteria 635
83 Ga0070667_100029794 3300005367 Bacteria 4550
84 Ga0070667_100891019 3300005367 Bacteria 828
85 Ga0070667_101372630 3300005367 Bacteria 663
86 Ga0070667_101442397 3300005367 Bacteria 646
87 Ga0070703_10017715 3300005406 Bacteria 2053
88 Ga0070703_10405124 3300005406 Bacteria 595
89 Ga0070709_10019732 3300005434 Bacteria 3902
90 Ga0070709_10135399 3300005434 Bacteria 1687
91 Ga0070714_100111396 3300005435 Bacteria 2424
92 Ga0070713_100141291 3300005436 Bacteria 2133
93 Ga0070713_100269258 3300005436 Bacteria 1559
94 Ga0070710_10469865 3300005437 Bacteria 856
95 Ga0070701_10023654 3300005438 Bacteria 2963
96 Ga0070701_10052081 3300005438 Bacteria 2125
97 Ga0070711_100009279 3300005439 Bacteria 6051
98 Ga0070711_100012490 3300005439 Bacteria 5308
99 Ga0070705_100020780 3300005440 Bacteria 3481
100 Ga0070705_100567736 3300005440 Bacteria 873
101 Ga0070700_100004331 3300005441 Bacteria 7405
102 Ga0070700_100006526 3300005441 Bacteria 6240
103 Ga0070694_100023644 3300005444 Bacteria 3955
104 Ga0070663_100047212 3300005455 Bacteria 3050
105 Ga0070663_100156191 3300005455 Bacteria 1753
106 Ga0070663_100782477 3300005455 Bacteria 817
107 Ga0070678_100021273 3300005456 Bacteria 4274
108 Ga0070678_100062656 3300005456 Bacteria 2747
109 Ga0070678_100445707 3300005456 Bacteria 1133
110 Ga0070678_100615579 3300005456 Bacteria 971
111 Ga0070678_100766593 3300005456 Bacteria 874
112 Ga0070678_100804334 3300005456 Bacteria 854
113 Ga0070662_100134006 3300005457 Bacteria 1914
114 Ga0070662_100651061 3300005457 Bacteria 889
115 Ga0070681_10316703 3300005458 Bacteria 1469
116 Ga0068867_100945659 3300005459 Bacteria 778
117 Ga0070685_10028835 3300005466 Bacteria 3079
118 Ga0070685_10092956 3300005466 Bacteria 1829
119 Ga0070685_10142355 3300005466 Bacteria 1511
120 Ga0070685_11277154 3300005466 Bacteria 560
121 Ga0070685_11622873 3300005466 Bacteria 500
122 Ga0070706_101740907 3300005467 Bacteria 567
123 Ga0070679_100120169 3300005530 Bacteria 2612
124 Ga0070679_100319214 3300005530 Bacteria 1503
125 Ga0070679_101286186 3300005530 Bacteria 677
126 Ga0070684_100237449 3300005535 Bacteria 1665
127 Ga0070684_100519979 3300005535 Bacteria 1103
128 Ga0070684_101882031 3300005535 Bacteria 565
129 Ga0070697_101604653 3300005536 Bacteria 582
130 Ga0068853_100042716 3300005539 Bacteria 3877
131 Ga0068853_100372293 3300005539 Bacteria 1333
132 Ga0068853_100462842 3300005539 Bacteria 1194
133 Ga0070672_100034382 3300005543 Bacteria 3847
134 Ga0070672_100319926 3300005543 Bacteria 1319
135 Ga0070672_100649960 3300005543 Bacteria 921
136 Ga0070672_101262994 3300005543 Bacteria 659
137 Ga0070686_100062377 3300005544 Bacteria 2412
138 Ga0070686_100188776 3300005544 Bacteria 1470
139 Ga0070686_100353493 3300005544 Bacteria 1105
140 Ga0070695_100196305 3300005545 Bacteria 1439
141 Ga0070695_100242902 3300005545 Bacteria 1307
142 Ga0070695_101323907 3300005545 Bacteria 596
143 Ga0070696_100103425 3300005546 Bacteria 2044
144 Ga0070693_100002461 3300005547 Bacteria 8532
145 Ga0070693_100039609 3300005547 Bacteria 2640
146 Ga0070665_100166349 3300005548 Bacteria 2207
147 Ga0070665_100341833 3300005548 Bacteria 1501
148 Ga0070665_100486710 3300005548 Bacteria 1245
149 Ga0070665_101908014 3300005548 Bacteria 600
150 Ga0070704_100144995 3300005549 Bacteria 1859
151 Ga0068855_100020107 3300005563 Bacteria 8017
152 Ga0070664_100024970 3300005564 Bacteria 4952
153 Ga0070664_100033081 3300005564 Bacteria 4328
154 Ga0070664_100479402 3300005564 Bacteria 1145
155 Ga0070664_101473803 3300005564 Bacteria 644
156 Ga0068857_100701137 3300005577 Bacteria 962
157 Ga0068857_100919350 3300005577 Bacteria 839
158 Ga0068854_100071782 3300005578 Bacteria 2533
159 Ga0068854_100079579 3300005578 Bacteria 2416
160 Ga0068854_100494698 3300005578 Bacteria 1029
161 Ga0068856_100012332 3300005614 Bacteria 8276
162 Ga0068856_100139606 3300005614 Bacteria 2430
163 Ga0070702_100019496 3300005615 Bacteria 3539
164 Ga0070702_100059763 3300005615 Bacteria 2213
165 Ga0070702_101097327 3300005615 Bacteria 636
166 Ga0068852_100053614 3300005616 Bacteria 3472
167 Ga0068852_100082606 3300005616 Bacteria 2855
168 Ga0068852_100236747 3300005616 Bacteria 1743
169 Ga0068852_100766374 3300005616 Bacteria 978
170 Ga0068852_102392668 3300005616 Bacteria 549
171 Ga0068859_100019852 3300005617 Bacteria 6746
172 Ga0068859_100038562 3300005617 Bacteria 4793
173 Ga0068859_100431008 3300005617 Bacteria 1415
174 Ga0068864_100005825 3300005618 Bacteria 10104
175 Ga0068864_100018168 3300005618 Bacteria 5869
176 Ga0068864_100103011 3300005618 Bacteria 2534
177 Ga0068866_10246409 3300005718 Bacteria 1091
178 Ga0068866_10578264 3300005718 Bacteria 755
179 Ga0068866_11189946 3300005718 Bacteria 550
180 Ga0068861_100034773 3300005719 Bacteria 3728
181 Ga0068861_100788150 3300005719 Bacteria 891
182 Ga0068861_102290756 3300005719 Bacteria 542
183 Ga0068851_10027537 3300005834 Bacteria 2802
184 Ga0068851_10248837 3300005834 Bacteria 1008
185 Ga0068851_10284442 3300005834 Bacteria 947
186 Ga0068870_10000950 3300005840 Bacteria 11375
187 Ga0068870_10079331 3300005840 Bacteria 1810
188 Ga0068863_100004915 3300005841 Bacteria 13171
189 Ga0068863_100085578 3300005841 Bacteria 2987
190 Ga0068863_101267343 3300005841 Bacteria 744
191 Ga0068863_102012020 3300005841 Bacteria 588
192 Ga0068858_100010914 3300005842 Bacteria 8586
193 Ga0068858_100167228 3300005842 Bacteria 2073
194 Ga0068858_100740014 3300005842 Bacteria 958
195 Ga0068860_100044452 3300005843 Bacteria 4233
196 Ga0068860_100068304 3300005843 Bacteria 3376
197 Ga0068860_100106697 3300005843 Bacteria 2676
198 Ga0068862_100120232 3300005844 Bacteria 2314
199 Ga0068862_100679443 3300005844 Bacteria 996
200 Ga0081540_1059500 3300005983 Bacteria 1834
201 Ga0081540_1078675 3300005983 Bacteria 1493
202 Ga0070717_10021268 3300006028 Bacteria 5111
203 Ga0070717_10582937 3300006028 Bacteria 1014
204 Ga0075432_10007031 3300006058 Bacteria 3835
205 Ga0075432_10037334 3300006058 Bacteria 1691
206 Ga0070715_10281814 3300006163 Bacteria 881
207 Ga0070716_101175340 3300006173 Bacteria 615
208 Ga0070712_100917676 3300006175 Bacteria 755
209 Ga0070712_101763832 3300006175 Bacteria 542
210 Ga0075427_10106155 3300006194 Bacteria 526
211 Ga0097621_100022749 3300006237 Bacteria 4869
212 Ga0097621_100025168 3300006237 Bacteria 4654
213 Ga0068871_100031063 3300006358 Bacteria 4209
214 Ga0068871_100076505 3300006358 Bacteria 2764
215 Ga0068871_101670628 3300006358 Bacteria 604
216 Ga0075428_100626913 3300006844 Bacteria 1148
217 Ga0075431_100354326 3300006847 Bacteria 1475
218 Ga0075433_10026668 3300006852 Bacteria 4896
219 Ga0075433_10078608 3300006852 Bacteria 2907
220 Ga0075434_100005189 3300006871 Bacteria 11827
221 Ga0075434_100243413 3300006871 Bacteria 1818
222 Ga0075434_100660903 3300006871 Bacteria 1063
223 Ga0075434_102257282 3300006871 Bacteria 548
224 Ga0075429_100177981 3300006880 Bacteria 1864
225 Ga0075429_101948471 3300006880 Bacteria 509
226 Ga0068865_100131926 3300006881 Bacteria 1873
227 Ga0068865_100268731 3300006881 Bacteria 1353
228 Ga0075436_100021585 3300006914 Bacteria 4419
229 Ga0075436_100235002 3300006914 Bacteria 1302
230 Ga0097620_100019850 3300006931 Bacteria 6746
231 Ga0097620_100038562 3300006931 Bacteria 4793
232 Ga0097620_100431065 3300006931 Bacteria 1415
233 Ga0075435_100009249 3300007076 Bacteria 7118
234 Ga0075435_100206707 3300007076 Bacteria 1664
235 Ga0105251_10005745 3300009011 Bacteria 8046
236 Ga0105251_10085627 3300009011 Bacteria 1452
237 Ga0105251_10109050 3300009011 Bacteria 1262
238 Ga0105240_10020672 3300009093 Bacteria 8773
239 Ga0105240_10260258 3300009093 Bacteria 2002
240 Ga0111539_10070843 3300009094 Bacteria 4115
241 Ga0111539_10524251 3300009094 Bacteria 1380
242 Ga0111539_11610064 3300009094 Bacteria 753
243 Ga0105245_10347345 3300009098 Bacteria 1469
244 Ga0105245_10480286 3300009098 Bacteria 1256
245 Ga0105245_10655443 3300009098 Bacteria 1080
246 Ga0105245_11316161 3300009098 Bacteria 772
247 Ga0105245_12301214 3300009098 Bacteria 592
248 Ga0105247_10000024 3300009101 Bacteria 210946
249 Ga0105247_10014350 3300009101 Bacteria 4756
250 Ga0105247_10113307 3300009101 Bacteria 1748
251 Ga0105247_10550235 3300009101 Bacteria 848
252 Ga0114129_10035791 3300009147 Bacteria 7012
253 Ga0114129_10107558 3300009147 Bacteria 3851
254 Ga0105243_10148708 3300009148 Bacteria 2007
255 Ga0105243_10474188 3300009148 Bacteria 1180
256 Ga0105243_10845882 3300009148 Bacteria 906
257 Ga0105243_11015025 3300009148 Bacteria 833
258 Ga0105243_11581458 3300009148 Bacteria 682
259 Ga0105241_10003922 3300009174 Bacteria 11017
260 Ga0105241_11147661 3300009174 Bacteria 734
261 Ga0105241_11505525 3300009174 Unclassified 648
262 Ga0105242_10031355 3300009176 Bacteria 4244
263 Ga0105242_10897926 3300009176 Bacteria 886
264 Ga0105242_12172646 3300009176 Bacteria 600
265 Ga0105248_10001056 3300009177 Bacteria 30519
266 Ga0105248_10020922 3300009177 Bacteria 7251
267 Ga0105248_10136721 3300009177 Bacteria 2765
268 Ga0105248_12152620 3300009177 Bacteria 634
269 Ga0105248_12374324 3300009177 Bacteria 604
270 Ga0105237_10030455 3300009545 Bacteria 5481
271 Ga0105237_10054405 3300009545 Bacteria 4010
272 Ga0105237_11432203 3300009545 Bacteria 697
273 Ga0105237_12241566 3300009545 Bacteria 556
274 Ga0105238_10012420 3300009551 Bacteria 8590
275 Ga0105238_10041516 3300009551 Bacteria 4658
276 Ga0105238_10476900 3300009551 Bacteria 1246
277 Ga0105249_10134093 3300009553 Bacteria 2368
278 Ga0105249_10482687 3300009553 Bacteria 1282
279 Ga0105239_10139416 3300010375 Bacteria 2702
280 Ga0105239_10166452 3300010375 Bacteria 2465
281 Ga0105239_10658786 3300010375 Bacteria 1196
282 Ga0105239_12249420 3300010375 Bacteria 634
283 Ga0105246_10002775 3300011119 Bacteria 10600
284 Ga0105246_10047986 3300011119 Bacteria 2918
285 Ga0105246_10324541 3300011119 Bacteria 1252
286 Ga0105246_10411213 3300011119 Bacteria 1126
287 Ga0105246_10513732 3300011119 Bacteria 1020
288 Ga0105246_10524359 3300011119 Bacteria 1010
289 Ga0105246_12472437 3300011119 Bacteria 511
290 Ga0157336_1018690 3300012477 Bacteria 609
291 Ga0157338_1009066 3300012515 Bacteria 978
292 Ga0154012_129348 3300013059 Bacteria 548
293 Ga0157373_10173743 3300013100 Bacteria 1516
294 Ga0157373_10188314 3300013100 Bacteria 1454
295 Ga0157371_10041110 3300013102 Bacteria 3301
296 Ga0157371_10222638 3300013102 Bacteria 1355
297 Ga0157370_10016638 3300013104 Bacteria 7441
298 Ga0157370_10037442 3300013104 Bacteria 4702
299 Ga0157370_11700019 3300013104 Bacteria 566
300 Ga0157369_10065102 3300013105 Bacteria 3924
301 Ga0157369_10391996 3300013105 Bacteria 1441
302 Ga0157369_12518212 3300013105 Bacteria 521
303 Ga0157374_10008470 3300013296 Bacteria 8794
304 Ga0157374_10045677 3300013296 Bacteria 4054
305 Ga0157374_11240233 3300013296 Bacteria 767
306 Ga0157374_11608267 3300013296 Bacteria 674
307 Ga0157378_11319992 3300013297 Bacteria 763
308 Ga0163162_10080192 3300013306 Bacteria 3331
309 Ga0163162_10559158 3300013306 Bacteria 1272
310 Ga0163162_10624267 3300013306 Bacteria 1203
311 Ga0163162_11294678 3300013306 Bacteria 828
312 Ga0163162_11630720 3300013306 Bacteria 736
313 Ga0157372_10000004 3300013307 Bacteria 435659
314 Ga0157372_10009917 3300013307 Bacteria 10133
315 Ga0157372_10038352 3300013307 Bacteria 5287
316 Ga0157372_10316410 3300013307 Bacteria 1817
317 Ga0157372_10470615 3300013307 Bacteria 1465
318 Ga0157375_10067993 3300013308 Bacteria 3562
319 Ga0157375_10106574 3300013308 Bacteria 2895
320 Ga0157375_10163382 3300013308 Bacteria 2370
321 Ga0157375_10513509 3300013308 Bacteria 1362
322 Ga0157375_11054265 3300013308 Bacteria 950
323 Ga0157375_11127373 3300013308 Bacteria 919
324 Ga0163163_10021986 3300014325 Bacteria 6030
325 Ga0163163_10060853 3300014325 Bacteria 3740
