F483231
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 844 | 390 | 820 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0218260|Ga0500568_0218260_37_357 |
| Length | 106 |
| Sequence | MGSTTPVTDDTFTAEVLNSDKPVLVDFWAEWCGPCKMVGPVLEEIAAEHDSIRIVKLNIDENPEIARKYGIMSIPTMSVFVGGEVAKSIVGAKPKAALLRDLADFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 3 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 4 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 5 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 6 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 7 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 8 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 9 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 10 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 11 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 12 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 13 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 14 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 15 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 16 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 17 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 18 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 19 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 20 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 21 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 22 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 23 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 26 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 27 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 35 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 36 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 38 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 142 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 143 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 164 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 172 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 243 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 246 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 249 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 250 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 251 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 252 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 253 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 254 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 260 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 262 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 272 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 276 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 285 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 286 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 287 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 288 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 289 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 290 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 291 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 292 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 293 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 294 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 295 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 296 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 299 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 300 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 301 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 302 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 303 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 350 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 379 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 387 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 388 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 389 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 390 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.65 |
| Metatranscriptomes | 13.51 |
| Isolates | 2.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 2.01 |
| Rhizoplane | 8.65 |
| Rhizosphere | 86.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1021311 | 3300001915 | Bacteria | 1012 |
| 2 | JGI24752J21851_1006979 | 3300001976 | Bacteria | 1476 |
| 3 | JGI24746J21847_1014990 | 3300001977 | Bacteria | 1116 |
| 4 | JGI24740J21852_10092970 | 3300001979 | Bacteria | 776 |
| 5 | JGI24740J21852_10168524 | 3300001979 | Bacteria | 543 |
| 6 | JGI24033J26618_1030347 | 3300002155 | Bacteria | 725 |
| 7 | JGI24751J29686_10009980 | 3300002459 | Bacteria | 1955 |
| 8 | Ga0006778J45830_1015158 | 3300003162 | Bacteria | 1288 |
| 9 | Ga0006777J48905_1093645 | 3300003308 | Bacteria | 609 |
| 10 | Ga0007417J51691_1093063 | 3300003544 | Bacteria | 506 |
| 11 | Ga0007416J51690_1121851 | 3300003577 | Bacteria | 770 |
| 12 | Ga0007429J51699_1045772 | 3300003579 | Bacteria | 523 |
| 13 | Ga0032354_1024214 | 3300003693 | Bacteria | 1584 |
| 14 | Ga0032354_1080657 | 3300003693 | Bacteria | 853 |
| 15 | Ga0058858_1430783 | 3300004785 | Bacteria | 577 |
| 16 | Ga0058858_1435338 | 3300004785 | Bacteria | 1101 |
| 17 | Ga0058859_11831860 | 3300004798 | Bacteria | 736 |
| 18 | Ga0058863_11752507 | 3300004799 | Bacteria | 517 |
| 19 | Ga0058863_11795119 | 3300004799 | Bacteria | 577 |
| 20 | Ga0058863_11969637 | 3300004799 | Bacteria | 664 |
| 21 | Ga0058861_10038173 | 3300004800 | Bacteria | 719 |
| 22 | Ga0058861_10053673 | 3300004800 | Bacteria | 1547 |
| 23 | Ga0058860_12223939 | 3300004801 | Bacteria | 688 |
| 24 | Ga0058862_10004410 | 3300004803 | Bacteria | 864 |
| 25 | Ga0058862_10052241 | 3300004803 | Bacteria | 963 |
| 26 | Ga0058862_12662569 | 3300004803 | Bacteria | 626 |
| 27 | Ga0058862_12834696 | 3300004803 | Bacteria | 684 |
| 28 | Ga0070658_10140252 | 3300005327 | Bacteria | 2019 |
| 29 | Ga0070658_10160401 | 3300005327 | Bacteria | 1886 |
| 30 | Ga0070676_10453536 | 3300005328 | Bacteria | 902 |
| 31 | Ga0070683_100709508 | 3300005329 | Bacteria | 963 |
| 32 | Ga0070683_100854729 | 3300005329 | Bacteria | 872 |
| 33 | Ga0070690_100061856 | 3300005330 | Bacteria | 2413 |
| 34 | Ga0070690_100088821 | 3300005330 | Bacteria | 2032 |
| 35 | Ga0070670_100013557 | 3300005331 | Bacteria | 6986 |
| 36 | Ga0070670_100259383 | 3300005331 | Bacteria | 1515 |
| 37 | Ga0068869_100004413 | 3300005334 | Bacteria | 8744 |
| 38 | Ga0068869_100276573 | 3300005334 | Bacteria | 1349 |
| 39 | Ga0070666_10012116 | 3300005335 | Bacteria | 5430 |
| 40 | Ga0070666_10081633 | 3300005335 | Bacteria | 2210 |
| 41 | Ga0070666_10928554 | 3300005335 | Bacteria | 644 |
| 42 | Ga0070680_100016246 | 3300005336 | Bacteria | 5855 |
| 43 | Ga0070680_100242630 | 3300005336 | Bacteria | 1523 |
| 44 | Ga0070682_100003294 | 3300005337 | Bacteria | 8953 |
| 45 | Ga0070682_100008216 | 3300005337 | Bacteria | 5884 |
| 46 | Ga0070682_100037889 | 3300005337 | Bacteria | 2954 |
| 47 | Ga0070682_100194688 | 3300005337 | Bacteria | 1426 |
| 48 | Ga0070682_100729476 | 3300005337 | Bacteria | 798 |
| 49 | Ga0070682_100766130 | 3300005337 | Bacteria | 781 |
| 50 | Ga0070682_101518458 | 3300005337 | Bacteria | 577 |
| 51 | Ga0068868_100008441 | 3300005338 | Bacteria | 7376 |
| 52 | Ga0068868_100155395 | 3300005338 | Bacteria | 1886 |
| 53 | Ga0070660_100006740 | 3300005339 | Bacteria | 7967 |
| 54 | Ga0070689_100068893 | 3300005340 | Bacteria | 2760 |
| 55 | Ga0070689_100128592 | 3300005340 | Bacteria | 2030 |
| 56 | Ga0070689_100211674 | 3300005340 | Bacteria | 1587 |
| 57 | Ga0070691_10008108 | 3300005341 | Bacteria | 4809 |
| 58 | Ga0070691_10194959 | 3300005341 | Bacteria | 1061 |
| 59 | Ga0070687_100065344 | 3300005343 | Bacteria | 1935 |
| 60 | Ga0070687_100730420 | 3300005343 | Bacteria | 695 |
| 61 | Ga0070661_100145236 | 3300005344 | Bacteria | 1790 |
| 62 | Ga0070661_101134917 | 3300005344 | Bacteria | 652 |
| 63 | Ga0070661_101364047 | 3300005344 | Bacteria | 596 |
| 64 | Ga0070692_10002095 | 3300005345 | Bacteria | 7614 |
| 65 | Ga0070692_10022846 | 3300005345 | Bacteria | 3059 |
| 66 | Ga0070692_10324671 | 3300005345 | Bacteria | 948 |
| 67 | Ga0070668_100587720 | 3300005347 | Bacteria | 973 |
| 68 | Ga0070668_101034674 | 3300005347 | Bacteria | 739 |
| 69 | Ga0070675_100015059 | 3300005354 | Bacteria | 6108 |
| 70 | Ga0070671_100006414 | 3300005355 | Bacteria | 9398 |
| 71 | Ga0070671_100008056 | 3300005355 | Bacteria | 8435 |
| 72 | Ga0070671_100034922 | 3300005355 | Bacteria | 4164 |
| 73 | Ga0070671_101538629 | 3300005355 | Bacteria | 589 |
| 74 | Ga0070674_100070094 | 3300005356 | Bacteria | 2476 |
| 75 | Ga0070674_100187609 | 3300005356 | Bacteria | 1588 |
| 76 | Ga0070674_101514688 | 3300005356 | Bacteria | 603 |
| 77 | Ga0070673_100031198 | 3300005364 | Bacteria | 3997 |
| 78 | Ga0070673_100178389 | 3300005364 | Bacteria | 1817 |
| 79 | Ga0070688_100545011 | 3300005365 | Bacteria | 881 |
| 80 | Ga0070659_100052882 | 3300005366 | Bacteria | 3195 |
| 81 | Ga0070659_100291745 | 3300005366 | Bacteria | 1358 |
| 82 | Ga0070659_101341381 | 3300005366 | Bacteria | 635 |
| 83 | Ga0070667_100029794 | 3300005367 | Bacteria | 4550 |
| 84 | Ga0070667_100891019 | 3300005367 | Bacteria | 828 |
| 85 | Ga0070667_101372630 | 3300005367 | Bacteria | 663 |
| 86 | Ga0070667_101442397 | 3300005367 | Bacteria | 646 |
| 87 | Ga0070703_10017715 | 3300005406 | Bacteria | 2053 |
| 88 | Ga0070703_10405124 | 3300005406 | Bacteria | 595 |
| 89 | Ga0070709_10019732 | 3300005434 | Bacteria | 3902 |
| 90 | Ga0070709_10135399 | 3300005434 | Bacteria | 1687 |
| 91 | Ga0070714_100111396 | 3300005435 | Bacteria | 2424 |
| 92 | Ga0070713_100141291 | 3300005436 | Bacteria | 2133 |
| 93 | Ga0070713_100269258 | 3300005436 | Bacteria | 1559 |
| 94 | Ga0070710_10469865 | 3300005437 | Bacteria | 856 |
| 95 | Ga0070701_10023654 | 3300005438 | Bacteria | 2963 |
| 96 | Ga0070701_10052081 | 3300005438 | Bacteria | 2125 |
| 97 | Ga0070711_100009279 | 3300005439 | Bacteria | 6051 |
| 98 | Ga0070711_100012490 | 3300005439 | Bacteria | 5308 |
| 99 | Ga0070705_100020780 | 3300005440 | Bacteria | 3481 |
| 100 | Ga0070705_100567736 | 3300005440 | Bacteria | 873 |
| 101 | Ga0070700_100004331 | 3300005441 | Bacteria | 7405 |
| 102 | Ga0070700_100006526 | 3300005441 | Bacteria | 6240 |
| 103 | Ga0070694_100023644 | 3300005444 | Bacteria | 3955 |
| 104 | Ga0070663_100047212 | 3300005455 | Bacteria | 3050 |
| 105 | Ga0070663_100156191 | 3300005455 | Bacteria | 1753 |
| 106 | Ga0070663_100782477 | 3300005455 | Bacteria | 817 |
| 107 | Ga0070678_100021273 | 3300005456 | Bacteria | 4274 |
| 108 | Ga0070678_100062656 | 3300005456 | Bacteria | 2747 |
| 109 | Ga0070678_100445707 | 3300005456 | Bacteria | 1133 |
| 110 | Ga0070678_100615579 | 3300005456 | Bacteria | 971 |
| 111 | Ga0070678_100766593 | 3300005456 | Bacteria | 874 |
| 112 | Ga0070678_100804334 | 3300005456 | Bacteria | 854 |
| 113 | Ga0070662_100134006 | 3300005457 | Bacteria | 1914 |
| 114 | Ga0070662_100651061 | 3300005457 | Bacteria | 889 |
| 115 | Ga0070681_10316703 | 3300005458 | Bacteria | 1469 |
| 116 | Ga0068867_100945659 | 3300005459 | Bacteria | 778 |
| 117 | Ga0070685_10028835 | 3300005466 | Bacteria | 3079 |
| 118 | Ga0070685_10092956 | 3300005466 | Bacteria | 1829 |
| 119 | Ga0070685_10142355 | 3300005466 | Bacteria | 1511 |
| 120 | Ga0070685_11277154 | 3300005466 | Bacteria | 560 |
| 121 | Ga0070685_11622873 | 3300005466 | Bacteria | 500 |
| 122 | Ga0070706_101740907 | 3300005467 | Bacteria | 567 |
| 123 | Ga0070679_100120169 | 3300005530 | Bacteria | 2612 |
| 124 | Ga0070679_100319214 | 3300005530 | Bacteria | 1503 |
| 125 | Ga0070679_101286186 | 3300005530 | Bacteria | 677 |
| 126 | Ga0070684_100237449 | 3300005535 | Bacteria | 1665 |
| 127 | Ga0070684_100519979 | 3300005535 | Bacteria | 1103 |
| 128 | Ga0070684_101882031 | 3300005535 | Bacteria | 565 |
| 129 | Ga0070697_101604653 | 3300005536 | Bacteria | 582 |
| 130 | Ga0068853_100042716 | 3300005539 | Bacteria | 3877 |
| 131 | Ga0068853_100372293 | 3300005539 | Bacteria | 1333 |
| 132 | Ga0068853_100462842 | 3300005539 | Bacteria | 1194 |
| 133 | Ga0070672_100034382 | 3300005543 | Bacteria | 3847 |
| 134 | Ga0070672_100319926 | 3300005543 | Bacteria | 1319 |
| 135 | Ga0070672_100649960 | 3300005543 | Bacteria | 921 |
| 136 | Ga0070672_101262994 | 3300005543 | Bacteria | 659 |
| 137 | Ga0070686_100062377 | 3300005544 | Bacteria | 2412 |
| 138 | Ga0070686_100188776 | 3300005544 | Bacteria | 1470 |
| 139 | Ga0070686_100353493 | 3300005544 | Bacteria | 1105 |
| 140 | Ga0070695_100196305 | 3300005545 | Bacteria | 1439 |
| 141 | Ga0070695_100242902 | 3300005545 | Bacteria | 1307 |
| 142 | Ga0070695_101323907 | 3300005545 | Bacteria | 596 |
| 143 | Ga0070696_100103425 | 3300005546 | Bacteria | 2044 |
| 144 | Ga0070693_100002461 | 3300005547 | Bacteria | 8532 |
| 145 | Ga0070693_100039609 | 3300005547 | Bacteria | 2640 |
| 146 | Ga0070665_100166349 | 3300005548 | Bacteria | 2207 |
| 147 | Ga0070665_100341833 | 3300005548 | Bacteria | 1501 |
| 148 | Ga0070665_100486710 | 3300005548 | Bacteria | 1245 |
| 149 | Ga0070665_101908014 | 3300005548 | Bacteria | 600 |
| 150 | Ga0070704_100144995 | 3300005549 | Bacteria | 1859 |
| 151 | Ga0068855_100020107 | 3300005563 | Bacteria | 8017 |
| 152 | Ga0070664_100024970 | 3300005564 | Bacteria | 4952 |
| 153 | Ga0070664_100033081 | 3300005564 | Bacteria | 4328 |
| 154 | Ga0070664_100479402 | 3300005564 | Bacteria | 1145 |
| 155 | Ga0070664_101473803 | 3300005564 | Bacteria | 644 |
| 156 | Ga0068857_100701137 | 3300005577 | Bacteria | 962 |
| 157 | Ga0068857_100919350 | 3300005577 | Bacteria | 839 |
| 158 | Ga0068854_100071782 | 3300005578 | Bacteria | 2533 |
| 159 | Ga0068854_100079579 | 3300005578 | Bacteria | 2416 |
| 160 | Ga0068854_100494698 | 3300005578 | Bacteria | 1029 |
| 161 | Ga0068856_100012332 | 3300005614 | Bacteria | 8276 |
| 162 | Ga0068856_100139606 | 3300005614 | Bacteria | 2430 |
| 163 | Ga0070702_100019496 | 3300005615 | Bacteria | 3539 |
| 164 | Ga0070702_100059763 | 3300005615 | Bacteria | 2213 |
| 165 | Ga0070702_101097327 | 3300005615 | Bacteria | 636 |
| 166 | Ga0068852_100053614 | 3300005616 | Bacteria | 3472 |
| 167 | Ga0068852_100082606 | 3300005616 | Bacteria | 2855 |
| 168 | Ga0068852_100236747 | 3300005616 | Bacteria | 1743 |
| 169 | Ga0068852_100766374 | 3300005616 | Bacteria | 978 |
| 170 | Ga0068852_102392668 | 3300005616 | Bacteria | 549 |
| 171 | Ga0068859_100019852 | 3300005617 | Bacteria | 6746 |
| 172 | Ga0068859_100038562 | 3300005617 | Bacteria | 4793 |
| 173 | Ga0068859_100431008 | 3300005617 | Bacteria | 1415 |
| 174 | Ga0068864_100005825 | 3300005618 | Bacteria | 10104 |
| 175 | Ga0068864_100018168 | 3300005618 | Bacteria | 5869 |
| 176 | Ga0068864_100103011 | 3300005618 | Bacteria | 2534 |
| 177 | Ga0068866_10246409 | 3300005718 | Bacteria | 1091 |
| 178 | Ga0068866_10578264 | 3300005718 | Bacteria | 755 |
| 179 | Ga0068866_11189946 | 3300005718 | Bacteria | 550 |
| 180 | Ga0068861_100034773 | 3300005719 | Bacteria | 3728 |
| 181 | Ga0068861_100788150 | 3300005719 | Bacteria | 891 |
| 182 | Ga0068861_102290756 | 3300005719 | Bacteria | 542 |
| 183 | Ga0068851_10027537 | 3300005834 | Bacteria | 2802 |
| 184 | Ga0068851_10248837 | 3300005834 | Bacteria | 1008 |
| 185 | Ga0068851_10284442 | 3300005834 | Bacteria | 947 |
| 186 | Ga0068870_10000950 | 3300005840 | Bacteria | 11375 |
| 187 | Ga0068870_10079331 | 3300005840 | Bacteria | 1810 |
| 188 | Ga0068863_100004915 | 3300005841 | Bacteria | 13171 |
| 189 | Ga0068863_100085578 | 3300005841 | Bacteria | 2987 |
| 190 | Ga0068863_101267343 | 3300005841 | Bacteria | 744 |
| 191 | Ga0068863_102012020 | 3300005841 | Bacteria | 588 |
| 192 | Ga0068858_100010914 | 3300005842 | Bacteria | 8586 |
| 193 | Ga0068858_100167228 | 3300005842 | Bacteria | 2073 |
| 194 | Ga0068858_100740014 | 3300005842 | Bacteria | 958 |
| 195 | Ga0068860_100044452 | 3300005843 | Bacteria | 4233 |
| 196 | Ga0068860_100068304 | 3300005843 | Bacteria | 3376 |
| 197 | Ga0068860_100106697 | 3300005843 | Bacteria | 2676 |
| 198 | Ga0068862_100120232 | 3300005844 | Bacteria | 2314 |
| 199 | Ga0068862_100679443 | 3300005844 | Bacteria | 996 |
| 200 | Ga0081540_1059500 | 3300005983 | Bacteria | 1834 |
| 201 | Ga0081540_1078675 | 3300005983 | Bacteria | 1493 |
| 202 | Ga0070717_10021268 | 3300006028 | Bacteria | 5111 |
| 203 | Ga0070717_10582937 | 3300006028 | Bacteria | 1014 |
| 204 | Ga0075432_10007031 | 3300006058 | Bacteria | 3835 |
| 205 | Ga0075432_10037334 | 3300006058 | Bacteria | 1691 |
| 206 | Ga0070715_10281814 | 3300006163 | Bacteria | 881 |
| 207 | Ga0070716_101175340 | 3300006173 | Bacteria | 615 |
| 208 | Ga0070712_100917676 | 3300006175 | Bacteria | 755 |
| 209 | Ga0070712_101763832 | 3300006175 | Bacteria | 542 |
| 210 | Ga0075427_10106155 | 3300006194 | Bacteria | 526 |
| 211 | Ga0097621_100022749 | 3300006237 | Bacteria | 4869 |
| 212 | Ga0097621_100025168 | 3300006237 | Bacteria | 4654 |
| 213 | Ga0068871_100031063 | 3300006358 | Bacteria | 4209 |
| 214 | Ga0068871_100076505 | 3300006358 | Bacteria | 2764 |
| 215 | Ga0068871_101670628 | 3300006358 | Bacteria | 604 |
| 216 | Ga0075428_100626913 | 3300006844 | Bacteria | 1148 |
| 217 | Ga0075431_100354326 | 3300006847 | Bacteria | 1475 |
| 218 | Ga0075433_10026668 | 3300006852 | Bacteria | 4896 |
| 219 | Ga0075433_10078608 | 3300006852 | Bacteria | 2907 |
| 220 | Ga0075434_100005189 | 3300006871 | Bacteria | 11827 |
| 221 | Ga0075434_100243413 | 3300006871 | Bacteria | 1818 |
| 222 | Ga0075434_100660903 | 3300006871 | Bacteria | 1063 |
| 223 | Ga0075434_102257282 | 3300006871 | Bacteria | 548 |
| 224 | Ga0075429_100177981 | 3300006880 | Bacteria | 1864 |
| 225 | Ga0075429_101948471 | 3300006880 | Bacteria | 509 |
| 226 | Ga0068865_100131926 | 3300006881 | Bacteria | 1873 |
| 227 | Ga0068865_100268731 | 3300006881 | Bacteria | 1353 |
| 228 | Ga0075436_100021585 | 3300006914 | Bacteria | 4419 |
| 229 | Ga0075436_100235002 | 3300006914 | Bacteria | 1302 |
| 230 | Ga0097620_100019850 | 3300006931 | Bacteria | 6746 |
| 231 | Ga0097620_100038562 | 3300006931 | Bacteria | 4793 |
| 232 | Ga0097620_100431065 | 3300006931 | Bacteria | 1415 |
| 233 | Ga0075435_100009249 | 3300007076 | Bacteria | 7118 |
| 234 | Ga0075435_100206707 | 3300007076 | Bacteria | 1664 |
| 235 | Ga0105251_10005745 | 3300009011 | Bacteria | 8046 |
| 236 | Ga0105251_10085627 | 3300009011 | Bacteria | 1452 |
| 237 | Ga0105251_10109050 | 3300009011 | Bacteria | 1262 |
| 238 | Ga0105240_10020672 | 3300009093 | Bacteria | 8773 |
| 239 | Ga0105240_10260258 | 3300009093 | Bacteria | 2002 |
| 240 | Ga0111539_10070843 | 3300009094 | Bacteria | 4115 |
| 241 | Ga0111539_10524251 | 3300009094 | Bacteria | 1380 |
| 242 | Ga0111539_11610064 | 3300009094 | Bacteria | 753 |
| 243 | Ga0105245_10347345 | 3300009098 | Bacteria | 1469 |
| 244 | Ga0105245_10480286 | 3300009098 | Bacteria | 1256 |
| 245 | Ga0105245_10655443 | 3300009098 | Bacteria | 1080 |
| 246 | Ga0105245_11316161 | 3300009098 | Bacteria | 772 |
| 247 | Ga0105245_12301214 | 3300009098 | Bacteria | 592 |
| 248 | Ga0105247_10000024 | 3300009101 | Bacteria | 210946 |
| 249 | Ga0105247_10014350 | 3300009101 | Bacteria | 4756 |
| 250 | Ga0105247_10113307 | 3300009101 | Bacteria | 1748 |
| 251 | Ga0105247_10550235 | 3300009101 | Bacteria | 848 |
| 252 | Ga0114129_10035791 | 3300009147 | Bacteria | 7012 |
| 253 | Ga0114129_10107558 | 3300009147 | Bacteria | 3851 |
| 254 | Ga0105243_10148708 | 3300009148 | Bacteria | 2007 |
| 255 | Ga0105243_10474188 | 3300009148 | Bacteria | 1180 |
| 256 | Ga0105243_10845882 | 3300009148 | Bacteria | 906 |
| 257 | Ga0105243_11015025 | 3300009148 | Bacteria | 833 |
| 258 | Ga0105243_11581458 | 3300009148 | Bacteria | 682 |
| 259 | Ga0105241_10003922 | 3300009174 | Bacteria | 11017 |
| 260 | Ga0105241_11147661 | 3300009174 | Bacteria | 734 |
| 261 | Ga0105241_11505525 | 3300009174 | Unclassified | 648 |
| 262 | Ga0105242_10031355 | 3300009176 | Bacteria | 4244 |
| 263 | Ga0105242_10897926 | 3300009176 | Bacteria | 886 |
| 264 | Ga0105242_12172646 | 3300009176 | Bacteria | 600 |
| 265 | Ga0105248_10001056 | 3300009177 | Bacteria | 30519 |
| 266 | Ga0105248_10020922 | 3300009177 | Bacteria | 7251 |
| 267 | Ga0105248_10136721 | 3300009177 | Bacteria | 2765 |
| 268 | Ga0105248_12152620 | 3300009177 | Bacteria | 634 |
| 269 | Ga0105248_12374324 | 3300009177 | Bacteria | 604 |
| 270 | Ga0105237_10030455 | 3300009545 | Bacteria | 5481 |
| 271 | Ga0105237_10054405 | 3300009545 | Bacteria | 4010 |
| 272 | Ga0105237_11432203 | 3300009545 | Bacteria | 697 |
| 273 | Ga0105237_12241566 | 3300009545 | Bacteria | 556 |
| 274 | Ga0105238_10012420 | 3300009551 | Bacteria | 8590 |
| 275 | Ga0105238_10041516 | 3300009551 | Bacteria | 4658 |
| 276 | Ga0105238_10476900 | 3300009551 | Bacteria | 1246 |
| 277 | Ga0105249_10134093 | 3300009553 | Bacteria | 2368 |
| 278 | Ga0105249_10482687 | 3300009553 | Bacteria | 1282 |
| 279 | Ga0105239_10139416 | 3300010375 | Bacteria | 2702 |
| 280 | Ga0105239_10166452 | 3300010375 | Bacteria | 2465 |
| 281 | Ga0105239_10658786 | 3300010375 | Bacteria | 1196 |
| 282 | Ga0105239_12249420 | 3300010375 | Bacteria | 634 |
| 283 | Ga0105246_10002775 | 3300011119 | Bacteria | 10600 |
| 284 | Ga0105246_10047986 | 3300011119 | Bacteria | 2918 |
| 285 | Ga0105246_10324541 | 3300011119 | Bacteria | 1252 |
| 286 | Ga0105246_10411213 | 3300011119 | Bacteria | 1126 |
| 287 | Ga0105246_10513732 | 3300011119 | Bacteria | 1020 |
| 288 | Ga0105246_10524359 | 3300011119 | Bacteria | 1010 |
| 289 | Ga0105246_12472437 | 3300011119 | Bacteria | 511 |
| 290 | Ga0157336_1018690 | 3300012477 | Bacteria | 609 |
| 291 | Ga0157338_1009066 | 3300012515 | Bacteria | 978 |
| 292 | Ga0154012_129348 | 3300013059 | Bacteria | 548 |
| 293 | Ga0157373_10173743 | 3300013100 | Bacteria | 1516 |
| 294 | Ga0157373_10188314 | 3300013100 | Bacteria | 1454 |
| 295 | Ga0157371_10041110 | 3300013102 | Bacteria | 3301 |
| 296 | Ga0157371_10222638 | 3300013102 | Bacteria | 1355 |
| 297 | Ga0157370_10016638 | 3300013104 | Bacteria | 7441 |
| 298 | Ga0157370_10037442 | 3300013104 | Bacteria | 4702 |
| 299 | Ga0157370_11700019 | 3300013104 | Bacteria | 566 |
| 300 | Ga0157369_10065102 | 3300013105 | Bacteria | 3924 |
| 301 | Ga0157369_10391996 | 3300013105 | Bacteria | 1441 |
| 302 | Ga0157369_12518212 | 3300013105 | Bacteria | 521 |
| 303 | Ga0157374_10008470 | 3300013296 | Bacteria | 8794 |
| 304 | Ga0157374_10045677 | 3300013296 | Bacteria | 4054 |
| 305 | Ga0157374_11240233 | 3300013296 | Bacteria | 767 |
| 306 | Ga0157374_11608267 | 3300013296 | Bacteria | 674 |
| 307 | Ga0157378_11319992 | 3300013297 | Bacteria | 763 |
| 308 | Ga0163162_10080192 | 3300013306 | Bacteria | 3331 |
| 309 | Ga0163162_10559158 | 3300013306 | Bacteria | 1272 |
| 310 | Ga0163162_10624267 | 3300013306 | Bacteria | 1203 |
| 311 | Ga0163162_11294678 | 3300013306 | Bacteria | 828 |
| 312 | Ga0163162_11630720 | 3300013306 | Bacteria | 736 |
| 313 | Ga0157372_10000004 | 3300013307 | Bacteria | 435659 |
| 314 | Ga0157372_10009917 | 3300013307 | Bacteria | 10133 |
| 315 | Ga0157372_10038352 | 3300013307 | Bacteria | 5287 |
| 316 | Ga0157372_10316410 | 3300013307 | Bacteria | 1817 |
| 317 | Ga0157372_10470615 | 3300013307 | Bacteria | 1465 |
| 318 | Ga0157375_10067993 | 3300013308 | Bacteria | 3562 |
| 319 | Ga0157375_10106574 | 3300013308 | Bacteria | 2895 |
| 320 | Ga0157375_10163382 | 3300013308 | Bacteria | 2370 |
| 321 | Ga0157375_10513509 | 3300013308 | Bacteria | 1362 |
| 322 | Ga0157375_11054265 | 3300013308 | Bacteria | 950 |
| 323 | Ga0157375_11127373 | 3300013308 | Bacteria | 919 |
| 324 | Ga0163163_10021986 | 3300014325 | Bacteria | 6030 |
| 325 | Ga0163163_10060853 | 3300014325 | Bacteria | 3740 |
| 326 | Ga0163163_10123902 | 3300014325 | Bacteria | 2621 |
| 327 | Ga0163163_11038923 | 3300014325 | Bacteria | 883 |
| 328 | Ga0157380_10023685 | 3300014326 | Bacteria | 4635 |
| 329 | Ga0182008_10103657 | 3300014497 | Bacteria | 1407 |
| 330 | Ga0157377_10007324 | 3300014745 | Bacteria | 5322 |
| 331 | Ga0157377_10146494 | 3300014745 | Bacteria | 1456 |
| 332 | Ga0157377_11056712 | 3300014745 | Bacteria | 619 |
| 333 | Ga0157379_10025436 | 3300014968 | Bacteria | 5259 |
| 334 | Ga0157379_10053099 | 3300014968 | Bacteria | 3621 |
| 335 | Ga0157379_10084610 | 3300014968 | Bacteria | 2842 |
| 336 | Ga0157379_10324576 | 3300014968 | Bacteria | 1406 |
| 337 | Ga0157379_11691776 | 3300014968 | Bacteria | 620 |
| 338 | Ga0157376_10088133 | 3300014969 | Bacteria | 2680 |
| 339 | Ga0157376_10332741 | 3300014969 | Bacteria | 1448 |
| 340 | Ga0157376_10353219 | 3300014969 | Bacteria | 1407 |
| 341 | Ga0157376_10527499 | 3300014969 | Bacteria | 1165 |
| 342 | Ga0157376_10856823 | 3300014969 | Bacteria | 924 |
| 343 | Ga0157376_12298095 | 3300014969 | Bacteria | 578 |
| 344 | Ga0157376_12923460 | 3300014969 | Bacteria | 517 |
| 345 | Ga0163161_10033855 | 3300017792 | Bacteria | 3652 |
| 346 | Ga0163161_10419030 | 3300017792 | Bacteria | 1077 |
| 347 | Ga0163161_10871350 | 3300017792 | Bacteria | 761 |
| 348 | Ga0197907_10349344 | 3300020069 | Bacteria | 881 |
| 349 | Ga0197907_10461931 | 3300020069 | Bacteria | 2878 |
| 350 | Ga0197907_10650100 | 3300020069 | Bacteria | 608 |
| 351 | Ga0197907_10999803 | 3300020069 | Bacteria | 505 |
| 352 | Ga0197907_11208770 | 3300020069 | Bacteria | 1635 |
| 353 | Ga0197907_11215366 | 3300020069 | Bacteria | 966 |
| 354 | Ga0197907_11476430 | 3300020069 | Bacteria | 568 |
| 355 | Ga0206356_10676114 | 3300020070 | Bacteria | 513 |
| 356 | Ga0206356_10891290 | 3300020070 | Bacteria | 906 |
| 357 | Ga0206356_11707506 | 3300020070 | Bacteria | 1256 |
| 358 | Ga0206356_11857247 | 3300020070 | Bacteria | 1424 |
| 359 | Ga0206349_1272775 | 3300020075 | Bacteria | 1006 |
| 360 | Ga0206349_1289577 | 3300020075 | Bacteria | 2103 |
| 361 | Ga0206349_1823967 | 3300020075 | Bacteria | 588 |
| 362 | Ga0206355_1007316 | 3300020076 | Bacteria | 1353 |
| 363 | Ga0206355_1054578 | 3300020076 | Bacteria | 1918 |
| 364 | Ga0206355_1080654 | 3300020076 | Bacteria | 509 |
| 365 | Ga0206355_1099384 | 3300020076 | Bacteria | 1453 |
| 366 | Ga0206355_1318107 | 3300020076 | Bacteria | 567 |
| 367 | Ga0206355_1474009 | 3300020076 | Bacteria | 796 |
| 368 | Ga0206355_1521014 | 3300020076 | Bacteria | 609 |
| 369 | Ga0206355_1554658 | 3300020076 | Bacteria | 610 |
| 370 | Ga0206351_10077041 | 3300020077 | Bacteria | 2499 |
| 371 | Ga0206351_10606993 | 3300020077 | Bacteria | 1398 |
| 372 | Ga0206351_10607123 | 3300020077 | Bacteria | 734 |
| 373 | Ga0206352_10015410 | 3300020078 | Bacteria | 731 |
| 374 | Ga0206352_10212823 | 3300020078 | Bacteria | 779 |
| 375 | Ga0206352_10315045 | 3300020078 | Bacteria | 580 |
| 376 | Ga0206352_11140863 | 3300020078 | Bacteria | 697 |
| 377 | Ga0206352_11246446 | 3300020078 | Bacteria | 757 |
| 378 | Ga0206350_10506608 | 3300020080 | Bacteria | 826 |
| 379 | Ga0206350_10909644 | 3300020080 | Bacteria | 624 |
| 380 | Ga0206350_11030234 | 3300020080 | Bacteria | 623 |
| 381 | Ga0206350_11551424 | 3300020080 | Bacteria | 2352 |
| 382 | Ga0206354_10018836 | 3300020081 | Bacteria | 735 |
| 383 | Ga0206354_10341810 | 3300020081 | Bacteria | 1173 |
| 384 | Ga0206354_10445232 | 3300020081 | Bacteria | 652 |
| 385 | Ga0206354_11320400 | 3300020081 | Bacteria | 1056 |
| 386 | Ga0206354_11499300 | 3300020081 | Bacteria | 814 |
| 387 | Ga0206353_10167382 | 3300020082 | Bacteria | 1207 |
| 388 | Ga0206353_10174093 | 3300020082 | Bacteria | 609 |
| 389 | Ga0206353_10773459 | 3300020082 | Bacteria | 1686 |
| 390 | Ga0206353_11061505 | 3300020082 | Bacteria | 1132 |
| 391 | Ga0206353_11066816 | 3300020082 | Bacteria | 614 |
| 392 | Ga0206353_11435619 | 3300020082 | Bacteria | 2056 |
| 393 | Ga0206353_11848817 | 3300020082 | Bacteria | 588 |
| 394 | Ga0154015_1066299 | 3300020610 | Bacteria | 744 |
| 395 | Ga0154015_1245520 | 3300020610 | Bacteria | 628 |
| 396 | Ga0154015_1299450 | 3300020610 | Bacteria | 894 |
| 397 | Ga0154015_1580325 | 3300020610 | Bacteria | 1948 |
| 398 | Ga0224712_10004796 | 3300022467 | Bacteria | 3689 |
| 399 | Ga0224712_10058367 | 3300022467 | Bacteria | 1528 |
| 400 | Ga0224712_10089803 | 3300022467 | Bacteria | 1285 |
| 401 | Ga0224712_10161127 | 3300022467 | Bacteria | 1001 |
| 402 | Ga0224712_10401055 | 3300022467 | Bacteria | 654 |
| 403 | Ga0224712_10532127 | 3300022467 | Bacteria | 570 |
| 404 | Ga0256744_117491 | 3300023309 | Bacteria | 673 |
| 405 | Ga0247528_112676 | 3300023680 | Bacteria | 560 |
| 406 | Ga0207656_10110159 | 3300025321 | Bacteria | 1271 |
| 407 | Ga0207656_10122939 | 3300025321 | Bacteria | 1210 |
| 408 | Ga0207656_10126403 | 3300025321 | Bacteria | 1194 |
| 409 | Ga0207713_1072822 | 3300025735 | Bacteria | 1263 |
| 410 | Ga0207713_1189392 | 3300025735 | Bacteria | 637 |