326 Ga0163163_10123902 3300014325 Bacteria 2621
327 Ga0163163_11038923 3300014325 Bacteria 883
328 Ga0157380_10023685 3300014326 Bacteria 4635
329 Ga0182008_10103657 3300014497 Bacteria 1407
330 Ga0157377_10007324 3300014745 Bacteria 5322
331 Ga0157377_10146494 3300014745 Bacteria 1456
332 Ga0157377_11056712 3300014745 Bacteria 619
333 Ga0157379_10025436 3300014968 Bacteria 5259
334 Ga0157379_10053099 3300014968 Bacteria 3621
335 Ga0157379_10084610 3300014968 Bacteria 2842
336 Ga0157379_10324576 3300014968 Bacteria 1406
337 Ga0157379_11691776 3300014968 Bacteria 620
338 Ga0157376_10088133 3300014969 Bacteria 2680
339 Ga0157376_10332741 3300014969 Bacteria 1448
340 Ga0157376_10353219 3300014969 Bacteria 1407
341 Ga0157376_10527499 3300014969 Bacteria 1165
342 Ga0157376_10856823 3300014969 Bacteria 924
343 Ga0157376_12298095 3300014969 Bacteria 578
344 Ga0157376_12923460 3300014969 Bacteria 517
345 Ga0163161_10033855 3300017792 Bacteria 3652
346 Ga0163161_10419030 3300017792 Bacteria 1077
347 Ga0163161_10871350 3300017792 Bacteria 761
348 Ga0197907_10349344 3300020069 Bacteria 881
349 Ga0197907_10461931 3300020069 Bacteria 2878
350 Ga0197907_10650100 3300020069 Bacteria 608
351 Ga0197907_10999803 3300020069 Bacteria 505
352 Ga0197907_11208770 3300020069 Bacteria 1635
353 Ga0197907_11215366 3300020069 Bacteria 966
354 Ga0197907_11476430 3300020069 Bacteria 568
355 Ga0206356_10676114 3300020070 Bacteria 513
356 Ga0206356_10891290 3300020070 Bacteria 906
357 Ga0206356_11707506 3300020070 Bacteria 1256
358 Ga0206356_11857247 3300020070 Bacteria 1424
359 Ga0206349_1272775 3300020075 Bacteria 1006
360 Ga0206349_1289577 3300020075 Bacteria 2103
361 Ga0206349_1823967 3300020075 Bacteria 588
362 Ga0206355_1007316 3300020076 Bacteria 1353
363 Ga0206355_1054578 3300020076 Bacteria 1918
364 Ga0206355_1080654 3300020076 Bacteria 509
365 Ga0206355_1099384 3300020076 Bacteria 1453
366 Ga0206355_1318107 3300020076 Bacteria 567
367 Ga0206355_1474009 3300020076 Bacteria 796
368 Ga0206355_1521014 3300020076 Bacteria 609
369 Ga0206355_1554658 3300020076 Bacteria 610
370 Ga0206351_10077041 3300020077 Bacteria 2499
371 Ga0206351_10606993 3300020077 Bacteria 1398
372 Ga0206351_10607123 3300020077 Bacteria 734
373 Ga0206352_10015410 3300020078 Bacteria 731
374 Ga0206352_10212823 3300020078 Bacteria 779
375 Ga0206352_10315045 3300020078 Bacteria 580
376 Ga0206352_11140863 3300020078 Bacteria 697
377 Ga0206352_11246446 3300020078 Bacteria 757
378 Ga0206350_10506608 3300020080 Bacteria 826
379 Ga0206350_10909644 3300020080 Bacteria 624
380 Ga0206350_11030234 3300020080 Bacteria 623
381 Ga0206350_11551424 3300020080 Bacteria 2352
382 Ga0206354_10018836 3300020081 Bacteria 735
383 Ga0206354_10341810 3300020081 Bacteria 1173
384 Ga0206354_10445232 3300020081 Bacteria 652
385 Ga0206354_11320400 3300020081 Bacteria 1056
386 Ga0206354_11499300 3300020081 Bacteria 814
387 Ga0206353_10167382 3300020082 Bacteria 1207
388 Ga0206353_10174093 3300020082 Bacteria 609
389 Ga0206353_10773459 3300020082 Bacteria 1686
390 Ga0206353_11061505 3300020082 Bacteria 1132
391 Ga0206353_11066816 3300020082 Bacteria 614
392 Ga0206353_11435619 3300020082 Bacteria 2056
393 Ga0206353_11848817 3300020082 Bacteria 588
394 Ga0154015_1066299 3300020610 Bacteria 744
395 Ga0154015_1245520 3300020610 Bacteria 628
396 Ga0154015_1299450 3300020610 Bacteria 894
397 Ga0154015_1580325 3300020610 Bacteria 1948
398 Ga0224712_10004796 3300022467 Bacteria 3689
399 Ga0224712_10058367 3300022467 Bacteria 1528
400 Ga0224712_10089803 3300022467 Bacteria 1285
401 Ga0224712_10161127 3300022467 Bacteria 1001
402 Ga0224712_10401055 3300022467 Bacteria 654
403 Ga0224712_10532127 3300022467 Bacteria 570
404 Ga0256744_117491 3300023309 Bacteria 673
405 Ga0247528_112676 3300023680 Bacteria 560
406 Ga0207656_10110159 3300025321 Bacteria 1271
407 Ga0207656_10122939 3300025321 Bacteria 1210
408 Ga0207656_10126403 3300025321 Bacteria 1194
409 Ga0207713_1072822 3300025735 Bacteria 1263
410 Ga0207713_1189392 3300025735 Bacteria 637
411 Ga0207653_10006947 3300025885 Bacteria 3531
412 Ga0207653_10050738 3300025885 Bacteria 1380
413 Ga0207692_10016718 3300025898 Bacteria 3257
414 Ga0207692_10148749 3300025898 Bacteria 1339
415 Ga0207642_10639821 3300025899 Bacteria 665
416 Ga0207710_10000045 3300025900 Bacteria 210957
417 Ga0207710_10344834 3300025900 Bacteria 758
418 Ga0207688_10000847 3300025901 Bacteria 15401
419 Ga0207688_10019002 3300025901 Bacteria 3739
420 Ga0207688_10083125 3300025901 Bacteria 1831
421 Ga0207680_10054816 3300025903 Bacteria 2400
422 Ga0207680_10469572 3300025903 Bacteria 894
423 Ga0207680_10765138 3300025903 Bacteria 692
424 Ga0207680_10874226 3300025903 Bacteria 644
425 Ga0207647_10015966 3300025904 Bacteria 5133
426 Ga0207647_10322205 3300025904 Bacteria 877
427 Ga0207685_10855408 3300025905 Bacteria 504
428 Ga0207699_10310625 3300025906 Bacteria 1103
429 Ga0207645_10716591 3300025907 Bacteria 680
430 Ga0207643_10000582 3300025908 Bacteria 23171
431 Ga0207643_10239468 3300025908 Bacteria 1115
432 Ga0207643_10392195 3300025908 Bacteria 877
433 Ga0207705_10043443 3300025909 Bacteria 3229
434 Ga0207705_10101255 3300025909 Bacteria 2119
435 Ga0207654_10026094 3300025911 Bacteria 3160
436 Ga0207654_10984501 3300025911 Bacteria 613
437 Ga0207707_10012852 3300025912 Bacteria 7284
438 Ga0207707_10151950 3300025912 Bacteria 2024
439 Ga0207695_10075230 3300025913 Bacteria 3436
440 Ga0207695_10218088 3300025913 Bacteria 1816
441 Ga0207671_10068903 3300025914 Bacteria 2637
442 Ga0207671_10117280 3300025914 Bacteria 2032
443 Ga0207693_10026789 3300025915 Bacteria 4560
444 Ga0207693_10034105 3300025915 Bacteria 4014
445 Ga0207663_10033424 3300025916 Bacteria 3063
446 Ga0207663_10045677 3300025916 Bacteria 2695
447 Ga0207660_10042353 3300025917 Bacteria 3195
448 Ga0207660_10645661 3300025917 Bacteria 863
449 Ga0207662_10012234 3300025918 Bacteria 4776
450 Ga0207657_10012967 3300025919 Bacteria 8194
451 Ga0207657_10145428 3300025919 Bacteria 1934
452 Ga0207657_10650164 3300025919 Bacteria 821
453 Ga0207649_10003295 3300025920 Bacteria 8837
454 Ga0207649_11384248 3300025920 Bacteria 557
455 Ga0207652_10007129 3300025921 Bacteria 9014
456 Ga0207652_10305194 3300025921 Bacteria 1437
457 Ga0207681_11320032 3300025923 Bacteria 606
458 Ga0207694_10227319 3300025924 Bacteria 1523
459 Ga0207694_10435768 3300025924 Bacteria 1093
460 Ga0207694_10694231 3300025924 Bacteria 858
461 Ga0207694_11395896 3300025924 Bacteria 592
462 Ga0207650_10011533 3300025925 Bacteria 6086
463 Ga0207650_10843622 3300025925 Bacteria 777
464 Ga0207650_11090608 3300025925 Bacteria 679
465 Ga0207659_10016055 3300025926 Bacteria 4867
466 Ga0207687_10011420 3300025927 Bacteria 5805
467 Ga0207687_10080672 3300025927 Bacteria 2349
468 Ga0207687_10171318 3300025927 Bacteria 1674
469 Ga0207687_10658706 3300025927 Bacteria 886
470 Ga0207687_11047200 3300025927 Bacteria 700
471 Ga0207664_10098201 3300025929 Bacteria 2414
472 Ga0207664_10104075 3300025929 Bacteria 2350
473 Ga0207664_10130702 3300025929 Bacteria 2113
474 Ga0207664_11197995 3300025929 Bacteria 677
475 Ga0207644_10001024 3300025931 Bacteria 17886
476 Ga0207644_10009147 3300025931 Bacteria 6496
477 Ga0207644_11201350 3300025931 Bacteria 637
478 Ga0207644_11211165 3300025931 Bacteria 635
479 Ga0207690_10102900 3300025932 Bacteria 2043
480 Ga0207690_10952056 3300025932 Bacteria 713
481 Ga0207706_10045030 3300025933 Bacteria 3909
482 Ga0207706_10314486 3300025933 Bacteria 1363
483 Ga0207686_10424958 3300025934 Bacteria 1017
484 Ga0207686_10581170 3300025934 Bacteria 879
485 Ga0207686_11262386 3300025934 Bacteria 606
486 Ga0207709_10813660 3300025935 Bacteria 755
487 Ga0207670_10113901 3300025936 Bacteria 1954
488 Ga0207670_10119726 3300025936 Bacteria 1911
489 Ga0207670_10143460 3300025936 Bacteria 1763
490 Ga0207669_10033093 3300025937 Bacteria 2913
491 Ga0207669_10239027 3300025937 Bacteria 1345
492 Ga0207704_10113080 3300025938 Bacteria 1840
493 Ga0207704_10334539 3300025938 Bacteria 1173
494 Ga0207665_10002925 3300025939 Bacteria 11439
495 Ga0207691_10107559 3300025940 Bacteria 2483
496 Ga0207691_10184939 3300025940 Bacteria 1819
497 Ga0207691_10216932 3300025940 Bacteria 1660
498 Ga0207711_10002931 3300025941 Bacteria 14919
499 Ga0207711_10100715 3300025941 Bacteria 2556
500 Ga0207711_10233446 3300025941 Bacteria 1685
501 Ga0207689_10002561 3300025942 Bacteria 16847
502 Ga0207689_10319474 3300025942 Bacteria 1288
503 Ga0207689_10328277 3300025942 Bacteria 1270
504 Ga0207689_10359069 3300025942 Bacteria 1211
505 Ga0207661_10419455 3300025944 Bacteria 1215
506 Ga0207661_10949912 3300025944 Bacteria 792
507 Ga0207679_10016058 3300025945 Bacteria 4964
508 Ga0207679_10744622 3300025945 Bacteria 891
509 Ga0207679_11867194 3300025945 Bacteria 548
510 Ga0207667_10270778 3300025949 Bacteria 1736
511 Ga0207667_10867626 3300025949 Bacteria 896
512 Ga0207651_10320273 3300025960 Bacteria 1296
513 Ga0207712_10070020 3300025961 Bacteria 2519
514 Ga0207712_10225610 3300025961 Bacteria 1500
515 Ga0207712_10944564 3300025961 Bacteria 763
516 Ga0207668_10017424 3300025972 Bacteria 4501
517 Ga0207668_10032912 3300025972 Bacteria 3432
518 Ga0207668_11023261 3300025972 Bacteria 739
519 Ga0207640_10216149 3300025981 Bacteria 1464
520 Ga0207658_10203067 3300025986 Bacteria 1656
521 Ga0207658_10768963 3300025986 Bacteria 873
522 Ga0207658_11469115 3300025986 Unclassified 624
523 Ga0207677_10031358 3300026023 Bacteria 3404
524 Ga0207677_10058031 3300026023 Bacteria 2662
525 Ga0207677_10933446 3300026023 Bacteria 784
526 Ga0207703_10025397 3300026035 Bacteria 4659
527 Ga0207703_10087590 3300026035 Bacteria 2611
528 Ga0207703_10296149 3300026035 Bacteria 1474
529 Ga0207639_10105316 3300026041 Bacteria 2288
530 Ga0207639_10341620 3300026041 Bacteria 1335
531 Ga0207678_10001737 3300026067 Bacteria 19932
532 Ga0207678_10171662 3300026067 Bacteria 1851
533 Ga0207678_10257393 3300026067 Bacteria 1495
534 Ga0207708_10082896 3300026075 Bacteria 2465
535 Ga0207708_10197366 3300026075 Bacteria 1604
536 Ga0207702_10001548 3300026078 Bacteria 22747
537 Ga0207702_10010112 3300026078 Bacteria 7906
538 Ga0207702_10180275 3300026078 Bacteria 1945
539 Ga0207702_10344233 3300026078 Bacteria 1425
540 Ga0207641_10009255 3300026088 Bacteria 8122
541 Ga0207641_10179450 3300026088 Bacteria 1938
542 Ga0207641_10261108 3300026088 Bacteria 1622
543 Ga0207641_11121351 3300026088 Bacteria 785
544 Ga0207648_10209082 3300026089 Bacteria 1732
545 Ga0207648_10557389 3300026089 Bacteria 1053
546 Ga0207676_10010083 3300026095 Bacteria 6723
547 Ga0207676_10120609 3300026095 Bacteria 2211
548 Ga0207676_10355087 3300026095 Bacteria 1357
549 Ga0207674_10140330 3300026116 Bacteria 2376
550 Ga0207674_10203372 3300026116 Bacteria 1930
551 Ga0207674_10239100 3300026116 Bacteria 1763
552 Ga0207675_100006128 3300026118 Bacteria 11431
553 Ga0207675_100356105 3300026118 Bacteria 1435
554 Ga0207675_101575080 3300026118 Bacteria 677
555 Ga0207683_10000940 3300026121 Bacteria 26716
556 Ga0207683_10002124 3300026121 Bacteria 17409
557 Ga0207683_10154486 3300026121 Bacteria 2072
558 Ga0207683_10456884 3300026121 Bacteria 1178
559 Ga0207683_10596788 3300026121 Bacteria 1022
560 Ga0207683_10886916 3300026121 Bacteria 828
561 Ga0207683_11181233 3300026121 Bacteria 709
562 Ga0207698_10027133 3300026142 Bacteria 4062
563 Ga0207698_10395815 3300026142 Bacteria 1319
564 Ga0207698_10638917 3300026142 Bacteria 1053
565 Ga0207698_12603925 3300026142 Bacteria 515
566 Ga0207428_10037394 3300027907 Bacteria 3949
567 Ga0268266_10019784 3300028379 Bacteria 5737
568 Ga0268266_10086549 3300028379 Bacteria 2740
569 Ga0268266_10092904 3300028379 Bacteria 2648
570 Ga0268266_12163106 3300028379 Bacteria 529
571 Ga0268265_10148279 3300028380 Bacteria 1975