| 411 | Ga0207653_10006947 | 3300025885 | Bacteria | 3531 |
| 412 | Ga0207653_10050738 | 3300025885 | Bacteria | 1380 |
| 413 | Ga0207692_10016718 | 3300025898 | Bacteria | 3257 |
| 414 | Ga0207692_10148749 | 3300025898 | Bacteria | 1339 |
| 415 | Ga0207642_10639821 | 3300025899 | Bacteria | 665 |
| 416 | Ga0207710_10000045 | 3300025900 | Bacteria | 210957 |
| 417 | Ga0207710_10344834 | 3300025900 | Bacteria | 758 |
| 418 | Ga0207688_10000847 | 3300025901 | Bacteria | 15401 |
| 419 | Ga0207688_10019002 | 3300025901 | Bacteria | 3739 |
| 420 | Ga0207688_10083125 | 3300025901 | Bacteria | 1831 |
| 421 | Ga0207680_10054816 | 3300025903 | Bacteria | 2400 |
| 422 | Ga0207680_10469572 | 3300025903 | Bacteria | 894 |
| 423 | Ga0207680_10765138 | 3300025903 | Bacteria | 692 |
| 424 | Ga0207680_10874226 | 3300025903 | Bacteria | 644 |
| 425 | Ga0207647_10015966 | 3300025904 | Bacteria | 5133 |
| 426 | Ga0207647_10322205 | 3300025904 | Bacteria | 877 |
| 427 | Ga0207685_10855408 | 3300025905 | Bacteria | 504 |
| 428 | Ga0207699_10310625 | 3300025906 | Bacteria | 1103 |
| 429 | Ga0207645_10716591 | 3300025907 | Bacteria | 680 |
| 430 | Ga0207643_10000582 | 3300025908 | Bacteria | 23171 |
| 431 | Ga0207643_10239468 | 3300025908 | Bacteria | 1115 |
| 432 | Ga0207643_10392195 | 3300025908 | Bacteria | 877 |
| 433 | Ga0207705_10043443 | 3300025909 | Bacteria | 3229 |
| 434 | Ga0207705_10101255 | 3300025909 | Bacteria | 2119 |
| 435 | Ga0207654_10026094 | 3300025911 | Bacteria | 3160 |
| 436 | Ga0207654_10984501 | 3300025911 | Bacteria | 613 |
| 437 | Ga0207707_10012852 | 3300025912 | Bacteria | 7284 |
| 438 | Ga0207707_10151950 | 3300025912 | Bacteria | 2024 |
| 439 | Ga0207695_10075230 | 3300025913 | Bacteria | 3436 |
| 440 | Ga0207695_10218088 | 3300025913 | Bacteria | 1816 |
| 441 | Ga0207671_10068903 | 3300025914 | Bacteria | 2637 |
| 442 | Ga0207671_10117280 | 3300025914 | Bacteria | 2032 |
| 443 | Ga0207693_10026789 | 3300025915 | Bacteria | 4560 |
| 444 | Ga0207693_10034105 | 3300025915 | Bacteria | 4014 |
| 445 | Ga0207663_10033424 | 3300025916 | Bacteria | 3063 |
| 446 | Ga0207663_10045677 | 3300025916 | Bacteria | 2695 |
| 447 | Ga0207660_10042353 | 3300025917 | Bacteria | 3195 |
| 448 | Ga0207660_10645661 | 3300025917 | Bacteria | 863 |
| 449 | Ga0207662_10012234 | 3300025918 | Bacteria | 4776 |
| 450 | Ga0207657_10012967 | 3300025919 | Bacteria | 8194 |
| 451 | Ga0207657_10145428 | 3300025919 | Bacteria | 1934 |
| 452 | Ga0207657_10650164 | 3300025919 | Bacteria | 821 |
| 453 | Ga0207649_10003295 | 3300025920 | Bacteria | 8837 |
| 454 | Ga0207649_11384248 | 3300025920 | Bacteria | 557 |
| 455 | Ga0207652_10007129 | 3300025921 | Bacteria | 9014 |
| 456 | Ga0207652_10305194 | 3300025921 | Bacteria | 1437 |
| 457 | Ga0207681_11320032 | 3300025923 | Bacteria | 606 |
| 458 | Ga0207694_10227319 | 3300025924 | Bacteria | 1523 |
| 459 | Ga0207694_10435768 | 3300025924 | Bacteria | 1093 |
| 460 | Ga0207694_10694231 | 3300025924 | Bacteria | 858 |
| 461 | Ga0207694_11395896 | 3300025924 | Bacteria | 592 |
| 462 | Ga0207650_10011533 | 3300025925 | Bacteria | 6086 |
| 463 | Ga0207650_10843622 | 3300025925 | Bacteria | 777 |
| 464 | Ga0207650_11090608 | 3300025925 | Bacteria | 679 |
| 465 | Ga0207659_10016055 | 3300025926 | Bacteria | 4867 |
| 466 | Ga0207687_10011420 | 3300025927 | Bacteria | 5805 |
| 467 | Ga0207687_10080672 | 3300025927 | Bacteria | 2349 |
| 468 | Ga0207687_10171318 | 3300025927 | Bacteria | 1674 |
| 469 | Ga0207687_10658706 | 3300025927 | Bacteria | 886 |
| 470 | Ga0207687_11047200 | 3300025927 | Bacteria | 700 |
| 471 | Ga0207664_10098201 | 3300025929 | Bacteria | 2414 |
| 472 | Ga0207664_10104075 | 3300025929 | Bacteria | 2350 |
| 473 | Ga0207664_10130702 | 3300025929 | Bacteria | 2113 |
| 474 | Ga0207664_11197995 | 3300025929 | Bacteria | 677 |
| 475 | Ga0207644_10001024 | 3300025931 | Bacteria | 17886 |
| 476 | Ga0207644_10009147 | 3300025931 | Bacteria | 6496 |
| 477 | Ga0207644_11201350 | 3300025931 | Bacteria | 637 |
| 478 | Ga0207644_11211165 | 3300025931 | Bacteria | 635 |
| 479 | Ga0207690_10102900 | 3300025932 | Bacteria | 2043 |
| 480 | Ga0207690_10952056 | 3300025932 | Bacteria | 713 |
| 481 | Ga0207706_10045030 | 3300025933 | Bacteria | 3909 |
| 482 | Ga0207706_10314486 | 3300025933 | Bacteria | 1363 |
| 483 | Ga0207686_10424958 | 3300025934 | Bacteria | 1017 |
| 484 | Ga0207686_10581170 | 3300025934 | Bacteria | 879 |
| 485 | Ga0207686_11262386 | 3300025934 | Bacteria | 606 |
| 486 | Ga0207709_10813660 | 3300025935 | Bacteria | 755 |
| 487 | Ga0207670_10113901 | 3300025936 | Bacteria | 1954 |
| 488 | Ga0207670_10119726 | 3300025936 | Bacteria | 1911 |
| 489 | Ga0207670_10143460 | 3300025936 | Bacteria | 1763 |
| 490 | Ga0207669_10033093 | 3300025937 | Bacteria | 2913 |
| 491 | Ga0207669_10239027 | 3300025937 | Bacteria | 1345 |
| 492 | Ga0207704_10113080 | 3300025938 | Bacteria | 1840 |
| 493 | Ga0207704_10334539 | 3300025938 | Bacteria | 1173 |
| 494 | Ga0207665_10002925 | 3300025939 | Bacteria | 11439 |
| 495 | Ga0207691_10107559 | 3300025940 | Bacteria | 2483 |
| 496 | Ga0207691_10184939 | 3300025940 | Bacteria | 1819 |
| 497 | Ga0207691_10216932 | 3300025940 | Bacteria | 1660 |
| 498 | Ga0207711_10002931 | 3300025941 | Bacteria | 14919 |
| 499 | Ga0207711_10100715 | 3300025941 | Bacteria | 2556 |
| 500 | Ga0207711_10233446 | 3300025941 | Bacteria | 1685 |
| 501 | Ga0207689_10002561 | 3300025942 | Bacteria | 16847 |
| 502 | Ga0207689_10319474 | 3300025942 | Bacteria | 1288 |
| 503 | Ga0207689_10328277 | 3300025942 | Bacteria | 1270 |
| 504 | Ga0207689_10359069 | 3300025942 | Bacteria | 1211 |
| 505 | Ga0207661_10419455 | 3300025944 | Bacteria | 1215 |
| 506 | Ga0207661_10949912 | 3300025944 | Bacteria | 792 |
| 507 | Ga0207679_10016058 | 3300025945 | Bacteria | 4964 |
| 508 | Ga0207679_10744622 | 3300025945 | Bacteria | 891 |
| 509 | Ga0207679_11867194 | 3300025945 | Bacteria | 548 |
| 510 | Ga0207667_10270778 | 3300025949 | Bacteria | 1736 |
| 511 | Ga0207667_10867626 | 3300025949 | Bacteria | 896 |
| 512 | Ga0207651_10320273 | 3300025960 | Bacteria | 1296 |
| 513 | Ga0207712_10070020 | 3300025961 | Bacteria | 2519 |
| 514 | Ga0207712_10225610 | 3300025961 | Bacteria | 1500 |
| 515 | Ga0207712_10944564 | 3300025961 | Bacteria | 763 |
| 516 | Ga0207668_10017424 | 3300025972 | Bacteria | 4501 |
| 517 | Ga0207668_10032912 | 3300025972 | Bacteria | 3432 |
| 518 | Ga0207668_11023261 | 3300025972 | Bacteria | 739 |
| 519 | Ga0207640_10216149 | 3300025981 | Bacteria | 1464 |
| 520 | Ga0207658_10203067 | 3300025986 | Bacteria | 1656 |
| 521 | Ga0207658_10768963 | 3300025986 | Bacteria | 873 |
| 522 | Ga0207658_11469115 | 3300025986 | Unclassified | 624 |
| 523 | Ga0207677_10031358 | 3300026023 | Bacteria | 3404 |
| 524 | Ga0207677_10058031 | 3300026023 | Bacteria | 2662 |
| 525 | Ga0207677_10933446 | 3300026023 | Bacteria | 784 |
| 526 | Ga0207703_10025397 | 3300026035 | Bacteria | 4659 |
| 527 | Ga0207703_10087590 | 3300026035 | Bacteria | 2611 |
| 528 | Ga0207703_10296149 | 3300026035 | Bacteria | 1474 |
| 529 | Ga0207639_10105316 | 3300026041 | Bacteria | 2288 |
| 530 | Ga0207639_10341620 | 3300026041 | Bacteria | 1335 |
| 531 | Ga0207678_10001737 | 3300026067 | Bacteria | 19932 |
| 532 | Ga0207678_10171662 | 3300026067 | Bacteria | 1851 |
| 533 | Ga0207678_10257393 | 3300026067 | Bacteria | 1495 |
| 534 | Ga0207708_10082896 | 3300026075 | Bacteria | 2465 |
| 535 | Ga0207708_10197366 | 3300026075 | Bacteria | 1604 |
| 536 | Ga0207702_10001548 | 3300026078 | Bacteria | 22747 |
| 537 | Ga0207702_10010112 | 3300026078 | Bacteria | 7906 |
| 538 | Ga0207702_10180275 | 3300026078 | Bacteria | 1945 |
| 539 | Ga0207702_10344233 | 3300026078 | Bacteria | 1425 |
| 540 | Ga0207641_10009255 | 3300026088 | Bacteria | 8122 |
| 541 | Ga0207641_10179450 | 3300026088 | Bacteria | 1938 |
| 542 | Ga0207641_10261108 | 3300026088 | Bacteria | 1622 |
| 543 | Ga0207641_11121351 | 3300026088 | Bacteria | 785 |
| 544 | Ga0207648_10209082 | 3300026089 | Bacteria | 1732 |
| 545 | Ga0207648_10557389 | 3300026089 | Bacteria | 1053 |
| 546 | Ga0207676_10010083 | 3300026095 | Bacteria | 6723 |
| 547 | Ga0207676_10120609 | 3300026095 | Bacteria | 2211 |
| 548 | Ga0207676_10355087 | 3300026095 | Bacteria | 1357 |
| 549 | Ga0207674_10140330 | 3300026116 | Bacteria | 2376 |
| 550 | Ga0207674_10203372 | 3300026116 | Bacteria | 1930 |
| 551 | Ga0207674_10239100 | 3300026116 | Bacteria | 1763 |
| 552 | Ga0207675_100006128 | 3300026118 | Bacteria | 11431 |
| 553 | Ga0207675_100356105 | 3300026118 | Bacteria | 1435 |
| 554 | Ga0207675_101575080 | 3300026118 | Bacteria | 677 |
| 555 | Ga0207683_10000940 | 3300026121 | Bacteria | 26716 |
| 556 | Ga0207683_10002124 | 3300026121 | Bacteria | 17409 |
| 557 | Ga0207683_10154486 | 3300026121 | Bacteria | 2072 |
| 558 | Ga0207683_10456884 | 3300026121 | Bacteria | 1178 |
| 559 | Ga0207683_10596788 | 3300026121 | Bacteria | 1022 |
| 560 | Ga0207683_10886916 | 3300026121 | Bacteria | 828 |
| 561 | Ga0207683_11181233 | 3300026121 | Bacteria | 709 |
| 562 | Ga0207698_10027133 | 3300026142 | Bacteria | 4062 |
| 563 | Ga0207698_10395815 | 3300026142 | Bacteria | 1319 |
| 564 | Ga0207698_10638917 | 3300026142 | Bacteria | 1053 |
| 565 | Ga0207698_12603925 | 3300026142 | Bacteria | 515 |
| 566 | Ga0207428_10037394 | 3300027907 | Bacteria | 3949 |
| 567 | Ga0268266_10019784 | 3300028379 | Bacteria | 5737 |
| 568 | Ga0268266_10086549 | 3300028379 | Bacteria | 2740 |
| 569 | Ga0268266_10092904 | 3300028379 | Bacteria | 2648 |
| 570 | Ga0268266_12163106 | 3300028379 | Bacteria | 529 |
| 571 | Ga0268265_10148279 | 3300028380 | Bacteria | 1975 |
| 572 | Ga0268264_10054614 | 3300028381 | Bacteria | 3336 |
| 573 | Ga0268264_10078028 | 3300028381 | Bacteria | 2823 |
| 574 | Ga0268264_10393393 | 3300028381 | Bacteria | 1330 |
| 575 | Ga0265338_10005202 | 3300028800 | Bacteria | 17064 |
| 576 | Ga0265338_10010328 | 3300028800 | Bacteria | 10964 |
| 577 | Ga0311001_1037751 | 3300029277 | Bacteria | 633 |
| 578 | Ga0265767_111138 | 3300030836 | Bacteria | 608 |
| 579 | Ga0265766_1019552 | 3300030863 | Bacteria | 550 |
| 580 | Ga0307508_10276192 | 3300031616 | Bacteria | 1274 |
| 581 | Ga0316575_10292596 | 3300031665 | Bacteria | 688 |
| 582 | Ga0316576_10001892 | 3300031727 | Bacteria | 11647 |
| 583 | Ga0316576_10119181 | 3300031727 | Bacteria | 1981 |
| 584 | Ga0316576_10394910 | 3300031727 | Bacteria | 1025 |
| 585 | Ga0316578_10386461 | 3300031728 | Bacteria | 830 |
| 586 | Ga0316578_10920557 | 3300031728 | Bacteria | 505 |
| 587 | Ga0316577_10537161 | 3300031733 | Bacteria | 665 |
| 588 | Ga0316042_126616 | 3300031816 | Bacteria | 562 |
| 589 | Ga0307410_10771735 | 3300031852 | Bacteria | 815 |
| 590 | Ga0316583_10289566 | 3300032133 | Bacteria | 567 |
| 591 | Ga0316585_10125639 | 3300032137 | Bacteria | 845 |
| 592 | Ga0316593_10036839 | 3300032168 | Bacteria | 1614 |
| 593 | Ga0316593_10146215 | 3300032168 | Bacteria | 858 |
| 594 | Ga0316592_1083288 | 3300033524 | Bacteria | 728 |
| 595 | Ga0316588_1034364 | 3300033528 | Bacteria | 1197 |
| 596 | Ga0316587_1012151 | 3300033529 | Bacteria | 1397 |
| 597 | Ga0316596_1059175 | 3300033541 | Bacteria | 1021 |
| 598 | Ga0316596_1144469 | 3300033541 | Bacteria | 652 |
| 599 | Ga0316596_1205725 | 3300033541 | Bacteria | 548 |
| 600 | Ga0373948_0048350 | 3300034817 | Bacteria | 908 |
| 601 | Ga0373959_0108367 | 3300034820 | Bacteria | 668 |
| 602 | Ga0373929_0064471 | 3300035085 | Bacteria | 864 |
| 603 | Ga0373940_0034752 | 3300035088 | Bacteria | 1362 |
| 604 | Ga0373951_0039318 | 3300035091 | Bacteria | 1137 |
| 605 | Ga0373941_0365865 | 3300035115 | Bacteria | 590 |
| 606 | Ga0373960_0010185 | 3300035121 | Bacteria | 2292 |
| 607 | Ga0373960_0185603 | 3300035121 | Bacteria | 728 |
| 608 | Ga0373942_0168913 | 3300035207 | Bacteria | 711 |
| 609 | Ga0373961_0369336 | 3300035241 | Bacteria | 545 |
| 610 | Ga0373962_0011800 | 3300035242 | Bacteria | 2195 |
| 611 | Ga0316574_0206009 | 3300035398 | Bacteria | 1263 |
| 612 | Ga0316574_0454401 | 3300035398 | Bacteria | 802 |
| 613 | Ga0373931_0047821 | 3300035691 | Bacteria | 2265 |
| 614 | Ga0316582_1036041 | 3300036647 | Bacteria | 560 |
| 615 | Ga0316584_0001134 | 3300036712 | Bacteria | 15636 |
| 616 | Ga0316584_0029752 | 3300036712 | Bacteria | 4032 |
| 617 | Ga0316584_0114016 | 3300036712 | Bacteria | 2022 |
| 618 | Ga0316584_0505673 | 3300036712 | Bacteria | 848 |
| 619 | Ga0373925_1156669 | 3300037068 | Bacteria | 636 |
| 620 | Ga0395905_0971002 | 3300037471 | Bacteria | 753 |
| 621 | Ga0436362_1001710 | 3300039453 | Bacteria | 1171 |
| 622 | Ga0451787_606478 | 3300041441 | Bacteria | 1645 |
| 623 | Ga0451789_0545708 | 3300041443 | Bacteria | 1218 |
| 624 | Ga0451791_0034478 | 3300041451 | Bacteria | 2643 |
| 625 | Ga0451793_0143711 | 3300041452 | Bacteria | 5120 |
| 626 | Ga0451797_0134441 | 3300041453 | Bacteria | 2289 |
| 627 | Ga0451797_0880098 | 3300041453 | Bacteria | 609 |
| 628 | Ga0451795_0030371 | 3300041456 | Bacteria | 1489 |
| 629 | Ga0451800_0901040 | 3300041459 | Bacteria | 1109 |
| 630 | Ga0451804_0895874 | 3300041463 | Bacteria | 1108 |
| 631 | Ga0451833_0089908 | 3300041491 | Bacteria | 2338 |
| 632 | Ga0451837_1276101 | 3300041494 | Bacteria | 4040 |
| 633 | Ga0451839_0579003 | 3300041496 | Bacteria | 1633 |
| 634 | Ga0451843_0638116 | 3300041509 | Bacteria | 685 |
| 635 | Ga0451843_0783312 | 3300041509 | Bacteria | 526 |
| 636 | Ga0451843_0815425 | 3300041509 | Bacteria | 6342 |
| 637 | Ga0451855_1182033 | 3300041511 | Bacteria | 1149 |
| 638 | Ga0451853_0777022 | 3300041512 | Bacteria | 8132 |
| 639 | Ga0439458_0004621 | 3300042157 | Bacteria | 3143 |
| 640 | Ga0439459_0017849 | 3300042438 | Bacteria | 1327 |
| 641 | Ga0439440_0113579 | 3300042993 | Bacteria | 747 |
| 642 | Ga0466969_0004202 | 3300044656 | Bacteria | 7643 |
| 643 | Ga0466969_0037052 | 3300044656 | Bacteria | 2461 |
| 644 | Ga0466972_0076024 | 3300044658 | Bacteria | 1600 |
| 645 | Ga0466966_0030559 | 3300044684 | Bacteria | 3496 |
| 646 | Ga0466966_0046207 | 3300044684 | Bacteria | 2780 |
| 647 | Ga0466961_0043893 | 3300044693 | Bacteria | 2862 |
| 648 | Ga0466961_0339478 | 3300044693 | Bacteria | 915 |
| 649 | Ga0466963_0060280 | 3300044694 | Bacteria | 2534 |
| 650 | Ga0466963_0114187 | 3300044694 | Bacteria | 1855 |
| 651 | Ga0466963_0479865 | 3300044694 | Bacteria | 878 |
| 652 | Ga0466963_0952140 | 3300044694 | Bacteria | 605 |
| 653 | Ga0466971_0053539 | 3300044719 | Bacteria | 1818 |
| 654 | Ga0466971_0558288 | 3300044719 | Bacteria | 568 |
| 655 | Ga0466968_0131100 | 3300044735 | Bacteria | 1141 |
| 656 | Ga0466970_0341284 | 3300044765 | Bacteria | 849 |
| 657 | Ga0466957_0352699 | 3300044842 | Bacteria | 998 |
| 658 | Ga0466957_0393017 | 3300044842 | Bacteria | 947 |
| 659 | Ga0466960_0104511 | 3300044901 | Bacteria | 1463 |
| 660 | Ga0466959_0012505 | 3300045049 | Bacteria | 6135 |
| 661 | Ga0466959_0116797 | 3300045049 | Bacteria | 1899 |
| 662 | Ga0466958_0637588 | 3300045836 | Bacteria | 693 |
| 663 | Ga0466967_0064715 | 3300045976 | Bacteria | 3252 |
| 664 | Ga0466967_0112603 | 3300045976 | Bacteria | 2502 |
| 665 | Ga0466967_0281702 | 3300045976 | Bacteria | 1595 |
| 666 | Ga0466967_0393344 | 3300045976 | Bacteria | 1348 |
| 667 | Ga0466967_2049898 | 3300045976 | Bacteria | 569 |
| 668 | Ga0495629_0086040 | 3300046459 | Bacteria | 2193 |
| 669 | Ga0495641_0338557 | 3300046461 | Bacteria | 680 |
| 670 | Ga0495653_0904243 | 3300046463 | Bacteria | 526 |
| 671 | Ga0495582_0189340 | 3300046473 | Bacteria | 1174 |
| 672 | Ga0495639_0095351 | 3300046475 | Bacteria | 1400 |
| 673 | Ga0495594_0068287 | 3300046499 | Bacteria | 1974 |
| 674 | Ga0495608_0859053 | 3300046511 | Bacteria | 533 |
| 675 | Ga0495618_0872476 | 3300046514 | Bacteria | 521 |
| 676 | Ga0495620_0105891 | 3300046515 | Bacteria | 1118 |
| 677 | Ga0495630_0819977 | 3300046517 | Bacteria | 710 |
| 678 | Ga0495665_0218712 | 3300046531 | Bacteria | 985 |
| 679 | Ga0495640_0157795 | 3300046533 | Bacteria | 1456 |
| 680 | Ga0495667_0532374 | 3300046559 | Bacteria | 735 |
| 681 | Ga0495611_0248816 | 3300046648 | Bacteria | 824 |
| 682 | Ga0495635_0697794 | 3300046663 | Bacteria | 658 |
| 683 | Ga0495588_0743363 | 3300046674 | Bacteria | 513 |
| 684 | Ga0495624_0181829 | 3300046690 | Bacteria | 1281 |
| 685 | Ga0495589_0402283 | 3300046794 | Bacteria | 629 |
| 686 | Ga0495600_0058234 | 3300046809 | Bacteria | 2524 |
| 687 | Ga0495600_0795424 | 3300046809 | Bacteria | 564 |
| 688 | Ga0495581_0105472 | 3300047315 | Bacteria | 1638 |
| 689 | Ga0495581_0160350 | 3300047315 | Bacteria | 1315 |
| 690 | Ga0495581_0907065 | 3300047315 | Bacteria | 503 |
| 691 | Ga0495676_0120545 | 3300047321 | Bacteria | 1909 |
| 692 | Ga0495676_0178638 | 3300047321 | Bacteria | 1489 |
| 693 | Ga0495680_0343885 | 3300047322 | Bacteria | 1040 |
| 694 | Ga0495680_0748019 | 3300047322 | Bacteria | 642 |
| 695 | Ga0495684_0898609 | 3300047471 | Bacteria | 571 |
| 696 | Ga0495593_0377984 | 3300047673 | Bacteria | 708 |
| 697 | Ga0496100_0257298 | 3300048903 | Bacteria | 1293 |
| 698 | Ga0496100_0752727 | 3300048903 | Bacteria | 762 |
| 699 | Ga0496101_0068289 | 3300048904 | Bacteria | 2598 |
| 700 | Ga0496101_0091285 | 3300048904 | Bacteria | 2267 |
| 701 | Ga0496101_0258003 | 3300048904 | Bacteria | 1359 |
| 702 | Ga0496101_1471562 | 3300048904 | Bacteria | 530 |
| 703 | Ga0496102_0018028 | 3300048905 | Bacteria | 6195 |
| 704 | Ga0496102_0023910 | 3300048905 | Bacteria | 5431 |
| 705 | Ga0496102_0332561 | 3300048905 | Bacteria | 1431 |
| 706 | Ga0496102_0474381 | 3300048905 | Bacteria | 1172 |
| 707 | Ga0496103_0074701 | 3300048906 | Bacteria | 2125 |
| 708 | Ga0496103_0074920 | 3300048906 | Bacteria | 2122 |
| 709 | Ga0496103_0333389 | 3300048906 | Bacteria | 976 |
| 710 | Ga0496103_0794467 | 3300048906 | Bacteria | 597 |
| 711 | Ga0496104_0011142 | 3300048907 | Bacteria | 8044 |
| 712 | Ga0496104_0015067 | 3300048907 | Bacteria | 6997 |
| 713 | Ga0496104_0027560 | 3300048907 | Bacteria | 5258 |
| 714 | Ga0496105_0004142 | 3300048908 | Bacteria | 10877 |
| 715 | Ga0496105_0007851 | 3300048908 | Bacteria | 8285 |
| 716 | Ga0496105_0068646 | 3300048908 | Bacteria | 2928 |
| 717 | Ga0496105_1078922 | 3300048908 | Bacteria | 597 |
| 718 | Ga0496106_0008819 | 3300048909 | Bacteria | 7453 |
| 719 | Ga0496106_0033788 | 3300048909 | Bacteria | 3817 |
| 720 | Ga0496107_0008557 | 3300048910 | Bacteria | 7081 |
| 721 | Ga0496107_0039010 | 3300048910 | Bacteria | 3407 |
| 722 | Ga0496108_0001314 | 3300048911 | Bacteria | 19538 |
| 723 | Ga0496108_0005089 | 3300048911 | Bacteria | 10623 |
| 724 | Ga0496108_0038342 | 3300048911 | Bacteria | 3991 |
| 725 | Ga0496108_0044842 | 3300048911 | Bacteria | 3692 |
| 726 | Ga0496108_0068054 | 3300048911 | Bacteria | 3004 |
| 727 | Ga0496108_0878912 | 3300048911 | Bacteria | 770 |
| 728 | Ga0496109_0002656 | 3300048912 | Bacteria | 15001 |
| 729 | Ga0496109_0042670 | 3300048912 | Bacteria | 4109 |
| 730 | Ga0496109_0047288 | 3300048912 | Bacteria | 3912 |
| 731 | Ga0496109_0124834 | 3300048912 | Bacteria | 2399 |
| 732 | Ga0496109_0200278 | 3300048912 | Bacteria | 1877 |
| 733 | Ga0496109_1106651 | 3300048912 | Bacteria | 729 |
| 734 | Ga0496110_0000656 | 3300048913 | Bacteria | 23611 |
| 735 | Ga0496110_0001739 | 3300048913 | Bacteria | 16060 |
| 736 | Ga0496110_0068962 | 3300048913 | Bacteria | 3130 |
| 737 | Ga0496110_0842731 | 3300048913 | Bacteria | 822 |
| 738 | Ga0496110_0883737 | 3300048913 | Bacteria | 799 |
| 739 | Ga0496111_0001057 | 3300048914 | Bacteria | 15165 |
| 740 | Ga0496111_0001201 | 3300048914 | Bacteria | 14452 |
| 741 | Ga0496111_0005464 | 3300048914 | Bacteria | 8147 |
| 742 | Ga0496111_0849878 | 3300048914 | Bacteria | 659 |
| 743 | Ga0496112_0059092 | 3300048915 | Bacteria | 3777 |
| 744 | Ga0496112_0060911 | 3300048915 | Bacteria | 3719 |
| 745 | Ga0496113_0003887 | 3300048916 | Bacteria | 9048 |
| 746 | Ga0496113_0007515 | 3300048916 | Bacteria | 7023 |
| 747 | Ga0496113_0051622 | 3300048916 | Bacteria | 3069 |
| 748 | Ga0496114_0005871 | 3300048917 | Bacteria | 9647 |
| 749 | Ga0496114_0069225 | 3300048917 | Bacteria | 2963 |
| 750 | Ga0496114_0175534 | 3300048917 | Bacteria | 1869 |
| 751 | Ga0496114_0217136 | 3300048917 | Bacteria | 1678 |
| 752 | Ga0496114_1048914 | 3300048917 | Bacteria | 699 |
| 753 | Ga0496114_1093625 | 3300048917 | Bacteria | 682 |
| 754 | Ga0496114_1768804 | 3300048917 | Bacteria | 506 |
| 755 | Ga0496115_0013815 | 3300048918 | Bacteria | 6115 |
| 756 | Ga0496115_0137391 | 3300048918 | Bacteria | 2016 |
| 757 | Ga0496115_0169409 | 3300048918 | Bacteria | 1806 |
| 758 | Ga0496115_0279994 | 3300048918 | Bacteria | 1369 |
| 759 | Ga0496115_0343953 | 3300048918 | Bacteria | 1217 |
| 760 | Ga0496119_0001274 | 3300048922 | Bacteria | 31248 |
| 761 | Ga0496120_0000892 | 3300048923 | Bacteria | 41970 |
| 762 | Ga0496121_0014534 | 3300048924 | Bacteria | 8346 |
| 763 | Ga0496126_0000003 | 3300048929 | Bacteria | 961576 |
| 764 | Ga0501309_070125 | 3300049129 | Bacteria | 575 |
| 765 | Ga0501310_040179 | 3300049130 | Bacteria | 649 |
| 766 | Ga0501305_016824 | 3300049161 | Bacteria | 1046 |
| 767 | Ga0501315_028870 | 3300049531 | Bacteria | 789 |
| 768 | Ga0501317_006203 | 3300049533 | Bacteria | 1305 |
| 769 | Ga0501317_012962 | 3300049533 | Bacteria | 1036 |
| 770 | Ga0501317_024465 | 3300049533 | Bacteria | 840 |
| 771 | Ga0501317_027594 | 3300049533 | Bacteria | 807 |
| 772 | Ga0501318_002713 | 3300049534 | Bacteria | 1562 |
| 773 | Ga0501318_003777 | 3300049534 | Bacteria | 1412 |
| 774 | Ga0501318_016336 | 3300049534 | Bacteria | 896 |
| 775 | Ga0501318_024719 | 3300049534 | Bacteria | 783 |
| 776 | Ga0501318_061271 | 3300049534 | Bacteria | 578 |
| 777 | Ga0501321_003257 | 3300049537 | Bacteria | 1473 |
| 778 | Ga0501331_14350 | 3300049547 | Bacteria | 519 |
| 779 | Ga0501034_0053353 | 3300049571 | Bacteria | 4071 |
| 780 | Ga0501036_0003482 | 3300049572 | Bacteria | 12582 |
| 781 | Ga0501038_0176256 | 3300049574 | Bacteria | 1728 |
| 782 | Ga0501038_0547403 | 3300049574 | Bacteria | 880 |
| 783 | Ga0501039_0268785 | 3300049575 | Bacteria | 1340 |
| 784 | Ga0501042_0425371 | 3300049578 | Bacteria | 962 |
| 785 | Ga0501046_0512696 | 3300049580 | Bacteria | 858 |
| 786 | Ga0501047_0011210 | 3300049581 | Bacteria | 8481 |
| 787 | Ga0501047_0237796 | 3300049581 | Bacteria | 1673 |
| 788 | Ga0501048_0614312 | 3300049582 | Bacteria | 780 |
| 789 | Ga0501074_0001033 | 3300049590 | Bacteria | 18071 |
| 790 | Ga0501077_0122674 | 3300049593 | Bacteria | 1647 |
| 791 | Ga0501044_0185669 | 3300049823 | Bacteria | 2044 |
| 792 | Ga0501044_0381359 | 3300049823 | Bacteria | 1325 |
| 793 | nmdc:mga0yw44_307371_c1 | 3300050492 | Bacteria | 1063 |
| 794 | nmdc:mga05p37_190695_c1 | 3300050507 | Bacteria | 2489 |
| 795 | nmdc:mga09592_525200_c1 | 3300050508 | Bacteria | 1018 |
| 796 | nmdc:mga06r32_130467_c2 | 3300050510 | Bacteria | 1202 |
| 797 | nmdc:mga06r32_697157_c1 | 3300050510 | Bacteria | 981 |
| 798 | nmdc:mga08y16_302547_c1 | 3300050511 | Bacteria | 1648 |
| 799 | nmdc:mga08y16_9435_c1 | 3300050511 | Bacteria | 10235 |
| 800 | nmdc:mga0n895_1378459_c1 | 3300050512 | Bacteria | 674 |
| 801 | nmdc:mga0n895_162137_c1 | 3300050512 | Bacteria | 2268 |
| 802 | nmdc:mga0n895_2047902_c1 | 3300050512 | Bacteria | 530 |
| 803 | nmdc:mga0n895_40350_c1 | 3300050512 | Bacteria | 4534 |
| 804 | nmdc:mga0rr50_118112_c1 | 3300050513 | Bacteria | 2107 |
| 805 | nmdc:mga0rr50_36381_c1 | 3300050513 | Bacteria | 3545 |
| 806 | nmdc:mga08x19_453598_c1 | 3300050514 | Bacteria | 903 |
| 807 | nmdc:mga08x19_4888_c1 | 3300050514 | Bacteria | 7922 |
| 808 | nmdc:mga0a205_12931_c1 | 3300050515 | Bacteria | 7744 |
| 809 | nmdc:mga0a205_1353402_c1 | 3300050515 | Bacteria | 560 |
| 810 | Ga0500568_0218260 | 3300053139 | Bacteria | 697 |
| 811 | Ga0587073_0105335 | 3300059492 | Bacteria | 739 |
| 812 | Ga0587073_0169057 | 3300059492 | Bacteria | 633 |
| 813 | Ga0587080_172566 | 3300059503 | Bacteria | 514 |
| 814 | Ga0587082_164319 | 3300059504 | Bacteria | 534 |
| 815 | Ga0587088_188038 | 3300059508 | Bacteria | 521 |
| 816 | Ga0587113_056077 | 3300059625 | Bacteria | 501 |
| 817 | Ga0587079_248815 | 3300059647 | Bacteria | 505 |
| 818 | Ga0587111_0282634 | 3300060346 | Bacteria | 502 |
| 819 | Ga0466962_0060741 | 3300061719 | Bacteria | 1804 |
| 820 | Ga0466962_0065534 | 3300061719 | Bacteria | 1734 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2579778521 | 2579855127 | 103 |
| 2 | iso_pu_bacteria | 2619618881 | 2619853012 | 103 |
| 3 | iso_pu_bacteria | 2619619003 | 2620351550 | 103 |
| 4 | iso_pu_bacteria | 2626541554 | 2626637312 | 103 |
| 5 | iso_pu_bacteria | 8054913762 | 8054918043 | 103 |
| 6 | 3300005337 | Ga0070682_100766130 | Ga0070682_1007661301 | 104 |
| 7 | 3300005564 | Ga0070664_100479402 | Ga0070664_1004794021 | 104 |
| 8 | 3300005616 | Ga0068852_102392668 | Ga0068852_1023926681 | 104 |
| 9 | 3300009177 | Ga0105248_12374324 | Ga0105248_123743241 | 104 |
| 10 | 3300020082 | Ga0206353_10167382 | Ga0206353_101673822 | 104 |
| 11 | 3300020610 | Ga0154015_1580325 | Ga0154015_15803252 | 104 |
| 12 | 3300025913 | Ga0207695_10075230 | Ga0207695_100752303 | 104 |
| 13 | 3300025924 | Ga0207694_10435768 | Ga0207694_104357681 | 104 |
| 14 | 3300025929 | Ga0207664_10104075 | Ga0207664_101040751 | 104 |
| 15 | 3300025929 | Ga0207664_11197995 | Ga0207664_111979952 | 104 |
| 16 | 3300025945 | Ga0207679_10744622 | Ga0207679_107446221 | 104 |
| 17 | 3300044658 | Ga0466972_0076024 | Ga0466972_0076024_599_913 | 104 |
| 18 | 3300044842 | Ga0466957_0393017 | Ga0466957_0393017_618_932 | 104 |
| 19 | 3300045976 | Ga0466967_0281702 | Ga0466967_0281702_1202_1516 | 104 |
| 20 | 3300049574 | Ga0501038_0176256 | Ga0501038_0176256_505_819 | 104 |
| 21 | 3300049581 | Ga0501047_0237796 | Ga0501047_0237796_377_691 | 104 |
| 22 | 3300049593 | Ga0501077_0122674 | Ga0501077_0122674_1014_1328 | 104 |
| 23 | 3300049823 | Ga0501044_0381359 | Ga0501044_0381359_988_1302 | 104 |
| 24 | iso_pu_bacteria | 2506783011 | 2506869112 | 104 |
| 25 | iso_pu_bacteria | 2527291627 | 2528202272 | 104 |
| 26 | iso_pu_bacteria | 2527291629 | 2528214531 | 104 |
| 27 | iso_pu_bacteria | 2546825537 | 2546947286 | 104 |
| 28 | iso_pu_bacteria | 2576861822 | 2579749481 | 104 |
| 29 | iso_pu_bacteria | 2671180195 | 2671837547 | 104 |
| 30 | iso_pu_bacteria | 2684623035 | 2686538021 | 104 |
| 31 | iso_pu_bacteria | 2684623036 | 2686542285 | 104 |
| 32 | iso_pu_bacteria | 2687453743 | 2689992499 | 104 |
| 33 | iso_pu_bacteria | 2710264753 | 2710603982 | 104 |
| 34 | iso_pu_bacteria | 2773857922 | 2774855703 | 104 |
| 35 | iso_pu_bacteria | 2773857924 | 2774865582 | 104 |
| 36 | iso_pu_bacteria | 2773857933 | 2774901515 | 104 |
| 37 | iso_pu_bacteria | 2895880812 | 2895888051 | 104 |
| 38 | iso_pu_bacteria | 637000116 | 637881870 | 104 |
| 39 | iso_pu_bacteria | 8055157932 | 8055161223 | 104 |
| 40 | 3300031665 | Ga0316575_10292596 | Ga0316575_102925962 | 105 |
| 41 | 3300031727 | Ga0316576_10001892 | Ga0316576_100018924 | 105 |
| 42 | 3300031727 | Ga0316576_10119181 | Ga0316576_101191813 | 105 |
| 43 | 3300031727 | Ga0316576_10394910 | Ga0316576_103949102 | 105 |
| 44 | 3300031728 | Ga0316578_10386461 | Ga0316578_103864612 | 105 |
| 45 | 3300031728 | Ga0316578_10920557 | Ga0316578_109205571 | 105 |
| 46 | 3300031733 | Ga0316577_10537161 | Ga0316577_105371612 | 105 |
| 47 | 3300032133 | Ga0316583_10289566 | Ga0316583_102895661 | 105 |
| 48 | 3300032137 | Ga0316585_10125639 | Ga0316585_101256392 | 105 |
| 49 | 3300032168 | Ga0316593_10036839 | Ga0316593_100368392 | 105 |
| 50 | 3300032168 | Ga0316593_10146215 | Ga0316593_101462152 | 105 |
| 51 | 3300033524 | Ga0316592_1083288 | Ga0316592_10832882 | 105 |
| 52 | 3300033528 | Ga0316588_1034364 | Ga0316588_10343642 | 105 |
| 53 | 3300033529 | Ga0316587_1012151 | Ga0316587_10121512 | 105 |
| 54 | 3300033541 | Ga0316596_1144469 | Ga0316596_11444691 | 105 |
| 55 | 3300033541 | Ga0316596_1205725 | Ga0316596_12057252 | 105 |
| 56 | 3300035398 | Ga0316574_0454401 | Ga0316574_0454401_338_658 | 105 |
| 57 | 3300036647 | Ga0316582_1036041 | Ga0316582_1036041_85_405 | 105 |
| 58 | 3300036712 | Ga0316584_0001134 | Ga0316584_0001134_10868_11188 | 105 |
| 59 | 3300036712 | Ga0316584_0029752 | Ga0316584_0029752_188_508 | 105 |
| 60 | 3300036712 | Ga0316584_0505673 | Ga0316584_0505673_74_394 | 105 |
| 61 | 3300045976 | Ga0466967_2049898 | Ga0466967_2049898_168_488 | 105 |
| 62 | 3300049571 | Ga0501034_0053353 | Ga0501034_0053353_3479_3799 | 105 |
| 63 | 3300049572 | Ga0501036_0003482 | Ga0501036_0003482_7201_7521 | 105 |
| 64 | 3300049574 | Ga0501038_0547403 | Ga0501038_0547403_17_337 | 105 |
| 65 | 3300049575 | Ga0501039_0268785 | Ga0501039_0268785_45_365 | 105 |
| 66 | 3300049578 | Ga0501042_0425371 | Ga0501042_0425371_353_673 | 105 |
| 67 | 3300049580 | Ga0501046_0512696 | Ga0501046_0512696_57_377 | 105 |