572 Ga0268264_10054614 3300028381 Bacteria 3336
573 Ga0268264_10078028 3300028381 Bacteria 2823
574 Ga0268264_10393393 3300028381 Bacteria 1330
575 Ga0265338_10005202 3300028800 Bacteria 17064
576 Ga0265338_10010328 3300028800 Bacteria 10964
577 Ga0311001_1037751 3300029277 Bacteria 633
578 Ga0265767_111138 3300030836 Bacteria 608
579 Ga0265766_1019552 3300030863 Bacteria 550
580 Ga0307508_10276192 3300031616 Bacteria 1274
581 Ga0316575_10292596 3300031665 Bacteria 688
582 Ga0316576_10001892 3300031727 Bacteria 11647
583 Ga0316576_10119181 3300031727 Bacteria 1981
584 Ga0316576_10394910 3300031727 Bacteria 1025
585 Ga0316578_10386461 3300031728 Bacteria 830
586 Ga0316578_10920557 3300031728 Bacteria 505
587 Ga0316577_10537161 3300031733 Bacteria 665
588 Ga0316042_126616 3300031816 Bacteria 562
589 Ga0307410_10771735 3300031852 Bacteria 815
590 Ga0316583_10289566 3300032133 Bacteria 567
591 Ga0316585_10125639 3300032137 Bacteria 845
592 Ga0316593_10036839 3300032168 Bacteria 1614
593 Ga0316593_10146215 3300032168 Bacteria 858
594 Ga0316592_1083288 3300033524 Bacteria 728
595 Ga0316588_1034364 3300033528 Bacteria 1197
596 Ga0316587_1012151 3300033529 Bacteria 1397
597 Ga0316596_1059175 3300033541 Bacteria 1021
598 Ga0316596_1144469 3300033541 Bacteria 652
599 Ga0316596_1205725 3300033541 Bacteria 548
600 Ga0373948_0048350 3300034817 Bacteria 908
601 Ga0373959_0108367 3300034820 Bacteria 668
602 Ga0373929_0064471 3300035085 Bacteria 864
603 Ga0373940_0034752 3300035088 Bacteria 1362
604 Ga0373951_0039318 3300035091 Bacteria 1137
605 Ga0373941_0365865 3300035115 Bacteria 590
606 Ga0373960_0010185 3300035121 Bacteria 2292
607 Ga0373960_0185603 3300035121 Bacteria 728
608 Ga0373942_0168913 3300035207 Bacteria 711
609 Ga0373961_0369336 3300035241 Bacteria 545
610 Ga0373962_0011800 3300035242 Bacteria 2195
611 Ga0316574_0206009 3300035398 Bacteria 1263
612 Ga0316574_0454401 3300035398 Bacteria 802
613 Ga0373931_0047821 3300035691 Bacteria 2265
614 Ga0316582_1036041 3300036647 Bacteria 560
615 Ga0316584_0001134 3300036712 Bacteria 15636
616 Ga0316584_0029752 3300036712 Bacteria 4032
617 Ga0316584_0114016 3300036712 Bacteria 2022
618 Ga0316584_0505673 3300036712 Bacteria 848
619 Ga0373925_1156669 3300037068 Bacteria 636
620 Ga0395905_0971002 3300037471 Bacteria 753
621 Ga0436362_1001710 3300039453 Bacteria 1171
622 Ga0451787_606478 3300041441 Bacteria 1645
623 Ga0451789_0545708 3300041443 Bacteria 1218
624 Ga0451791_0034478 3300041451 Bacteria 2643
625 Ga0451793_0143711 3300041452 Bacteria 5120
626 Ga0451797_0134441 3300041453 Bacteria 2289
627 Ga0451797_0880098 3300041453 Bacteria 609
628 Ga0451795_0030371 3300041456 Bacteria 1489
629 Ga0451800_0901040 3300041459 Bacteria 1109
630 Ga0451804_0895874 3300041463 Bacteria 1108
631 Ga0451833_0089908 3300041491 Bacteria 2338
632 Ga0451837_1276101 3300041494 Bacteria 4040
633 Ga0451839_0579003 3300041496 Bacteria 1633
634 Ga0451843_0638116 3300041509 Bacteria 685
635 Ga0451843_0783312 3300041509 Bacteria 526
636 Ga0451843_0815425 3300041509 Bacteria 6342
637 Ga0451855_1182033 3300041511 Bacteria 1149
638 Ga0451853_0777022 3300041512 Bacteria 8132
639 Ga0439458_0004621 3300042157 Bacteria 3143
640 Ga0439459_0017849 3300042438 Bacteria 1327
641 Ga0439440_0113579 3300042993 Bacteria 747
642 Ga0466969_0004202 3300044656 Bacteria 7643
643 Ga0466969_0037052 3300044656 Bacteria 2461
644 Ga0466972_0076024 3300044658 Bacteria 1600
645 Ga0466966_0030559 3300044684 Bacteria 3496
646 Ga0466966_0046207 3300044684 Bacteria 2780
647 Ga0466961_0043893 3300044693 Bacteria 2862
648 Ga0466961_0339478 3300044693 Bacteria 915
649 Ga0466963_0060280 3300044694 Bacteria 2534
650 Ga0466963_0114187 3300044694 Bacteria 1855
651 Ga0466963_0479865 3300044694 Bacteria 878
652 Ga0466963_0952140 3300044694 Bacteria 605
653 Ga0466971_0053539 3300044719 Bacteria 1818
654 Ga0466971_0558288 3300044719 Bacteria 568
655 Ga0466968_0131100 3300044735 Bacteria 1141
656 Ga0466970_0341284 3300044765 Bacteria 849
657 Ga0466957_0352699 3300044842 Bacteria 998
658 Ga0466957_0393017 3300044842 Bacteria 947
659 Ga0466960_0104511 3300044901 Bacteria 1463
660 Ga0466959_0012505 3300045049 Bacteria 6135
661 Ga0466959_0116797 3300045049 Bacteria 1899
662 Ga0466958_0637588 3300045836 Bacteria 693
663 Ga0466967_0064715 3300045976 Bacteria 3252
664 Ga0466967_0112603 3300045976 Bacteria 2502
665 Ga0466967_0281702 3300045976 Bacteria 1595
666 Ga0466967_0393344 3300045976 Bacteria 1348
667 Ga0466967_2049898 3300045976 Bacteria 569
668 Ga0495629_0086040 3300046459 Bacteria 2193
669 Ga0495641_0338557 3300046461 Bacteria 680
670 Ga0495653_0904243 3300046463 Bacteria 526
671 Ga0495582_0189340 3300046473 Bacteria 1174
672 Ga0495639_0095351 3300046475 Bacteria 1400
673 Ga0495594_0068287 3300046499 Bacteria 1974
674 Ga0495608_0859053 3300046511 Bacteria 533
675 Ga0495618_0872476 3300046514 Bacteria 521
676 Ga0495620_0105891 3300046515 Bacteria 1118
677 Ga0495630_0819977 3300046517 Bacteria 710
678 Ga0495665_0218712 3300046531 Bacteria 985
679 Ga0495640_0157795 3300046533 Bacteria 1456
680 Ga0495667_0532374 3300046559 Bacteria 735
681 Ga0495611_0248816 3300046648 Bacteria 824
682 Ga0495635_0697794 3300046663 Bacteria 658
683 Ga0495588_0743363 3300046674 Bacteria 513
684 Ga0495624_0181829 3300046690 Bacteria 1281
685 Ga0495589_0402283 3300046794 Bacteria 629
686 Ga0495600_0058234 3300046809 Bacteria 2524
687 Ga0495600_0795424 3300046809 Bacteria 564
688 Ga0495581_0105472 3300047315 Bacteria 1638
689 Ga0495581_0160350 3300047315 Bacteria 1315
690 Ga0495581_0907065 3300047315 Bacteria 503
691 Ga0495676_0120545 3300047321 Bacteria 1909
692 Ga0495676_0178638 3300047321 Bacteria 1489
693 Ga0495680_0343885 3300047322 Bacteria 1040
694 Ga0495680_0748019 3300047322 Bacteria 642
695 Ga0495684_0898609 3300047471 Bacteria 571
696 Ga0495593_0377984 3300047673 Bacteria 708
697 Ga0496100_0257298 3300048903 Bacteria 1293
698 Ga0496100_0752727 3300048903 Bacteria 762
699 Ga0496101_0068289 3300048904 Bacteria 2598
700 Ga0496101_0091285 3300048904 Bacteria 2267
701 Ga0496101_0258003 3300048904 Bacteria 1359
702 Ga0496101_1471562 3300048904 Bacteria 530
703 Ga0496102_0018028 3300048905 Bacteria 6195
704 Ga0496102_0023910 3300048905 Bacteria 5431
705 Ga0496102_0332561 3300048905 Bacteria 1431
706 Ga0496102_0474381 3300048905 Bacteria 1172
707 Ga0496103_0074701 3300048906 Bacteria 2125
708 Ga0496103_0074920 3300048906 Bacteria 2122
709 Ga0496103_0333389 3300048906 Bacteria 976
710 Ga0496103_0794467 3300048906 Bacteria 597
711 Ga0496104_0011142 3300048907 Bacteria 8044
712 Ga0496104_0015067 3300048907 Bacteria 6997
713 Ga0496104_0027560 3300048907 Bacteria 5258
714 Ga0496105_0004142 3300048908 Bacteria 10877
715 Ga0496105_0007851 3300048908 Bacteria 8285
716 Ga0496105_0068646 3300048908 Bacteria 2928
717 Ga0496105_1078922 3300048908 Bacteria 597
718 Ga0496106_0008819 3300048909 Bacteria 7453
719 Ga0496106_0033788 3300048909 Bacteria 3817
720 Ga0496107_0008557 3300048910 Bacteria 7081
721 Ga0496107_0039010 3300048910 Bacteria 3407
722 Ga0496108_0001314 3300048911 Bacteria 19538
723 Ga0496108_0005089 3300048911 Bacteria 10623
724 Ga0496108_0038342 3300048911 Bacteria 3991
725 Ga0496108_0044842 3300048911 Bacteria 3692
726 Ga0496108_0068054 3300048911 Bacteria 3004
727 Ga0496108_0878912 3300048911 Bacteria 770
728 Ga0496109_0002656 3300048912 Bacteria 15001
729 Ga0496109_0042670 3300048912 Bacteria 4109
730 Ga0496109_0047288 3300048912 Bacteria 3912
731 Ga0496109_0124834 3300048912 Bacteria 2399
732 Ga0496109_0200278 3300048912 Bacteria 1877
733 Ga0496109_1106651 3300048912 Bacteria 729
734 Ga0496110_0000656 3300048913 Bacteria 23611
735 Ga0496110_0001739 3300048913 Bacteria 16060
736 Ga0496110_0068962 3300048913 Bacteria 3130
737 Ga0496110_0842731 3300048913 Bacteria 822
738 Ga0496110_0883737 3300048913 Bacteria 799
739 Ga0496111_0001057 3300048914 Bacteria 15165
740 Ga0496111_0001201 3300048914 Bacteria 14452
741 Ga0496111_0005464 3300048914 Bacteria 8147
742 Ga0496111_0849878 3300048914 Bacteria 659
743 Ga0496112_0059092 3300048915 Bacteria 3777
744 Ga0496112_0060911 3300048915 Bacteria 3719
745 Ga0496113_0003887 3300048916 Bacteria 9048
746 Ga0496113_0007515 3300048916 Bacteria 7023
747 Ga0496113_0051622 3300048916 Bacteria 3069
748 Ga0496114_0005871 3300048917 Bacteria 9647
749 Ga0496114_0069225 3300048917 Bacteria 2963
750 Ga0496114_0175534 3300048917 Bacteria 1869
751 Ga0496114_0217136 3300048917 Bacteria 1678
752 Ga0496114_1048914 3300048917 Bacteria 699
753 Ga0496114_1093625 3300048917 Bacteria 682
754 Ga0496114_1768804 3300048917 Bacteria 506
755 Ga0496115_0013815 3300048918 Bacteria 6115
756 Ga0496115_0137391 3300048918 Bacteria 2016
757 Ga0496115_0169409 3300048918 Bacteria 1806
758 Ga0496115_0279994 3300048918 Bacteria 1369
759 Ga0496115_0343953 3300048918 Bacteria 1217
760 Ga0496119_0001274 3300048922 Bacteria 31248
761 Ga0496120_0000892 3300048923 Bacteria 41970
762 Ga0496121_0014534 3300048924 Bacteria 8346
763 Ga0496126_0000003 3300048929 Bacteria 961576
764 Ga0501309_070125 3300049129 Bacteria 575
765 Ga0501310_040179 3300049130 Bacteria 649
766 Ga0501305_016824 3300049161 Bacteria 1046
767 Ga0501315_028870 3300049531 Bacteria 789
768 Ga0501317_006203 3300049533 Bacteria 1305
769 Ga0501317_012962 3300049533 Bacteria 1036
770 Ga0501317_024465 3300049533 Bacteria 840
771 Ga0501317_027594 3300049533 Bacteria 807
772 Ga0501318_002713 3300049534 Bacteria 1562
773 Ga0501318_003777 3300049534 Bacteria 1412
774 Ga0501318_016336 3300049534 Bacteria 896
775 Ga0501318_024719 3300049534 Bacteria 783
776 Ga0501318_061271 3300049534 Bacteria 578
777 Ga0501321_003257 3300049537 Bacteria 1473
778 Ga0501331_14350 3300049547 Bacteria 519
779 Ga0501034_0053353 3300049571 Bacteria 4071
780 Ga0501036_0003482 3300049572 Bacteria 12582
781 Ga0501038_0176256 3300049574 Bacteria 1728
782 Ga0501038_0547403 3300049574 Bacteria 880
783 Ga0501039_0268785 3300049575 Bacteria 1340
784 Ga0501042_0425371 3300049578 Bacteria 962
785 Ga0501046_0512696 3300049580 Bacteria 858
786 Ga0501047_0011210 3300049581 Bacteria 8481
787 Ga0501047_0237796 3300049581 Bacteria 1673
788 Ga0501048_0614312 3300049582 Bacteria 780
789 Ga0501074_0001033 3300049590 Bacteria 18071
790 Ga0501077_0122674 3300049593 Bacteria 1647
791 Ga0501044_0185669 3300049823 Bacteria 2044
792 Ga0501044_0381359 3300049823 Bacteria 1325
793 nmdc:mga0yw44_307371_c1 3300050492 Bacteria 1063
794 nmdc:mga05p37_190695_c1 3300050507 Bacteria 2489
795 nmdc:mga09592_525200_c1 3300050508 Bacteria 1018
796 nmdc:mga06r32_130467_c2 3300050510 Bacteria 1202
797 nmdc:mga06r32_697157_c1 3300050510 Bacteria 981
798 nmdc:mga08y16_302547_c1 3300050511 Bacteria 1648
799 nmdc:mga08y16_9435_c1 3300050511 Bacteria 10235
800 nmdc:mga0n895_1378459_c1 3300050512 Bacteria 674
801 nmdc:mga0n895_162137_c1 3300050512 Bacteria 2268
802 nmdc:mga0n895_2047902_c1 3300050512 Bacteria 530
803 nmdc:mga0n895_40350_c1 3300050512 Bacteria 4534
804 nmdc:mga0rr50_118112_c1 3300050513 Bacteria 2107
805 nmdc:mga0rr50_36381_c1 3300050513 Bacteria 3545
806 nmdc:mga08x19_453598_c1 3300050514 Bacteria 903
807 nmdc:mga08x19_4888_c1 3300050514 Bacteria 7922
808 nmdc:mga0a205_12931_c1 3300050515 Bacteria 7744
809 nmdc:mga0a205_1353402_c1 3300050515 Bacteria 560
810 Ga0500568_0218260 3300053139 Bacteria 697
811 Ga0587073_0105335 3300059492 Bacteria 739
812 Ga0587073_0169057 3300059492 Bacteria 633
813 Ga0587080_172566 3300059503 Bacteria 514
814 Ga0587082_164319 3300059504 Bacteria 534
815 Ga0587088_188038 3300059508 Bacteria 521
816 Ga0587113_056077 3300059625 Bacteria 501
817 Ga0587079_248815 3300059647 Bacteria 505
818 Ga0587111_0282634 3300060346 Bacteria 502
819 Ga0466962_0060741 3300061719 Bacteria 1804
820 Ga0466962_0065534 3300061719 Bacteria 1734