| 68 | 3300049581 | Ga0501047_0011210 | Ga0501047_0011210_288_608 | 105 |
| 69 | 3300049582 | Ga0501048_0614312 | Ga0501048_0614312_265_585 | 105 |
| 70 | 3300049590 | Ga0501074_0001033 | Ga0501074_0001033_307_627 | 105 |
| 71 | 3300049823 | Ga0501044_0185669 | Ga0501044_0185669_632_952 | 105 |
| 72 | 3300050492 | nmdc:mga0yw44_307371_c1 | nmdc:mga0yw44_307371_c1_121_441 | 105 |
| 73 | 3300053139 | Ga0500568_0218260 | Ga0500568_0218260_37_357 | 105 |
| 74 | iso_pu_bacteria | 2915358134 | 2915360571 | 105 |
| 75 | iso_pu_bacteria | 2995463766 | 2995468759 | 105 |
| 76 | 3300005466 | Ga0070685_11277154 | Ga0070685_112771541 | 106 |
| 77 | 3300009098 | Ga0105245_11316161 | Ga0105245_113161611 | 106 |
| 78 | 3300013105 | Ga0157369_12518212 | Ga0157369_125182121 | 106 |
| 79 | 3300025735 | Ga0207713_1189392 | Ga0207713_11893922 | 106 |
| 80 | 3300033541 | Ga0316596_1059175 | Ga0316596_10591751 | 106 |
| 81 | 3300035398 | Ga0316574_0206009 | Ga0316574_0206009_520_843 | 106 |
| 82 | 3300036712 | Ga0316584_0114016 | Ga0316584_0114016_499_822 | 106 |
| 83 | 3300046499 | Ga0495594_0068287 | Ga0495594_0068287_53_379 | 106 |
| 84 | 3300049533 | Ga0501317_027594 | Ga0501317_027594_17_340 | 106 |
| 85 | 3300049547 | Ga0501331_14350 | Ga0501331_14350_162_485 | 106 |
| 86 | 3300059503 | Ga0587080_172566 | Ga0587080_172566_38_361 | 106 |
| 87 | 3300003308 | Ga0006777J48905_1093645 | Ga0006777J48905_10936452 | 107 |
| 88 | 3300003544 | Ga0007417J51691_1093063 | Ga0007417J51691_10930631 | 107 |
| 89 | 3300003579 | Ga0007429J51699_1045772 | Ga0007429J51699_10457721 | 107 |
| 90 | 3300003693 | Ga0032354_1024214 | Ga0032354_10242142 | 107 |
| 91 | 3300003693 | Ga0032354_1080657 | Ga0032354_10806572 | 107 |
| 92 | 3300004785 | Ga0058858_1430783 | Ga0058858_14307832 | 107 |
| 93 | 3300004785 | Ga0058858_1435338 | Ga0058858_14353382 | 107 |
| 94 | 3300004799 | Ga0058863_11752507 | Ga0058863_117525071 | 107 |
| 95 | 3300005335 | Ga0070666_10928554 | Ga0070666_109285541 | 107 |
| 96 | 3300005337 | Ga0070682_100194688 | Ga0070682_1001946881 | 107 |
| 97 | 3300005344 | Ga0070661_101134917 | Ga0070661_1011349172 | 107 |
| 98 | 3300005347 | Ga0070668_101034674 | Ga0070668_1010346741 | 107 |
| 99 | 3300005356 | Ga0070674_100187609 | Ga0070674_1001876092 | 107 |
| 100 | 3300005366 | Ga0070659_101341381 | Ga0070659_1013413811 | 107 |
| 101 | 3300005367 | Ga0070667_100891019 | Ga0070667_1008910191 | 107 |
| 102 | 3300005455 | Ga0070663_100782477 | Ga0070663_1007824772 | 107 |
| 103 | 3300005456 | Ga0070678_100804334 | Ga0070678_1008043342 | 107 |
| 104 | 3300005466 | Ga0070685_10142355 | Ga0070685_101423551 | 107 |
| 105 | 3300005543 | Ga0070672_101262994 | Ga0070672_1012629941 | 107 |
| 106 | 3300005548 | Ga0070665_101908014 | Ga0070665_1019080142 | 107 |
| 107 | 3300005616 | Ga0068852_100236747 | Ga0068852_1002367472 | 107 |
| 108 | 3300005841 | Ga0068863_102012020 | Ga0068863_1020120201 | 107 |
| 109 | 3300006028 | Ga0070717_10582937 | Ga0070717_105829371 | 107 |
| 110 | 3300009011 | Ga0105251_10109050 | Ga0105251_101090501 | 107 |
| 111 | 3300009093 | Ga0105240_10260258 | Ga0105240_102602583 | 107 |
| 112 | 3300009098 | Ga0105245_10347345 | Ga0105245_103473452 | 107 |
| 113 | 3300009101 | Ga0105247_10000024 | Ga0105247_10000024123 | 107 |
| 114 | 3300009148 | Ga0105243_10845882 | Ga0105243_108458822 | 107 |
| 115 | 3300009148 | Ga0105243_11015025 | Ga0105243_110150252 | 107 |
| 116 | 3300009174 | Ga0105241_11505525 | Ga0105241_115055251 | 107 |
| 117 | 3300009176 | Ga0105242_12172646 | Ga0105242_121726461 | 107 |
| 118 | 3300009177 | Ga0105248_10001056 | Ga0105248_1000105619 | 107 |
| 119 | 3300009545 | Ga0105237_11432203 | Ga0105237_114322032 | 107 |
| 120 | 3300010375 | Ga0105239_12249420 | Ga0105239_122494201 | 107 |
| 121 | 3300011119 | Ga0105246_10411213 | Ga0105246_104112132 | 107 |
| 122 | 3300011119 | Ga0105246_10513732 | Ga0105246_105137322 | 107 |
| 123 | 3300011119 | Ga0105246_10524359 | Ga0105246_105243592 | 107 |
| 124 | 3300012477 | Ga0157336_1018690 | Ga0157336_10186901 | 107 |
| 125 | 3300013296 | Ga0157374_11240233 | Ga0157374_112402331 | 107 |
| 126 | 3300013296 | Ga0157374_11608267 | Ga0157374_116082671 | 107 |
| 127 | 3300013306 | Ga0163162_10559158 | Ga0163162_105591582 | 107 |
| 128 | 3300013306 | Ga0163162_11294678 | Ga0163162_112946781 | 107 |
| 129 | 3300013306 | Ga0163162_11630720 | Ga0163162_116307202 | 107 |
| 130 | 3300013307 | Ga0157372_10000004 | Ga0157372_10000004162 | 107 |
| 131 | 3300013307 | Ga0157372_10316410 | Ga0157372_103164102 | 107 |
| 132 | 3300013307 | Ga0157372_10470615 | Ga0157372_104706151 | 107 |
| 133 | 3300013308 | Ga0157375_10513509 | Ga0157375_105135092 | 107 |
| 134 | 3300013308 | Ga0157375_11054265 | Ga0157375_110542652 | 107 |
| 135 | 3300013308 | Ga0157375_11127373 | Ga0157375_111273732 | 107 |
| 136 | 3300014325 | Ga0163163_10060853 | Ga0163163_100608532 | 107 |
| 137 | 3300014325 | Ga0163163_10123902 | Ga0163163_101239023 | 107 |
| 138 | 3300014745 | Ga0157377_11056712 | Ga0157377_110567121 | 107 |
| 139 | 3300014968 | Ga0157379_10025436 | Ga0157379_100254362 | 107 |
| 140 | 3300014968 | Ga0157379_10324576 | Ga0157379_103245762 | 107 |
| 141 | 3300014969 | Ga0157376_10332741 | Ga0157376_103327412 | 107 |
| 142 | 3300014969 | Ga0157376_10353219 | Ga0157376_103532192 | 107 |
| 143 | 3300014969 | Ga0157376_10527499 | Ga0157376_105274992 | 107 |
| 144 | 3300014969 | Ga0157376_10856823 | Ga0157376_108568232 | 107 |
| 145 | 3300014969 | Ga0157376_12923460 | Ga0157376_129234601 | 107 |
| 146 | 3300017792 | Ga0163161_10419030 | Ga0163161_104190301 | 107 |
| 147 | 3300017792 | Ga0163161_10871350 | Ga0163161_108713502 | 107 |
| 148 | 3300020069 | Ga0197907_10349344 | Ga0197907_103493441 | 107 |
| 149 | 3300020069 | Ga0197907_10650100 | Ga0197907_106501001 | 107 |
| 150 | 3300020069 | Ga0197907_10999803 | Ga0197907_109998031 | 107 |
| 151 | 3300020069 | Ga0197907_11208770 | Ga0197907_112087702 | 107 |
| 152 | 3300020070 | Ga0206356_10676114 | Ga0206356_106761141 | 107 |
| 153 | 3300020075 | Ga0206349_1272775 | Ga0206349_12727752 | 107 |
| 154 | 3300020076 | Ga0206355_1080654 | Ga0206355_10806542 | 107 |
| 155 | 3300020076 | Ga0206355_1521014 | Ga0206355_15210141 | 107 |
| 156 | 3300020077 | Ga0206351_10607123 | Ga0206351_106071232 | 107 |
| 157 | 3300020078 | Ga0206352_10015410 | Ga0206352_100154101 | 107 |
| 158 | 3300020078 | Ga0206352_11140863 | Ga0206352_111408631 | 107 |
| 159 | 3300020078 | Ga0206352_11246446 | Ga0206352_112464462 | 107 |
| 160 | 3300020081 | Ga0206354_11499300 | Ga0206354_114993001 | 107 |
| 161 | 3300020082 | Ga0206353_11061505 | Ga0206353_110615052 | 107 |
| 162 | 3300020082 | Ga0206353_11066816 | Ga0206353_110668162 | 107 |
| 163 | 3300022467 | Ga0224712_10089803 | Ga0224712_100898032 | 107 |
| 164 | 3300022467 | Ga0224712_10161127 | Ga0224712_101611271 | 107 |
| 165 | 3300022467 | Ga0224712_10401055 | Ga0224712_104010551 | 107 |
| 166 | 3300023680 | Ga0247528_112676 | Ga0247528_1126761 | 107 |
| 167 | 3300025735 | Ga0207713_1072822 | Ga0207713_10728222 | 107 |
| 168 | 3300025900 | Ga0207710_10000045 | Ga0207710_1000004558 | 107 |
| 169 | 3300025901 | Ga0207688_10083125 | Ga0207688_100831251 | 107 |
| 170 | 3300025903 | Ga0207680_10874226 | Ga0207680_108742261 | 107 |
| 171 | 3300025911 | Ga0207654_10984501 | Ga0207654_109845012 | 107 |
| 172 | 3300025913 | Ga0207695_10218088 | Ga0207695_102180882 | 107 |
| 173 | 3300025924 | Ga0207694_11395896 | Ga0207694_113958961 | 107 |
| 174 | 3300025927 | Ga0207687_10080672 | Ga0207687_100806722 | 107 |
| 175 | 3300025927 | Ga0207687_10171318 | Ga0207687_101713182 | 107 |
| 176 | 3300025927 | Ga0207687_11047200 | Ga0207687_110472001 | 107 |
| 177 | 3300025932 | Ga0207690_10952056 | Ga0207690_109520562 | 107 |
| 178 | 3300025934 | Ga0207686_11262386 | Ga0207686_112623861 | 107 |
| 179 | 3300025935 | Ga0207709_10813660 | Ga0207709_108136601 | 107 |
| 180 | 3300025937 | Ga0207669_10239027 | Ga0207669_102390271 | 107 |
| 181 | 3300025941 | Ga0207711_10002931 | Ga0207711_100029318 | 107 |
| 182 | 3300025949 | Ga0207667_10867626 | Ga0207667_108676262 | 107 |
| 183 | 3300025972 | Ga0207668_11023261 | Ga0207668_110232611 | 107 |
| 184 | 3300025986 | Ga0207658_11469115 | Ga0207658_114691152 | 107 |
| 185 | 3300026023 | Ga0207677_10933446 | Ga0207677_109334461 | 107 |
| 186 | 3300026067 | Ga0207678_10257393 | Ga0207678_102573932 | 107 |
| 187 | 3300026095 | Ga0207676_10120609 | Ga0207676_101206092 | 107 |
| 188 | 3300026121 | Ga0207683_10154486 | Ga0207683_101544862 | 107 |
| 189 | 3300026121 | Ga0207683_10886916 | Ga0207683_108869163 | 107 |
| 190 | 3300026142 | Ga0207698_10395815 | Ga0207698_103958152 | 107 |
| 191 | 3300028379 | Ga0268266_12163106 | Ga0268266_121631062 | 107 |
| 192 | 3300028800 | Ga0265338_10005202 | Ga0265338_100052028 | 107 |
| 193 | 3300028800 | Ga0265338_10010328 | Ga0265338_100103286 | 107 |
| 194 | 3300031616 | Ga0307508_10276192 | Ga0307508_102761922 | 107 |
| 195 | 3300031816 | Ga0316042_126616 | Ga0316042_1266161 | 107 |
| 196 | 3300039453 | Ga0436362_1001710 | Ga0436362_1001710_748_1074 | 107 |
| 197 | 3300041441 | Ga0451787_606478 | Ga0451787_606478_490_813 | 107 |
| 198 | 3300041443 | Ga0451789_0545708 | Ga0451789_0545708_502_825 | 107 |
| 199 | 3300041451 | Ga0451791_0034478 | Ga0451791_0034478_294_617 | 107 |
| 200 | 3300041452 | Ga0451793_0143711 | Ga0451793_0143711_1663_1986 | 107 |
| 201 | 3300041453 | Ga0451797_0134441 | Ga0451797_0134441_1096_1419 | 107 |
| 202 | 3300041453 | Ga0451797_0880098 | Ga0451797_0880098_226_549 | 107 |
| 203 | 3300041456 | Ga0451795_0030371 | Ga0451795_0030371_14_337 | 107 |
| 204 | 3300041459 | Ga0451800_0901040 | Ga0451800_0901040_378_701 | 107 |
| 205 | 3300041463 | Ga0451804_0895874 | Ga0451804_0895874_322_645 | 107 |
| 206 | 3300041491 | Ga0451833_0089908 | Ga0451833_0089908_849_1172 | 107 |
| 207 | 3300041494 | Ga0451837_1276101 | Ga0451837_1276101_1901_2224 | 107 |
| 208 | 3300041496 | Ga0451839_0579003 | Ga0451839_0579003_738_1061 | 107 |
| 209 | 3300041509 | Ga0451843_0638116 | Ga0451843_0638116_279_602 | 107 |
| 210 | 3300041509 | Ga0451843_0815425 | Ga0451843_0815425_5632_5955 | 107 |
| 211 | 3300041511 | Ga0451855_1182033 | Ga0451855_1182033_507_830 | 107 |
| 212 | 3300041512 | Ga0451853_0777022 | Ga0451853_0777022_1676_1999 | 107 |
| 213 | 3300044694 | Ga0466963_0060280 | Ga0466963_0060280_1216_1542 | 107 |
| 214 | 3300044694 | Ga0466963_0114187 | Ga0466963_0114187_703_1029 | 107 |
| 215 | 3300044694 | Ga0466963_0952140 | Ga0466963_0952140_176_502 | 107 |
| 216 | 3300044719 | Ga0466971_0558288 | Ga0466971_0558288_152_478 | 107 |
| 217 | 3300044842 | Ga0466957_0352699 | Ga0466957_0352699_588_914 | 107 |
| 218 | 3300044901 | Ga0466960_0104511 | Ga0466960_0104511_37_363 | 107 |
| 219 | 3300045836 | Ga0466958_0637588 | Ga0466958_0637588_75_401 | 107 |
| 220 | 3300045976 | Ga0466967_0064715 | Ga0466967_0064715_2173_2499 | 107 |
| 221 | 3300046459 | Ga0495629_0086040 | Ga0495629_0086040_1817_2140 | 107 |
| 222 | 3300046461 | Ga0495641_0338557 | Ga0495641_0338557_229_552 | 107 |
| 223 | 3300046463 | Ga0495653_0904243 | Ga0495653_0904243_101_424 | 107 |
| 224 | 3300046473 | Ga0495582_0189340 | Ga0495582_0189340_23_346 | 107 |
| 225 | 3300046475 | Ga0495639_0095351 | Ga0495639_0095351_992_1315 | 107 |
| 226 | 3300046511 | Ga0495608_0859053 | Ga0495608_0859053_23_346 | 107 |
| 227 | 3300046514 | Ga0495618_0872476 | Ga0495618_0872476_36_359 | 107 |
| 228 | 3300046517 | Ga0495630_0819977 | Ga0495630_0819977_224_547 | 107 |
| 229 | 3300046531 | Ga0495665_0218712 | Ga0495665_0218712_418_741 | 107 |
| 230 | 3300046533 | Ga0495640_0157795 | Ga0495640_0157795_1059_1382 | 107 |
| 231 | 3300046559 | Ga0495667_0532374 | Ga0495667_0532374_83_406 | 107 |
| 232 | 3300046663 | Ga0495635_0697794 | Ga0495635_0697794_225_548 | 107 |
| 233 | 3300046674 | Ga0495588_0743363 | Ga0495588_0743363_162_485 | 107 |
| 234 | 3300046690 | Ga0495624_0181829 | Ga0495624_0181829_89_412 | 107 |
| 235 | 3300046809 | Ga0495600_0058234 | Ga0495600_0058234_724_1047 | 107 |
| 236 | 3300046809 | Ga0495600_0795424 | Ga0495600_0795424_192_515 | 107 |
| 237 | 3300047315 | Ga0495581_0105472 | Ga0495581_0105472_1122_1445 | 107 |
| 238 | 3300047315 | Ga0495581_0160350 | Ga0495581_0160350_731_1054 | 107 |
| 239 | 3300047315 | Ga0495581_0907065 | Ga0495581_0907065_107_430 | 107 |
| 240 | 3300047321 | Ga0495676_0120545 | Ga0495676_0120545_1354_1677 | 107 |
| 241 | 3300047322 | Ga0495680_0343885 | Ga0495680_0343885_180_503 | 107 |
| 242 | 3300047322 | Ga0495680_0748019 | Ga0495680_0748019_166_489 | 107 |
| 243 | 3300047471 | Ga0495684_0898609 | Ga0495684_0898609_124_447 | 107 |
| 244 | 3300047673 | Ga0495593_0377984 | Ga0495593_0377984_113_436 | 107 |
| 245 | 3300048903 | Ga0496100_0752727 | Ga0496100_0752727_32_355 | 107 |
| 246 | 3300048904 | Ga0496101_0091285 | Ga0496101_0091285_275_601 | 107 |
| 247 | 3300048904 | Ga0496101_1471562 | Ga0496101_1471562_75_398 | 107 |
| 248 | 3300048905 | Ga0496102_0018028 | Ga0496102_0018028_1112_1435 | 107 |
| 249 | 3300048905 | Ga0496102_0332561 | Ga0496102_0332561_1066_1389 | 107 |
| 250 | 3300048905 | Ga0496102_0474381 | Ga0496102_0474381_548_874 | 107 |
| 251 | 3300048906 | Ga0496103_0074701 | Ga0496103_0074701_157_483 | 107 |
| 252 | 3300048906 | Ga0496103_0333389 | Ga0496103_0333389_310_636 | 107 |
| 253 | 3300048907 | Ga0496104_0015067 | Ga0496104_0015067_3043_3366 | 107 |
| 254 | 3300048908 | Ga0496105_0004142 | Ga0496105_0004142_5337_5660 | 107 |
| 255 | 3300048911 | Ga0496108_0001314 | Ga0496108_0001314_11844_12167 | 107 |
| 256 | 3300048911 | Ga0496108_0068054 | Ga0496108_0068054_2007_2330 | 107 |
| 257 | 3300048911 | Ga0496108_0878912 | Ga0496108_0878912_392_715 | 107 |
| 258 | 3300048912 | Ga0496109_0002656 | Ga0496109_0002656_7367_7690 | 107 |
| 259 | 3300048912 | Ga0496109_0200278 | Ga0496109_0200278_118_441 | 107 |
| 260 | 3300048912 | Ga0496109_1106651 | Ga0496109_1106651_241_564 | 107 |
| 261 | 3300048913 | Ga0496110_0000656 | Ga0496110_0000656_15080_15403 | 107 |
| 262 | 3300048913 | Ga0496110_0883737 | Ga0496110_0883737_254_577 | 107 |
| 263 | 3300048914 | Ga0496111_0001201 | Ga0496111_0001201_1650_1973 | 107 |
| 264 | 3300048914 | Ga0496111_0849878 | Ga0496111_0849878_176_499 | 107 |
| 265 | 3300048916 | Ga0496113_0003887 | Ga0496113_0003887_4548_4871 | 107 |
| 266 | 3300048917 | Ga0496114_0069225 | Ga0496114_0069225_1144_1467 | 107 |
| 267 | 3300048917 | Ga0496114_0175534 | Ga0496114_0175534_479_802 | 107 |
| 268 | 3300048917 | Ga0496114_0217136 | Ga0496114_0217136_242_568 | 107 |
| 269 | 3300048917 | Ga0496114_1048914 | Ga0496114_1048914_272_595 | 107 |
| 270 | 3300048917 | Ga0496114_1768804 | Ga0496114_1768804_41_364 | 107 |
| 271 | 3300048918 | Ga0496115_0137391 | Ga0496115_0137391_42_368 | 107 |
| 272 | 3300048918 | Ga0496115_0279994 | Ga0496115_0279994_92_415 | 107 |
| 273 | 3300048918 | Ga0496115_0343953 | Ga0496115_0343953_814_1137 | 107 |
| 274 | 3300048922 | Ga0496119_0001274 | Ga0496119_0001274_25014_25340 | 107 |
| 275 | 3300048923 | Ga0496120_0000892 | Ga0496120_0000892_26476_26802 | 107 |
| 276 | 3300048924 | Ga0496121_0014534 | Ga0496121_0014534_119_445 | 107 |
| 277 | 3300048929 | Ga0496126_0000003 | Ga0496126_0000003_72737_73063 | 107 |
| 278 | 3300049129 | Ga0501309_070125 | Ga0501309_070125_56_382 | 107 |
| 279 | 3300049534 | Ga0501318_002713 | Ga0501318_002713_95_421 | 107 |
| 280 | 3300049534 | Ga0501318_061271 | Ga0501318_061271_20_346 | 107 |
| 281 | 3300059504 | Ga0587082_164319 | Ga0587082_164319_189_515 | 107 |
| 282 | 3300059647 | Ga0587079_248815 | Ga0587079_248815_111_437 | 107 |
| 283 | 3300060346 | Ga0587111_0282634 | Ga0587111_0282634_20_343 | 107 |
| 284 | 3300061719 | Ga0466962_0060741 | Ga0466962_0060741_1249_1575 | 107 |
| 285 | iso_pu_bacteria | 8054920844 | 8054926864 | 107 |
| 286 | 3300001915 | JGI24741J21665_1021311 | JGI24741J21665_10213112 | 108 |
| 287 | 3300001976 | JGI24752J21851_1006979 | JGI24752J21851_10069792 | 108 |
| 288 | 3300001977 | JGI24746J21847_1014990 | JGI24746J21847_10149902 | 108 |
| 289 | 3300001979 | JGI24740J21852_10092970 | JGI24740J21852_100929702 | 108 |
| 290 | 3300001979 | JGI24740J21852_10168524 | JGI24740J21852_101685242 | 108 |
| 291 | 3300002155 | JGI24033J26618_1030347 | JGI24033J26618_10303472 | 108 |
| 292 | 3300002459 | JGI24751J29686_10009980 | JGI24751J29686_100099802 | 108 |
| 293 | 3300003162 | Ga0006778J45830_1015158 | Ga0006778J45830_10151582 | 108 |
| 294 | 3300003577 | Ga0007416J51690_1121851 | Ga0007416J51690_11218511 | 108 |
| 295 | 3300004798 | Ga0058859_11831860 | Ga0058859_118318601 | 108 |
| 296 | 3300004799 | Ga0058863_11795119 | Ga0058863_117951192 | 108 |
| 297 | 3300004799 | Ga0058863_11969637 | Ga0058863_119696372 | 108 |
| 298 | 3300004800 | Ga0058861_10038173 | Ga0058861_100381732 | 108 |
| 299 | 3300004800 | Ga0058861_10053673 | Ga0058861_100536732 | 108 |
| 300 | 3300004801 | Ga0058860_12223939 | Ga0058860_122239391 | 108 |
| 301 | 3300004803 | Ga0058862_10004410 | Ga0058862_100044102 | 108 |
| 302 | 3300004803 | Ga0058862_10052241 | Ga0058862_100522411 | 108 |
| 303 | 3300004803 | Ga0058862_12662569 | Ga0058862_126625692 | 108 |
| 304 | 3300004803 | Ga0058862_12834696 | Ga0058862_128346962 | 108 |
| 305 | 3300005327 | Ga0070658_10140252 | Ga0070658_101402523 | 108 |
| 306 | 3300005327 | Ga0070658_10160401 | Ga0070658_101604012 | 108 |
| 307 | 3300005328 | Ga0070676_10453536 | Ga0070676_104535361 | 108 |
| 308 | 3300005329 | Ga0070683_100709508 | Ga0070683_1007095082 | 108 |
| 309 | 3300005329 | Ga0070683_100854729 | Ga0070683_1008547291 | 108 |
| 310 | 3300005330 | Ga0070690_100061856 | Ga0070690_1000618563 | 108 |
| 311 | 3300005330 | Ga0070690_100088821 | Ga0070690_1000888212 | 108 |
| 312 | 3300005331 | Ga0070670_100013557 | Ga0070670_1000135577 | 108 |
| 313 | 3300005331 | Ga0070670_100259383 | Ga0070670_1002593832 | 108 |
| 314 | 3300005334 | Ga0068869_100004413 | Ga0068869_1000044133 | 108 |
| 315 | 3300005334 | Ga0068869_100276573 | Ga0068869_1002765732 | 108 |
| 316 | 3300005335 | Ga0070666_10012116 | Ga0070666_100121164 | 108 |
| 317 | 3300005335 | Ga0070666_10081633 | Ga0070666_100816333 | 108 |
| 318 | 3300005336 | Ga0070680_100016246 | Ga0070680_1000162463 | 108 |
| 319 | 3300005336 | Ga0070680_100242630 | Ga0070680_1002426302 | 108 |
| 320 | 3300005337 | Ga0070682_100003294 | Ga0070682_1000032943 | 108 |
| 321 | 3300005337 | Ga0070682_100008216 | Ga0070682_1000082163 | 108 |
| 322 | 3300005337 | Ga0070682_100037889 | Ga0070682_1000378892 | 108 |
| 323 | 3300005337 | Ga0070682_100729476 | Ga0070682_1007294762 | 108 |
| 324 | 3300005337 | Ga0070682_101518458 | Ga0070682_1015184581 | 108 |
| 325 | 3300005338 | Ga0068868_100008441 | Ga0068868_1000084412 | 108 |
| 326 | 3300005338 | Ga0068868_100155395 | Ga0068868_1001553952 | 108 |
| 327 | 3300005339 | Ga0070660_100006740 | Ga0070660_1000067408 | 108 |
| 328 | 3300005340 | Ga0070689_100068893 | Ga0070689_1000688932 | 108 |
| 329 | 3300005340 | Ga0070689_100128592 | Ga0070689_1001285923 | 108 |
| 330 | 3300005340 | Ga0070689_100211674 | Ga0070689_1002116742 | 108 |
| 331 | 3300005341 | Ga0070691_10008108 | Ga0070691_100081085 | 108 |
| 332 | 3300005341 | Ga0070691_10194959 | Ga0070691_101949592 | 108 |
| 333 | 3300005343 | Ga0070687_100065344 | Ga0070687_1000653442 | 108 |
| 334 | 3300005343 | Ga0070687_100730420 | Ga0070687_1007304201 | 108 |
| 335 | 3300005344 | Ga0070661_100145236 | Ga0070661_1001452362 | 108 |
| 336 | 3300005344 | Ga0070661_101364047 | Ga0070661_1013640471 | 108 |
| 337 | 3300005345 | Ga0070692_10002095 | Ga0070692_100020956 | 108 |
| 338 | 3300005345 | Ga0070692_10022846 | Ga0070692_100228463 | 108 |
| 339 | 3300005345 | Ga0070692_10324671 | Ga0070692_103246712 | 108 |
| 340 | 3300005347 | Ga0070668_100587720 | Ga0070668_1005877202 | 108 |
| 341 | 3300005354 | Ga0070675_100015059 | Ga0070675_1000150593 | 108 |
| 342 | 3300005355 | Ga0070671_100006414 | Ga0070671_1000064146 | 108 |
| 343 | 3300005355 | Ga0070671_100008056 | Ga0070671_1000080562 | 108 |
| 344 | 3300005355 | Ga0070671_100034922 | Ga0070671_1000349222 | 108 |
| 345 | 3300005355 | Ga0070671_101538629 | Ga0070671_1015386291 | 108 |
| 346 | 3300005356 | Ga0070674_100070094 | Ga0070674_1000700943 | 108 |
| 347 | 3300005356 | Ga0070674_101514688 | Ga0070674_1015146882 | 108 |
| 348 | 3300005364 | Ga0070673_100031198 | Ga0070673_1000311983 | 108 |
| 349 | 3300005364 | Ga0070673_100178389 | Ga0070673_1001783892 | 108 |
| 350 | 3300005365 | Ga0070688_100545011 | Ga0070688_1005450112 | 108 |
| 351 | 3300005366 | Ga0070659_100052882 | Ga0070659_1000528823 | 108 |
| 352 | 3300005366 | Ga0070659_100291745 | Ga0070659_1002917452 | 108 |
| 353 | 3300005367 | Ga0070667_100029794 | Ga0070667_1000297944 | 108 |
| 354 | 3300005367 | Ga0070667_101372630 | Ga0070667_1013726301 | 108 |
| 355 | 3300005367 | Ga0070667_101442397 | Ga0070667_1014423971 | 108 |
| 356 | 3300005406 | Ga0070703_10017715 | Ga0070703_100177152 | 108 |
| 357 | 3300005406 | Ga0070703_10405124 | Ga0070703_104051241 | 108 |
| 358 | 3300005434 | Ga0070709_10019732 | Ga0070709_100197324 | 108 |
| 359 | 3300005434 | Ga0070709_10135399 | Ga0070709_101353992 | 108 |
| 360 | 3300005435 | Ga0070714_100111396 | Ga0070714_1001113962 | 108 |
| 361 | 3300005436 | Ga0070713_100141291 | Ga0070713_1001412912 | 108 |
| 362 | 3300005436 | Ga0070713_100269258 | Ga0070713_1002692582 | 108 |
| 363 | 3300005437 | Ga0070710_10469865 | Ga0070710_104698651 | 108 |
| 364 | 3300005438 | Ga0070701_10023654 | Ga0070701_100236543 | 108 |
| 365 | 3300005438 | Ga0070701_10052081 | Ga0070701_100520811 | 108 |
| 366 | 3300005439 | Ga0070711_100009279 | Ga0070711_1000092793 | 108 |
| 367 | 3300005439 | Ga0070711_100012490 | Ga0070711_1000124904 | 108 |
| 368 | 3300005440 | Ga0070705_100020780 | Ga0070705_1000207802 | 108 |
| 369 | 3300005440 | Ga0070705_100567736 | Ga0070705_1005677362 | 108 |
| 370 | 3300005441 | Ga0070700_100004331 | Ga0070700_1000043313 | 108 |
| 371 | 3300005441 | Ga0070700_100006526 | Ga0070700_1000065264 | 108 |
| 372 | 3300005444 | Ga0070694_100023644 | Ga0070694_1000236443 | 108 |
| 373 | 3300005455 | Ga0070663_100047212 | Ga0070663_1000472122 | 108 |
| 374 | 3300005455 | Ga0070663_100156191 | Ga0070663_1001561912 | 108 |
| 375 | 3300005456 | Ga0070678_100021273 | Ga0070678_1000212734 | 108 |
| 376 | 3300005456 | Ga0070678_100062656 | Ga0070678_1000626562 | 108 |
| 377 | 3300005456 | Ga0070678_100445707 | Ga0070678_1004457072 | 108 |
| 378 | 3300005456 | Ga0070678_100615579 | Ga0070678_1006155791 | 108 |
| 379 | 3300005456 | Ga0070678_100766593 | Ga0070678_1007665931 | 108 |
| 380 | 3300005457 | Ga0070662_100134006 | Ga0070662_1001340062 | 108 |
| 381 | 3300005457 | Ga0070662_100651061 | Ga0070662_1006510612 | 108 |
| 382 | 3300005458 | Ga0070681_10316703 | Ga0070681_103167032 | 108 |
| 383 | 3300005459 | Ga0068867_100945659 | Ga0068867_1009456592 | 108 |
| 384 | 3300005466 | Ga0070685_10028835 | Ga0070685_100288352 | 108 |
| 385 | 3300005466 | Ga0070685_10092956 | Ga0070685_100929563 | 108 |
| 386 | 3300005466 | Ga0070685_11622873 | Ga0070685_116228731 | 108 |
| 387 | 3300005467 | Ga0070706_101740907 | Ga0070706_1017409071 | 108 |
| 388 | 3300005530 | Ga0070679_100120169 | Ga0070679_1001201693 | 108 |
| 389 | 3300005530 | Ga0070679_100319214 | Ga0070679_1003192142 | 108 |
| 390 | 3300005530 | Ga0070679_101286186 | Ga0070679_1012861862 | 108 |
| 391 | 3300005535 | Ga0070684_100237449 | Ga0070684_1002374492 | 108 |
| 392 | 3300005535 | Ga0070684_100519979 | Ga0070684_1005199791 | 108 |
| 393 | 3300005535 | Ga0070684_101882031 | Ga0070684_1018820311 | 108 |
| 394 | 3300005536 | Ga0070697_101604653 | Ga0070697_1016046532 | 108 |
| 395 | 3300005539 | Ga0068853_100042716 | Ga0068853_1000427163 | 108 |
| 396 | 3300005539 | Ga0068853_100372293 | Ga0068853_1003722932 | 108 |
| 397 | 3300005539 | Ga0068853_100462842 | Ga0068853_1004628422 | 108 |
| 398 | 3300005543 | Ga0070672_100034382 | Ga0070672_1000343823 | 108 |
| 399 | 3300005543 | Ga0070672_100319926 | Ga0070672_1003199262 | 108 |
| 400 | 3300005543 | Ga0070672_100649960 | Ga0070672_1006499602 | 108 |
| 401 | 3300005544 | Ga0070686_100062377 | Ga0070686_1000623772 | 108 |
| 402 | 3300005544 | Ga0070686_100188776 | Ga0070686_1001887762 | 108 |
| 403 | 3300005544 | Ga0070686_100353493 | Ga0070686_1003534932 | 108 |
| 404 | 3300005545 | Ga0070695_100196305 | Ga0070695_1001963052 | 108 |
| 405 | 3300005545 | Ga0070695_100242902 | Ga0070695_1002429022 | 108 |
| 406 | 3300005545 | Ga0070695_101323907 | Ga0070695_1013239072 | 108 |
| 407 | 3300005546 | Ga0070696_100103425 | Ga0070696_1001034252 | 108 |
| 408 | 3300005547 | Ga0070693_100002461 | Ga0070693_1000024613 | 108 |
| 409 | 3300005547 | Ga0070693_100039609 | Ga0070693_1000396092 | 108 |
| 410 | 3300005548 | Ga0070665_100166349 | Ga0070665_1001663492 | 108 |
| 411 | 3300005548 | Ga0070665_100341833 | Ga0070665_1003418331 | 108 |
| 412 | 3300005548 | Ga0070665_100486710 | Ga0070665_1004867102 | 108 |
| 413 | 3300005549 | Ga0070704_100144995 | Ga0070704_1001449952 | 108 |
| 414 | 3300005563 | Ga0068855_100020107 | Ga0068855_1000201078 | 108 |
| 415 | 3300005564 | Ga0070664_100024970 | Ga0070664_1000249705 | 108 |
| 416 | 3300005564 | Ga0070664_100033081 | Ga0070664_1000330813 | 108 |
| 417 | 3300005564 | Ga0070664_101473803 | Ga0070664_1014738032 | 108 |
| 418 | 3300005577 | Ga0068857_100701137 | Ga0068857_1007011372 | 108 |
| 419 | 3300005577 | Ga0068857_100919350 | Ga0068857_1009193501 | 108 |
| 420 | 3300005578 | Ga0068854_100071782 | Ga0068854_1000717822 | 108 |
| 421 | 3300005578 | Ga0068854_100079579 | Ga0068854_1000795793 | 108 |
| 422 | 3300005578 | Ga0068854_100494698 | Ga0068854_1004946982 | 108 |
| 423 | 3300005614 | Ga0068856_100012332 | Ga0068856_1000123323 | 108 |
| 424 | 3300005614 | Ga0068856_100139606 | Ga0068856_1001396062 | 108 |
| 425 | 3300005615 | Ga0070702_100019496 | Ga0070702_1000194962 | 108 |
| 426 | 3300005615 | Ga0070702_100059763 | Ga0070702_1000597633 | 108 |
| 427 | 3300005615 | Ga0070702_101097327 | Ga0070702_1010973272 | 108 |
| 428 | 3300005616 | Ga0068852_100053614 | Ga0068852_1000536143 | 108 |
| 429 | 3300005616 | Ga0068852_100082606 | Ga0068852_1000826063 | 108 |
| 430 | 3300005616 | Ga0068852_100766374 | Ga0068852_1007663742 | 108 |
| 431 | 3300005617 | Ga0068859_100019852 | Ga0068859_1000198523 | 108 |
| 432 | 3300005617 | Ga0068859_100038562 | Ga0068859_1000385624 | 108 |
| 433 | 3300005617 | Ga0068859_100431008 | Ga0068859_1004310082 | 108 |
| 434 | 3300005618 | Ga0068864_100005825 | Ga0068864_1000058255 | 108 |
| 435 | 3300005618 | Ga0068864_100018168 | Ga0068864_1000181682 | 108 |
| 436 | 3300005618 | Ga0068864_100103011 | Ga0068864_1001030112 | 108 |
| 437 | 3300005718 | Ga0068866_10246409 | Ga0068866_102464092 | 108 |
| 438 | 3300005718 | Ga0068866_10578264 | Ga0068866_105782642 | 108 |
| 439 | 3300005718 | Ga0068866_11189946 | Ga0068866_111899461 | 108 |
| 440 | 3300005719 | Ga0068861_100034773 | Ga0068861_1000347733 | 108 |
| 441 | 3300005719 | Ga0068861_100788150 | Ga0068861_1007881502 | 108 |
| 442 | 3300005719 | Ga0068861_102290756 | Ga0068861_1022907562 | 108 |
| 443 | 3300005834 | Ga0068851_10027537 | Ga0068851_100275372 | 108 |
| 444 | 3300005834 | Ga0068851_10248837 | Ga0068851_102488372 | 108 |
| 445 | 3300005834 | Ga0068851_10284442 | Ga0068851_102844422 | 108 |
| 446 | 3300005840 | Ga0068870_10000950 | Ga0068870_100009502 | 108 |
| 447 | 3300005840 | Ga0068870_10079331 | Ga0068870_100793311 | 108 |
| 448 | 3300005841 | Ga0068863_100004915 | Ga0068863_1000049158 | 108 |
| 449 | 3300005841 | Ga0068863_100085578 | Ga0068863_1000855782 | 108 |
| 450 | 3300005841 | Ga0068863_101267343 | Ga0068863_1012673432 | 108 |
| 451 | 3300005842 | Ga0068858_100010914 | Ga0068858_1000109148 | 108 |
| 452 | 3300005842 | Ga0068858_100167228 | Ga0068858_1001672283 | 108 |
| 453 | 3300005842 | Ga0068858_100740014 | Ga0068858_1007400142 | 108 |
| 454 | 3300005843 | Ga0068860_100044452 | Ga0068860_1000444523 | 108 |
| 455 | 3300005843 | Ga0068860_100068304 | Ga0068860_1000683042 | 108 |
| 456 | 3300005843 | Ga0068860_100106697 | Ga0068860_1001066972 | 108 |
| 457 | 3300005844 | Ga0068862_100120232 | Ga0068862_1001202322 | 108 |
| 458 | 3300005844 | Ga0068862_100679443 | Ga0068862_1006794432 | 108 |
| 459 | 3300005983 | Ga0081540_1059500 | Ga0081540_10595002 | 108 |
| 460 | 3300005983 | Ga0081540_1078675 | Ga0081540_10786752 | 108 |
| 461 | 3300006028 | Ga0070717_10021268 | Ga0070717_100212684 | 108 |
| 462 | 3300006058 | Ga0075432_10007031 | Ga0075432_100070312 | 108 |
| 463 | 3300006058 | Ga0075432_10037334 | Ga0075432_100373341 | 108 |
| 464 | 3300006163 | Ga0070715_10281814 | Ga0070715_102818142 | 108 |
| 465 | 3300006173 | Ga0070716_101175340 | Ga0070716_1011753401 | 108 |
| 466 | 3300006175 | Ga0070712_100917676 | Ga0070712_1009176762 | 108 |