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2579778521 2579855127 103
2 iso_pu_bacteria 2619618881 2619853012 103
3 iso_pu_bacteria 2619619003 2620351550 103
4 iso_pu_bacteria 2626541554 2626637312 103
5 iso_pu_bacteria 8054913762 8054918043 103
6 3300005337 Ga0070682_100766130 Ga0070682_1007661301 104
7 3300005564 Ga0070664_100479402 Ga0070664_1004794021 104
8 3300005616 Ga0068852_102392668 Ga0068852_1023926681 104
9 3300009177 Ga0105248_12374324 Ga0105248_123743241 104
10 3300020082 Ga0206353_10167382 Ga0206353_101673822 104
11 3300020610 Ga0154015_1580325 Ga0154015_15803252 104
12 3300025913 Ga0207695_10075230 Ga0207695_100752303 104
13 3300025924 Ga0207694_10435768 Ga0207694_104357681 104
14 3300025929 Ga0207664_10104075 Ga0207664_101040751 104
15 3300025929 Ga0207664_11197995 Ga0207664_111979952 104
16 3300025945 Ga0207679_10744622 Ga0207679_107446221 104
17 3300044658 Ga0466972_0076024 Ga0466972_0076024_599_913 104
18 3300044842 Ga0466957_0393017 Ga0466957_0393017_618_932 104
19 3300045976 Ga0466967_0281702 Ga0466967_0281702_1202_1516 104
20 3300049574 Ga0501038_0176256 Ga0501038_0176256_505_819 104
21 3300049581 Ga0501047_0237796 Ga0501047_0237796_377_691 104
22 3300049593 Ga0501077_0122674 Ga0501077_0122674_1014_1328 104
23 3300049823 Ga0501044_0381359 Ga0501044_0381359_988_1302 104
24 iso_pu_bacteria 2506783011 2506869112 104
25 iso_pu_bacteria 2527291627 2528202272 104
26 iso_pu_bacteria 2527291629 2528214531 104
27 iso_pu_bacteria 2546825537 2546947286 104
28 iso_pu_bacteria 2576861822 2579749481 104
29 iso_pu_bacteria 2671180195 2671837547 104
30 iso_pu_bacteria 2684623035 2686538021 104
31 iso_pu_bacteria 2684623036 2686542285 104
32 iso_pu_bacteria 2687453743 2689992499 104
33 iso_pu_bacteria 2710264753 2710603982 104
34 iso_pu_bacteria 2773857922 2774855703 104
35 iso_pu_bacteria 2773857924 2774865582 104
36 iso_pu_bacteria 2773857933 2774901515 104
37 iso_pu_bacteria 2895880812 2895888051 104
38 iso_pu_bacteria 637000116 637881870 104
39 iso_pu_bacteria 8055157932 8055161223 104
40 3300031665 Ga0316575_10292596 Ga0316575_102925962 105
41 3300031727 Ga0316576_10001892 Ga0316576_100018924 105
42 3300031727 Ga0316576_10119181 Ga0316576_101191813 105
43 3300031727 Ga0316576_10394910 Ga0316576_103949102 105
44 3300031728 Ga0316578_10386461 Ga0316578_103864612 105
45 3300031728 Ga0316578_10920557 Ga0316578_109205571 105
46 3300031733 Ga0316577_10537161 Ga0316577_105371612 105
47 3300032133 Ga0316583_10289566 Ga0316583_102895661 105
48 3300032137 Ga0316585_10125639 Ga0316585_101256392 105
49 3300032168 Ga0316593_10036839 Ga0316593_100368392 105
50 3300032168 Ga0316593_10146215 Ga0316593_101462152 105
51 3300033524 Ga0316592_1083288 Ga0316592_10832882 105
52 3300033528 Ga0316588_1034364 Ga0316588_10343642 105
53 3300033529 Ga0316587_1012151 Ga0316587_10121512 105
54 3300033541 Ga0316596_1144469 Ga0316596_11444691 105
55 3300033541 Ga0316596_1205725 Ga0316596_12057252 105
56 3300035398 Ga0316574_0454401 Ga0316574_0454401_338_658 105
57 3300036647 Ga0316582_1036041 Ga0316582_1036041_85_405 105
58 3300036712 Ga0316584_0001134 Ga0316584_0001134_10868_11188 105
59 3300036712 Ga0316584_0029752 Ga0316584_0029752_188_508 105
60 3300036712 Ga0316584_0505673 Ga0316584_0505673_74_394 105
61 3300045976 Ga0466967_2049898 Ga0466967_2049898_168_488 105
62 3300049571 Ga0501034_0053353 Ga0501034_0053353_3479_3799 105
63 3300049572 Ga0501036_0003482 Ga0501036_0003482_7201_7521 105
64 3300049574 Ga0501038_0547403 Ga0501038_0547403_17_337 105
65 3300049575 Ga0501039_0268785 Ga0501039_0268785_45_365 105
66 3300049578 Ga0501042_0425371 Ga0501042_0425371_353_673 105
67 3300049580 Ga0501046_0512696 Ga0501046_0512696_57_377 105
68 3300049581 Ga0501047_0011210 Ga0501047_0011210_288_608 105
69 3300049582 Ga0501048_0614312 Ga0501048_0614312_265_585 105
70 3300049590 Ga0501074_0001033 Ga0501074_0001033_307_627 105
71 3300049823 Ga0501044_0185669 Ga0501044_0185669_632_952 105
72 3300050492 nmdc:mga0yw44_307371_c1 nmdc:mga0yw44_307371_c1_121_441 105
73 3300053139 Ga0500568_0218260 Ga0500568_0218260_37_357 105
74 iso_pu_bacteria 2915358134 2915360571 105
75 iso_pu_bacteria 2995463766 2995468759 105
76 3300005466 Ga0070685_11277154 Ga0070685_112771541 106
77 3300009098 Ga0105245_11316161 Ga0105245_113161611 106
78 3300013105 Ga0157369_12518212 Ga0157369_125182121 106
79 3300025735 Ga0207713_1189392 Ga0207713_11893922 106
80 3300033541 Ga0316596_1059175 Ga0316596_10591751 106
81 3300035398 Ga0316574_0206009 Ga0316574_0206009_520_843 106
82 3300036712 Ga0316584_0114016 Ga0316584_0114016_499_822 106
83 3300046499 Ga0495594_0068287 Ga0495594_0068287_53_379 106
84 3300049533 Ga0501317_027594 Ga0501317_027594_17_340 106
85 3300049547 Ga0501331_14350 Ga0501331_14350_162_485 106
86 3300059503 Ga0587080_172566 Ga0587080_172566_38_361 106
87 3300003308 Ga0006777J48905_1093645 Ga0006777J48905_10936452 107
88 3300003544 Ga0007417J51691_1093063 Ga0007417J51691_10930631 107
89 3300003579 Ga0007429J51699_1045772 Ga0007429J51699_10457721 107
90 3300003693 Ga0032354_1024214 Ga0032354_10242142 107
91 3300003693 Ga0032354_1080657 Ga0032354_10806572 107
92 3300004785 Ga0058858_1430783 Ga0058858_14307832 107
93 3300004785 Ga0058858_1435338 Ga0058858_14353382 107
94 3300004799 Ga0058863_11752507 Ga0058863_117525071 107
95 3300005335 Ga0070666_10928554 Ga0070666_109285541 107
96 3300005337 Ga0070682_100194688 Ga0070682_1001946881 107
97 3300005344 Ga0070661_101134917 Ga0070661_1011349172 107
98 3300005347 Ga0070668_101034674 Ga0070668_1010346741 107
99 3300005356 Ga0070674_100187609 Ga0070674_1001876092 107
100 3300005366 Ga0070659_101341381 Ga0070659_1013413811 107
101 3300005367 Ga0070667_100891019 Ga0070667_1008910191 107
102 3300005455 Ga0070663_100782477 Ga0070663_1007824772 107
103 3300005456 Ga0070678_100804334 Ga0070678_1008043342 107
104 3300005466 Ga0070685_10142355 Ga0070685_101423551 107
105 3300005543 Ga0070672_101262994 Ga0070672_1012629941 107
106 3300005548 Ga0070665_101908014 Ga0070665_1019080142 107
107 3300005616 Ga0068852_100236747 Ga0068852_1002367472 107
108 3300005841 Ga0068863_102012020 Ga0068863_1020120201 107
109 3300006028 Ga0070717_10582937 Ga0070717_105829371 107
110 3300009011 Ga0105251_10109050 Ga0105251_101090501 107
111 3300009093 Ga0105240_10260258 Ga0105240_102602583 107
112 3300009098 Ga0105245_10347345 Ga0105245_103473452 107
113 3300009101 Ga0105247_10000024 Ga0105247_10000024123 107
114 3300009148 Ga0105243_10845882 Ga0105243_108458822 107
115 3300009148 Ga0105243_11015025 Ga0105243_110150252 107
116 3300009174 Ga0105241_11505525 Ga0105241_115055251 107
117 3300009176 Ga0105242_12172646 Ga0105242_121726461 107
118 3300009177 Ga0105248_10001056 Ga0105248_1000105619 107
119 3300009545 Ga0105237_11432203 Ga0105237_114322032 107
120 3300010375 Ga0105239_12249420 Ga0105239_122494201 107
121 3300011119 Ga0105246_10411213 Ga0105246_104112132 107
122 3300011119 Ga0105246_10513732 Ga0105246_105137322 107
123 3300011119 Ga0105246_10524359 Ga0105246_105243592 107
124 3300012477 Ga0157336_1018690 Ga0157336_10186901 107
125 3300013296 Ga0157374_11240233 Ga0157374_112402331 107
126 3300013296 Ga0157374_11608267 Ga0157374_116082671 107
127 3300013306 Ga0163162_10559158 Ga0163162_105591582 107
128 3300013306 Ga0163162_11294678 Ga0163162_112946781 107
129 3300013306 Ga0163162_11630720 Ga0163162_116307202 107
130 3300013307 Ga0157372_10000004 Ga0157372_10000004162 107
131 3300013307 Ga0157372_10316410 Ga0157372_103164102 107
132 3300013307 Ga0157372_10470615 Ga0157372_104706151 107
133 3300013308 Ga0157375_10513509 Ga0157375_105135092 107
134 3300013308 Ga0157375_11054265 Ga0157375_110542652 107
135 3300013308 Ga0157375_11127373 Ga0157375_111273732 107
136 3300014325 Ga0163163_10060853 Ga0163163_100608532 107
137 3300014325 Ga0163163_10123902 Ga0163163_101239023 107
138 3300014745 Ga0157377_11056712 Ga0157377_110567121 107
139 3300014968 Ga0157379_10025436 Ga0157379_100254362 107
140 3300014968 Ga0157379_10324576 Ga0157379_103245762 107
141 3300014969 Ga0157376_10332741 Ga0157376_103327412 107
142 3300014969 Ga0157376_10353219 Ga0157376_103532192 107
143 3300014969 Ga0157376_10527499 Ga0157376_105274992 107
144 3300014969 Ga0157376_10856823 Ga0157376_108568232 107
145 3300014969 Ga0157376_12923460 Ga0157376_129234601 107
146 3300017792 Ga0163161_10419030 Ga0163161_104190301 107
147 3300017792 Ga0163161_10871350 Ga0163161_108713502 107
148 3300020069 Ga0197907_10349344 Ga0197907_103493441 107
149 3300020069 Ga0197907_10650100 Ga0197907_106501001 107
150 3300020069 Ga0197907_10999803 Ga0197907_109998031 107
151 3300020069 Ga0197907_11208770 Ga0197907_112087702 107
152 3300020070 Ga0206356_10676114 Ga0206356_106761141 107
153 3300020075 Ga0206349_1272775 Ga0206349_12727752 107
154 3300020076 Ga0206355_1080654 Ga0206355_10806542 107
155 3300020076 Ga0206355_1521014 Ga0206355_15210141 107
156 3300020077 Ga0206351_10607123 Ga0206351_106071232 107
157 3300020078 Ga0206352_10015410 Ga0206352_100154101 107
158 3300020078 Ga0206352_11140863 Ga0206352_111408631 107
159 3300020078 Ga0206352_11246446 Ga0206352_112464462 107
160 3300020081 Ga0206354_11499300 Ga0206354_114993001 107
161 3300020082 Ga0206353_11061505 Ga0206353_110615052 107
162 3300020082 Ga0206353_11066816 Ga0206353_110668162 107
163 3300022467 Ga0224712_10089803 Ga0224712_100898032 107
164 3300022467 Ga0224712_10161127 Ga0224712_101611271 107
165 3300022467 Ga0224712_10401055 Ga0224712_104010551 107
166 3300023680 Ga0247528_112676 Ga0247528_1126761 107
167 3300025735 Ga0207713_1072822 Ga0207713_10728222 107
168 3300025900 Ga0207710_10000045 Ga0207710_1000004558 107
169 3300025901 Ga0207688_10083125 Ga0207688_100831251 107
170 3300025903 Ga0207680_10874226 Ga0207680_108742261 107
171 3300025911 Ga0207654_10984501 Ga0207654_109845012 107
172 3300025913 Ga0207695_10218088 Ga0207695_102180882 107
173 3300025924 Ga0207694_11395896 Ga0207694_113958961 107
174 3300025927 Ga0207687_10080672 Ga0207687_100806722 107
175 3300025927 Ga0207687_10171318 Ga0207687_101713182 107
176 3300025927 Ga0207687_11047200 Ga0207687_110472001 107
177 3300025932 Ga0207690_10952056 Ga0207690_109520562 107
178 3300025934 Ga0207686_11262386 Ga0207686_112623861 107
179 3300025935 Ga0207709_10813660 Ga0207709_108136601 107
180 3300025937 Ga0207669_10239027 Ga0207669_102390271 107
181 3300025941 Ga0207711_10002931 Ga0207711_100029318 107
182 3300025949 Ga0207667_10867626 Ga0207667_108676262 107
183 3300025972 Ga0207668_11023261 Ga0207668_110232611 107
184 3300025986 Ga0207658_11469115 Ga0207658_114691152 107
185 3300026023 Ga0207677_10933446 Ga0207677_109334461 107
186 3300026067 Ga0207678_10257393 Ga0207678_102573932 107
187 3300026095 Ga0207676_10120609 Ga0207676_101206092 107
188 3300026121 Ga0207683_10154486 Ga0207683_101544862 107
189 3300026121 Ga0207683_10886916 Ga0207683_108869163 107
190 3300026142 Ga0207698_10395815 Ga0207698_103958152 107
191 3300028379 Ga0268266_12163106 Ga0268266_121631062 107
192 3300028800 Ga0265338_10005202 Ga0265338_100052028 107
193 3300028800 Ga0265338_10010328 Ga0265338_100103286 107
194 3300031616 Ga0307508_10276192 Ga0307508_102761922 107
195 3300031816 Ga0316042_126616 Ga0316042_1266161 107
196 3300039453 Ga0436362_1001710 Ga0436362_1001710_748_1074 107
197 3300041441 Ga0451787_606478 Ga0451787_606478_490_813 107
198 3300041443 Ga0451789_0545708 Ga0451789_0545708_502_825 107
199 3300041451 Ga0451791_0034478 Ga0451791_0034478_294_617 107
200 3300041452 Ga0451793_0143711 Ga0451793_0143711_1663_1986 107
201 3300041453 Ga0451797_0134441 Ga0451797_0134441_1096_1419 107
202 3300041453 Ga0451797_0880098 Ga0451797_0880098_226_549 107
203 3300041456 Ga0451795_0030371 Ga0451795_0030371_14_337 107
204 3300041459 Ga0451800_0901040 Ga0451800_0901040_378_701 107
205 3300041463 Ga0451804_0895874 Ga0451804_0895874_322_645 107
206 3300041491 Ga0451833_0089908 Ga0451833_0089908_849_1172 107
207 3300041494 Ga0451837_1276101 Ga0451837_1276101_1901_2224 107
208 3300041496 Ga0451839_0579003 Ga0451839_0579003_738_1061 107
209 3300041509 Ga0451843_0638116 Ga0451843_0638116_279_602 107
210 3300041509 Ga0451843_0815425 Ga0451843_0815425_5632_5955 107
211 3300041511 Ga0451855_1182033 Ga0451855_1182033_507_830 107
212 3300041512 Ga0451853_0777022 Ga0451853_0777022_1676_1999 107
213 3300044694 Ga0466963_0060280 Ga0466963_0060280_1216_1542 107
214 3300044694 Ga0466963_0114187 Ga0466963_0114187_703_1029 107
215 3300044694 Ga0466963_0952140 Ga0466963_0952140_176_502 107
216 3300044719 Ga0466971_0558288 Ga0466971_0558288_152_478 107
217 3300044842 Ga0466957_0352699 Ga0466957_0352699_588_914 107
218 3300044901 Ga0466960_0104511 Ga0466960_0104511_37_363 107
219 3300045836 Ga0466958_0637588 Ga0466958_0637588_75_401 107
220 3300045976 Ga0466967_0064715 Ga0466967_0064715_2173_2499 107
221 3300046459 Ga0495629_0086040 Ga0495629_0086040_1817_2140 107
222 3300046461 Ga0495641_0338557 Ga0495641_0338557_229_552 107
223 3300046463 Ga0495653_0904243 Ga0495653_0904243_101_424 107
224 3300046473 Ga0495582_0189340 Ga0495582_0189340_23_346 107
225 3300046475 Ga0495639_0095351 Ga0495639_0095351_992_1315 107
226 3300046511 Ga0495608_0859053 Ga0495608_0859053_23_346 107
227 3300046514 Ga0495618_0872476 Ga0495618_0872476_36_359 107
228 3300046517 Ga0495630_0819977 Ga0495630_0819977_224_547 107
229 3300046531 Ga0495665_0218712 Ga0495665_0218712_418_741 107
230 3300046533 Ga0495640_0157795 Ga0495640_0157795_1059_1382 107
231 3300046559 Ga0495667_0532374 Ga0495667_0532374_83_406 107
232 3300046663 Ga0495635_0697794 Ga0495635_0697794_225_548 107
233 3300046674 Ga0495588_0743363 Ga0495588_0743363_162_485 107
234 3300046690 Ga0495624_0181829 Ga0495624_0181829_89_412 107
235 3300046809 Ga0495600_0058234 Ga0495600_0058234_724_1047 107
236 3300046809 Ga0495600_0795424 Ga0495600_0795424_192_515 107
237 3300047315 Ga0495581_0105472 Ga0495581_0105472_1122_1445 107
238 3300047315 Ga0495581_0160350 Ga0495581_0160350_731_1054 107
239 3300047315 Ga0495581_0907065 Ga0495581_0907065_107_430 107
240 3300047321 Ga0495676_0120545 Ga0495676_0120545_1354_1677 107
241 3300047322 Ga0495680_0343885 Ga0495680_0343885_180_503 107
242 3300047322 Ga0495680_0748019 Ga0495680_0748019_166_489 107
243 3300047471 Ga0495684_0898609 Ga0495684_0898609_124_447 107
244 3300047673 Ga0495593_0377984 Ga0495593_0377984_113_436 107
245 3300048903 Ga0496100_0752727 Ga0496100_0752727_32_355 107
246 3300048904 Ga0496101_0091285 Ga0496101_0091285_275_601 107
247 3300048904 Ga0496101_1471562 Ga0496101_1471562_75_398 107
248 3300048905 Ga0496102_0018028 Ga0496102_0018028_1112_1435 107
249 3300048905 Ga0496102_0332561 Ga0496102_0332561_1066_1389 107
250 3300048905 Ga0496102_0474381 Ga0496102_0474381_548_874 107
251 3300048906 Ga0496103_0074701 Ga0496103_0074701_157_483 107
252 3300048906 Ga0496103_0333389 Ga0496103_0333389_310_636 107
253 3300048907 Ga0496104_0015067 Ga0496104_0015067_3043_3366 107
254 3300048908 Ga0496105_0004142 Ga0496105_0004142_5337_5660 107
255 3300048911 Ga0496108_0001314 Ga0496108_0001314_11844_12167 107
256 3300048911 Ga0496108_0068054 Ga0496108_0068054_2007_2330 107
257 3300048911 Ga0496108_0878912 Ga0496108_0878912_392_715 107
258 3300048912 Ga0496109_0002656 Ga0496109_0002656_7367_7690 107
259 3300048912 Ga0496109_0200278 Ga0496109_0200278_118_441 107
260 3300048912 Ga0496109_1106651 Ga0496109_1106651_241_564 107
261 3300048913 Ga0496110_0000656 Ga0496110_0000656_15080_15403 107
262 3300048913 Ga0496110_0883737 Ga0496110_0883737_254_577 107
263 3300048914 Ga0496111_0001201 Ga0496111_0001201_1650_1973 107
264 3300048914 Ga0496111_0849878 Ga0496111_0849878_176_499 107
265 3300048916 Ga0496113_0003887 Ga0496113_0003887_4548_4871 107
266 3300048917 Ga0496114_0069225 Ga0496114_0069225_1144_1467 107
267 3300048917 Ga0496114_0175534 Ga0496114_0175534_479_802 107
268 3300048917 Ga0496114_0217136 Ga0496114_0217136_242_568 107
269 3300048917 Ga0496114_1048914 Ga0496114_1048914_272_595 107
270 3300048917 Ga0496114_1768804 Ga0496114_1768804_41_364 107
271 3300048918 Ga0496115_0137391 Ga0496115_0137391_42_368 107
272 3300048918 Ga0496115_0279994 Ga0496115_0279994_92_415 107
273 3300048918 Ga0496115_0343953 Ga0496115_0343953_814_1137 107
274 3300048922 Ga0496119_0001274 Ga0496119_0001274_25014_25340 107
275 3300048923 Ga0496120_0000892 Ga0496120_0000892_26476_26802 107
276 3300048924 Ga0496121_0014534 Ga0496121_0014534_119_445 107
277 3300048929 Ga0496126_0000003 Ga0496126_0000003_72737_73063 107
278 3300049129 Ga0501309_070125 Ga0501309_070125_56_382 107
279 3300049534 Ga0501318_002713 Ga0501318_002713_95_421 107
280 3300049534 Ga0501318_061271 Ga0501318_061271_20_346 107
281 3300059504 Ga0587082_164319 Ga0587082_164319_189_515 107
282 3300059647 Ga0587079_248815 Ga0587079_248815_111_437 107
283 3300060346 Ga0587111_0282634 Ga0587111_0282634_20_343 107
284 3300061719 Ga0466962_0060741 Ga0466962_0060741_1249_1575 107
285 iso_pu_bacteria 8054920844 8054926864 107
286 3300001915 JGI24741J21665_1021311 JGI24741J21665_10213112 108
287 3300001976 JGI24752J21851_1006979 JGI24752J21851_10069792 108
288 3300001977 JGI24746J21847_1014990 JGI24746J21847_10149902 108
289 3300001979 JGI24740J21852_10092970 JGI24740J21852_100929702 108
290 3300001979 JGI24740J21852_10168524 JGI24740J21852_101685242 108
291 3300002155 JGI24033J26618_1030347 JGI24033J26618_10303472 108
292 3300002459 JGI24751J29686_10009980 JGI24751J29686_100099802 108
293 3300003162 Ga0006778J45830_1015158 Ga0006778J45830_10151582 108
294 3300003577 Ga0007416J51690_1121851 Ga0007416J51690_11218511 108
295 3300004798 Ga0058859_11831860 Ga0058859_118318601 108
296 3300004799 Ga0058863_11795119 Ga0058863_117951192 108
297 3300004799 Ga0058863_11969637 Ga0058863_119696372 108
298 3300004800 Ga0058861_10038173 Ga0058861_100381732 108
299 3300004800 Ga0058861_10053673 Ga0058861_100536732 108
300 3300004801 Ga0058860_12223939 Ga0058860_122239391 108
301 3300004803 Ga0058862_10004410 Ga0058862_100044102 108
302 3300004803 Ga0058862_10052241 Ga0058862_100522411 108
303 3300004803 Ga0058862_12662569 Ga0058862_126625692 108
304 3300004803 Ga0058862_12834696 Ga0058862_128346962 108
305 3300005327 Ga0070658_10140252 Ga0070658_101402523 108
306 3300005327 Ga0070658_10160401 Ga0070658_101604012 108
307 3300005328 Ga0070676_10453536 Ga0070676_104535361 108
308 3300005329 Ga0070683_100709508 Ga0070683_1007095082 108
309 3300005329 Ga0070683_100854729 Ga0070683_1008547291 108
310 3300005330 Ga0070690_100061856 Ga0070690_1000618563 108
311 3300005330 Ga0070690_100088821 Ga0070690_1000888212 108
312 3300005331 Ga0070670_100013557 Ga0070670_1000135577 108
313 3300005331 Ga0070670_100259383 Ga0070670_1002593832 108
314 3300005334 Ga0068869_100004413 Ga0068869_1000044133 108
315 3300005334 Ga0068869_100276573 Ga0068869_1002765732 108
316 3300005335 Ga0070666_10012116 Ga0070666_100121164 108
317 3300005335 Ga0070666_10081633 Ga0070666_100816333 108
318 3300005336 Ga0070680_100016246 Ga0070680_1000162463 108
319 3300005336 Ga0070680_100242630 Ga0070680_1002426302 108
320 3300005337 Ga0070682_100003294 Ga0070682_1000032943 108
321 3300005337 Ga0070682_100008216 Ga0070682_1000082163 108
322 3300005337 Ga0070682_100037889 Ga0070682_1000378892 108
323 3300005337 Ga0070682_100729476 Ga0070682_1007294762 108
324 3300005337 Ga0070682_101518458 Ga0070682_1015184581 108
325 3300005338 Ga0068868_100008441 Ga0068868_1000084412 108
326 3300005338 Ga0068868_100155395 Ga0068868_1001553952 108
327 3300005339 Ga0070660_100006740 Ga0070660_1000067408 108
328 3300005340 Ga0070689_100068893 Ga0070689_1000688932 108
329 3300005340 Ga0070689_100128592 Ga0070689_1001285923 108
330 3300005340 Ga0070689_100211674 Ga0070689_1002116742 108
331 3300005341 Ga0070691_10008108 Ga0070691_100081085 108
332 3300005341 Ga0070691_10194959 Ga0070691_101949592 108
333 3300005343 Ga0070687_100065344 Ga0070687_1000653442 108
334 3300005343 Ga0070687_100730420 Ga0070687_1007304201 108
335 3300005344 Ga0070661_100145236 Ga0070661_1001452362 108
336 3300005344 Ga0070661_101364047 Ga0070661_1013640471 108
337 3300005345 Ga0070692_10002095 Ga0070692_100020956 108
338 3300005345 Ga0070692_10022846 Ga0070692_100228463 108
339 3300005345 Ga0070692_10324671 Ga0070692_103246712 108
340 3300005347 Ga0070668_100587720 Ga0070668_1005877202 108
341 3300005354 Ga0070675_100015059 Ga0070675_1000150593 108
342 3300005355 Ga0070671_100006414 Ga0070671_1000064146 108
343 3300005355 Ga0070671_100008056 Ga0070671_1000080562 108
344 3300005355 Ga0070671_100034922 Ga0070671_1000349222 108
345 3300005355 Ga0070671_101538629 Ga0070671_1015386291 108
346 3300005356 Ga0070674_100070094 Ga0070674_1000700943 108
347 3300005356 Ga0070674_101514688 Ga0070674_1015146882 108
348 3300005364 Ga0070673_100031198 Ga0070673_1000311983 108
349 3300005364 Ga0070673_100178389 Ga0070673_1001783892 108
350 3300005365 Ga0070688_100545011 Ga0070688_1005450112 108
351 3300005366 Ga0070659_100052882 Ga0070659_1000528823 108
352 3300005366 Ga0070659_100291745 Ga0070659_1002917452 108
353 3300005367 Ga0070667_100029794 Ga0070667_1000297944 108
354 3300005367 Ga0070667_101372630 Ga0070667_1013726301 108
355 3300005367 Ga0070667_101442397 Ga0070667_1014423971 108
356 3300005406 Ga0070703_10017715 Ga0070703_100177152 108
357 3300005406 Ga0070703_10405124 Ga0070703_104051241 108
358 3300005434 Ga0070709_10019732 Ga0070709_100197324 108
359 3300005434 Ga0070709_10135399 Ga0070709_101353992 108
360 3300005435 Ga0070714_100111396 Ga0070714_1001113962 108
361 3300005436 Ga0070713_100141291 Ga0070713_1001412912 108
362 3300005436 Ga0070713_100269258 Ga0070713_1002692582 108
363 3300005437 Ga0070710_10469865 Ga0070710_104698651 108
364 3300005438 Ga0070701_10023654 Ga0070701_100236543 108
365 3300005438 Ga0070701_10052081 Ga0070701_100520811 108
366 3300005439 Ga0070711_100009279 Ga0070711_1000092793 108
367 3300005439 Ga0070711_100012490 Ga0070711_1000124904 108
368 3300005440 Ga0070705_100020780 Ga0070705_1000207802 108
369 3300005440 Ga0070705_100567736 Ga0070705_1005677362 108
370 3300005441 Ga0070700_100004331 Ga0070700_1000043313 108
371 3300005441 Ga0070700_100006526 Ga0070700_1000065264 108
372 3300005444 Ga0070694_100023644 Ga0070694_1000236443 108
373 3300005455 Ga0070663_100047212 Ga0070663_1000472122 108
374 3300005455 Ga0070663_100156191 Ga0070663_1001561912 108
375 3300005456 Ga0070678_100021273 Ga0070678_1000212734 108
376 3300005456 Ga0070678_100062656 Ga0070678_1000626562 108
377 3300005456 Ga0070678_100445707 Ga0070678_1004457072 108
378 3300005456 Ga0070678_100615579 Ga0070678_1006155791 108
379 3300005456 Ga0070678_100766593 Ga0070678_1007665931 108
380 3300005457 Ga0070662_100134006 Ga0070662_1001340062 108
381 3300005457 Ga0070662_100651061 Ga0070662_1006510612 108
382 3300005458 Ga0070681_10316703 Ga0070681_103167032 108
383 3300005459 Ga0068867_100945659 Ga0068867_1009456592 108
384 3300005466 Ga0070685_10028835 Ga0070685_100288352 108
385 3300005466 Ga0070685_10092956 Ga0070685_100929563 108
386 3300005466 Ga0070685_11622873 Ga0070685_116228731 108
387 3300005467 Ga0070706_101740907 Ga0070706_1017409071 108
388 3300005530 Ga0070679_100120169 Ga0070679_1001201693 108
389 3300005530 Ga0070679_100319214 Ga0070679_1003192142 108
390 3300005530 Ga0070679_101286186 Ga0070679_1012861862 108
391 3300005535 Ga0070684_100237449 Ga0070684_1002374492 108
392 3300005535 Ga0070684_100519979 Ga0070684_1005199791 108
393 3300005535 Ga0070684_101882031 Ga0070684_1018820311 108
394 3300005536 Ga0070697_101604653 Ga0070697_1016046532 108
395 3300005539 Ga0068853_100042716 Ga0068853_1000427163 108
396 3300005539 Ga0068853_100372293 Ga0068853_1003722932 108
397 3300005539 Ga0068853_100462842 Ga0068853_1004628422 108
398 3300005543 Ga0070672_100034382 Ga0070672_1000343823 108
399 3300005543 Ga0070672_100319926 Ga0070672_1003199262 108
400 3300005543 Ga0070672_100649960 Ga0070672_1006499602 108
401 3300005544 Ga0070686_100062377 Ga0070686_1000623772 108
402 3300005544 Ga0070686_100188776 Ga0070686_1001887762 108
403 3300005544 Ga0070686_100353493 Ga0070686_1003534932 108
404 3300005545 Ga0070695_100196305 Ga0070695_1001963052 108
405 3300005545 Ga0070695_100242902 Ga0070695_1002429022 108
406 3300005545 Ga0070695_101323907 Ga0070695_1013239072 108
407 3300005546 Ga0070696_100103425 Ga0070696_1001034252 108
408 3300005547 Ga0070693_100002461 Ga0070693_1000024613 108
409 3300005547 Ga0070693_100039609 Ga0070693_1000396092 108
410 3300005548 Ga0070665_100166349 Ga0070665_1001663492 108
411 3300005548 Ga0070665_100341833 Ga0070665_1003418331 108
412 3300005548 Ga0070665_100486710 Ga0070665_1004867102 108
413 3300005549 Ga0070704_100144995 Ga0070704_1001449952 108
414 3300005563 Ga0068855_100020107 Ga0068855_1000201078 108
415 3300005564 Ga0070664_100024970 Ga0070664_1000249705 108
416 3300005564 Ga0070664_100033081 Ga0070664_1000330813 108
417 3300005564 Ga0070664_101473803 Ga0070664_1014738032 108
418 3300005577 Ga0068857_100701137 Ga0068857_1007011372 108
419 3300005577 Ga0068857_100919350 Ga0068857_1009193501 108
420 3300005578 Ga0068854_100071782 Ga0068854_1000717822 108
421 3300005578 Ga0068854_100079579 Ga0068854_1000795793 108
422 3300005578 Ga0068854_100494698 Ga0068854_1004946982 108
423 3300005614 Ga0068856_100012332 Ga0068856_1000123323 108
424 3300005614 Ga0068856_100139606 Ga0068856_1001396062 108
425 3300005615 Ga0070702_100019496 Ga0070702_1000194962 108
426 3300005615 Ga0070702_100059763 Ga0070702_1000597633 108
427 3300005615 Ga0070702_101097327 Ga0070702_1010973272 108
428 3300005616 Ga0068852_100053614 Ga0068852_1000536143 108
429 3300005616 Ga0068852_100082606 Ga0068852_1000826063 108
430 3300005616 Ga0068852_100766374 Ga0068852_1007663742 108
431 3300005617 Ga0068859_100019852 Ga0068859_1000198523 108
432 3300005617 Ga0068859_100038562 Ga0068859_1000385624 108
433 3300005617 Ga0068859_100431008 Ga0068859_1004310082 108
434 3300005618 Ga0068864_100005825 Ga0068864_1000058255 108
435 3300005618 Ga0068864_100018168 Ga0068864_1000181682 108
436 3300005618 Ga0068864_100103011 Ga0068864_1001030112 108
437 3300005718 Ga0068866_10246409 Ga0068866_102464092 108
438 3300005718 Ga0068866_10578264 Ga0068866_105782642 108
439 3300005718 Ga0068866_11189946 Ga0068866_111899461 108
440 3300005719 Ga0068861_100034773 Ga0068861_1000347733 108
441 3300005719 Ga0068861_100788150 Ga0068861_1007881502 108
442 3300005719 Ga0068861_102290756 Ga0068861_1022907562 108
443 3300005834 Ga0068851_10027537 Ga0068851_100275372 108
444 3300005834 Ga0068851_10248837 Ga0068851_102488372 108
445 3300005834 Ga0068851_10284442 Ga0068851_102844422 108
446 3300005840 Ga0068870_10000950 Ga0068870_100009502 108
447 3300005840 Ga0068870_10079331 Ga0068870_100793311 108
448 3300005841 Ga0068863_100004915 Ga0068863_1000049158 108
449 3300005841 Ga0068863_100085578 Ga0068863_1000855782 108
450 3300005841 Ga0068863_101267343 Ga0068863_1012673432 108
451 3300005842 Ga0068858_100010914 Ga0068858_1000109148 108
452 3300005842 Ga0068858_100167228 Ga0068858_1001672283 108
453 3300005842 Ga0068858_100740014 Ga0068858_1007400142 108
454 3300005843 Ga0068860_100044452 Ga0068860_1000444523 108
455 3300005843 Ga0068860_100068304 Ga0068860_1000683042 108
456 3300005843 Ga0068860_100106697 Ga0068860_1001066972 108
457 3300005844 Ga0068862_100120232 Ga0068862_1001202322 108
458 3300005844 Ga0068862_100679443 Ga0068862_1006794432 108
459 3300005983 Ga0081540_1059500 Ga0081540_10595002 108
460 3300005983 Ga0081540_1078675 Ga0081540_10786752 108
461 3300006028 Ga0070717_10021268 Ga0070717_100212684 108
462 3300006058 Ga0075432_10007031 Ga0075432_100070312 108
463 3300006058 Ga0075432_10037334 Ga0075432_100373341 108
464 3300006163 Ga0070715_10281814 Ga0070715_102818142 108
465 3300006173 Ga0070716_101175340 Ga0070716_1011753401 108
466 3300006175 Ga0070712_100917676 Ga0070712_1009176762 108
467 3300006175 Ga0070712_101763832 Ga0070712_1017638321 108
468 3300006194 Ga0075427_10106155 Ga0075427_101061551 108
469 3300006237 Ga0097621_100022749 Ga0097621_1000227495 108
470 3300006237 Ga0097621_100025168 Ga0097621_1000251683 108
471 3300006358 Ga0068871_100031063 Ga0068871_1000310632 108
472 3300006358 Ga0068871_100076505 Ga0068871_1000765053 108
473 3300006358 Ga0068871_101670628 Ga0068871_1016706281 108
474 3300006844 Ga0075428_100626913 Ga0075428_1006269132 108
475 3300006847 Ga0075431_100354326 Ga0075431_1003543262 108
476 3300006852 Ga0075433_10026668 Ga0075433_100266683 108
477 3300006852 Ga0075433_10078608 Ga0075433_100786083 108
478 3300006871 Ga0075434_100005189 Ga0075434_1000051898 108
479 3300006871 Ga0075434_100243413 Ga0075434_1002434131 108
480 3300006871 Ga0075434_100660903 Ga0075434_1006609032 108
481 3300006871 Ga0075434_102257282 Ga0075434_1022572821 108
482 3300006880 Ga0075429_100177981 Ga0075429_1001779813 108
483 3300006880 Ga0075429_101948471 Ga0075429_1019484711 108
484 3300006881 Ga0068865_100131926 Ga0068865_1001319263 108
485 3300006881 Ga0068865_100268731 Ga0068865_1002687312 108
486 3300006914 Ga0075436_100021585 Ga0075436_1000215854 108
487 3300006914 Ga0075436_100235002 Ga0075436_1002350022 108
488 3300006931 Ga0097620_100019850 Ga0097620_1000198503 108
489 3300006931 Ga0097620_100038562 Ga0097620_1000385624 108
490 3300006931 Ga0097620_100431065 Ga0097620_1004310652 108
491 3300007076 Ga0075435_100009249 Ga0075435_1000092495 108
492 3300007076 Ga0075435_100206707 Ga0075435_1002067073 108
493 3300009011 Ga0105251_10005745 Ga0105251_100057455 108
494 3300009011 Ga0105251_10085627 Ga0105251_100856272 108
495 3300009093 Ga0105240_10020672 Ga0105240_100206725 108
496 3300009094 Ga0111539_10070843 Ga0111539_100708433 108
497 3300009094 Ga0111539_10524251 Ga0111539_105242512 108
498 3300009094 Ga0111539_11610064 Ga0111539_116100642 108
499 3300009098 Ga0105245_10480286 Ga0105245_104802862 108
500 3300009098 Ga0105245_10655443 Ga0105245_106554431 108
501 3300009098 Ga0105245_12301214 Ga0105245_123012142 108
502 3300009101 Ga0105247_10014350 Ga0105247_100143504 108
503 3300009101 Ga0105247_10113307 Ga0105247_101133071 108
504 3300009101 Ga0105247_10550235 Ga0105247_105502352 108
505 3300009147 Ga0114129_10035791 Ga0114129_100357913 108
506 3300009147 Ga0114129_10107558 Ga0114129_101075582 108
507 3300009148 Ga0105243_10148708 Ga0105243_101487082 108
508 3300009148 Ga0105243_10474188 Ga0105243_104741882 108
509 3300009148 Ga0105243_11581458 Ga0105243_115814582 108
510 3300009174 Ga0105241_10003922 Ga0105241_100039227 108
511 3300009174 Ga0105241_11147661 Ga0105241_111476611 108
512 3300009176 Ga0105242_10031355 Ga0105242_100313552 108
513 3300009176 Ga0105242_10897926 Ga0105242_108979262 108
514 3300009177 Ga0105248_10020922 Ga0105248_100209224 108
515 3300009177 Ga0105248_10136721 Ga0105248_101367212 108
516 3300009177 Ga0105248_12152620 Ga0105248_121526202 108
517 3300009545 Ga0105237_10030455 Ga0105237_100304552 108
518 3300009545 Ga0105237_10054405 Ga0105237_100544052 108
519 3300009545 Ga0105237_12241566 Ga0105237_122415661 108
520 3300009551 Ga0105238_10012420 Ga0105238_100124202 108
521 3300009551 Ga0105238_10041516 Ga0105238_100415162 108
522 3300009551 Ga0105238_10476900 Ga0105238_104769002 108
523 3300009553 Ga0105249_10134093 Ga0105249_101340932 108
524 3300009553 Ga0105249_10482687 Ga0105249_104826872 108
525 3300010375 Ga0105239_10139416 Ga0105239_101394163 108
526 3300010375 Ga0105239_10166452 Ga0105239_101664523 108
527 3300010375 Ga0105239_10658786 Ga0105239_106587862 108
528 3300011119 Ga0105246_10002775 Ga0105246_100027755 108
529 3300011119 Ga0105246_10047986 Ga0105246_100479863 108
530 3300011119 Ga0105246_10324541 Ga0105246_103245413 108
531 3300011119 Ga0105246_12472437 Ga0105246_124724371 108
532 3300012515 Ga0157338_1009066 Ga0157338_10090661 108
533 3300013059 Ga0154012_129348 Ga0154012_1293481 108
534 3300013100 Ga0157373_10173743 Ga0157373_101737432 108
535 3300013100 Ga0157373_10188314 Ga0157373_101883142 108
536 3300013102 Ga0157371_10041110 Ga0157371_100411102 108
537 3300013102 Ga0157371_10222638 Ga0157371_102226381 108
538 3300013104 Ga0157370_10016638 Ga0157370_100166382 108
539 3300013104 Ga0157370_10037442 Ga0157370_100374422 108
540 3300013104 Ga0157370_11700019 Ga0157370_117000191 108
541 3300013105 Ga0157369_10065102 Ga0157369_100651024 108
542 3300013105 Ga0157369_10391996 Ga0157369_103919962 108
543 3300013296 Ga0157374_10008470 Ga0157374_100084705 108
544 3300013296 Ga0157374_10045677 Ga0157374_100456773 108
545 3300013297 Ga0157378_11319992 Ga0157378_113199922 108
546 3300013306 Ga0163162_10080192 Ga0163162_100801923 108
547 3300013306 Ga0163162_10624267 Ga0163162_106242671 108
548 3300013307 Ga0157372_10009917 Ga0157372_100099174 108
549 3300013307 Ga0157372_10038352 Ga0157372_100383524 108
550 3300013308 Ga0157375_10067993 Ga0157375_100679933 108
551 3300013308 Ga0157375_10106574 Ga0157375_101065744 108
552 3300013308 Ga0157375_10163382 Ga0157375_101633823 108
553 3300014325 Ga0163163_10021986 Ga0163163_100219864 108
554 3300014325 Ga0163163_11038923 Ga0163163_110389231 108
555 3300014326 Ga0157380_10023685 Ga0157380_100236854 108
556 3300014497 Ga0182008_10103657 Ga0182008_101036572 108
557 3300014745 Ga0157377_10007324 Ga0157377_100073243 108
558 3300014745 Ga0157377_10146494 Ga0157377_101464942 108
559 3300014968 Ga0157379_10053099 Ga0157379_100530995 108
560 3300014968 Ga0157379_10084610 Ga0157379_100846103 108
561 3300014968 Ga0157379_11691776 Ga0157379_116917762 108
562 3300014969 Ga0157376_10088133 Ga0157376_100881332 108
563 3300014969 Ga0157376_12298095 Ga0157376_122980951 108
564 3300017792 Ga0163161_10033855 Ga0163161_100338552 108
565 3300020069 Ga0197907_10461931 Ga0197907_104619313 108
566 3300020069 Ga0197907_11215366 Ga0197907_112153661 108
567 3300020069 Ga0197907_11476430 Ga0197907_114764301 108
568 3300020070 Ga0206356_10891290 Ga0206356_108912902 108
569 3300020070 Ga0206356_11707506 Ga0206356_117075062 108
570 3300020070 Ga0206356_11857247 Ga0206356_118572472 108
571 3300020075 Ga0206349_1289577 Ga0206349_12895772 108
572 3300020075 Ga0206349_1823967 Ga0206349_18239671 108
573 3300020076 Ga0206355_1007316 Ga0206355_10073162 108
574 3300020076 Ga0206355_1054578 Ga0206355_10545782 108
575 3300020076 Ga0206355_1099384 Ga0206355_10993842 108
576 3300020076 Ga0206355_1318107 Ga0206355_13181071 108
577 3300020076 Ga0206355_1474009 Ga0206355_14740092 108
578 3300020076 Ga0206355_1554658 Ga0206355_15546582 108
579 3300020077 Ga0206351_10077041 Ga0206351_100770412 108
580 3300020077 Ga0206351_10606993 Ga0206351_106069931 108
581 3300020078 Ga0206352_10212823 Ga0206352_102128232 108
582 3300020078 Ga0206352_10315045 Ga0206352_103150451 108
583 3300020080 Ga0206350_10506608 Ga0206350_105066081 108
584 3300020080 Ga0206350_10909644 Ga0206350_109096442 108
585 3300020080 Ga0206350_11030234 Ga0206350_110302341 108
586 3300020080 Ga0206350_11551424 Ga0206350_115514241 108
587 3300020081 Ga0206354_10018836 Ga0206354_100188361 108
588 3300020081 Ga0206354_10341810 Ga0206354_103418102 108
589 3300020081 Ga0206354_10445232 Ga0206354_104452321 108
590 3300020081 Ga0206354_11320400 Ga0206354_113204002 108
591 3300020082 Ga0206353_10174093 Ga0206353_101740931 108
592 3300020082 Ga0206353_10773459 Ga0206353_107734591 108
593 3300020082 Ga0206353_11435619 Ga0206353_114356192 108
594 3300020082 Ga0206353_11848817 Ga0206353_118488171 108
595 3300020610 Ga0154015_1066299 Ga0154015_10662991 108
596 3300020610 Ga0154015_1245520 Ga0154015_12455201 108
597 3300020610 Ga0154015_1299450 Ga0154015_12994502 108
598 3300022467 Ga0224712_10004796 Ga0224712_100047964 108
599 3300022467 Ga0224712_10058367 Ga0224712_100583672 108
600 3300022467 Ga0224712_10532127 Ga0224712_105321271 108
601 3300023309 Ga0256744_117491 Ga0256744_1174911 108
602 3300025321 Ga0207656_10110159 Ga0207656_101101592 108
603 3300025321 Ga0207656_10122939 Ga0207656_101229392 108
604 3300025321 Ga0207656_10126403 Ga0207656_101264032 108
605 3300025885 Ga0207653_10006947 Ga0207653_100069472 108
606 3300025885 Ga0207653_10050738 Ga0207653_100507382 108
607 3300025898 Ga0207692_10016718 Ga0207692_100167183 108
608 3300025898 Ga0207692_10148749 Ga0207692_101487492 108
609 3300025899 Ga0207642_10639821 Ga0207642_106398211 108
610 3300025900 Ga0207710_10344834 Ga0207710_103448341 108
611 3300025901 Ga0207688_10000847 Ga0207688_100008474 108
612 3300025901 Ga0207688_10019002 Ga0207688_100190023 108
613 3300025903 Ga0207680_10054816 Ga0207680_100548163 108
614 3300025903 Ga0207680_10469572 Ga0207680_104695721 108
615 3300025903 Ga0207680_10765138 Ga0207680_107651381 108
616 3300025904 Ga0207647_10015966 Ga0207647_100159664 108
617 3300025904 Ga0207647_10322205 Ga0207647_103222052 108
618 3300025905 Ga0207685_10855408 Ga0207685_108554081 108
619 3300025906 Ga0207699_10310625 Ga0207699_103106252 108
620 3300025907 Ga0207645_10716591 Ga0207645_107165912 108
621 3300025908 Ga0207643_10000582 Ga0207643_100005826 108
622 3300025908 Ga0207643_10239468 Ga0207643_102394682 108
623 3300025908 Ga0207643_10392195 Ga0207643_103921952 108
624 3300025909 Ga0207705_10043443 Ga0207705_100434433 108
625 3300025909 Ga0207705_10101255 Ga0207705_101012552 108
626 3300025911 Ga0207654_10026094 Ga0207654_100260942 108
627 3300025912 Ga0207707_10012852 Ga0207707_100128522 108
628 3300025912 Ga0207707_10151950 Ga0207707_101519502 108
629 3300025914 Ga0207671_10068903 Ga0207671_100689033 108
630 3300025914 Ga0207671_10117280 Ga0207671_101172802 108
631 3300025915 Ga0207693_10026789 Ga0207693_100267892 108
632 3300025915 Ga0207693_10034105 Ga0207693_100341054 108
633 3300025916 Ga0207663_10033424 Ga0207663_100334243 108
634 3300025916 Ga0207663_10045677 Ga0207663_100456773 108
635 3300025917 Ga0207660_10042353 Ga0207660_100423533 108
636 3300025917 Ga0207660_10645661 Ga0207660_106456611 108
637 3300025918 Ga0207662_10012234 Ga0207662_100122343 108
638 3300025919 Ga0207657_10012967 Ga0207657_100129676 108
639 3300025919 Ga0207657_10145428 Ga0207657_101454282 108
640 3300025919 Ga0207657_10650164 Ga0207657_106501641 108
641 3300025920 Ga0207649_10003295 Ga0207649_100032958 108
642 3300025920 Ga0207649_11384248 Ga0207649_113842481 108
643 3300025921 Ga0207652_10007129 Ga0207652_100071297 108
644 3300025921 Ga0207652_10305194 Ga0207652_103051942 108
645 3300025923 Ga0207681_11320032 Ga0207681_113200321 108
646 3300025924 Ga0207694_10227319 Ga0207694_102273193 108
647 3300025924 Ga0207694_10694231 Ga0207694_106942312 108
648 3300025925 Ga0207650_10011533 Ga0207650_100115333 108
649 3300025925 Ga0207650_10843622 Ga0207650_108436221 108
650 3300025925 Ga0207650_11090608 Ga0207650_110906082 108
651 3300025926 Ga0207659_10016055 Ga0207659_100160555 108
652 3300025927 Ga0207687_10011420 Ga0207687_100114204 108
653 3300025927 Ga0207687_10658706 Ga0207687_106587062 108
654 3300025929 Ga0207664_10098201 Ga0207664_100982012 108
655 3300025929 Ga0207664_10130702 Ga0207664_101307022 108
656 3300025931 Ga0207644_10001024 Ga0207644_1000102414 108
657 3300025931 Ga0207644_10009147 Ga0207644_100091473 108
658 3300025931 Ga0207644_11201350 Ga0207644_112013502 108
659 3300025931 Ga0207644_11211165 Ga0207644_112111651 108
660 3300025932 Ga0207690_10102900 Ga0207690_101029002 108
661 3300025933 Ga0207706_10045030 Ga0207706_100450303 108
662 3300025933 Ga0207706_10314486 Ga0207706_103144862 108
663 3300025934 Ga0207686_10424958 Ga0207686_104249582 108
664 3300025934 Ga0207686_10581170 Ga0207686_105811701 108
665 3300025936 Ga0207670_10113901 Ga0207670_101139012 108
666 3300025936 Ga0207670_10119726 Ga0207670_101197262 108
667 3300025936 Ga0207670_10143460 Ga0207670_101434603 108
668 3300025937 Ga0207669_10033093 Ga0207669_100330933 108
669 3300025938 Ga0207704_10113080 Ga0207704_101130801 108
670 3300025938 Ga0207704_10334539 Ga0207704_103345392 108
671 3300025939 Ga0207665_10002925 Ga0207665_100029252 108
672 3300025940 Ga0207691_10107559 Ga0207691_101075593 108
673 3300025940 Ga0207691_10184939 Ga0207691_101849392 108
674 3300025940 Ga0207691_10216932 Ga0207691_102169322 108
675 3300025941 Ga0207711_10100715 Ga0207711_101007152 108
676 3300025941 Ga0207711_10233446 Ga0207711_102334462 108
677 3300025942 Ga0207689_10002561 Ga0207689_1000256117 108
678 3300025942 Ga0207689_10319474 Ga0207689_103194742 108
679 3300025942 Ga0207689_10328277 Ga0207689_103282772 108
680 3300025942 Ga0207689_10359069 Ga0207689_103590692 108
681 3300025944 Ga0207661_10419455 Ga0207661_104194552 108
682 3300025944 Ga0207661_10949912 Ga0207661_109499122 108
683 3300025945 Ga0207679_10016058 Ga0207679_100160583 108
684 3300025945 Ga0207679_11867194 Ga0207679_118671942 108
685 3300025949 Ga0207667_10270778 Ga0207667_102707782 108
686 3300025960 Ga0207651_10320273 Ga0207651_103202732 108
687 3300025961 Ga0207712_10070020 Ga0207712_100700203 108
688 3300025961 Ga0207712_10225610 Ga0207712_102256102 108
689 3300025961 Ga0207712_10944564 Ga0207712_109445642 108
690 3300025972 Ga0207668_10017424 Ga0207668_100174242 108
691 3300025972 Ga0207668_10032912 Ga0207668_100329123 108
692 3300025981 Ga0207640_10216149 Ga0207640_102161492 108
693 3300025986 Ga0207658_10203067 Ga0207658_102030672 108
694 3300025986 Ga0207658_10768963 Ga0207658_107689632 108
695 3300026023 Ga0207677_10031358 Ga0207677_100313582 108
696 3300026023 Ga0207677_10058031 Ga0207677_100580313 108
697 3300026035 Ga0207703_10025397 Ga0207703_100253974 108
698 3300026035 Ga0207703_10087590 Ga0207703_100875903 108
699 3300026035 Ga0207703_10296149 Ga0207703_102961492 108
700 3300026041 Ga0207639_10105316 Ga0207639_101053163 108
701 3300026041 Ga0207639_10341620 Ga0207639_103416202 108
702 3300026067 Ga0207678_10001737 Ga0207678_100017378 108
703 3300026067 Ga0207678_10171662 Ga0207678_101716622 108
704 3300026075 Ga0207708_10082896 Ga0207708_100828963 108
705 3300026075 Ga0207708_10197366 Ga0207708_101973662 108
706 3300026078 Ga0207702_10001548 Ga0207702_100015485 108
707 3300026078 Ga0207702_10010112 Ga0207702_100101121 108
708 3300026078 Ga0207702_10180275 Ga0207702_101802753 108
709 3300026078 Ga0207702_10344233 Ga0207702_103442331 108
710 3300026088 Ga0207641_10009255 Ga0207641_100092554 108
711 3300026088 Ga0207641_10179450 Ga0207641_101794502 108
712 3300026088 Ga0207641_10261108 Ga0207641_102611082 108
713 3300026088 Ga0207641_11121351 Ga0207641_111213511 108
714 3300026089 Ga0207648_10209082 Ga0207648_102090822 108
715 3300026089 Ga0207648_10557389 Ga0207648_105573892 108
716 3300026095 Ga0207676_10010083 Ga0207676_100100835 108
717 3300026095 Ga0207676_10355087 Ga0207676_103550872 108
718 3300026116 Ga0207674_10140330 Ga0207674_101403303 108
719 3300026116 Ga0207674_10203372 Ga0207674_102033722 108
720 3300026116 Ga0207674_10239100 Ga0207674_102391002 108
721 3300026118 Ga0207675_100006128 Ga0207675_1000061287 108
722 3300026118 Ga0207675_100356105 Ga0207675_1003561053 108
723 3300026118 Ga0207675_101575080 Ga0207675_1015750801 108
724 3300026121 Ga0207683_10000940 Ga0207683_1000094017 108
725 3300026121 Ga0207683_10002124 Ga0207683_100021248 108
726 3300026121 Ga0207683_10456884 Ga0207683_104568842 108
727 3300026121 Ga0207683_10596788 Ga0207683_105967882 108
728 3300026121 Ga0207683_11181233 Ga0207683_111812331 108
729 3300026142 Ga0207698_10027133 Ga0207698_100271333 108
730 3300026142 Ga0207698_10638917 Ga0207698_106389172 108
731 3300026142 Ga0207698_12603925 Ga0207698_126039251 108
732 3300027907 Ga0207428_10037394 Ga0207428_100373942 108
733 3300028379 Ga0268266_10019784 Ga0268266_100197845 108
734 3300028379 Ga0268266_10086549 Ga0268266_100865493 108
735 3300028379 Ga0268266_10092904 Ga0268266_100929043 108
736 3300028380 Ga0268265_10148279 Ga0268265_101482792 108
737 3300028381 Ga0268264_10054614 Ga0268264_100546142 108
738 3300028381 Ga0268264_10078028 Ga0268264_100780282 108
739 3300028381 Ga0268264_10393393 Ga0268264_103933932 108
740 3300029277 Ga0311001_1037751 Ga0311001_10377511 108
741 3300030836 Ga0265767_111138 Ga0265767_1111382 108
742 3300030863 Ga0265766_1019552 Ga0265766_10195521 108
743 3300031852 Ga0307410_10771735 Ga0307410_107717351 108
744 3300034817 Ga0373948_0048350 Ga0373948_0048350_565_894 108
745 3300034820 Ga0373959_0108367 Ga0373959_0108367_33_362 108
746 3300035085 Ga0373929_0064471 Ga0373929_0064471_55_384 108
747 3300035088 Ga0373940_0034752 Ga0373940_0034752_140_469 108
748 3300035091 Ga0373951_0039318 Ga0373951_0039318_510_839 108
749 3300035115 Ga0373941_0365865 Ga0373941_0365865_230_559 108
750 3300035121 Ga0373960_0010185 Ga0373960_0010185_672_1001 108
751 3300035121 Ga0373960_0185603 Ga0373960_0185603_239_565 108
752 3300035207 Ga0373942_0168913 Ga0373942_0168913_33_362 108
753 3300035241 Ga0373961_0369336 Ga0373961_0369336_164_493 108
754 3300035242 Ga0373962_0011800 Ga0373962_0011800_649_978 108
755 3300035691 Ga0373931_0047821 Ga0373931_0047821_894_1223 108
756 3300037068 Ga0373925_1156669 Ga0373925_1156669_147_476 108
757 3300037471 Ga0395905_0971002 Ga0395905_0971002_132_458 108
758 3300041509 Ga0451843_0783312 Ga0451843_0783312_157_486 108
759 3300042157 Ga0439458_0004621 Ga0439458_0004621_2523_2849 108
760 3300042438 Ga0439459_0017849 Ga0439459_0017849_34_387 108
761 3300042993 Ga0439440_0113579 Ga0439440_0113579_212_538 108
762 3300044656 Ga0466969_0004202 Ga0466969_0004202_3270_3599 108
763 3300044656 Ga0466969_0037052 Ga0466969_0037052_1572_1901 108
764 3300044684 Ga0466966_0030559 Ga0466966_0030559_433_762 108
765 3300044684 Ga0466966_0046207 Ga0466966_0046207_699_1028 108
766 3300044693 Ga0466961_0043893 Ga0466961_0043893_1533_1862 108
767 3300044693 Ga0466961_0339478 Ga0466961_0339478_319_648 108
768 3300044694 Ga0466963_0479865 Ga0466963_0479865_492_821 108
769 3300044719 Ga0466971_0053539 Ga0466971_0053539_1192_1521 108
770 3300044735 Ga0466968_0131100 Ga0466968_0131100_97_426 108
771 3300044765 Ga0466970_0341284 Ga0466970_0341284_202_531 108
772 3300045049 Ga0466959_0012505 Ga0466959_0012505_213_542 108
773 3300045049 Ga0466959_0116797 Ga0466959_0116797_561_890 108
774 3300045976 Ga0466967_0112603 Ga0466967_0112603_940_1269 108
775 3300045976 Ga0466967_0393344 Ga0466967_0393344_423_761 108
776 3300046515 Ga0495620_0105891 Ga0495620_0105891_742_1071 108
777 3300046648 Ga0495611_0248816 Ga0495611_0248816_17_346 108
778 3300046794 Ga0495589_0402283 Ga0495589_0402283_10_339 108
779 3300047321 Ga0495676_0178638 Ga0495676_0178638_1045_1374 108
780 3300048903 Ga0496100_0257298 Ga0496100_0257298_497_826 108
781 3300048904 Ga0496101_0068289 Ga0496101_0068289_1680_2009 108
782 3300048904 Ga0496101_0258003 Ga0496101_0258003_975_1301 108
783 3300048905 Ga0496102_0023910 Ga0496102_0023910_1342_1668 108
784 3300048906 Ga0496103_0074920 Ga0496103_0074920_18_347 108
785 3300048906 Ga0496103_0794467 Ga0496103_0794467_168_506 108
786 3300048907 Ga0496104_0011142 Ga0496104_0011142_6037_6366 108
787 3300048907 Ga0496104_0027560 Ga0496104_0027560_3161_3487 108
788 3300048908 Ga0496105_0007851 Ga0496105_0007851_467_793 108
789 3300048908 Ga0496105_0068646 Ga0496105_0068646_337_666 108
790 3300048908 Ga0496105_1078922 Ga0496105_1078922_92_430 108
791 3300048909 Ga0496106_0008819 Ga0496106_0008819_1996_2322 108
792 3300048909 Ga0496106_0033788 Ga0496106_0033788_2079_2408 108
793 3300048910 Ga0496107_0008557 Ga0496107_0008557_4069_4395 108
794 3300048910 Ga0496107_0039010 Ga0496107_0039010_2034_2363 108
795 3300048911 Ga0496108_0005089 Ga0496108_0005089_1998_2327 108
796 3300048911 Ga0496108_0038342 Ga0496108_0038342_3033_3359 108
797 3300048911 Ga0496108_0044842 Ga0496108_0044842_1398_1727 108
798 3300048912 Ga0496109_0042670 Ga0496109_0042670_949_1278 108
799 3300048912 Ga0496109_0047288 Ga0496109_0047288_973_1302 108
800 3300048912 Ga0496109_0124834 Ga0496109_0124834_775_1101 108
801 3300048913 Ga0496110_0001739 Ga0496110_0001739_7478_7804 108
802 3300048913 Ga0496110_0068962 Ga0496110_0068962_1247_1576 108
803 3300048913 Ga0496110_0842731 Ga0496110_0842731_260_589 108
804 3300048914 Ga0496111_0001057 Ga0496111_0001057_6852_7178 108
805 3300048914 Ga0496111_0005464 Ga0496111_0005464_203_532 108
806 3300048915 Ga0496112_0059092 Ga0496112_0059092_1997_2323 108
807 3300048915 Ga0496112_0060911 Ga0496112_0060911_2079_2408 108
808 3300048916 Ga0496113_0007515 Ga0496113_0007515_2793_3122 108
809 3300048916 Ga0496113_0051622 Ga0496113_0051622_595_921 108
810 3300048917 Ga0496114_0005871 Ga0496114_0005871_7019_7348 108
811 3300048917 Ga0496114_1093625 Ga0496114_1093625_328_654 108
812 3300048918 Ga0496115_0013815 Ga0496115_0013815_1707_2036 108
813 3300048918 Ga0496115_0169409 Ga0496115_0169409_1020_1346 108
814 3300049130 Ga0501310_040179 Ga0501310_040179_251_580 108
815 3300049161 Ga0501305_016824 Ga0501305_016824_466_795 108
816 3300049531 Ga0501315_028870 Ga0501315_028870_100_429 108
817 3300049533 Ga0501317_006203 Ga0501317_006203_112_441 108
818 3300049533 Ga0501317_012962 Ga0501317_012962_251_580 108
819 3300049533 Ga0501317_024465 Ga0501317_024465_500_829 108
820 3300049534 Ga0501318_003777 Ga0501318_003777_47_376 108
821 3300049534 Ga0501318_016336 Ga0501318_016336_316_645 108
822 3300049534 Ga0501318_024719 Ga0501318_024719_11_340 108
823 3300049537 Ga0501321_003257 Ga0501321_003257_618_947 108
824 3300050507 nmdc:mga05p37_190695_c1 nmdc:mga05p37_190695_c1_1250_1576 108
825 3300050508 nmdc:mga09592_525200_c1 nmdc:mga09592_525200_c1_108_434 108
826 3300050510 nmdc:mga06r32_130467_c2 nmdc:mga06r32_130467_c2_116_442 108
827 3300050510 nmdc:mga06r32_697157_c1 nmdc:mga06r32_697157_c1_11_337 108
828 3300050511 nmdc:mga08y16_302547_c1 nmdc:mga08y16_302547_c1_1309_1638 108
829 3300050511 nmdc:mga08y16_9435_c1 nmdc:mga08y16_9435_c1_2949_3275 108
830 3300050512 nmdc:mga0n895_1378459_c1 nmdc:mga0n895_1378459_c1_184_513 108
831 3300050512 nmdc:mga0n895_162137_c1 nmdc:mga0n895_162137_c1_1136_1465 108
832 3300050512 nmdc:mga0n895_2047902_c1 nmdc:mga0n895_2047902_c1_140_469 108
833 3300050512 nmdc:mga0n895_40350_c1 nmdc:mga0n895_40350_c1_3160_3486 108
834 3300050513 nmdc:mga0rr50_118112_c1 nmdc:mga0rr50_118112_c1_1720_2049 108
835 3300050513 nmdc:mga0rr50_36381_c1 nmdc:mga0rr50_36381_c1_2076_2402 108
836 3300050514 nmdc:mga08x19_453598_c1 nmdc:mga08x19_453598_c1_369_698 108
837 3300050514 nmdc:mga08x19_4888_c1 nmdc:mga08x19_4888_c1_1526_1852 108
838 3300050515 nmdc:mga0a205_12931_c1 nmdc:mga0a205_12931_c1_3775_4101 108
839 3300050515 nmdc:mga0a205_1353402_c1 nmdc:mga0a205_1353402_c1_123_452 108
840 3300059492 Ga0587073_0105335 Ga0587073_0105335_314_697 108
841 3300059492 Ga0587073_0169057 Ga0587073_0169057_278_604 108
842 3300059508 Ga0587088_188038 Ga0587088_188038_23_349 108
843 3300059625 Ga0587113_056077 Ga0587113_056077_151_477 108
844 3300061719 Ga0466962_0065534 Ga0466962_0065534_226_555 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

3

104

0.96

PF13192

Thioredoxin_3

Thioredoxin domain

23

104

0.84

PF14595

Thioredoxin_9

Thioredoxin

4

102

0.82

PF13098

Thioredoxin_2

Thioredoxin-like domain

16

102

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9984 3 105
4pob-assembly1.cif.gz_B crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus 0.9965 4 107
6esx-assembly1.cif.gz_A caulobacter crescentus trx1 0.993 4 105
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.9902 28 101
4ulx-assembly1.cif.gz_A crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. 0.9887 4 105
ID Description Score Start End Superfamily
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9902 28 101 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9887 4 105 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9701 32 105 3.40.30.10
3hz4B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9679 4 105 3.40.30.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9664 4 107 3.40.30.10

Feature Viewer

pLDDT pTM Quality
96.36 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map