| 467 | 3300006175 | Ga0070712_101763832 | Ga0070712_1017638321 | 108 |
| 468 | 3300006194 | Ga0075427_10106155 | Ga0075427_101061551 | 108 |
| 469 | 3300006237 | Ga0097621_100022749 | Ga0097621_1000227495 | 108 |
| 470 | 3300006237 | Ga0097621_100025168 | Ga0097621_1000251683 | 108 |
| 471 | 3300006358 | Ga0068871_100031063 | Ga0068871_1000310632 | 108 |
| 472 | 3300006358 | Ga0068871_100076505 | Ga0068871_1000765053 | 108 |
| 473 | 3300006358 | Ga0068871_101670628 | Ga0068871_1016706281 | 108 |
| 474 | 3300006844 | Ga0075428_100626913 | Ga0075428_1006269132 | 108 |
| 475 | 3300006847 | Ga0075431_100354326 | Ga0075431_1003543262 | 108 |
| 476 | 3300006852 | Ga0075433_10026668 | Ga0075433_100266683 | 108 |
| 477 | 3300006852 | Ga0075433_10078608 | Ga0075433_100786083 | 108 |
| 478 | 3300006871 | Ga0075434_100005189 | Ga0075434_1000051898 | 108 |
| 479 | 3300006871 | Ga0075434_100243413 | Ga0075434_1002434131 | 108 |
| 480 | 3300006871 | Ga0075434_100660903 | Ga0075434_1006609032 | 108 |
| 481 | 3300006871 | Ga0075434_102257282 | Ga0075434_1022572821 | 108 |
| 482 | 3300006880 | Ga0075429_100177981 | Ga0075429_1001779813 | 108 |
| 483 | 3300006880 | Ga0075429_101948471 | Ga0075429_1019484711 | 108 |
| 484 | 3300006881 | Ga0068865_100131926 | Ga0068865_1001319263 | 108 |
| 485 | 3300006881 | Ga0068865_100268731 | Ga0068865_1002687312 | 108 |
| 486 | 3300006914 | Ga0075436_100021585 | Ga0075436_1000215854 | 108 |
| 487 | 3300006914 | Ga0075436_100235002 | Ga0075436_1002350022 | 108 |
| 488 | 3300006931 | Ga0097620_100019850 | Ga0097620_1000198503 | 108 |
| 489 | 3300006931 | Ga0097620_100038562 | Ga0097620_1000385624 | 108 |
| 490 | 3300006931 | Ga0097620_100431065 | Ga0097620_1004310652 | 108 |
| 491 | 3300007076 | Ga0075435_100009249 | Ga0075435_1000092495 | 108 |
| 492 | 3300007076 | Ga0075435_100206707 | Ga0075435_1002067073 | 108 |
| 493 | 3300009011 | Ga0105251_10005745 | Ga0105251_100057455 | 108 |
| 494 | 3300009011 | Ga0105251_10085627 | Ga0105251_100856272 | 108 |
| 495 | 3300009093 | Ga0105240_10020672 | Ga0105240_100206725 | 108 |
| 496 | 3300009094 | Ga0111539_10070843 | Ga0111539_100708433 | 108 |
| 497 | 3300009094 | Ga0111539_10524251 | Ga0111539_105242512 | 108 |
| 498 | 3300009094 | Ga0111539_11610064 | Ga0111539_116100642 | 108 |
| 499 | 3300009098 | Ga0105245_10480286 | Ga0105245_104802862 | 108 |
| 500 | 3300009098 | Ga0105245_10655443 | Ga0105245_106554431 | 108 |
| 501 | 3300009098 | Ga0105245_12301214 | Ga0105245_123012142 | 108 |
| 502 | 3300009101 | Ga0105247_10014350 | Ga0105247_100143504 | 108 |
| 503 | 3300009101 | Ga0105247_10113307 | Ga0105247_101133071 | 108 |
| 504 | 3300009101 | Ga0105247_10550235 | Ga0105247_105502352 | 108 |
| 505 | 3300009147 | Ga0114129_10035791 | Ga0114129_100357913 | 108 |
| 506 | 3300009147 | Ga0114129_10107558 | Ga0114129_101075582 | 108 |
| 507 | 3300009148 | Ga0105243_10148708 | Ga0105243_101487082 | 108 |
| 508 | 3300009148 | Ga0105243_10474188 | Ga0105243_104741882 | 108 |
| 509 | 3300009148 | Ga0105243_11581458 | Ga0105243_115814582 | 108 |
| 510 | 3300009174 | Ga0105241_10003922 | Ga0105241_100039227 | 108 |
| 511 | 3300009174 | Ga0105241_11147661 | Ga0105241_111476611 | 108 |
| 512 | 3300009176 | Ga0105242_10031355 | Ga0105242_100313552 | 108 |
| 513 | 3300009176 | Ga0105242_10897926 | Ga0105242_108979262 | 108 |
| 514 | 3300009177 | Ga0105248_10020922 | Ga0105248_100209224 | 108 |
| 515 | 3300009177 | Ga0105248_10136721 | Ga0105248_101367212 | 108 |
| 516 | 3300009177 | Ga0105248_12152620 | Ga0105248_121526202 | 108 |
| 517 | 3300009545 | Ga0105237_10030455 | Ga0105237_100304552 | 108 |
| 518 | 3300009545 | Ga0105237_10054405 | Ga0105237_100544052 | 108 |
| 519 | 3300009545 | Ga0105237_12241566 | Ga0105237_122415661 | 108 |
| 520 | 3300009551 | Ga0105238_10012420 | Ga0105238_100124202 | 108 |
| 521 | 3300009551 | Ga0105238_10041516 | Ga0105238_100415162 | 108 |
| 522 | 3300009551 | Ga0105238_10476900 | Ga0105238_104769002 | 108 |
| 523 | 3300009553 | Ga0105249_10134093 | Ga0105249_101340932 | 108 |
| 524 | 3300009553 | Ga0105249_10482687 | Ga0105249_104826872 | 108 |
| 525 | 3300010375 | Ga0105239_10139416 | Ga0105239_101394163 | 108 |
| 526 | 3300010375 | Ga0105239_10166452 | Ga0105239_101664523 | 108 |
| 527 | 3300010375 | Ga0105239_10658786 | Ga0105239_106587862 | 108 |
| 528 | 3300011119 | Ga0105246_10002775 | Ga0105246_100027755 | 108 |
| 529 | 3300011119 | Ga0105246_10047986 | Ga0105246_100479863 | 108 |
| 530 | 3300011119 | Ga0105246_10324541 | Ga0105246_103245413 | 108 |
| 531 | 3300011119 | Ga0105246_12472437 | Ga0105246_124724371 | 108 |
| 532 | 3300012515 | Ga0157338_1009066 | Ga0157338_10090661 | 108 |
| 533 | 3300013059 | Ga0154012_129348 | Ga0154012_1293481 | 108 |
| 534 | 3300013100 | Ga0157373_10173743 | Ga0157373_101737432 | 108 |
| 535 | 3300013100 | Ga0157373_10188314 | Ga0157373_101883142 | 108 |
| 536 | 3300013102 | Ga0157371_10041110 | Ga0157371_100411102 | 108 |
| 537 | 3300013102 | Ga0157371_10222638 | Ga0157371_102226381 | 108 |
| 538 | 3300013104 | Ga0157370_10016638 | Ga0157370_100166382 | 108 |
| 539 | 3300013104 | Ga0157370_10037442 | Ga0157370_100374422 | 108 |
| 540 | 3300013104 | Ga0157370_11700019 | Ga0157370_117000191 | 108 |
| 541 | 3300013105 | Ga0157369_10065102 | Ga0157369_100651024 | 108 |
| 542 | 3300013105 | Ga0157369_10391996 | Ga0157369_103919962 | 108 |
| 543 | 3300013296 | Ga0157374_10008470 | Ga0157374_100084705 | 108 |
| 544 | 3300013296 | Ga0157374_10045677 | Ga0157374_100456773 | 108 |
| 545 | 3300013297 | Ga0157378_11319992 | Ga0157378_113199922 | 108 |
| 546 | 3300013306 | Ga0163162_10080192 | Ga0163162_100801923 | 108 |
| 547 | 3300013306 | Ga0163162_10624267 | Ga0163162_106242671 | 108 |
| 548 | 3300013307 | Ga0157372_10009917 | Ga0157372_100099174 | 108 |
| 549 | 3300013307 | Ga0157372_10038352 | Ga0157372_100383524 | 108 |
| 550 | 3300013308 | Ga0157375_10067993 | Ga0157375_100679933 | 108 |
| 551 | 3300013308 | Ga0157375_10106574 | Ga0157375_101065744 | 108 |
| 552 | 3300013308 | Ga0157375_10163382 | Ga0157375_101633823 | 108 |
| 553 | 3300014325 | Ga0163163_10021986 | Ga0163163_100219864 | 108 |
| 554 | 3300014325 | Ga0163163_11038923 | Ga0163163_110389231 | 108 |
| 555 | 3300014326 | Ga0157380_10023685 | Ga0157380_100236854 | 108 |
| 556 | 3300014497 | Ga0182008_10103657 | Ga0182008_101036572 | 108 |
| 557 | 3300014745 | Ga0157377_10007324 | Ga0157377_100073243 | 108 |
| 558 | 3300014745 | Ga0157377_10146494 | Ga0157377_101464942 | 108 |
| 559 | 3300014968 | Ga0157379_10053099 | Ga0157379_100530995 | 108 |
| 560 | 3300014968 | Ga0157379_10084610 | Ga0157379_100846103 | 108 |
| 561 | 3300014968 | Ga0157379_11691776 | Ga0157379_116917762 | 108 |
| 562 | 3300014969 | Ga0157376_10088133 | Ga0157376_100881332 | 108 |
| 563 | 3300014969 | Ga0157376_12298095 | Ga0157376_122980951 | 108 |
| 564 | 3300017792 | Ga0163161_10033855 | Ga0163161_100338552 | 108 |
| 565 | 3300020069 | Ga0197907_10461931 | Ga0197907_104619313 | 108 |
| 566 | 3300020069 | Ga0197907_11215366 | Ga0197907_112153661 | 108 |
| 567 | 3300020069 | Ga0197907_11476430 | Ga0197907_114764301 | 108 |
| 568 | 3300020070 | Ga0206356_10891290 | Ga0206356_108912902 | 108 |
| 569 | 3300020070 | Ga0206356_11707506 | Ga0206356_117075062 | 108 |
| 570 | 3300020070 | Ga0206356_11857247 | Ga0206356_118572472 | 108 |
| 571 | 3300020075 | Ga0206349_1289577 | Ga0206349_12895772 | 108 |
| 572 | 3300020075 | Ga0206349_1823967 | Ga0206349_18239671 | 108 |
| 573 | 3300020076 | Ga0206355_1007316 | Ga0206355_10073162 | 108 |
| 574 | 3300020076 | Ga0206355_1054578 | Ga0206355_10545782 | 108 |
| 575 | 3300020076 | Ga0206355_1099384 | Ga0206355_10993842 | 108 |
| 576 | 3300020076 | Ga0206355_1318107 | Ga0206355_13181071 | 108 |
| 577 | 3300020076 | Ga0206355_1474009 | Ga0206355_14740092 | 108 |
| 578 | 3300020076 | Ga0206355_1554658 | Ga0206355_15546582 | 108 |
| 579 | 3300020077 | Ga0206351_10077041 | Ga0206351_100770412 | 108 |
| 580 | 3300020077 | Ga0206351_10606993 | Ga0206351_106069931 | 108 |
| 581 | 3300020078 | Ga0206352_10212823 | Ga0206352_102128232 | 108 |
| 582 | 3300020078 | Ga0206352_10315045 | Ga0206352_103150451 | 108 |
| 583 | 3300020080 | Ga0206350_10506608 | Ga0206350_105066081 | 108 |
| 584 | 3300020080 | Ga0206350_10909644 | Ga0206350_109096442 | 108 |
| 585 | 3300020080 | Ga0206350_11030234 | Ga0206350_110302341 | 108 |
| 586 | 3300020080 | Ga0206350_11551424 | Ga0206350_115514241 | 108 |
| 587 | 3300020081 | Ga0206354_10018836 | Ga0206354_100188361 | 108 |
| 588 | 3300020081 | Ga0206354_10341810 | Ga0206354_103418102 | 108 |
| 589 | 3300020081 | Ga0206354_10445232 | Ga0206354_104452321 | 108 |
| 590 | 3300020081 | Ga0206354_11320400 | Ga0206354_113204002 | 108 |
| 591 | 3300020082 | Ga0206353_10174093 | Ga0206353_101740931 | 108 |
| 592 | 3300020082 | Ga0206353_10773459 | Ga0206353_107734591 | 108 |
| 593 | 3300020082 | Ga0206353_11435619 | Ga0206353_114356192 | 108 |
| 594 | 3300020082 | Ga0206353_11848817 | Ga0206353_118488171 | 108 |
| 595 | 3300020610 | Ga0154015_1066299 | Ga0154015_10662991 | 108 |
| 596 | 3300020610 | Ga0154015_1245520 | Ga0154015_12455201 | 108 |
| 597 | 3300020610 | Ga0154015_1299450 | Ga0154015_12994502 | 108 |
| 598 | 3300022467 | Ga0224712_10004796 | Ga0224712_100047964 | 108 |
| 599 | 3300022467 | Ga0224712_10058367 | Ga0224712_100583672 | 108 |
| 600 | 3300022467 | Ga0224712_10532127 | Ga0224712_105321271 | 108 |
| 601 | 3300023309 | Ga0256744_117491 | Ga0256744_1174911 | 108 |
| 602 | 3300025321 | Ga0207656_10110159 | Ga0207656_101101592 | 108 |
| 603 | 3300025321 | Ga0207656_10122939 | Ga0207656_101229392 | 108 |
| 604 | 3300025321 | Ga0207656_10126403 | Ga0207656_101264032 | 108 |
| 605 | 3300025885 | Ga0207653_10006947 | Ga0207653_100069472 | 108 |
| 606 | 3300025885 | Ga0207653_10050738 | Ga0207653_100507382 | 108 |
| 607 | 3300025898 | Ga0207692_10016718 | Ga0207692_100167183 | 108 |
| 608 | 3300025898 | Ga0207692_10148749 | Ga0207692_101487492 | 108 |
| 609 | 3300025899 | Ga0207642_10639821 | Ga0207642_106398211 | 108 |
| 610 | 3300025900 | Ga0207710_10344834 | Ga0207710_103448341 | 108 |
| 611 | 3300025901 | Ga0207688_10000847 | Ga0207688_100008474 | 108 |
| 612 | 3300025901 | Ga0207688_10019002 | Ga0207688_100190023 | 108 |
| 613 | 3300025903 | Ga0207680_10054816 | Ga0207680_100548163 | 108 |
| 614 | 3300025903 | Ga0207680_10469572 | Ga0207680_104695721 | 108 |
| 615 | 3300025903 | Ga0207680_10765138 | Ga0207680_107651381 | 108 |
| 616 | 3300025904 | Ga0207647_10015966 | Ga0207647_100159664 | 108 |
| 617 | 3300025904 | Ga0207647_10322205 | Ga0207647_103222052 | 108 |
| 618 | 3300025905 | Ga0207685_10855408 | Ga0207685_108554081 | 108 |
| 619 | 3300025906 | Ga0207699_10310625 | Ga0207699_103106252 | 108 |
| 620 | 3300025907 | Ga0207645_10716591 | Ga0207645_107165912 | 108 |
| 621 | 3300025908 | Ga0207643_10000582 | Ga0207643_100005826 | 108 |
| 622 | 3300025908 | Ga0207643_10239468 | Ga0207643_102394682 | 108 |
| 623 | 3300025908 | Ga0207643_10392195 | Ga0207643_103921952 | 108 |
| 624 | 3300025909 | Ga0207705_10043443 | Ga0207705_100434433 | 108 |
| 625 | 3300025909 | Ga0207705_10101255 | Ga0207705_101012552 | 108 |
| 626 | 3300025911 | Ga0207654_10026094 | Ga0207654_100260942 | 108 |
| 627 | 3300025912 | Ga0207707_10012852 | Ga0207707_100128522 | 108 |
| 628 | 3300025912 | Ga0207707_10151950 | Ga0207707_101519502 | 108 |
| 629 | 3300025914 | Ga0207671_10068903 | Ga0207671_100689033 | 108 |
| 630 | 3300025914 | Ga0207671_10117280 | Ga0207671_101172802 | 108 |
| 631 | 3300025915 | Ga0207693_10026789 | Ga0207693_100267892 | 108 |
| 632 | 3300025915 | Ga0207693_10034105 | Ga0207693_100341054 | 108 |
| 633 | 3300025916 | Ga0207663_10033424 | Ga0207663_100334243 | 108 |
| 634 | 3300025916 | Ga0207663_10045677 | Ga0207663_100456773 | 108 |
| 635 | 3300025917 | Ga0207660_10042353 | Ga0207660_100423533 | 108 |
| 636 | 3300025917 | Ga0207660_10645661 | Ga0207660_106456611 | 108 |
| 637 | 3300025918 | Ga0207662_10012234 | Ga0207662_100122343 | 108 |
| 638 | 3300025919 | Ga0207657_10012967 | Ga0207657_100129676 | 108 |
| 639 | 3300025919 | Ga0207657_10145428 | Ga0207657_101454282 | 108 |
| 640 | 3300025919 | Ga0207657_10650164 | Ga0207657_106501641 | 108 |
| 641 | 3300025920 | Ga0207649_10003295 | Ga0207649_100032958 | 108 |
| 642 | 3300025920 | Ga0207649_11384248 | Ga0207649_113842481 | 108 |
| 643 | 3300025921 | Ga0207652_10007129 | Ga0207652_100071297 | 108 |
| 644 | 3300025921 | Ga0207652_10305194 | Ga0207652_103051942 | 108 |
| 645 | 3300025923 | Ga0207681_11320032 | Ga0207681_113200321 | 108 |
| 646 | 3300025924 | Ga0207694_10227319 | Ga0207694_102273193 | 108 |
| 647 | 3300025924 | Ga0207694_10694231 | Ga0207694_106942312 | 108 |
| 648 | 3300025925 | Ga0207650_10011533 | Ga0207650_100115333 | 108 |
| 649 | 3300025925 | Ga0207650_10843622 | Ga0207650_108436221 | 108 |
| 650 | 3300025925 | Ga0207650_11090608 | Ga0207650_110906082 | 108 |
| 651 | 3300025926 | Ga0207659_10016055 | Ga0207659_100160555 | 108 |
| 652 | 3300025927 | Ga0207687_10011420 | Ga0207687_100114204 | 108 |
| 653 | 3300025927 | Ga0207687_10658706 | Ga0207687_106587062 | 108 |
| 654 | 3300025929 | Ga0207664_10098201 | Ga0207664_100982012 | 108 |
| 655 | 3300025929 | Ga0207664_10130702 | Ga0207664_101307022 | 108 |
| 656 | 3300025931 | Ga0207644_10001024 | Ga0207644_1000102414 | 108 |
| 657 | 3300025931 | Ga0207644_10009147 | Ga0207644_100091473 | 108 |
| 658 | 3300025931 | Ga0207644_11201350 | Ga0207644_112013502 | 108 |
| 659 | 3300025931 | Ga0207644_11211165 | Ga0207644_112111651 | 108 |
| 660 | 3300025932 | Ga0207690_10102900 | Ga0207690_101029002 | 108 |
| 661 | 3300025933 | Ga0207706_10045030 | Ga0207706_100450303 | 108 |
| 662 | 3300025933 | Ga0207706_10314486 | Ga0207706_103144862 | 108 |
| 663 | 3300025934 | Ga0207686_10424958 | Ga0207686_104249582 | 108 |
| 664 | 3300025934 | Ga0207686_10581170 | Ga0207686_105811701 | 108 |
| 665 | 3300025936 | Ga0207670_10113901 | Ga0207670_101139012 | 108 |
| 666 | 3300025936 | Ga0207670_10119726 | Ga0207670_101197262 | 108 |
| 667 | 3300025936 | Ga0207670_10143460 | Ga0207670_101434603 | 108 |
| 668 | 3300025937 | Ga0207669_10033093 | Ga0207669_100330933 | 108 |
| 669 | 3300025938 | Ga0207704_10113080 | Ga0207704_101130801 | 108 |
| 670 | 3300025938 | Ga0207704_10334539 | Ga0207704_103345392 | 108 |
| 671 | 3300025939 | Ga0207665_10002925 | Ga0207665_100029252 | 108 |
| 672 | 3300025940 | Ga0207691_10107559 | Ga0207691_101075593 | 108 |
| 673 | 3300025940 | Ga0207691_10184939 | Ga0207691_101849392 | 108 |
| 674 | 3300025940 | Ga0207691_10216932 | Ga0207691_102169322 | 108 |
| 675 | 3300025941 | Ga0207711_10100715 | Ga0207711_101007152 | 108 |
| 676 | 3300025941 | Ga0207711_10233446 | Ga0207711_102334462 | 108 |
| 677 | 3300025942 | Ga0207689_10002561 | Ga0207689_1000256117 | 108 |
| 678 | 3300025942 | Ga0207689_10319474 | Ga0207689_103194742 | 108 |
| 679 | 3300025942 | Ga0207689_10328277 | Ga0207689_103282772 | 108 |
| 680 | 3300025942 | Ga0207689_10359069 | Ga0207689_103590692 | 108 |
| 681 | 3300025944 | Ga0207661_10419455 | Ga0207661_104194552 | 108 |
| 682 | 3300025944 | Ga0207661_10949912 | Ga0207661_109499122 | 108 |
| 683 | 3300025945 | Ga0207679_10016058 | Ga0207679_100160583 | 108 |
| 684 | 3300025945 | Ga0207679_11867194 | Ga0207679_118671942 | 108 |
| 685 | 3300025949 | Ga0207667_10270778 | Ga0207667_102707782 | 108 |
| 686 | 3300025960 | Ga0207651_10320273 | Ga0207651_103202732 | 108 |
| 687 | 3300025961 | Ga0207712_10070020 | Ga0207712_100700203 | 108 |
| 688 | 3300025961 | Ga0207712_10225610 | Ga0207712_102256102 | 108 |
| 689 | 3300025961 | Ga0207712_10944564 | Ga0207712_109445642 | 108 |
| 690 | 3300025972 | Ga0207668_10017424 | Ga0207668_100174242 | 108 |
| 691 | 3300025972 | Ga0207668_10032912 | Ga0207668_100329123 | 108 |
| 692 | 3300025981 | Ga0207640_10216149 | Ga0207640_102161492 | 108 |
| 693 | 3300025986 | Ga0207658_10203067 | Ga0207658_102030672 | 108 |
| 694 | 3300025986 | Ga0207658_10768963 | Ga0207658_107689632 | 108 |
| 695 | 3300026023 | Ga0207677_10031358 | Ga0207677_100313582 | 108 |
| 696 | 3300026023 | Ga0207677_10058031 | Ga0207677_100580313 | 108 |
| 697 | 3300026035 | Ga0207703_10025397 | Ga0207703_100253974 | 108 |
| 698 | 3300026035 | Ga0207703_10087590 | Ga0207703_100875903 | 108 |
| 699 | 3300026035 | Ga0207703_10296149 | Ga0207703_102961492 | 108 |
| 700 | 3300026041 | Ga0207639_10105316 | Ga0207639_101053163 | 108 |
| 701 | 3300026041 | Ga0207639_10341620 | Ga0207639_103416202 | 108 |
| 702 | 3300026067 | Ga0207678_10001737 | Ga0207678_100017378 | 108 |
| 703 | 3300026067 | Ga0207678_10171662 | Ga0207678_101716622 | 108 |
| 704 | 3300026075 | Ga0207708_10082896 | Ga0207708_100828963 | 108 |
| 705 | 3300026075 | Ga0207708_10197366 | Ga0207708_101973662 | 108 |
| 706 | 3300026078 | Ga0207702_10001548 | Ga0207702_100015485 | 108 |
| 707 | 3300026078 | Ga0207702_10010112 | Ga0207702_100101121 | 108 |
| 708 | 3300026078 | Ga0207702_10180275 | Ga0207702_101802753 | 108 |
| 709 | 3300026078 | Ga0207702_10344233 | Ga0207702_103442331 | 108 |
| 710 | 3300026088 | Ga0207641_10009255 | Ga0207641_100092554 | 108 |
| 711 | 3300026088 | Ga0207641_10179450 | Ga0207641_101794502 | 108 |
| 712 | 3300026088 | Ga0207641_10261108 | Ga0207641_102611082 | 108 |
| 713 | 3300026088 | Ga0207641_11121351 | Ga0207641_111213511 | 108 |
| 714 | 3300026089 | Ga0207648_10209082 | Ga0207648_102090822 | 108 |
| 715 | 3300026089 | Ga0207648_10557389 | Ga0207648_105573892 | 108 |
| 716 | 3300026095 | Ga0207676_10010083 | Ga0207676_100100835 | 108 |
| 717 | 3300026095 | Ga0207676_10355087 | Ga0207676_103550872 | 108 |
| 718 | 3300026116 | Ga0207674_10140330 | Ga0207674_101403303 | 108 |
| 719 | 3300026116 | Ga0207674_10203372 | Ga0207674_102033722 | 108 |
| 720 | 3300026116 | Ga0207674_10239100 | Ga0207674_102391002 | 108 |
| 721 | 3300026118 | Ga0207675_100006128 | Ga0207675_1000061287 | 108 |
| 722 | 3300026118 | Ga0207675_100356105 | Ga0207675_1003561053 | 108 |
| 723 | 3300026118 | Ga0207675_101575080 | Ga0207675_1015750801 | 108 |
| 724 | 3300026121 | Ga0207683_10000940 | Ga0207683_1000094017 | 108 |
| 725 | 3300026121 | Ga0207683_10002124 | Ga0207683_100021248 | 108 |
| 726 | 3300026121 | Ga0207683_10456884 | Ga0207683_104568842 | 108 |
| 727 | 3300026121 | Ga0207683_10596788 | Ga0207683_105967882 | 108 |
| 728 | 3300026121 | Ga0207683_11181233 | Ga0207683_111812331 | 108 |
| 729 | 3300026142 | Ga0207698_10027133 | Ga0207698_100271333 | 108 |
| 730 | 3300026142 | Ga0207698_10638917 | Ga0207698_106389172 | 108 |
| 731 | 3300026142 | Ga0207698_12603925 | Ga0207698_126039251 | 108 |
| 732 | 3300027907 | Ga0207428_10037394 | Ga0207428_100373942 | 108 |
| 733 | 3300028379 | Ga0268266_10019784 | Ga0268266_100197845 | 108 |
| 734 | 3300028379 | Ga0268266_10086549 | Ga0268266_100865493 | 108 |
| 735 | 3300028379 | Ga0268266_10092904 | Ga0268266_100929043 | 108 |
| 736 | 3300028380 | Ga0268265_10148279 | Ga0268265_101482792 | 108 |
| 737 | 3300028381 | Ga0268264_10054614 | Ga0268264_100546142 | 108 |
| 738 | 3300028381 | Ga0268264_10078028 | Ga0268264_100780282 | 108 |
| 739 | 3300028381 | Ga0268264_10393393 | Ga0268264_103933932 | 108 |
| 740 | 3300029277 | Ga0311001_1037751 | Ga0311001_10377511 | 108 |
| 741 | 3300030836 | Ga0265767_111138 | Ga0265767_1111382 | 108 |
| 742 | 3300030863 | Ga0265766_1019552 | Ga0265766_10195521 | 108 |
| 743 | 3300031852 | Ga0307410_10771735 | Ga0307410_107717351 | 108 |
| 744 | 3300034817 | Ga0373948_0048350 | Ga0373948_0048350_565_894 | 108 |
| 745 | 3300034820 | Ga0373959_0108367 | Ga0373959_0108367_33_362 | 108 |
| 746 | 3300035085 | Ga0373929_0064471 | Ga0373929_0064471_55_384 | 108 |
| 747 | 3300035088 | Ga0373940_0034752 | Ga0373940_0034752_140_469 | 108 |
| 748 | 3300035091 | Ga0373951_0039318 | Ga0373951_0039318_510_839 | 108 |
| 749 | 3300035115 | Ga0373941_0365865 | Ga0373941_0365865_230_559 | 108 |
| 750 | 3300035121 | Ga0373960_0010185 | Ga0373960_0010185_672_1001 | 108 |
| 751 | 3300035121 | Ga0373960_0185603 | Ga0373960_0185603_239_565 | 108 |
| 752 | 3300035207 | Ga0373942_0168913 | Ga0373942_0168913_33_362 | 108 |
| 753 | 3300035241 | Ga0373961_0369336 | Ga0373961_0369336_164_493 | 108 |
| 754 | 3300035242 | Ga0373962_0011800 | Ga0373962_0011800_649_978 | 108 |
| 755 | 3300035691 | Ga0373931_0047821 | Ga0373931_0047821_894_1223 | 108 |
| 756 | 3300037068 | Ga0373925_1156669 | Ga0373925_1156669_147_476 | 108 |
| 757 | 3300037471 | Ga0395905_0971002 | Ga0395905_0971002_132_458 | 108 |
| 758 | 3300041509 | Ga0451843_0783312 | Ga0451843_0783312_157_486 | 108 |
| 759 | 3300042157 | Ga0439458_0004621 | Ga0439458_0004621_2523_2849 | 108 |
| 760 | 3300042438 | Ga0439459_0017849 | Ga0439459_0017849_34_387 | 108 |
| 761 | 3300042993 | Ga0439440_0113579 | Ga0439440_0113579_212_538 | 108 |
| 762 | 3300044656 | Ga0466969_0004202 | Ga0466969_0004202_3270_3599 | 108 |
| 763 | 3300044656 | Ga0466969_0037052 | Ga0466969_0037052_1572_1901 | 108 |
| 764 | 3300044684 | Ga0466966_0030559 | Ga0466966_0030559_433_762 | 108 |
| 765 | 3300044684 | Ga0466966_0046207 | Ga0466966_0046207_699_1028 | 108 |
| 766 | 3300044693 | Ga0466961_0043893 | Ga0466961_0043893_1533_1862 | 108 |
| 767 | 3300044693 | Ga0466961_0339478 | Ga0466961_0339478_319_648 | 108 |
| 768 | 3300044694 | Ga0466963_0479865 | Ga0466963_0479865_492_821 | 108 |
| 769 | 3300044719 | Ga0466971_0053539 | Ga0466971_0053539_1192_1521 | 108 |
| 770 | 3300044735 | Ga0466968_0131100 | Ga0466968_0131100_97_426 | 108 |
| 771 | 3300044765 | Ga0466970_0341284 | Ga0466970_0341284_202_531 | 108 |
| 772 | 3300045049 | Ga0466959_0012505 | Ga0466959_0012505_213_542 | 108 |
| 773 | 3300045049 | Ga0466959_0116797 | Ga0466959_0116797_561_890 | 108 |
| 774 | 3300045976 | Ga0466967_0112603 | Ga0466967_0112603_940_1269 | 108 |
| 775 | 3300045976 | Ga0466967_0393344 | Ga0466967_0393344_423_761 | 108 |
| 776 | 3300046515 | Ga0495620_0105891 | Ga0495620_0105891_742_1071 | 108 |
| 777 | 3300046648 | Ga0495611_0248816 | Ga0495611_0248816_17_346 | 108 |
| 778 | 3300046794 | Ga0495589_0402283 | Ga0495589_0402283_10_339 | 108 |
| 779 | 3300047321 | Ga0495676_0178638 | Ga0495676_0178638_1045_1374 | 108 |
| 780 | 3300048903 | Ga0496100_0257298 | Ga0496100_0257298_497_826 | 108 |
| 781 | 3300048904 | Ga0496101_0068289 | Ga0496101_0068289_1680_2009 | 108 |
| 782 | 3300048904 | Ga0496101_0258003 | Ga0496101_0258003_975_1301 | 108 |
| 783 | 3300048905 | Ga0496102_0023910 | Ga0496102_0023910_1342_1668 | 108 |
| 784 | 3300048906 | Ga0496103_0074920 | Ga0496103_0074920_18_347 | 108 |
| 785 | 3300048906 | Ga0496103_0794467 | Ga0496103_0794467_168_506 | 108 |
| 786 | 3300048907 | Ga0496104_0011142 | Ga0496104_0011142_6037_6366 | 108 |
| 787 | 3300048907 | Ga0496104_0027560 | Ga0496104_0027560_3161_3487 | 108 |
| 788 | 3300048908 | Ga0496105_0007851 | Ga0496105_0007851_467_793 | 108 |
| 789 | 3300048908 | Ga0496105_0068646 | Ga0496105_0068646_337_666 | 108 |
| 790 | 3300048908 | Ga0496105_1078922 | Ga0496105_1078922_92_430 | 108 |
| 791 | 3300048909 | Ga0496106_0008819 | Ga0496106_0008819_1996_2322 | 108 |
| 792 | 3300048909 | Ga0496106_0033788 | Ga0496106_0033788_2079_2408 | 108 |
| 793 | 3300048910 | Ga0496107_0008557 | Ga0496107_0008557_4069_4395 | 108 |
| 794 | 3300048910 | Ga0496107_0039010 | Ga0496107_0039010_2034_2363 | 108 |
| 795 | 3300048911 | Ga0496108_0005089 | Ga0496108_0005089_1998_2327 | 108 |
| 796 | 3300048911 | Ga0496108_0038342 | Ga0496108_0038342_3033_3359 | 108 |
| 797 | 3300048911 | Ga0496108_0044842 | Ga0496108_0044842_1398_1727 | 108 |
| 798 | 3300048912 | Ga0496109_0042670 | Ga0496109_0042670_949_1278 | 108 |
| 799 | 3300048912 | Ga0496109_0047288 | Ga0496109_0047288_973_1302 | 108 |
| 800 | 3300048912 | Ga0496109_0124834 | Ga0496109_0124834_775_1101 | 108 |
| 801 | 3300048913 | Ga0496110_0001739 | Ga0496110_0001739_7478_7804 | 108 |
| 802 | 3300048913 | Ga0496110_0068962 | Ga0496110_0068962_1247_1576 | 108 |
| 803 | 3300048913 | Ga0496110_0842731 | Ga0496110_0842731_260_589 | 108 |
| 804 | 3300048914 | Ga0496111_0001057 | Ga0496111_0001057_6852_7178 | 108 |
| 805 | 3300048914 | Ga0496111_0005464 | Ga0496111_0005464_203_532 | 108 |
| 806 | 3300048915 | Ga0496112_0059092 | Ga0496112_0059092_1997_2323 | 108 |
| 807 | 3300048915 | Ga0496112_0060911 | Ga0496112_0060911_2079_2408 | 108 |
| 808 | 3300048916 | Ga0496113_0007515 | Ga0496113_0007515_2793_3122 | 108 |
| 809 | 3300048916 | Ga0496113_0051622 | Ga0496113_0051622_595_921 | 108 |
| 810 | 3300048917 | Ga0496114_0005871 | Ga0496114_0005871_7019_7348 | 108 |
| 811 | 3300048917 | Ga0496114_1093625 | Ga0496114_1093625_328_654 | 108 |
| 812 | 3300048918 | Ga0496115_0013815 | Ga0496115_0013815_1707_2036 | 108 |
| 813 | 3300048918 | Ga0496115_0169409 | Ga0496115_0169409_1020_1346 | 108 |
| 814 | 3300049130 | Ga0501310_040179 | Ga0501310_040179_251_580 | 108 |
| 815 | 3300049161 | Ga0501305_016824 | Ga0501305_016824_466_795 | 108 |
| 816 | 3300049531 | Ga0501315_028870 | Ga0501315_028870_100_429 | 108 |
| 817 | 3300049533 | Ga0501317_006203 | Ga0501317_006203_112_441 | 108 |
| 818 | 3300049533 | Ga0501317_012962 | Ga0501317_012962_251_580 | 108 |
| 819 | 3300049533 | Ga0501317_024465 | Ga0501317_024465_500_829 | 108 |
| 820 | 3300049534 | Ga0501318_003777 | Ga0501318_003777_47_376 | 108 |
| 821 | 3300049534 | Ga0501318_016336 | Ga0501318_016336_316_645 | 108 |
| 822 | 3300049534 | Ga0501318_024719 | Ga0501318_024719_11_340 | 108 |
| 823 | 3300049537 | Ga0501321_003257 | Ga0501321_003257_618_947 | 108 |
| 824 | 3300050507 | nmdc:mga05p37_190695_c1 | nmdc:mga05p37_190695_c1_1250_1576 | 108 |
| 825 | 3300050508 | nmdc:mga09592_525200_c1 | nmdc:mga09592_525200_c1_108_434 | 108 |
| 826 | 3300050510 | nmdc:mga06r32_130467_c2 | nmdc:mga06r32_130467_c2_116_442 | 108 |
| 827 | 3300050510 | nmdc:mga06r32_697157_c1 | nmdc:mga06r32_697157_c1_11_337 | 108 |
| 828 | 3300050511 | nmdc:mga08y16_302547_c1 | nmdc:mga08y16_302547_c1_1309_1638 | 108 |
| 829 | 3300050511 | nmdc:mga08y16_9435_c1 | nmdc:mga08y16_9435_c1_2949_3275 | 108 |
| 830 | 3300050512 | nmdc:mga0n895_1378459_c1 | nmdc:mga0n895_1378459_c1_184_513 | 108 |
| 831 | 3300050512 | nmdc:mga0n895_162137_c1 | nmdc:mga0n895_162137_c1_1136_1465 | 108 |
| 832 | 3300050512 | nmdc:mga0n895_2047902_c1 | nmdc:mga0n895_2047902_c1_140_469 | 108 |
| 833 | 3300050512 | nmdc:mga0n895_40350_c1 | nmdc:mga0n895_40350_c1_3160_3486 | 108 |
| 834 | 3300050513 | nmdc:mga0rr50_118112_c1 | nmdc:mga0rr50_118112_c1_1720_2049 | 108 |
| 835 | 3300050513 | nmdc:mga0rr50_36381_c1 | nmdc:mga0rr50_36381_c1_2076_2402 | 108 |
| 836 | 3300050514 | nmdc:mga08x19_453598_c1 | nmdc:mga08x19_453598_c1_369_698 | 108 |
| 837 | 3300050514 | nmdc:mga08x19_4888_c1 | nmdc:mga08x19_4888_c1_1526_1852 | 108 |
| 838 | 3300050515 | nmdc:mga0a205_12931_c1 | nmdc:mga0a205_12931_c1_3775_4101 | 108 |
| 839 | 3300050515 | nmdc:mga0a205_1353402_c1 | nmdc:mga0a205_1353402_c1_123_452 | 108 |
| 840 | 3300059492 | Ga0587073_0105335 | Ga0587073_0105335_314_697 | 108 |
| 841 | 3300059492 | Ga0587073_0169057 | Ga0587073_0169057_278_604 | 108 |
| 842 | 3300059508 | Ga0587088_188038 | Ga0587088_188038_23_349 | 108 |
| 843 | 3300059625 | Ga0587113_056077 | Ga0587113_056077_151_477 | 108 |
| 844 | 3300061719 | Ga0466962_0065534 | Ga0466962_0065534_226_555 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nof-assembly1.cif.gz_A | mycobacterium tuberculosis thioredoxin c c40s mutant | 0.9984 | 3 | 105 |
| 4pob-assembly1.cif.gz_B | crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus | 0.9965 | 4 | 107 |
| 6esx-assembly1.cif.gz_A | caulobacter crescentus trx1 | 0.993 | 4 | 105 |
| 5hr1-assembly7.cif.gz_G | crystal structure of thioredoxin l107a mutant | 0.9902 | 28 | 101 |
| 4ulx-assembly1.cif.gz_A | crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. | 0.9887 | 4 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hr1G00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9902 | 28 | 101 | 3.40.30.10 |
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9887 | 4 | 105 | 3.40.30.10 |
| 3dieB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9701 | 32 | 105 | 3.40.30.10 |
| 3hz4B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9679 | 4 | 105 | 3.40.30.10 |
| af_Q9SEU7_68_173_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9664 | 4 | 107 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A852ZU54-F1-model_v4 | Thioredoxin | 1.006 | 3 | 108 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A495QYT5-F1-model_v4 | Thioredoxin | 1.005 | 4 | 107 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A7K2YV32-F1-model_v4 | Thioredoxin | 1.004 | 1 | 107 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A5A7SFQ4-F1-model_v4 | Thioredoxin | 1.004 | 3 | 107 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A6P2BRU6-F1-model_v4 | Thioredoxin | 1.004 | 1 | 107 |
GO:0005829
GO:0015035 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar