F483136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 842 | 359 | 1684 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10972869|Ga0157376_109728691 |
| Length | 133 |
| Sequence | MKTYILGGLAAVALLLTHHSFAAEFDADKPITLKGIVTKVEWTNPHVWFYVNVKDEKGEVTNWGAEMGPPHGLQRRGWRQNTLKIGEEVTVSGSLAKNGAKRINASKVTLTSTGARPGETLDAASSGSAEKVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 26 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 27 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 128 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 230 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 231 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 234 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 237 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 238 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 331 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.1 |
| Metatranscriptomes | 13.9 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.26 |
| Rhizosphere | 95.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157376_10972869 | 3300014969 | Bacteria | 870 |
| 2 | JGI24746J21847_1001312 | 3300001977 | Unclassified | 3968 |
| 3 | JGI24746J21847_1002613 | 3300001977 | Unclassified | 2854 |
| 4 | JGI24749J21850_1035925 | 3300002076 | Bacteria | 719 |
| 5 | JGI24751J29686_10079364 | 3300002459 | Unclassified | 680 |
| 6 | Ga0006763J43179_102979 | 3300002870 | Unclassified | 714 |
| 7 | Ga0006762J43184_102821 | 3300002872 | Unclassified | 655 |
| 8 | Ga0006765J45826_102709 | 3300003161 | Bacteria | 629 |
| 9 | Ga0006778J45830_1008035 | 3300003162 | Unclassified | 581 |
| 10 | Ga0006759J45824_1007035 | 3300003163 | Unclassified | 1006 |
| 11 | Ga0006759J45824_1015090 | 3300003163 | Bacteria | 567 |
| 12 | Ga0006759J45824_1018684 | 3300003163 | Unclassified | 532 |
| 13 | JGI25406J46586_10022522 | 3300003203 | Unclassified | 2507 |
| 14 | Ga0006758J48902_1004937 | 3300003300 | Unclassified | 736 |
| 15 | Ga0006770J48903_1009933 | 3300003305 | Unclassified | 548 |
| 16 | Ga0006770J48903_1011447 | 3300003305 | Unclassified | 590 |
| 17 | Ga0006777J48905_1009548 | 3300003308 | Unclassified | 590 |
| 18 | Ga0006777J48905_1023568 | 3300003308 | Bacteria | 632 |
| 19 | Ga0007417J51691_1006602 | 3300003544 | Unclassified | 503 |
| 20 | Ga0007417J51691_1020827 | 3300003544 | Unclassified | 549 |
| 21 | Ga0007427J51700_104200 | 3300003559 | Unclassified | 583 |
| 22 | Ga0006781J51513_1003563 | 3300003568 | Unclassified | 625 |
| 23 | Ga0007410J51695_1118318 | 3300003574 | Unclassified | 554 |
| 24 | Ga0007409J51694_1008062 | 3300003575 | Unclassified | 1245 |
| 25 | Ga0007409J51694_1089376 | 3300003575 | Unclassified | 503 |
| 26 | Ga0007416J51690_1020843 | 3300003577 | Unclassified | 535 |
| 27 | Ga0007429J51699_1011709 | 3300003579 | Unclassified | 598 |
| 28 | Ga0007429J51699_1014819 | 3300003579 | Bacteria | 570 |
| 29 | Ga0007429J51699_1021144 | 3300003579 | Bacteria | 570 |
| 30 | Ga0007411J51799_109537 | 3300003611 | Unclassified | 506 |
| 31 | Ga0007415J51800_105917 | 3300003613 | Unclassified | 598 |
| 32 | Ga0032354_1001770 | 3300003693 | Unclassified | 564 |
| 33 | Ga0032354_1024662 | 3300003693 | Bacteria | 564 |
| 34 | Ga0032354_1044077 | 3300003693 | Bacteria | 765 |
| 35 | Ga0006780_1001386 | 3300003735 | Unclassified | 696 |
| 36 | Ga0058858_1005683 | 3300004785 | Unclassified | 1107 |
| 37 | Ga0058858_1434174 | 3300004785 | Unclassified | 709 |
| 38 | Ga0058859_10026768 | 3300004798 | Bacteria | 636 |
| 39 | Ga0058859_10047863 | 3300004798 | Unclassified | 1065 |
| 40 | Ga0058859_10048081 | 3300004798 | Bacteria | 1849 |
| 41 | Ga0058859_10068287 | 3300004798 | Bacteria | 1156 |
| 42 | Ga0058859_10138439 | 3300004798 | Bacteria | 652 |
| 43 | Ga0058863_11744773 | 3300004799 | Unclassified | 619 |
| 44 | Ga0058863_11851899 | 3300004799 | Bacteria | 1211 |
| 45 | Ga0058861_10045090 | 3300004800 | Unclassified | 714 |
| 46 | Ga0058861_10090615 | 3300004800 | Unclassified | 514 |
| 47 | Ga0058861_11811094 | 3300004800 | Unclassified | 835 |
| 48 | Ga0058861_11984224 | 3300004800 | Bacteria | 814 |
| 49 | Ga0058861_12067518 | 3300004800 | Unclassified | 610 |
| 50 | Ga0058860_10004586 | 3300004801 | Bacteria | 597 |
| 51 | Ga0058860_10022220 | 3300004801 | Unclassified | 1347 |
| 52 | Ga0058860_10053229 | 3300004801 | Unclassified | 2521 |
| 53 | Ga0058860_10053703 | 3300004801 | Unclassified | 699 |
| 54 | Ga0058860_10120934 | 3300004801 | Unclassified | 688 |
| 55 | Ga0058860_12157817 | 3300004801 | Bacteria | 555 |
| 56 | Ga0058860_12194457 | 3300004801 | Unclassified | 887 |
| 57 | Ga0058862_12532843 | 3300004803 | Bacteria | 591 |
| 58 | Ga0058862_12633905 | 3300004803 | Unclassified | 601 |
| 59 | Ga0058862_12868080 | 3300004803 | Unclassified | 1057 |
| 60 | Ga0058862_12874132 | 3300004803 | Unclassified | 857 |
| 61 | Ga0065714_10079673 | 3300005288 | Bacteria | 2495 |
| 62 | Ga0065714_10097205 | 3300005288 | Bacteria | 1742 |
| 63 | Ga0065704_10016305 | 3300005289 | Bacteria | 1650 |
| 64 | Ga0065712_10029825 | 3300005290 | Bacteria | 1482 |
| 65 | Ga0065712_10067852 | 3300005290 | Bacteria | 25461 |
| 66 | Ga0065712_10075103 | 3300005290 | Unclassified | 3936 |
| 67 | Ga0065715_10005596 | 3300005293 | Bacteria | 3129 |
| 68 | Ga0065715_10015619 | 3300005293 | Bacteria | 1874 |
| 69 | Ga0065715_10211374 | 3300005293 | Bacteria | 1312 |
| 70 | Ga0065715_10800613 | 3300005293 | Unclassified | 607 |
| 71 | Ga0065715_10886075 | 3300005293 | Bacteria | 579 |
| 72 | Ga0065707_10015336 | 3300005295 | Bacteria | 2148 |
| 73 | Ga0070658_10375830 | 3300005327 | Unclassified | 1218 |
| 74 | Ga0070676_10030575 | 3300005328 | Bacteria | 3072 |
| 75 | Ga0070676_10260275 | 3300005328 | Bacteria | 1161 |
| 76 | Ga0070676_10410942 | 3300005328 | Bacteria | 944 |
| 77 | Ga0070676_10735737 | 3300005328 | Bacteria | 723 |
| 78 | Ga0070683_100125341 | 3300005329 | Bacteria | 2428 |
| 79 | Ga0070683_100169869 | 3300005329 | Bacteria | 2070 |
| 80 | Ga0070690_100034739 | 3300005330 | Bacteria | 3160 |
| 81 | Ga0070690_100051401 | 3300005330 | Bacteria | 2631 |
| 82 | Ga0070690_100082110 | 3300005330 | Bacteria | 2110 |
| 83 | Ga0070670_100000476 | 3300005331 | Bacteria | 32289 |
| 84 | Ga0070670_100027457 | 3300005331 | Bacteria | 4896 |
| 85 | Ga0070670_101072705 | 3300005331 | Bacteria | 734 |
| 86 | Ga0070677_10002043 | 3300005333 | Bacteria | 6421 |
| 87 | Ga0070677_10086770 | 3300005333 | Unclassified | 1352 |
| 88 | Ga0070677_10229033 | 3300005333 | Unclassified | 912 |
| 89 | Ga0068869_100022580 | 3300005334 | Bacteria | 4337 |
| 90 | Ga0068869_100473526 | 3300005334 | Bacteria | 1042 |
| 91 | Ga0068869_101411936 | 3300005334 | Unclassified | 616 |
| 92 | Ga0070666_10022675 | 3300005335 | Bacteria | 4079 |
| 93 | Ga0070666_10024365 | 3300005335 | Unclassified | 3941 |
| 94 | Ga0070666_10168480 | 3300005335 | Bacteria | 1533 |
| 95 | Ga0070666_10389439 | 3300005335 | Unclassified | 1001 |
| 96 | Ga0070666_10639580 | 3300005335 | Bacteria | 778 |
| 97 | Ga0070680_100101329 | 3300005336 | Bacteria | 2390 |
| 98 | Ga0070680_100395196 | 3300005336 | Bacteria | 1178 |
| 99 | Ga0068868_100663789 | 3300005338 | Unclassified | 929 |
| 100 | Ga0068868_100890840 | 3300005338 | Unclassified | 808 |
| 101 | Ga0068868_100981448 | 3300005338 | Bacteria | 772 |
| 102 | Ga0068868_101199029 | 3300005338 | Bacteria | 702 |
| 103 | Ga0068868_101333898 | 3300005338 | Bacteria | 667 |
| 104 | Ga0070689_100011003 | 3300005340 | Bacteria | 6467 |
| 105 | Ga0070689_100104448 | 3300005340 | Bacteria | 2246 |
| 106 | Ga0070689_100223079 | 3300005340 | Bacteria | 1547 |
| 107 | Ga0070689_100596154 | 3300005340 | Bacteria | 957 |
| 108 | Ga0070687_100010039 | 3300005343 | Bacteria | 4076 |
| 109 | Ga0070687_100018578 | 3300005343 | Bacteria | 3219 |
| 110 | Ga0070687_100124272 | 3300005343 | Bacteria | 1480 |
| 111 | Ga0070687_101045643 | 3300005343 | Bacteria | 594 |
| 112 | Ga0070661_100049848 | 3300005344 | Bacteria | 3065 |
| 113 | Ga0070661_100099422 | 3300005344 | Unclassified | 2162 |
| 114 | Ga0070661_100407031 | 3300005344 | Unclassified | 1076 |
| 115 | Ga0070692_10281658 | 3300005345 | Bacteria | 1008 |
| 116 | Ga0070692_10565910 | 3300005345 | Unclassified | 747 |
| 117 | Ga0070692_10854010 | 3300005345 | Unclassified | 626 |
| 118 | Ga0070668_100021463 | 3300005347 | Bacteria | 4879 |
| 119 | Ga0070668_100136423 | 3300005347 | Unclassified | 1974 |
| 120 | Ga0070668_100494447 | 3300005347 | Bacteria | 1058 |
| 121 | Ga0070668_100688625 | 3300005347 | Unclassified | 901 |
| 122 | Ga0070669_100017963 | 3300005353 | Bacteria | 5052 |
| 123 | Ga0070669_100034057 | 3300005353 | Bacteria | 3687 |
| 124 | Ga0070669_100043507 | 3300005353 | Bacteria | 3271 |
| 125 | Ga0070669_100163591 | 3300005353 | Unclassified | 1731 |
| 126 | Ga0070669_100488722 | 3300005353 | Unclassified | 1020 |
| 127 | Ga0070669_100814540 | 3300005353 | Bacteria | 794 |
| 128 | Ga0070675_100000983 | 3300005354 | Bacteria | 20391 |
| 129 | Ga0070675_100028849 | 3300005354 | Bacteria | 4470 |
| 130 | Ga0070675_100068764 | 3300005354 | Unclassified | 2933 |
| 131 | Ga0070675_100085737 | 3300005354 | Bacteria | 2631 |
| 132 | Ga0070675_100103252 | 3300005354 | Unclassified | 2403 |
| 133 | Ga0070675_100106234 | 3300005354 | Bacteria | 2370 |
| 134 | Ga0070675_100135646 | 3300005354 | Bacteria | 2100 |
| 135 | Ga0070675_100197848 | 3300005354 | Bacteria | 1744 |
| 136 | Ga0070675_100209626 | 3300005354 | Bacteria | 1693 |
| 137 | Ga0070675_100434909 | 3300005354 | Bacteria | 1175 |
| 138 | Ga0070675_100784429 | 3300005354 | Unclassified | 870 |
| 139 | Ga0070675_101199374 | 3300005354 | Unclassified | 699 |
| 140 | Ga0070675_101441126 | 3300005354 | Bacteria | 635 |
| 141 | Ga0070671_100043604 | 3300005355 | Unclassified | 3728 |
| 142 | Ga0070671_100108267 | 3300005355 | Bacteria | 2334 |
| 143 | Ga0070671_100126417 | 3300005355 | Bacteria | 2152 |
| 144 | Ga0070671_100517561 | 3300005355 | Bacteria | 1027 |
| 145 | Ga0070674_100000340 | 3300005356 | Bacteria | 23159 |
| 146 | Ga0070674_100039459 | 3300005356 | Bacteria | 3188 |
| 147 | Ga0070674_100184987 | 3300005356 | Unclassified | 1598 |
| 148 | Ga0070674_100382366 | 3300005356 | Bacteria | 1145 |
| 149 | Ga0070674_100525732 | 3300005356 | Bacteria | 989 |
| 150 | Ga0070674_100528090 | 3300005356 | Unclassified | 987 |
| 151 | Ga0070674_100786871 | 3300005356 | Bacteria | 820 |
| 152 | Ga0070673_100004440 | 3300005364 | Bacteria | 8873 |
| 153 | Ga0070673_100014441 | 3300005364 | Bacteria | 5502 |
| 154 | Ga0070673_100023051 | 3300005364 | Bacteria | 4543 |
| 155 | Ga0070673_100033322 | 3300005364 | Bacteria | 3888 |
| 156 | Ga0070673_100116060 | 3300005364 | Bacteria | 2227 |
| 157 | Ga0070673_100609279 | 3300005364 | Bacteria | 997 |
| 158 | Ga0070688_100029468 | 3300005365 | Bacteria | 3287 |
| 159 | Ga0070688_100030176 | 3300005365 | Bacteria | 3252 |
| 160 | Ga0070688_100177410 | 3300005365 | Unclassified | 1475 |
| 161 | Ga0070688_100264110 | 3300005365 | Bacteria | 1230 |
| 162 | Ga0070688_101406087 | 3300005365 | Unclassified | 566 |
| 163 | Ga0070659_100020998 | 3300005366 | Bacteria | 4966 |
| 164 | Ga0070659_100270540 | 3300005366 | Bacteria | 1412 |
| 165 | Ga0070659_100611990 | 3300005366 | Bacteria | 937 |
| 166 | Ga0070667_100114115 | 3300005367 | Bacteria | 2345 |
| 167 | Ga0070667_100131754 | 3300005367 | Bacteria | 2183 |
| 168 | Ga0070667_100171194 | 3300005367 | Bacteria | 1917 |
| 169 | Ga0070667_100191322 | 3300005367 | Bacteria | 1813 |
| 170 | Ga0070713_101597591 | 3300005436 | Bacteria | 633 |
| 171 | Ga0070710_10710531 | 3300005437 | Bacteria | 710 |
| 172 | Ga0070701_10028383 | 3300005438 | Bacteria | 2751 |
| 173 | Ga0070701_10097573 | 3300005438 | Bacteria | 1622 |
| 174 | Ga0070701_10469988 | 3300005438 | Unclassified | 811 |
| 175 | Ga0070711_100048763 | 3300005439 | Bacteria | 2898 |
| 176 | Ga0070705_100075017 | 3300005440 | Bacteria | 2058 |
| 177 | Ga0070705_100107388 | 3300005440 | Unclassified | 1776 |
| 178 | Ga0070705_100322905 | 3300005440 | Bacteria | 1115 |
| 179 | Ga0070705_101867420 | 3300005440 | Unclassified | 511 |
| 180 | Ga0070700_100025700 | 3300005441 | Bacteria | 3469 |
| 181 | Ga0070700_100072724 | 3300005441 | Bacteria | 2199 |
| 182 | Ga0070700_100294119 | 3300005441 | Unclassified | 1183 |
| 183 | Ga0070700_100296916 | 3300005441 | Bacteria | 1178 |
| 184 | Ga0070700_100382011 | 3300005441 | Bacteria | 1054 |
| 185 | Ga0070700_100989099 | 3300005441 | Bacteria | 691 |
| 186 | Ga0070694_100208387 | 3300005444 | Bacteria | 1461 |
| 187 | Ga0070694_100438802 | 3300005444 | Unclassified | 1029 |
| 188 | Ga0070694_100492082 | 3300005444 | Bacteria | 975 |
| 189 | Ga0070694_100532510 | 3300005444 | Bacteria | 939 |
| 190 | Ga0070663_100864437 | 3300005455 | Bacteria | 779 |
| 191 | Ga0070663_101537742 | 3300005455 | Unclassified | 592 |
| 192 | Ga0070678_100118169 | 3300005456 | Unclassified | 2086 |
| 193 | Ga0070678_100140738 | 3300005456 | Bacteria | 1930 |
| 194 | Ga0070678_100388712 | 3300005456 | Bacteria | 1209 |
| 195 | Ga0070678_100455709 | 3300005456 | Bacteria | 1121 |
| 196 | Ga0070678_100524155 | 3300005456 | Bacteria | 1049 |
| 197 | Ga0070678_101672746 | 3300005456 | Bacteria | 598 |
| 198 | Ga0070662_100033661 | 3300005457 | Bacteria | 3610 |
| 199 | Ga0070662_100060406 | 3300005457 | Bacteria | 2764 |
| 200 | Ga0070662_100174242 | 3300005457 | Bacteria | 1691 |
| 201 | Ga0070662_100200832 | 3300005457 | Bacteria | 1582 |
| 202 | Ga0070662_100615227 | 3300005457 | Unclassified | 914 |
| 203 | Ga0068867_101001571 | 3300005459 | Bacteria | 758 |
| 204 | Ga0068867_101629087 | 3300005459 | Bacteria | 604 |
| 205 | Ga0068867_102078509 | 3300005459 | Bacteria | 538 |
| 206 | Ga0070685_10009649 | 3300005466 | Bacteria | 4996 |
| 207 | Ga0070685_10073434 | 3300005466 | Unclassified | 2033 |
| 208 | Ga0070685_10745462 | 3300005466 | Unclassified | 718 |
| 209 | Ga0070685_11009110 | 3300005466 | Unclassified | 625 |
| 210 | Ga0070706_101587690 | 3300005467 | Unclassified | 597 |
| 211 | Ga0070707_100345323 | 3300005468 | Bacteria | 1446 |
| 212 | Ga0070698_100603824 | 3300005471 | Bacteria | 1038 |
| 213 | Ga0070699_100521607 | 3300005518 | Unclassified | 1080 |
| 214 | Ga0070697_100150237 | 3300005536 | Bacteria | 1963 |
| 215 | Ga0070672_100011676 | 3300005543 | Bacteria | 6132 |
| 216 | Ga0070672_100030645 | 3300005543 | Bacteria | 4043 |
| 217 | Ga0070672_100112535 | 3300005543 | Bacteria | 2221 |
| 218 | Ga0070672_100156408 | 3300005543 | Bacteria | 1888 |
| 219 | Ga0070672_100239801 | 3300005543 | Bacteria | 1525 |
| 220 | Ga0070672_100394211 | 3300005543 | Bacteria | 1186 |
| 221 | Ga0070672_100682807 | 3300005543 | Bacteria | 898 |
| 222 | Ga0070686_100002629 | 3300005544 | Bacteria | 9904 |
| 223 | Ga0070686_100271202 | 3300005544 | Bacteria | 1248 |
| 224 | Ga0070686_100858289 | 3300005544 | Bacteria | 736 |
| 225 | Ga0070695_100272076 | 3300005545 | Unclassified | 1241 |
| 226 | Ga0070696_100308671 | 3300005546 | Bacteria | 1214 |
| 227 | Ga0070693_100119453 | 3300005547 | Bacteria | 1633 |
| 228 | Ga0070693_100375428 | 3300005547 | Unclassified | 979 |
| 229 | Ga0070693_101057167 | 3300005547 | Unclassified | 617 |
| 230 | Ga0070665_100026135 | 3300005548 | Bacteria | 5878 |
| 231 | Ga0070665_100611302 | 3300005548 | Bacteria | 1103 |
| 232 | Ga0070665_100882824 | 3300005548 | Unclassified | 907 |
| 233 | Ga0070665_101471881 | 3300005548 | Unclassified | 690 |
| 234 | Ga0070704_100277575 | 3300005549 | Bacteria | 1387 |
| 235 | Ga0070704_100324720 | 3300005549 | Bacteria | 1291 |
| 236 | Ga0070704_100515714 | 3300005549 | Bacteria | 1040 |
| 237 | Ga0070704_100844541 | 3300005549 | Bacteria | 821 |
| 238 | Ga0070664_100005370 | 3300005564 | Bacteria | 10288 |
| 239 | Ga0070664_100041960 | 3300005564 | Bacteria | 3862 |
| 240 | Ga0070664_100052057 | 3300005564 | Unclassified | 3467 |
| 241 | Ga0070664_100145346 | 3300005564 | Bacteria | 2091 |
| 242 | Ga0070664_100148300 | 3300005564 | Bacteria | 2070 |
| 243 | Ga0070664_100579614 | 3300005564 | Bacteria | 1039 |
| 244 | Ga0070664_102332596 | 3300005564 | Unclassified | 507 |
| 245 | Ga0068857_100027164 | 3300005577 | Bacteria | 5048 |
| 246 | Ga0068857_100532872 | 3300005577 | Bacteria | 1105 |
| 247 | Ga0068857_101200279 | 3300005577 | Bacteria | 735 |
| 248 | Ga0068854_100353870 | 3300005578 | Unclassified | 1203 |
| 249 | Ga0068856_100440721 | 3300005614 | Bacteria | 1323 |
| 250 | Ga0070702_100449133 | 3300005615 | Bacteria | 935 |
| 251 | Ga0068852_100127277 | 3300005616 | Bacteria | 2341 |
| 252 | Ga0068852_101947732 | 3300005616 | Bacteria | 610 |
| 253 | Ga0068859_100003217 | 3300005617 | Bacteria | 16627 |
| 254 | Ga0068859_100007329 | 3300005617 | Bacteria | 11190 |
| 255 | Ga0068859_100027985 | 3300005617 | Bacteria | 5651 |
| 256 | Ga0068859_100054697 | 3300005617 | Bacteria | 4015 |
| 257 | Ga0068859_101135372 | 3300005617 | Bacteria | 860 |
| 258 | Ga0068859_101739436 | 3300005617 | Bacteria | 689 |
| 259 | Ga0068864_100011606 | 3300005618 | Bacteria | 7274 |
| 260 | Ga0068864_100525708 | 3300005618 | Bacteria | 1141 |
| 261 | Ga0068864_101822508 | 3300005618 | Unclassified | 614 |
| 262 | Ga0068866_10222807 | 3300005718 | Bacteria | 1139 |
| 263 | Ga0068866_10269131 | 3300005718 | Bacteria | 1051 |
| 264 | Ga0068861_100044561 | 3300005719 | Bacteria | 3336 |
| 265 | Ga0068861_100121375 | 3300005719 | Bacteria | 2109 |
| 266 | Ga0068861_100228794 | 3300005719 | Bacteria | 1576 |
| 267 | Ga0068851_11075258 | 3300005834 | Unclassified | 510 |
| 268 | Ga0068870_10010727 | 3300005840 | Bacteria | 4219 |
| 269 | Ga0068870_10059173 | 3300005840 | Unclassified | 2053 |
| 270 | Ga0068870_10093666 | 3300005840 | Bacteria | 1685 |
| 271 | Ga0068870_10159588 | 3300005840 | Unclassified | 1336 |
| 272 | Ga0068870_10477126 | 3300005840 | Unclassified | 827 |
| 273 | Ga0068870_10951807 | 3300005840 | Unclassified | 610 |
| 274 | Ga0068863_100026234 | 3300005841 | Bacteria | 5560 |
| 275 | Ga0068863_100031429 | 3300005841 | Bacteria | 5065 |
| 276 | Ga0068863_100194186 | 3300005841 | Bacteria | 1951 |
| 277 | Ga0068863_100807471 | 3300005841 | Bacteria | 936 |
| 278 | Ga0068863_101344990 | 3300005841 | Unclassified | 722 |
| 279 | Ga0068863_102321419 | 3300005841 | Unclassified | 546 |
| 280 | Ga0068858_100021954 | 3300005842 | Bacteria | 5961 |
| 281 | Ga0068858_102478594 | 3300005842 | Unclassified | 512 |
| 282 | Ga0068860_100071370 | 3300005843 | Bacteria | 3300 |
| 283 | Ga0068860_100489572 | 3300005843 | Unclassified | 1226 |
| 284 | Ga0068860_100704189 | 3300005843 | Unclassified | 1020 |
| 285 | Ga0068862_100001025 | 3300005844 | Bacteria | 26893 |
| 286 | Ga0068862_100166119 | 3300005844 | Unclassified | 1973 |
| 287 | Ga0068862_100586466 | 3300005844 | Bacteria | 1068 |
| 288 | Ga0068862_100598717 | 3300005844 | Bacteria | 1058 |
| 289 | Ga0068862_100618764 | 3300005844 | Bacteria | 1042 |
| 290 | Ga0068862_100753587 | 3300005844 | Bacteria | 947 |
| 291 | Ga0068862_101615021 | 3300005844 | Unclassified | 655 |
| 292 | Ga0068862_101815108 | 3300005844 | Unclassified | 619 |
| 293 | Ga0081455_10146932 | 3300005937 | Bacteria | 1822 |
| 294 | Ga0081539_10005549 | 3300005985 | Bacteria | 12785 |
| 295 | Ga0081539_10200962 | 3300005985 | Bacteria | 921 |
| 296 | Ga0081539_10241490 | 3300005985 | Unclassified | 808 |
| 297 | Ga0075432_10041431 | 3300006058 | Bacteria | 1609 |
| 298 | Ga0070716_100321856 | 3300006173 | Bacteria | 1084 |
| 299 | Ga0097621_100010076 | 3300006237 | Bacteria | 6893 |
| 300 | Ga0097621_100039640 | 3300006237 | Unclassified | 3784 |
| 301 | Ga0097621_100062775 | 3300006237 | Bacteria | 3051 |
| 302 | Ga0097621_100140778 | 3300006237 | Bacteria | 2061 |
| 303 | Ga0097621_100636228 | 3300006237 | Unclassified | 978 |
| 304 | Ga0097621_100750224 | 3300006237 | Bacteria | 901 |
| 305 | Ga0097621_101933836 | 3300006237 | Bacteria | 563 |
| 306 | Ga0068871_100003652 | 3300006358 | Bacteria | 10572 |
| 307 | Ga0068871_100018419 | 3300006358 | Bacteria | 5306 |
| 308 | Ga0068871_100131306 | 3300006358 | Bacteria | 2124 |
| 309 | Ga0068871_100225394 | 3300006358 | Bacteria | 1625 |
| 310 | Ga0068871_100284430 | 3300006358 | Bacteria | 1447 |
| 311 | Ga0068871_100483951 | 3300006358 | Unclassified | 1113 |
| 312 | Ga0075428_100002841 | 3300006844 | Bacteria | 18885 |
| 313 | Ga0075428_100062988 | 3300006844 | Bacteria | 4060 |
| 314 | Ga0075428_100311914 | 3300006844 | Unclassified | 1691 |
| 315 | Ga0075428_100479914 | 3300006844 | Bacteria | 1331 |
| 316 | Ga0075430_100008036 | 3300006846 | Bacteria | 8916 |
| 317 | Ga0075430_100187479 | 3300006846 | Unclassified | 1720 |
| 318 | Ga0075431_100015089 | 3300006847 | Bacteria | 7823 |
| 319 | Ga0075431_100024715 | 3300006847 | Bacteria | 6160 |
| 320 | Ga0075431_100039344 | 3300006847 | Unclassified | 4872 |
| 321 | Ga0075431_100298840 | 3300006847 | Bacteria | 1627 |
| 322 | Ga0075433_10000251 | 3300006852 | Bacteria | 31061 |
| 323 | Ga0075433_10001092 | 3300006852 | Bacteria | 19562 |
| 324 | Ga0075433_10025597 | 3300006852 | Bacteria | 4989 |
| 325 | Ga0075433_10191200 | 3300006852 | Bacteria | 1821 |
| 326 | Ga0075434_100406549 | 3300006871 | Bacteria | 1382 |
| 327 | Ga0075434_101072232 | 3300006871 | Bacteria | 819 |
| 328 | Ga0075429_100002679 | 3300006880 | Bacteria | 14985 |
| 329 | Ga0075429_100011793 | 3300006880 | Bacteria | 7578 |
| 330 | Ga0075429_100027208 | 3300006880 | Bacteria | 4963 |
| 331 | Ga0075429_100106941 | 3300006880 | Bacteria | 2445 |
| 332 | Ga0075429_100455720 | 3300006880 | Bacteria | 1121 |
| 333 | Ga0075429_101205586 | 3300006880 | Unclassified | 661 |
| 334 | Ga0068865_100314861 | 3300006881 | Unclassified | 1257 |
| 335 | Ga0068865_100328685 | 3300006881 | Bacteria | 1232 |
| 336 | Ga0068865_100517196 | 3300006881 | Bacteria | 998 |
| 337 | Ga0075436_100539307 | 3300006914 | Bacteria | 856 |
| 338 | Ga0097620_100003217 | 3300006931 | Bacteria | 16627 |
| 339 | Ga0097620_100007329 | 3300006931 | Bacteria | 11190 |
| 340 | Ga0097620_100027989 | 3300006931 | Bacteria | 5651 |
| 341 | Ga0097620_100054698 | 3300006931 | Bacteria | 4015 |
| 342 | Ga0097620_101135261 | 3300006931 | Bacteria | 860 |
| 343 | Ga0097620_101739471 | 3300006931 | Bacteria | 689 |
| 344 | Ga0075435_100005384 | 3300007076 | Bacteria | 8927 |
| 345 | Ga0075435_100010639 | 3300007076 | Bacteria | 6734 |
| 346 | Ga0111539_10000346 | 3300009094 | Bacteria | 57056 |
| 347 | Ga0111539_10007109 | 3300009094 | Bacteria | 14347 |
| 348 | Ga0111539_10007388 | 3300009094 | Bacteria | 14075 |
| 349 | Ga0111539_10069875 | 3300009094 | Bacteria | 4146 |
| 350 | Ga0111539_10185810 | 3300009094 | Bacteria | 2427 |
| 351 | Ga0111539_10316968 | 3300009094 | Bacteria | 1815 |
| 352 | Ga0111539_10815396 | 3300009094 | Unclassified | 1086 |
| 353 | Ga0111539_11041117 | 3300009094 | Unclassified | 951 |
| 354 | Ga0111539_11738661 | 3300009094 | Bacteria | 723 |
| 355 | Ga0105245_10450959 | 3300009098 | Bacteria | 1295 |
| 356 | Ga0105245_11940776 | 3300009098 | Unclassified | 642 |
| 357 | Ga0105245_12174250 | 3300009098 | Bacteria | 609 |
| 358 | Ga0105247_11150718 | 3300009101 | Bacteria | 615 |
| 359 | Ga0114129_10025960 | 3300009147 | Bacteria | 8297 |
| 360 | Ga0114129_10045968 | 3300009147 | Bacteria | 6136 |
| 361 | Ga0114129_10111458 | 3300009147 | Bacteria | 3775 |
| 362 | Ga0114129_10396622 | 3300009147 | Bacteria | 1819 |
| 363 | Ga0114129_11678749 | 3300009147 | Bacteria | 776 |
| 364 | Ga0114129_11744471 | 3300009147 | Bacteria | 759 |
| 365 | Ga0105243_11783189 | 3300009148 | Unclassified | 646 |
| 366 | Ga0105242_10149065 | 3300009176 | Bacteria | 2038 |
| 367 | Ga0105242_11936888 | 3300009176 | Unclassified | 630 |
| 368 | Ga0105248_10025687 | 3300009177 | Bacteria | 6551 |
| 369 | Ga0105248_10163474 | 3300009177 | Bacteria | 2510 |
| 370 | Ga0105248_10292678 | 3300009177 | Bacteria | 1834 |
| 371 | Ga0105248_10777208 | 3300009177 | Unclassified | 1081 |
| 372 | Ga0105237_10654050 | 3300009545 | Unclassified | 1058 |
| 373 | Ga0105238_12264924 | 3300009551 | Unclassified | 578 |
| 374 | Ga0105249_10019650 | 3300009553 | Bacteria | 6029 |
| 375 | Ga0105249_11022792 | 3300009553 | Bacteria | 895 |
| 376 | Ga0105249_11033545 | 3300009553 | Unclassified | 891 |
| 377 | Ga0105249_11520613 | 3300009553 | Unclassified | 742 |
| 378 | Ga0105239_11251973 | 3300010375 | Unclassified | 855 |
| 379 | Ga0105246_10526675 | 3300011119 | Bacteria | 1008 |
| 380 | Ga0105246_10859642 | 3300011119 | Bacteria | 810 |
| 381 | Ga0157313_1022134 | 3300012503 | Bacteria | 658 |
| 382 | Ga0157324_1005969 | 3300012506 | Bacteria | 901 |
| 383 | Ga0157373_11282502 | 3300013100 | Unclassified | 554 |
| 384 | Ga0157371_10278883 | 3300013102 | Bacteria | 1207 |
| 385 | Ga0157369_12670384 | 3300013105 | Unclassified | 503 |
| 386 | Ga0157374_10071768 | 3300013296 | Bacteria | 3266 |
| 387 | Ga0157378_10009365 | 3300013297 | Bacteria | 8533 |
| 388 | Ga0157378_10719441 | 3300013297 | Unclassified | 1019 |
| 389 | Ga0157378_11087727 | 3300013297 | Bacteria | 836 |
| 390 | Ga0157378_12117785 | 3300013297 | Bacteria | 613 |
| 391 | Ga0157378_12745773 | 3300013297 | Unclassified | 545 |
| 392 | Ga0163162_10011291 | 3300013306 | Bacteria | 8710 |
| 393 | Ga0163162_10011337 | 3300013306 | Bacteria | 8692 |
| 394 | Ga0163162_10921463 | 3300013306 | Bacteria | 986 |
| 395 | Ga0163162_10998945 | 3300013306 | Bacteria | 946 |
| 396 | Ga0163162_11424800 | 3300013306 | Bacteria | 788 |
| 397 | Ga0157372_12018816 | 3300013307 | Unclassified | 663 |
| 398 | Ga0157375_10010270 | 3300013308 | Bacteria | 8239 |
| 399 | Ga0157375_10141462 | 3300013308 | Bacteria | 2533 |
| 400 | Ga0157375_10206991 | 3300013308 | Bacteria | 2118 |
| 401 | Ga0157375_10563765 | 3300013308 | Bacteria | 1300 |
| 402 | Ga0157375_11263536 | 3300013308 | Bacteria | 867 |
| 403 | Ga0157375_11988744 | 3300013308 | Bacteria | 691 |
| 404 | Ga0163163_10064680 | 3300014325 | Unclassified | 3629 |
| 405 | Ga0163163_10309143 | 3300014325 | Bacteria | 1633 |
| 406 | Ga0163163_10416754 | 3300014325 | Unclassified | 1402 |
| 407 | Ga0157380_10044593 | 3300014326 | Bacteria | 3476 |
| 408 | Ga0157380_10211833 | 3300014326 | Bacteria | 1727 |
| 409 | Ga0157377_10024608 | 3300014745 | Bacteria | 3202 |
| 410 | Ga0157377_10062614 | 3300014745 | Unclassified | 2129 |
| 411 | Ga0157377_10068383 | 3300014745 | Bacteria | 2047 |
| 412 | Ga0157377_10084779 | 3300014745 | Bacteria | 1859 |
| 413 | Ga0157377_10279846 | 3300014745 | Bacteria | 1093 |
| 414 | Ga0157379_10086884 | 3300014968 | Bacteria | 2804 |
| 415 | Ga0157376_10167116 | 3300014969 | Bacteria | 2000 |
| 416 | Ga0157376_12137937 | 3300014969 | Bacteria | 598 |
| 417 | Ga0157376_12367905 | 3300014969 | Bacteria | 570 |
| 418 | Ga0182007_10248501 | 3300015262 | Unclassified | 637 |
| 419 | Ga0163161_10038785 | 3300017792 | Bacteria | 3418 |
| 420 | Ga0163161_10111626 | 3300017792 | Bacteria | 2044 |
| 421 | Ga0163161_10530284 | 3300017792 | Unclassified | 962 |
| 422 | Ga0163161_11051717 | 3300017792 | Bacteria | 697 |
| 423 | Ga0206356_11730128 | 3300020070 | Bacteria | 510 |
| 424 | Ga0206351_10788732 | 3300020077 | Bacteria | 610 |
| 425 | Ga0206352_10552676 | 3300020078 | Bacteria | 708 |
| 426 | Ga0206352_10946638 | 3300020078 | Bacteria | 547 |
| 427 | Ga0206352_11266020 | 3300020078 | Unclassified | 573 |
| 428 | Ga0207673_1007456 | 3300025290 | Bacteria | 1373 |
| 429 | Ga0207697_10000815 | 3300025315 | Bacteria | 17655 |
| 430 | Ga0207682_10001377 | 3300025893 | Bacteria | 11222 |
| 431 | Ga0207682_10018403 | 3300025893 | Bacteria | 2731 |
| 432 | Ga0207682_10173463 | 3300025893 | Bacteria | 982 |
| 433 | Ga0207642_10316141 | 3300025899 | Bacteria | 910 |
| 434 | Ga0207688_10016453 | 3300025901 | Bacteria | 4011 |
| 435 | Ga0207680_10067471 | 3300025903 | Unclassified | 2204 |
| 436 | Ga0207680_10084265 | 3300025903 | Bacteria | 2005 |
| 437 | Ga0207680_10301161 | 3300025903 | Unclassified | 1118 |
| 438 | Ga0207647_10092929 | 3300025904 | Bacteria | 1798 |
| 439 | Ga0207645_10002151 | 3300025907 | Bacteria | 15755 |
| 440 | Ga0207645_10116427 | 3300025907 | Bacteria | 1733 |
| 441 | Ga0207645_10201849 | 3300025907 | Bacteria | 1308 |
| 442 | Ga0207645_10304298 | 3300025907 | Bacteria | 1062 |
| 443 | Ga0207643_10000847 | 3300025908 | Bacteria | 18546 |
| 444 | Ga0207643_10050557 | 3300025908 | Bacteria | 2357 |
| 445 | Ga0207643_10107599 | 3300025908 | Unclassified | 1640 |
| 446 | Ga0207643_10159840 | 3300025908 | Unclassified | 1355 |
| 447 | Ga0207663_10466388 | 3300025916 | Bacteria | 976 |
| 448 | Ga0207660_10429331 | 3300025917 | Bacteria | 1067 |
| 449 | Ga0207660_10617702 | 3300025917 | Bacteria | 883 |
| 450 | Ga0207662_10027222 | 3300025918 | Bacteria | 3300 |
| 451 | Ga0207662_10053348 | 3300025918 | Bacteria | 2409 |
| 452 | Ga0207662_10539908 | 3300025918 | Bacteria | 806 |
| 453 | Ga0207662_11036457 | 3300025918 | Unclassified | 583 |
| 454 | Ga0207657_10471146 | 3300025919 | Bacteria | 985 |
| 455 | Ga0207649_10020915 | 3300025920 | Bacteria | 3757 |
| 456 | Ga0207646_10386213 | 3300025922 | Bacteria | 1265 |
| 457 | Ga0207681_10014630 | 3300025923 | Bacteria | 4883 |
| 458 | Ga0207681_10156615 | 3300025923 | Bacteria | 1712 |
| 459 | Ga0207681_10194962 | 3300025923 | Bacteria | 1552 |
| 460 | Ga0207681_10336887 | 3300025923 | Bacteria | 1204 |
| 461 | Ga0207681_10970724 | 3300025923 | Bacteria | 712 |
| 462 | Ga0207650_10027746 | 3300025925 | Unclassified | 4055 |
| 463 | Ga0207650_10287977 | 3300025925 | Bacteria | 1339 |
| 464 | Ga0207650_11220780 | 3300025925 | Unclassified | 640 |
| 465 | Ga0207659_10013636 | 3300025926 | Bacteria | 5213 |
| 466 | Ga0207659_10015545 | 3300025926 | Bacteria | 4935 |
| 467 | Ga0207659_10019068 | 3300025926 | Unclassified | 4507 |
| 468 | Ga0207659_10019983 | 3300025926 | Bacteria | 4419 |
| 469 | Ga0207659_10146462 | 3300025926 | Bacteria | 1839 |
| 470 | Ga0207659_10178869 | 3300025926 | Bacteria | 1679 |
| 471 | Ga0207659_10245530 | 3300025926 | Bacteria | 1450 |
| 472 | Ga0207659_10387244 | 3300025926 | Bacteria | 1167 |
| 473 | Ga0207659_10394427 | 3300025926 | Bacteria | 1156 |
| 474 | Ga0207659_10608280 | 3300025926 | Unclassified | 932 |
| 475 | Ga0207659_10847005 | 3300025926 | Unclassified | 786 |
| 476 | Ga0207659_10856438 | 3300025926 | Bacteria | 781 |
| 477 | Ga0207687_11009238 | 3300025927 | Bacteria | 714 |
| 478 | Ga0207644_10149878 | 3300025931 | Unclassified | 1804 |
| 479 | Ga0207644_10182674 | 3300025931 | Bacteria | 1645 |
| 480 | Ga0207644_10457123 | 3300025931 | Bacteria | 1049 |
| 481 | Ga0207644_10729311 | 3300025931 | Bacteria | 827 |
| 482 | Ga0207644_11207630 | 3300025931 | Unclassified | 636 |
| 483 | Ga0207690_10248329 | 3300025932 | Bacteria | 1373 |
| 484 | Ga0207690_10808634 | 3300025932 | Unclassified | 775 |
| 485 | Ga0207706_10016778 | 3300025933 | Bacteria | 6609 |
| 486 | Ga0207706_10038510 | 3300025933 | Bacteria | 4241 |
| 487 | Ga0207706_10139232 | 3300025933 | Bacteria | 2135 |
| 488 | Ga0207706_10229892 | 3300025933 | Bacteria | 1623 |
| 489 | Ga0207706_10278741 | 3300025933 | Bacteria | 1458 |
| 490 | Ga0207706_10307661 | 3300025933 | Bacteria | 1380 |
| 491 | Ga0207706_10701344 | 3300025933 | Bacteria | 865 |
| 492 | Ga0207686_11040579 | 3300025934 | Unclassified | 666 |
| 493 | Ga0207670_10146986 | 3300025936 | Bacteria | 1744 |
| 494 | Ga0207670_10294631 | 3300025936 | Unclassified | 1268 |
| 495 | Ga0207670_11122675 | 3300025936 | Bacteria | 664 |
| 496 | Ga0207670_11411729 | 3300025936 | Unclassified | 591 |
| 497 | Ga0207670_11653635 | 3300025936 | Unclassified | 545 |
| 498 | Ga0207669_10000948 | 3300025937 | Bacteria | 12283 |
| 499 | Ga0207669_10117704 | 3300025937 | Bacteria | 1796 |
| 500 | Ga0207669_10412215 | 3300025937 | Bacteria | 1061 |
| 501 | Ga0207669_10512272 | 3300025937 | Bacteria | 962 |
| 502 | Ga0207704_10228646 | 3300025938 | Bacteria | 1382 |
| 503 | Ga0207704_10337026 | 3300025938 | Bacteria | 1169 |
| 504 | Ga0207704_10515999 | 3300025938 | Unclassified | 966 |
| 505 | Ga0207665_10249923 | 3300025939 | Bacteria | 1310 |
| 506 | Ga0207691_10003859 | 3300025940 | Bacteria | 14545 |
| 507 | Ga0207691_10076812 | 3300025940 | Bacteria | 3009 |
| 508 | Ga0207691_10077231 | 3300025940 | Unclassified | 3000 |
| 509 | Ga0207691_10125062 | 3300025940 | Bacteria | 2276 |
| 510 | Ga0207691_10152614 | 3300025940 | Bacteria | 2030 |
| 511 | Ga0207691_10389641 | 3300025940 | Bacteria | 1189 |
| 512 | Ga0207691_10598355 | 3300025940 | Bacteria | 934 |
| 513 | Ga0207711_10076139 | 3300025941 | Bacteria | 2921 |
| 514 | Ga0207711_10256429 | 3300025941 | Bacteria | 1607 |
| 515 | Ga0207711_10549836 | 3300025941 | Unclassified | 1077 |
| 516 | Ga0207689_10003934 | 3300025942 | Bacteria | 13528 |
| 517 | Ga0207661_10049125 | 3300025944 | Bacteria | 3357 |
| 518 | Ga0207661_10182526 | 3300025944 | Bacteria | 1834 |
| 519 | Ga0207661_10541884 | 3300025944 | Unclassified | 1066 |
| 520 | Ga0207679_10003089 | 3300025945 | Bacteria | 10307 |
| 521 | Ga0207679_10064111 | 3300025945 | Unclassified | 2745 |
| 522 | Ga0207679_10097672 | 3300025945 | Bacteria | 2288 |
| 523 | Ga0207679_10101409 | 3300025945 | Bacteria | 2252 |
| 524 | Ga0207651_10037684 | 3300025960 | Bacteria | 3169 |
| 525 | Ga0207651_10048279 | 3300025960 | Unclassified | 2876 |
| 526 | Ga0207651_10203594 | 3300025960 | Bacteria | 1588 |
| 527 | Ga0207651_10592329 | 3300025960 | Bacteria | 968 |
| 528 | Ga0207651_10734979 | 3300025960 | Unclassified | 871 |
| 529 | Ga0207651_11089190 | 3300025960 | Bacteria | 716 |
| 530 | Ga0207651_11379396 | 3300025960 | Bacteria | 634 |
| 531 | Ga0207712_10012851 | 3300025961 | Bacteria | 5356 |
| 532 | Ga0207712_10052244 | 3300025961 | Bacteria | 2862 |
| 533 | Ga0207712_10745018 | 3300025961 | Bacteria | 858 |
| 534 | Ga0207668_10104355 | 3300025972 | Bacteria | 2113 |
| 535 | Ga0207668_10256621 | 3300025972 | Unclassified | 1423 |
| 536 | Ga0207668_10422583 | 3300025972 | Bacteria | 1132 |
| 537 | Ga0207668_10552831 | 3300025972 | Bacteria | 997 |
| 538 | Ga0207668_10845176 | 3300025972 | Bacteria | 812 |
| 539 | Ga0207668_11012305 | 3300025972 | Bacteria | 743 |
| 540 | Ga0207640_10301751 | 3300025981 | Unclassified | 1267 |
| 541 | Ga0207640_10308653 | 3300025981 | Bacteria | 1255 |
| 542 | Ga0207658_10028472 | 3300025986 | Bacteria | 3934 |
| 543 | Ga0207658_10238959 | 3300025986 | Bacteria | 1538 |
| 544 | Ga0207658_10697145 | 3300025986 | Unclassified | 917 |
| 545 | Ga0207658_11162782 | 3300025986 | Bacteria | 705 |
| 546 | Ga0207677_10181545 | 3300026023 | Bacteria | 1656 |
| 547 | Ga0207677_10309865 | 3300026023 | Unclassified | 1307 |
| 548 | Ga0207677_11227507 | 3300026023 | Bacteria | 687 |
| 549 | Ga0207703_10137831 | 3300026035 | Bacteria | 2114 |
| 550 | Ga0207678_10106708 | 3300026067 | Bacteria | 2389 |
| 551 | Ga0207708_10012732 | 3300026075 | Bacteria | 6273 |
| 552 | Ga0207708_10072323 | 3300026075 | Bacteria | 2642 |
| 553 | Ga0207708_10085304 | 3300026075 | Bacteria | 2429 |
| 554 | Ga0207708_10124432 | 3300026075 | Bacteria | 2011 |
| 555 | Ga0207702_11085326 | 3300026078 | Unclassified | 794 |
| 556 | Ga0207641_10151510 | 3300026088 | Bacteria | 2100 |
| 557 | Ga0207641_10505901 | 3300026088 | Unclassified | 1174 |
| 558 | Ga0207641_11118449 | 3300026088 | Unclassified | 786 |
| 559 | Ga0207641_11134463 | 3300026088 | Bacteria | 781 |
| 560 | Ga0207641_11190856 | 3300026088 | Bacteria | 761 |
| 561 | Ga0207648_10188792 | 3300026089 | Bacteria | 1826 |
| 562 | Ga0207648_10331099 | 3300026089 | Unclassified | 1370 |
| 563 | Ga0207648_12210107 | 3300026089 | Bacteria | 511 |
| 564 | Ga0207676_10047847 | 3300026095 | Unclassified | 3316 |
| 565 | Ga0207676_10049559 | 3300026095 | Bacteria | 3268 |
| 566 | Ga0207676_10079855 | 3300026095 | Bacteria | 2654 |
| 567 | Ga0207676_10298852 | 3300026095 | Bacteria | 1469 |
| 568 | Ga0207674_10343311 | 3300026116 | Unclassified | 1444 |
| 569 | Ga0207674_10354459 | 3300026116 | Bacteria | 1418 |
| 570 | Ga0207674_10355175 | 3300026116 | Unclassified | 1417 |
| 571 | Ga0207674_10632502 | 3300026116 | Bacteria | 1033 |
| 572 | Ga0207674_10703767 | 3300026116 | Unclassified | 975 |
| 573 | Ga0207675_100017515 | 3300026118 | Bacteria | 6686 |
| 574 | Ga0207675_100041704 | 3300026118 | Bacteria | 4285 |
| 575 | Ga0207675_100067537 | 3300026118 | Bacteria | 3342 |
| 576 | Ga0207675_100091533 | 3300026118 | Bacteria | 2860 |
| 577 | Ga0207675_100190325 | 3300026118 | Bacteria | 1968 |
| 578 | Ga0207683_10015294 | 3300026121 | Bacteria | 6532 |
| 579 | Ga0207683_10060332 | 3300026121 | Bacteria | 3334 |
| 580 | Ga0207683_10106058 | 3300026121 | Unclassified | 2512 |
| 581 | Ga0207683_10527536 | 3300026121 | Bacteria | 1091 |
| 582 | Ga0207683_10576904 | 3300026121 | Bacteria | 1040 |
| 583 | Ga0207683_10601822 | 3300026121 | Bacteria | 1017 |
| 584 | Ga0207698_10159578 | 3300026142 | Bacteria | 1970 |
| 585 | Ga0209981_1058278 | 3300027378 | Unclassified | 590 |
| 586 | Ga0209971_1021869 | 3300027682 | Unclassified | 1522 |
| 587 | Ga0209998_10044324 | 3300027717 | Bacteria | 1016 |
| 588 | Ga0209998_10131603 | 3300027717 | Unclassified | 635 |
| 589 | Ga0209974_10024351 | 3300027876 | Bacteria | 2003 |
| 590 | Ga0207428_10000756 | 3300027907 | Bacteria | 36837 |
| 591 | Ga0207428_10008286 | 3300027907 | Bacteria | 9398 |
| 592 | Ga0207428_10026108 | 3300027907 | Bacteria | 4879 |
| 593 | Ga0207428_10035828 | 3300027907 | Bacteria | 4053 |
| 594 | Ga0207428_10036818 | 3300027907 | Bacteria | 3986 |
| 595 | Ga0207428_10307891 | 3300027907 | Bacteria | 1172 |
| 596 | Ga0207428_10862163 | 3300027907 | Bacteria | 641 |
| 597 | Ga0268266_10095343 | 3300028379 | Bacteria | 2613 |
| 598 | Ga0268266_10737173 | 3300028379 | Unclassified | 951 |
| 599 | Ga0268266_11238784 | 3300028379 | Bacteria | 721 |
| 600 | Ga0268266_11348218 | 3300028379 | Bacteria | 689 |
| 601 | Ga0268265_10225239 | 3300028380 | Bacteria | 1644 |
| 602 | Ga0268265_10306809 | 3300028380 | Unclassified | 1431 |
| 603 | Ga0268265_10517284 | 3300028380 | Bacteria | 1127 |
| 604 | Ga0268265_10604693 | 3300028380 | Bacteria | 1048 |
| 605 | Ga0268264_10149351 | 3300028381 | Bacteria | 2094 |
| 606 | Ga0307408_101053101 | 3300031548 | Bacteria | 752 |
| 607 | Ga0307413_11179621 | 3300031824 | Unclassified | 665 |
| 608 | Ga0307410_10531439 | 3300031852 | Bacteria | 972 |
| 609 | Ga0307416_102075159 | 3300032002 | Bacteria | 671 |
| 610 | Ga0307416_102329067 | 3300032002 | Bacteria | 636 |
| 611 | Ga0373930_0186175 | 3300034816 | Bacteria | 535 |
| 612 | Ga0373949_0221374 | 3300035090 | Bacteria | 575 |
| 613 | Ga0373951_0158244 | 3300035091 | Unclassified | 639 |
| 614 | Ga0373923_0011933 | 3300035111 | Bacteria | 3200 |
| 615 | Ga0373936_0104444 | 3300035113 | Bacteria | 1198 |
| 616 | Ga0373945_0014209 | 3300035116 | Bacteria | 2663 |
| 617 | Ga0373945_0182862 | 3300035116 | Unclassified | 864 |
| 618 | Ga0373953_0221067 | 3300035117 | Bacteria | 820 |
| 619 | Ga0373954_0175009 | 3300035118 | Bacteria | 1052 |
| 620 | Ga0373956_0165388 | 3300035119 | Bacteria | 1043 |
| 621 | Ga0373957_0132118 | 3300035120 | Unclassified | 1017 |
| 622 | Ga0373943_0011201 | 3300035170 | Bacteria | 4033 |
| 623 | Ga0373946_0008234 | 3300035171 | Bacteria | 3827 |
| 624 | Ga0373946_0389702 | 3300035171 | Unclassified | 702 |
| 625 | Ga0373961_0278568 | 3300035241 | Bacteria | 613 |
| 626 | Ga0373962_0020002 | 3300035242 | Bacteria | 1755 |
| 627 | Ga0373924_0009510 | 3300035410 | Bacteria | 3564 |
| 628 | Ga0373927_0078320 | 3300035695 | Unclassified | 2141 |
| 629 | Ga0373927_0791877 | 3300035695 | Unclassified | 626 |
| 630 | Ga0373933_0213415 | 3300035724 | Unclassified | 1237 |
| 631 | Ga0373947_0009312 | 3300035725 | Bacteria | 5642 |
| 632 | Ga0373947_0605934 | 3300035725 | Bacteria | 746 |
| 633 | Ga0373937_0224127 | 3300036401 | Bacteria | 1770 |
| 634 | Ga0373937_0239021 | 3300036401 | Unclassified | 1711 |
| 635 | Ga0373925_0011544 | 3300037068 | Bacteria | 6392 |
| 636 | Ga0395901_1516583 | 3300038443 | Unclassified | 626 |
| 637 | Ga0436365_0592924 | 3300039437 | Unclassified | 4847 |
| 638 | Ga0439436_0086212 | 3300041404 | Unclassified | 874 |
| 639 | Ga0439453_0002672 | 3300041408 | Unclassified | 2484 |
| 640 | Ga0451835_0093829 | 3300041492 | Unclassified | 539 |
| 641 | Ga0451853_2008618 | 3300041512 | Unclassified | 843 |
| 642 | Ga0439454_034223 | 3300042011 | Unclassified | 809 |
| 643 | Ga0439446_0113930 | 3300042156 | Unclassified | 865 |
| 644 | Ga0439435_0144210 | 3300042436 | Bacteria | 760 |
| 645 | Ga0439444_0138595 | 3300042437 | Unclassified | 580 |
| 646 | Ga0439464_0082464 | 3300042439 | Bacteria | 962 |
| 647 | Ga0439464_0085329 | 3300042439 | Unclassified | 947 |
| 648 | Ga0439460_0044318 | 3300042461 | Bacteria | 1317 |
| 649 | Ga0495592_0049540 | 3300046454 | Bacteria | 3123 |
| 650 | Ga0495580_0142027 | 3300046472 | Bacteria | 1664 |
| 651 | Ga0495580_0287862 | 3300046472 | Bacteria | 1120 |
| 652 | Ga0495580_0529072 | 3300046472 | Bacteria | 785 |
| 653 | Ga0495580_0947371 | 3300046472 | Bacteria | 551 |
| 654 | Ga0495582_0455115 | 3300046473 | Unclassified | 739 |
| 655 | Ga0495608_0013627 | 3300046511 | Bacteria | 5640 |
| 656 | Ga0495628_0078101 | 3300046516 | Bacteria | 2574 |
| 657 | Ga0495628_0092475 | 3300046516 | Unclassified | 2339 |
| 658 | Ga0495630_0033831 | 3300046517 | Unclassified | 3812 |
| 659 | Ga0495643_0003101 | 3300046522 | Bacteria | 12441 |
| 660 | Ga0495643_0007021 | 3300046522 | Bacteria | 7316 |
| 661 | Ga0495652_0173494 | 3300046529 | Bacteria | 1662 |
| 662 | Ga0495665_0493918 | 3300046531 | Bacteria | 617 |
| 663 | Ga0495640_0211220 | 3300046533 | Bacteria | 1227 |
| 664 | Ga0495587_0024556 | 3300046536 | Bacteria | 3692 |
| 665 | Ga0495621_0097546 | 3300046539 | Unclassified | 1115 |
| 666 | Ga0495645_0166367 | 3300046543 | Unclassified | 1520 |
| 667 | Ga0495633_0058439 | 3300046558 | Bacteria | 1810 |
| 668 | Ga0495633_0346099 | 3300046558 | Bacteria | 674 |
| 669 | Ga0495667_0262030 | 3300046559 | Bacteria | 1099 |
| 670 | Ga0495656_0558531 | 3300046615 | Unclassified | 610 |
| 671 | Ga0495656_0664603 | 3300046615 | Unclassified | 560 |
| 672 | Ga0495634_0290847 | 3300046642 | Bacteria | 990 |
| 673 | Ga0495588_0263264 | 3300046674 | Bacteria | 909 |
| 674 | Ga0495657_0122994 | 3300046675 | Unclassified | 1633 |
| 675 | Ga0495646_0142664 | 3300046680 | Bacteria | 1338 |
| 676 | Ga0495647_0033858 | 3300046681 | Unclassified | 1911 |
| 677 | Ga0495647_0043992 | 3300046681 | Bacteria | 1711 |
| 678 | Ga0495658_0044788 | 3300046683 | Bacteria | 2480 |
| 679 | Ga0495658_0255607 | 3300046683 | Bacteria | 1102 |
| 680 | Ga0495669_0040396 | 3300046684 | Bacteria | 2069 |
| 681 | Ga0495613_0000790 | 3300046689 | Bacteria | 24652 |
| 682 | Ga0495670_0376829 | 3300046691 | Unclassified | 765 |
| 683 | Ga0495600_0250911 | 3300046809 | Bacteria | 1125 |
| 684 | Ga0495581_0276933 | 3300047315 | Bacteria | 981 |
| 685 | Ga0495581_0328006 | 3300047315 | Bacteria | 894 |
| 686 | Ga0495604_0453721 | 3300047317 | Bacteria | 837 |
| 687 | Ga0495636_0295377 | 3300047318 | Bacteria | 757 |
| 688 | Ga0495674_0048220 | 3300047319 | Bacteria | 3771 |
| 689 | Ga0495674_0364170 | 3300047319 | Bacteria | 1172 |
| 690 | Ga0495676_0912063 | 3300047321 | Unclassified | 563 |
| 691 | Ga0495680_0466678 | 3300047322 | Bacteria | 862 |
| 692 | Ga0495675_0258281 | 3300047444 | Unclassified | 1044 |
| 693 | Ga0495684_0000697 | 3300047471 | Bacteria | 26977 |
| 694 | Ga0495602_0440181 | 3300048088 | Bacteria | 922 |
| 695 | Ga0496100_0003342 | 3300048903 | Bacteria | 8357 |
| 696 | Ga0496100_0433312 | 3300048903 | Bacteria | 1006 |
| 697 | Ga0496101_0000660 | 3300048904 | Bacteria | 20776 |
| 698 | Ga0496102_0273024 | 3300048905 | Bacteria | 1594 |
| 699 | Ga0496102_1749171 | 3300048905 | Bacteria | 539 |
| 700 | Ga0496104_0510933 | 3300048907 | Bacteria | 1113 |
| 701 | Ga0496105_0229662 | 3300048908 | Unclassified | 1508 |
| 702 | Ga0496106_0035903 | 3300048909 | Bacteria | 3708 |
| 703 | Ga0496106_0207999 | 3300048909 | Bacteria | 1558 |
| 704 | Ga0496107_0612781 | 3300048910 | Unclassified | 804 |
| 705 | Ga0496108_0586930 | 3300048911 | Unclassified | 971 |
| 706 | Ga0496108_0923420 | 3300048911 | Bacteria | 748 |
| 707 | Ga0496109_0126303 | 3300048912 | Bacteria | 2385 |
| 708 | Ga0496109_0126652 | 3300048912 | Unclassified | 2382 |
| 709 | Ga0496109_0231072 | 3300048912 | Unclassified | 1740 |
| 710 | Ga0496110_0579920 | 3300048913 | Bacteria | 1018 |
| 711 | Ga0496113_0227788 | 3300048916 | Bacteria | 1486 |
| 712 | Ga0496114_0000409 | 3300048917 | Bacteria | 31807 |
| 713 | Ga0496114_0322951 | 3300048917 | Bacteria | 1364 |
| 714 | Ga0501308_025804 | 3300049128 | Unclassified | 763 |
| 715 | Ga0501308_035943 | 3300049128 | Unclassified | 682 |
| 716 | Ga0501308_047531 | 3300049128 | Unclassified | 621 |
| 717 | Ga0501308_070606 | 3300049128 | Bacteria | 542 |
| 718 | Ga0501309_076386 | 3300049129 | Bacteria | 557 |
| 719 | Ga0501309_099240 | 3300049129 | Unclassified | 503 |
| 720 | Ga0501310_028854 | 3300049130 | Unclassified | 729 |
| 721 | Ga0501305_019899 | 3300049161 | Unclassified | 983 |
| 722 | Ga0501305_071091 | 3300049161 | Unclassified | 612 |
| 723 | Ga0501307_091405 | 3300049162 | Unclassified | 508 |
| 724 | Ga0501311_018930 | 3300049527 | Unclassified | 919 |
| 725 | Ga0501311_098827 | 3300049527 | Bacteria | 515 |
| 726 | Ga0501311_105359 | 3300049527 | Unclassified | 503 |
| 727 | Ga0501312_032754 | 3300049528 | Unclassified | 822 |
| 728 | Ga0501313_050999 | 3300049529 | Unclassified | 572 |
| 729 | Ga0501314_041595 | 3300049530 | Unclassified | 537 |
| 730 | Ga0501315_077919 | 3300049531 | Bacteria | 559 |
| 731 | Ga0501316_080964 | 3300049532 | Unclassified | 502 |
| 732 | Ga0501317_084112 | 3300049533 | Unclassified | 554 |
| 733 | Ga0501320_069639 | 3300049536 | Unclassified | 507 |
| 734 | Ga0501031_0982666 | 3300049568 | Unclassified | 540 |
| 735 | Ga0501033_0220332 | 3300049570 | Unclassified | 1351 |
| 736 | Ga0501036_1266168 | 3300049572 | Unclassified | 600 |
| 737 | Ga0501039_0094607 | 3300049575 | Bacteria | 2329 |
| 738 | Ga0501040_0029386 | 3300049576 | Bacteria | 3710 |
| 739 | Ga0501040_0290299 | 3300049576 | Unclassified | 1169 |
| 740 | Ga0501042_0026619 | 3300049578 | Bacteria | 4063 |
| 741 | Ga0501046_0913457 | 3300049580 | Bacteria | 612 |
| 742 | Ga0501068_0270890 | 3300049584 | Unclassified | 1084 |
| 743 | Ga0501071_0123927 | 3300049587 | Bacteria | 1917 |
| 744 | Ga0501071_0616179 | 3300049587 | Unclassified | 835 |
| 745 | Ga0501073_0649364 | 3300049589 | Bacteria | 728 |
| 746 | Ga0501074_0357905 | 3300049590 | Bacteria | 1036 |
| 747 | Ga0501075_0051252 | 3300049591 | Unclassified | 3103 |
| 748 | Ga0501075_0203823 | 3300049591 | Unclassified | 1509 |
| 749 | Ga0501075_0578138 | 3300049591 | Unclassified | 857 |
| 750 | Ga0501076_0690170 | 3300049592 | Unclassified | 843 |
| 751 | Ga0501076_0778170 | 3300049592 | Unclassified | 790 |
| 752 | Ga0501079_0787633 | 3300049741 | Unclassified | 748 |
| 753 | Ga0501079_0807239 | 3300049741 | Unclassified | 739 |
| 754 | Ga0501079_1247548 | 3300049741 | Unclassified | 585 |
| 755 | Ga0501079_1272131 | 3300049741 | Unclassified | 579 |
| 756 | Ga0501080_0672587 | 3300049742 | Bacteria | 915 |
| 757 | Ga0501080_1841595 | 3300049742 | Unclassified | 508 |
| 758 | Ga0501081_0035653 | 3300049743 | Bacteria | 3387 |
| 759 | Ga0501081_0498126 | 3300049743 | Bacteria | 908 |
| 760 | Ga0501035_1154597 | 3300049822 | Unclassified | 603 |
| 761 | Ga0501045_0104482 | 3300049824 | Bacteria | 2099 |
| 762 | nmdc:mga05p37_117687_c1 | 3300050507 | Bacteria | 3265 |
| 763 | nmdc:mga05p37_19854_c1 | 3300050507 | Bacteria | 2752 |
| 764 | nmdc:mga05p37_49082_c1 | 3300050507 | Bacteria | 5191 |
| 765 | nmdc:mga09592_139459_c1 | 3300050508 | Unclassified | 2089 |
| 766 | nmdc:mga09592_142615_c1 | 3300050508 | Bacteria | 2065 |
| 767 | nmdc:mga09592_340389_c1 | 3300050508 | Bacteria | 1298 |
| 768 | nmdc:mga09592_396027_c1 | 3300050508 | Bacteria | 1194 |
| 769 | nmdc:mga09592_74566_c1 | 3300050508 | Unclassified | 2883 |
| 770 | nmdc:mga09592_846_c1 | 3300050508 | Bacteria | 23790 |
| 771 | nmdc:mga0qj67_136564_c1 | 3300050509 | Unclassified | 1987 |
| 772 | nmdc:mga0qj67_137991_c1 | 3300050509 | Bacteria | 1976 |
| 773 | nmdc:mga0qj67_9598_c1 | 3300050509 | Bacteria | 7213 |
| 774 | nmdc:mga06r32_1315493_c1 | 3300050510 | Bacteria | 666 |
| 775 | nmdc:mga06r32_2905_c1 | 3300050510 | Bacteria | 15383 |
| 776 | nmdc:mga06r32_373624_c1 | 3300050510 | Unclassified | 1409 |
| 777 | nmdc:mga06r32_39065_c1 | 3300050510 | Unclassified | 4502 |
| 778 | nmdc:mga06r32_60325_c1 | 3300050510 | Unclassified | 3650 |
| 779 | nmdc:mga08y16_1485269_c1 | 3300050511 | Bacteria | 639 |
| 780 | nmdc:mga08y16_1867064_c1 | 3300050511 | Bacteria | 552 |
| 781 | nmdc:mga08y16_2011487_c1 | 3300050511 | Unclassified | 527 |
| 782 | nmdc:mga08y16_30452_c1 | 3300050511 | Bacteria | 5680 |
| 783 | nmdc:mga08y16_40972_c1 | 3300050511 | Bacteria | 4852 |
| 784 | nmdc:mga08y16_479493_c1 | 3300050511 | Bacteria | 1266 |
| 785 | nmdc:mga08y16_539922_c1 | 3300050511 | Bacteria | 1181 |
| 786 | nmdc:mga08y16_633_c1 | 3300050511 | Bacteria | 32997 |
| 787 | nmdc:mga08y16_6429_c1 | 3300050511 | Bacteria | 12319 |
| 788 | nmdc:mga0rr50_50168_c1 | 3300050513 | Bacteria | 3091 |
| 789 | nmdc:mga08x19_650164_c1 | 3300050514 | Bacteria | 748 |
| 790 | nmdc:mga08x19_772985_c1 | 3300050514 | Unclassified | 682 |
| 791 | nmdc:mga0a205_260959_c1 | 3300050515 | Unclassified | 1610 |
| 792 | nmdc:mga0a205_81787_c1 | 3300050515 | Bacteria | 1945 |
| 793 | nmdc:mga0a205_9233_c1 | 3300050515 | Bacteria | 9004 |
| 794 | Ga0495601_0123718 | 3300053077 | Unclassified | 1681 |
| 795 | Ga0495612_0073802 | 3300053078 | Bacteria | 1426 |
| 796 | Ga0495595_0044489 | 3300053084 | Unclassified | 2040 |
| 797 | Ga0495595_0117905 | 3300053084 | Bacteria | 1291 |
| 798 | Ga0495619_0003275 | 3300053085 | Bacteria | 10470 |
| 799 | Ga0495619_0552065 | 3300053085 | Unclassified | 790 |
| 800 | Ga0501084_0008598 | 3300054114 | Bacteria | 8440 |
| 801 | Ga0501084_0463183 | 3300054114 | Bacteria | 1072 |
| 802 | Ga0590075_129046 | 3300059424 | Unclassified | 663 |
| 803 | Ga0587084_045894 | 3300059477 | Unclassified | 758 |
| 804 | Ga0587066_065413 | 3300059490 | Unclassified | 753 |
| 805 | Ga0587066_080622 | 3300059490 | Unclassified | 704 |
| 806 | Ga0587070_097305 | 3300059491 | Unclassified | 671 |
| 807 | Ga0587073_0062478 | 3300059492 | Unclassified | 878 |
| 808 | Ga0587077_128274 | 3300059493 | Bacteria | 641 |
| 809 | Ga0587077_222994 | 3300059493 | Bacteria | 532 |
| 810 | Ga0587080_063049 | 3300059503 | Unclassified | 726 |
| 811 | Ga0587082_055398 | 3300059504 | Unclassified | 768 |
| 812 | Ga0587082_059561 | 3300059504 | Bacteria | 750 |
| 813 | Ga0587083_0131972 | 3300059505 | Unclassified | 656 |
| 814 | Ga0587085_038277 | 3300059506 | Unclassified | 823 |
| 815 | Ga0587085_089006 | 3300059506 | Unclassified | 634 |
| 816 | Ga0587085_171837 | 3300059506 | Bacteria | 514 |
| 817 | Ga0587090_055536 | 3300059510 | Unclassified | 737 |
| 818 | Ga0587091_074401 | 3300059511 | Bacteria | 750 |
| 819 | Ga0587092_052880 | 3300059512 | Unclassified | 740 |
| 820 | Ga0587092_066559 | 3300059512 | Bacteria | 685 |
| 821 | Ga0587094_061503 | 3300059513 | Bacteria | 658 |
| 822 | Ga0587125_036131 | 3300059607 | Unclassified | 650 |
| 823 | Ga0587101_002563 | 3300059623 | Bacteria | 1752 |
| 824 | Ga0587101_042625 | 3300059623 | Unclassified | 754 |
| 825 | Ga0587101_063952 | 3300059623 | Unclassified | 664 |
| 826 | Ga0587115_032401 | 3300059626 | Bacteria | 783 |
| 827 | Ga0587115_057822 | 3300059626 | Unclassified | 644 |
| 828 | Ga0587130_042373 | 3300059631 | Unclassified | 553 |
| 829 | Ga0587062_053577 | 3300059639 | Unclassified | 690 |
| 830 | Ga0587067_091741 | 3300059640 | Unclassified | 689 |
| 831 | Ga0587068_058512 | 3300059641 | Unclassified | 737 |
| 832 | Ga0587072_065690 | 3300059643 | Unclassified | 756 |
| 833 | Ga0587072_156616 | 3300059643 | Bacteria | 554 |
| 834 | Ga0587075_038076 | 3300059644 | Unclassified | 795 |
| 835 | Ga0587100_015058 | 3300059648 | Unclassified | 704 |
| 836 | Ga0587102_030159 | 3300059649 | Unclassified | 659 |
| 837 | Ga0587107_065921 | 3300059652 | Unclassified | 650 |
| 838 | Ga0587071_067690 | 3300060344 | Bacteria | 771 |
| 839 | Ga0587111_0044458 | 3300060346 | Bacteria | 959 |
| 840 | Ga0587111_0113504 | 3300060346 | Unclassified | 689 |
| 841 | Ga0501082_0106233 | 3300060353 | Bacteria | 2429 |
| 842 | Ga0530510_0414040 | 3300061734 | Unclassified | 1017 |
| 843 | Ga0157376_10972869 | |||
| 844 | JGI24746J21847_1001312 | |||
| 845 | JGI24746J21847_1002613 | |||
| 846 | JGI24749J21850_1035925 | |||
| 847 | JGI24751J29686_10079364 | |||
| 848 | Ga0006763J43179_102979 | |||
| 849 | Ga0006762J43184_102821 | |||
| 850 | Ga0006765J45826_102709 | |||
| 851 | Ga0006778J45830_1008035 | |||
| 852 | Ga0006759J45824_1007035 | |||
| 853 | Ga0006759J45824_1015090 | |||
| 854 | Ga0006759J45824_1018684 | |||
| 855 | JGI25406J46586_10022522 | |||
| 856 | Ga0006758J48902_1004937 | |||
| 857 | Ga0006770J48903_1009933 | |||
| 858 | Ga0006770J48903_1011447 | |||
| 859 | Ga0006777J48905_1009548 | |||
| 860 | Ga0006777J48905_1023568 | |||
| 861 | Ga0007417J51691_1006602 | |||
| 862 | Ga0007417J51691_1020827 | |||
| 863 | Ga0007427J51700_104200 | |||
| 864 | Ga0006781J51513_1003563 | |||
| 865 | Ga0007410J51695_1118318 | |||
| 866 | Ga0007409J51694_1008062 | |||
| 867 | Ga0007409J51694_1089376 | |||
| 868 | Ga0007416J51690_1020843 | |||
| 869 | Ga0007429J51699_1011709 | |||
| 870 | Ga0007429J51699_1014819 | |||
| 871 | Ga0007429J51699_1021144 | |||
| 872 | Ga0007411J51799_109537 | |||
| 873 | Ga0007415J51800_105917 | |||
| 874 | Ga0032354_1001770 | |||
| 875 | Ga0032354_1024662 | |||
| 876 | Ga0032354_1044077 | |||
| 877 | Ga0006780_1001386 | |||
| 878 | Ga0058858_1005683 | |||
| 879 | Ga0058858_1434174 | |||
| 880 | Ga0058859_10026768 | |||
| 881 | Ga0058859_10047863 | |||
| 882 | Ga0058859_10048081 | |||
| 883 | Ga0058859_10068287 | |||
| 884 | Ga0058859_10138439 | |||
| 885 | Ga0058863_11744773 | |||
| 886 | Ga0058863_11851899 | |||
| 887 | Ga0058861_10045090 | |||
| 888 | Ga0058861_10090615 | |||
| 889 | Ga0058861_11811094 | |||
| 890 | Ga0058861_11984224 | |||
| 891 | Ga0058861_12067518 | |||
| 892 | Ga0058860_10004586 | |||
| 893 | Ga0058860_10022220 | |||
| 894 | Ga0058860_10053229 | |||
| 895 | Ga0058860_10053703 | |||
| 896 | Ga0058860_10120934 | |||
| 897 | Ga0058860_12157817 | |||
| 898 | Ga0058860_12194457 | |||
| 899 | Ga0058862_12532843 | |||
| 900 | Ga0058862_12633905 | |||
| 901 | Ga0058862_12868080 | |||
| 902 | Ga0058862_12874132 | |||
| 903 | Ga0065714_10079673 | |||
| 904 | Ga0065714_10097205 | |||
| 905 | Ga0065704_10016305 | |||
| 906 | Ga0065712_10029825 | |||
| 907 | Ga0065712_10067852 | |||
| 908 | Ga0065712_10075103 | |||
| 909 | Ga0065715_10005596 | |||
| 910 | Ga0065715_10015619 | |||
| 911 | Ga0065715_10211374 | |||
| 912 | Ga0065715_10800613 | |||
| 913 | Ga0065715_10886075 | |||
| 914 | Ga0065707_10015336 | |||
| 915 | Ga0070658_10375830 | |||
| 916 | Ga0070676_10030575 | |||
| 917 | Ga0070676_10260275 | |||
| 918 | Ga0070676_10410942 | |||
| 919 | Ga0070676_10735737 | |||
| 920 | Ga0070683_100125341 | |||
| 921 | Ga0070683_100169869 | |||
| 922 | Ga0070690_100034739 | |||
| 923 | Ga0070690_100051401 | |||
| 924 | Ga0070690_100082110 | |||
| 925 | Ga0070670_100000476 | |||
| 926 | Ga0070670_100027457 | |||
| 927 | Ga0070670_101072705 | |||
| 928 | Ga0070677_10002043 | |||
| 929 | Ga0070677_10086770 | |||
| 930 | Ga0070677_10229033 | |||
| 931 | Ga0068869_100022580 | |||
| 932 | Ga0068869_100473526 | |||
| 933 | Ga0068869_101411936 | |||
| 934 | Ga0070666_10022675 | |||
| 935 | Ga0070666_10024365 | |||
| 936 | Ga0070666_10168480 | |||
| 937 | Ga0070666_10389439 | |||
| 938 | Ga0070666_10639580 | |||
| 939 | Ga0070680_100101329 | |||
| 940 | Ga0070680_100395196 | |||
| 941 | Ga0068868_100663789 | |||
| 942 | Ga0068868_100890840 | |||
| 943 | Ga0068868_100981448 | |||
| 944 | Ga0068868_101199029 | |||
| 945 | Ga0068868_101333898 | |||
| 946 | Ga0070689_100011003 | |||
| 947 | Ga0070689_100104448 | |||
| 948 | Ga0070689_100223079 | |||
| 949 | Ga0070689_100596154 | |||
| 950 | Ga0070687_100010039 | |||
| 951 | Ga0070687_100018578 | |||
| 952 | Ga0070687_100124272 | |||
| 953 | Ga0070687_101045643 | |||
| 954 | Ga0070661_100049848 | |||
| 955 | Ga0070661_100099422 | |||
| 956 | Ga0070661_100407031 | |||
| 957 | Ga0070692_10281658 | |||
| 958 | Ga0070692_10565910 | |||
| 959 | Ga0070692_10854010 | |||
| 960 | Ga0070668_100021463 | |||
| 961 | Ga0070668_100136423 | |||
| 962 | Ga0070668_100494447 | |||
| 963 | Ga0070668_100688625 | |||
| 964 | Ga0070669_100017963 | |||
| 965 | Ga0070669_100034057 | |||
| 966 | Ga0070669_100043507 | |||
| 967 | Ga0070669_100163591 | |||
| 968 | Ga0070669_100488722 | |||
| 969 | Ga0070669_100814540 | |||
| 970 | Ga0070675_100000983 | |||
| 971 | Ga0070675_100028849 | |||
| 972 | Ga0070675_100068764 | |||
| 973 | Ga0070675_100085737 | |||
| 974 | Ga0070675_100103252 | |||
| 975 | Ga0070675_100106234 | |||
| 976 | Ga0070675_100135646 | |||
| 977 | Ga0070675_100197848 | |||
| 978 | Ga0070675_100209626 | |||
| 979 | Ga0070675_100434909 | |||
| 980 | Ga0070675_100784429 | |||
| 981 | Ga0070675_101199374 | |||
| 982 | Ga0070675_101441126 | |||
| 983 | Ga0070671_100043604 | |||
| 984 | Ga0070671_100108267 | |||
| 985 | Ga0070671_100126417 | |||
| 986 | Ga0070671_100517561 | |||
| 987 | Ga0070674_100000340 | |||
| 988 | Ga0070674_100039459 | |||
| 989 | Ga0070674_100184987 | |||
| 990 | Ga0070674_100382366 | |||
| 991 | Ga0070674_100525732 | |||
| 992 | Ga0070674_100528090 | |||
| 993 | Ga0070674_100786871 | |||
| 994 | Ga0070673_100004440 | |||
| 995 | Ga0070673_100014441 | |||
| 996 | Ga0070673_100023051 | |||
| 997 | Ga0070673_100033322 | |||
| 998 | Ga0070673_100116060 | |||
| 999 | Ga0070673_100609279 | |||
| 1000 | Ga0070688_100029468 | |||
| 1001 | Ga0070688_100030176 | |||
| 1002 | Ga0070688_100177410 | |||
| 1003 | Ga0070688_100264110 | |||
| 1004 | Ga0070688_101406087 | |||
| 1005 | Ga0070659_100020998 | |||
| 1006 | Ga0070659_100270540 | |||
| 1007 | Ga0070659_100611990 | |||
| 1008 | Ga0070667_100114115 | |||
| 1009 | Ga0070667_100131754 | |||
| 1010 | Ga0070667_100171194 | |||
| 1011 | Ga0070667_100191322 | |||
| 1012 | Ga0070713_101597591 | |||
| 1013 | Ga0070710_10710531 | |||
| 1014 | Ga0070701_10028383 | |||
| 1015 | Ga0070701_10097573 | |||
| 1016 | Ga0070701_10469988 | |||
| 1017 | Ga0070711_100048763 | |||
| 1018 | Ga0070705_100075017 | |||
| 1019 | Ga0070705_100107388 | |||
| 1020 | Ga0070705_100322905 | |||
| 1021 | Ga0070705_101867420 | |||
| 1022 | Ga0070700_100025700 | |||
| 1023 | Ga0070700_100072724 | |||
| 1024 | Ga0070700_100294119 | |||
| 1025 | Ga0070700_100296916 | |||
| 1026 | Ga0070700_100382011 | |||
| 1027 | Ga0070700_100989099 | |||
| 1028 | Ga0070694_100208387 | |||
| 1029 | Ga0070694_100438802 | |||
| 1030 | Ga0070694_100492082 | |||
| 1031 | Ga0070694_100532510 | |||
| 1032 | Ga0070663_100864437 | |||
| 1033 | Ga0070663_101537742 | |||
| 1034 | Ga0070678_100118169 | |||
| 1035 | Ga0070678_100140738 | |||
| 1036 | Ga0070678_100388712 | |||
| 1037 | Ga0070678_100455709 | |||
| 1038 | Ga0070678_100524155 | |||
| 1039 | Ga0070678_101672746 | |||
| 1040 | Ga0070662_100033661 | |||
| 1041 | Ga0070662_100060406 | |||
| 1042 | Ga0070662_100174242 | |||
| 1043 | Ga0070662_100200832 | |||
| 1044 | Ga0070662_100615227 | |||
| 1045 | Ga0068867_101001571 | |||
| 1046 | Ga0068867_101629087 | |||
| 1047 | Ga0068867_102078509 | |||
| 1048 | Ga0070685_10009649 | |||
| 1049 | Ga0070685_10073434 | |||
| 1050 | Ga0070685_10745462 | |||
| 1051 | Ga0070685_11009110 | |||
| 1052 | Ga0070706_101587690 | |||
| 1053 | Ga0070707_100345323 | |||
| 1054 | Ga0070698_100603824 | |||
| 1055 | Ga0070699_100521607 | |||
| 1056 | Ga0070697_100150237 | |||
| 1057 | Ga0070672_100011676 | |||
| 1058 | Ga0070672_100030645 | |||
| 1059 | Ga0070672_100112535 | |||
| 1060 | Ga0070672_100156408 | |||
| 1061 | Ga0070672_100239801 | |||
| 1062 | Ga0070672_100394211 | |||
| 1063 | Ga0070672_100682807 | |||
| 1064 | Ga0070686_100002629 | |||
| 1065 | Ga0070686_100271202 | |||
| 1066 | Ga0070686_100858289 | |||
| 1067 | Ga0070695_100272076 | |||
| 1068 | Ga0070696_100308671 | |||
| 1069 | Ga0070693_100119453 | |||
| 1070 | Ga0070693_100375428 | |||
| 1071 | Ga0070693_101057167 | |||
| 1072 | Ga0070665_100026135 | |||
| 1073 | Ga0070665_100611302 | |||
| 1074 | Ga0070665_100882824 | |||
| 1075 | Ga0070665_101471881 | |||
| 1076 | Ga0070704_100277575 | |||
| 1077 | Ga0070704_100324720 | |||
| 1078 | Ga0070704_100515714 | |||
| 1079 | Ga0070704_100844541 | |||
| 1080 | Ga0070664_100005370 | |||
| 1081 | Ga0070664_100041960 | |||
| 1082 | Ga0070664_100052057 | |||
| 1083 | Ga0070664_100145346 | |||
| 1084 | Ga0070664_100148300 | |||
| 1085 | Ga0070664_100579614 | |||
| 1086 | Ga0070664_102332596 | |||
| 1087 | Ga0068857_100027164 | |||
| 1088 | Ga0068857_100532872 | |||
| 1089 | Ga0068857_101200279 | |||
| 1090 | Ga0068854_100353870 | |||
| 1091 | Ga0068856_100440721 | |||
| 1092 | Ga0070702_100449133 | |||
| 1093 | Ga0068852_100127277 | |||
| 1094 | Ga0068852_101947732 | |||
| 1095 | Ga0068859_100003217 | |||
| 1096 | Ga0068859_100007329 | |||
| 1097 | Ga0068859_100027985 | |||
| 1098 | Ga0068859_100054697 | |||
| 1099 | Ga0068859_101135372 | |||
| 1100 | Ga0068859_101739436 | |||
| 1101 | Ga0068864_100011606 | |||
| 1102 | Ga0068864_100525708 | |||
| 1103 | Ga0068864_101822508 | |||
| 1104 | Ga0068866_10222807 | |||
| 1105 | Ga0068866_10269131 | |||
| 1106 | Ga0068861_100044561 | |||
| 1107 | Ga0068861_100121375 | |||
| 1108 | Ga0068861_100228794 | |||
| 1109 | Ga0068851_11075258 | |||
| 1110 | Ga0068870_10010727 | |||
| 1111 | Ga0068870_10059173 | |||
| 1112 | Ga0068870_10093666 | |||
| 1113 | Ga0068870_10159588 | |||
| 1114 | Ga0068870_10477126 | |||
| 1115 | Ga0068870_10951807 | |||
| 1116 | Ga0068863_100026234 | |||
| 1117 | Ga0068863_100031429 | |||
| 1118 | Ga0068863_100194186 | |||
| 1119 | Ga0068863_100807471 | |||
| 1120 | Ga0068863_101344990 | |||
| 1121 | Ga0068863_102321419 | |||
| 1122 | Ga0068858_100021954 | |||
| 1123 | Ga0068858_102478594 | |||
| 1124 | Ga0068860_100071370 | |||
| 1125 | Ga0068860_100489572 | |||
| 1126 | Ga0068860_100704189 | |||
| 1127 | Ga0068862_100001025 | |||
| 1128 | Ga0068862_100166119 | |||
| 1129 | Ga0068862_100586466 | |||
| 1130 | Ga0068862_100598717 | |||
| 1131 | Ga0068862_100618764 | |||
| 1132 | Ga0068862_100753587 | |||
| 1133 | Ga0068862_101615021 | |||
| 1134 | Ga0068862_101815108 | |||
| 1135 | Ga0081455_10146932 | |||
| 1136 | Ga0081539_10005549 | |||
| 1137 | Ga0081539_10200962 | |||
| 1138 | Ga0081539_10241490 | |||
| 1139 | Ga0075432_10041431 | |||
| 1140 | Ga0070716_100321856 | |||
| 1141 | Ga0097621_100010076 | |||
| 1142 | Ga0097621_100039640 | |||
| 1143 | Ga0097621_100062775 | |||
| 1144 | Ga0097621_100140778 | |||
| 1145 | Ga0097621_100636228 | |||
| 1146 | Ga0097621_100750224 | |||
| 1147 | Ga0097621_101933836 | |||
| 1148 | Ga0068871_100003652 | |||
| 1149 | Ga0068871_100018419 | |||
| 1150 | Ga0068871_100131306 | |||
| 1151 | Ga0068871_100225394 | |||
| 1152 | Ga0068871_100284430 | |||
| 1153 | Ga0068871_100483951 | |||
| 1154 | Ga0075428_100002841 | |||
| 1155 | Ga0075428_100062988 | |||
| 1156 | Ga0075428_100311914 | |||
| 1157 | Ga0075428_100479914 | |||
| 1158 | Ga0075430_100008036 | |||
| 1159 | Ga0075430_100187479 | |||
| 1160 | Ga0075431_100015089 | |||
| 1161 | Ga0075431_100024715 | |||
| 1162 | Ga0075431_100039344 | |||
| 1163 | Ga0075431_100298840 | |||
| 1164 | Ga0075433_10000251 | |||
| 1165 | Ga0075433_10001092 | |||
| 1166 | Ga0075433_10025597 | |||
| 1167 | Ga0075433_10191200 | |||
| 1168 | Ga0075434_100406549 | |||
| 1169 | Ga0075434_101072232 | |||
| 1170 | Ga0075429_100002679 | |||
| 1171 | Ga0075429_100011793 | |||
| 1172 | Ga0075429_100027208 | |||
| 1173 | Ga0075429_100106941 | |||
| 1174 | Ga0075429_100455720 | |||
| 1175 | Ga0075429_101205586 | |||
| 1176 | Ga0068865_100314861 | |||
| 1177 | Ga0068865_100328685 | |||
| 1178 | Ga0068865_100517196 | |||
| 1179 | Ga0075436_100539307 | |||
| 1180 | Ga0097620_100003217 | |||
| 1181 | Ga0097620_100007329 | |||
| 1182 | Ga0097620_100027989 | |||
| 1183 | Ga0097620_100054698 | |||
| 1184 | Ga0097620_101135261 | |||
| 1185 | Ga0097620_101739471 | |||
| 1186 | Ga0075435_100005384 | |||
| 1187 | Ga0075435_100010639 | |||
| 1188 | Ga0111539_10000346 | |||
| 1189 | Ga0111539_10007109 | |||
| 1190 | Ga0111539_10007388 | |||
| 1191 | Ga0111539_10069875 | |||
| 1192 | Ga0111539_10185810 | |||
| 1193 | Ga0111539_10316968 | |||
| 1194 | Ga0111539_10815396 | |||
| 1195 | Ga0111539_11041117 | |||
| 1196 | Ga0111539_11738661 | |||
| 1197 | Ga0105245_10450959 | |||
| 1198 | Ga0105245_11940776 | |||
| 1199 | Ga0105245_12174250 | |||
| 1200 | Ga0105247_11150718 | |||
| 1201 | Ga0114129_10025960 | |||
| 1202 | Ga0114129_10045968 | |||
| 1203 | Ga0114129_10111458 | |||
| 1204 | Ga0114129_10396622 | |||
| 1205 | Ga0114129_11678749 | |||
| 1206 | Ga0114129_11744471 | |||
| 1207 | Ga0105243_11783189 | |||
| 1208 | Ga0105242_10149065 | |||
| 1209 | Ga0105242_11936888 | |||
| 1210 | Ga0105248_10025687 | |||
| 1211 | Ga0105248_10163474 | |||
| 1212 | Ga0105248_10292678 | |||
| 1213 | Ga0105248_10777208 | |||
| 1214 | Ga0105237_10654050 | |||
| 1215 | Ga0105238_12264924 | |||
| 1216 | Ga0105249_10019650 | |||
| 1217 | Ga0105249_11022792 | |||
| 1218 | Ga0105249_11033545 | |||
| 1219 | Ga0105249_11520613 | |||
| 1220 | Ga0105239_11251973 | |||
| 1221 | Ga0105246_10526675 | |||
| 1222 | Ga0105246_10859642 | |||
| 1223 | Ga0157313_1022134 | |||
| 1224 | Ga0157324_1005969 | |||
| 1225 | Ga0157373_11282502 | |||
| 1226 | Ga0157371_10278883 | |||
| 1227 | Ga0157369_12670384 | |||
| 1228 | Ga0157374_10071768 | |||
| 1229 | Ga0157378_10009365 | |||
| 1230 | Ga0157378_10719441 | |||
| 1231 | Ga0157378_11087727 | |||
| 1232 | Ga0157378_12117785 | |||
| 1233 | Ga0157378_12745773 | |||
| 1234 | Ga0163162_10011291 | |||
| 1235 | Ga0163162_10011337 | |||
| 1236 | Ga0163162_10921463 | |||
| 1237 | Ga0163162_10998945 | |||
| 1238 | Ga0163162_11424800 | |||
| 1239 | Ga0157372_12018816 | |||
| 1240 | Ga0157375_10010270 | |||
| 1241 | Ga0157375_10141462 | |||
| 1242 | Ga0157375_10206991 | |||
| 1243 | Ga0157375_10563765 | |||
| 1244 | Ga0157375_11263536 | |||
| 1245 | Ga0157375_11988744 | |||
| 1246 | Ga0163163_10064680 | |||
| 1247 | Ga0163163_10309143 | |||
| 1248 | Ga0163163_10416754 | |||
| 1249 | Ga0157380_10044593 | |||
| 1250 | Ga0157380_10211833 | |||
| 1251 | Ga0157377_10024608 | |||
| 1252 | Ga0157377_10062614 | |||
| 1253 | Ga0157377_10068383 | |||
| 1254 | Ga0157377_10084779 | |||
| 1255 | Ga0157377_10279846 | |||
| 1256 | Ga0157379_10086884 | |||
| 1257 | Ga0157376_10167116 | |||
| 1258 | Ga0157376_12137937 | |||
| 1259 | Ga0157376_12367905 | |||
| 1260 | Ga0182007_10248501 | |||
| 1261 | Ga0163161_10038785 | |||
| 1262 | Ga0163161_10111626 | |||
| 1263 | Ga0163161_10530284 | |||
| 1264 | Ga0163161_11051717 | |||
| 1265 | Ga0206356_11730128 | |||
| 1266 | Ga0206351_10788732 | |||
| 1267 | Ga0206352_10552676 | |||
| 1268 | Ga0206352_10946638 | |||
| 1269 | Ga0206352_11266020 | |||
| 1270 | Ga0207673_1007456 | |||
| 1271 | Ga0207697_10000815 | |||
| 1272 | Ga0207682_10001377 | |||
| 1273 | Ga0207682_10018403 | |||
| 1274 | Ga0207682_10173463 | |||
| 1275 | Ga0207642_10316141 | |||
| 1276 | Ga0207688_10016453 | |||
| 1277 | Ga0207680_10067471 | |||
| 1278 | Ga0207680_10084265 | |||
| 1279 | Ga0207680_10301161 | |||
| 1280 | Ga0207647_10092929 | |||
| 1281 | Ga0207645_10002151 | |||
| 1282 | Ga0207645_10116427 | |||
| 1283 | Ga0207645_10201849 | |||
| 1284 | Ga0207645_10304298 | |||
| 1285 | Ga0207643_10000847 | |||
| 1286 | Ga0207643_10050557 | |||
| 1287 | Ga0207643_10107599 | |||
| 1288 | Ga0207643_10159840 | |||
| 1289 | Ga0207663_10466388 | |||
| 1290 | Ga0207660_10429331 | |||
| 1291 | Ga0207660_10617702 | |||
| 1292 | Ga0207662_10027222 | |||
| 1293 | Ga0207662_10053348 | |||
| 1294 | Ga0207662_10539908 | |||
| 1295 | Ga0207662_11036457 | |||
| 1296 | Ga0207657_10471146 | |||
| 1297 | Ga0207649_10020915 | |||
| 1298 | Ga0207646_10386213 | |||
| 1299 | Ga0207681_10014630 | |||
| 1300 | Ga0207681_10156615 | |||
| 1301 | Ga0207681_10194962 | |||
| 1302 | Ga0207681_10336887 | |||
| 1303 | Ga0207681_10970724 | |||
| 1304 | Ga0207650_10027746 | |||
| 1305 | Ga0207650_10287977 | |||
| 1306 | Ga0207650_11220780 | |||
| 1307 | Ga0207659_10013636 | |||
| 1308 | Ga0207659_10015545 | |||
| 1309 | Ga0207659_10019068 | |||
| 1310 | Ga0207659_10019983 | |||
| 1311 | Ga0207659_10146462 | |||
| 1312 | Ga0207659_10178869 | |||
| 1313 | Ga0207659_10245530 | |||
| 1314 | Ga0207659_10387244 | |||
| 1315 | Ga0207659_10394427 | |||
| 1316 | Ga0207659_10608280 | |||
| 1317 | Ga0207659_10847005 | |||
| 1318 | Ga0207659_10856438 | |||
| 1319 | Ga0207687_11009238 | |||
| 1320 | Ga0207644_10149878 | |||
| 1321 | Ga0207644_10182674 | |||
| 1322 | Ga0207644_10457123 | |||
| 1323 | Ga0207644_10729311 | |||
| 1324 | Ga0207644_11207630 | |||
| 1325 | Ga0207690_10248329 | |||
| 1326 | Ga0207690_10808634 | |||
| 1327 | Ga0207706_10016778 | |||
| 1328 | Ga0207706_10038510 | |||
| 1329 | Ga0207706_10139232 | |||
| 1330 | Ga0207706_10229892 | |||
| 1331 | Ga0207706_10278741 | |||
| 1332 | Ga0207706_10307661 | |||
| 1333 | Ga0207706_10701344 | |||
| 1334 | Ga0207686_11040579 | |||
| 1335 | Ga0207670_10146986 | |||
| 1336 | Ga0207670_10294631 | |||
| 1337 | Ga0207670_11122675 | |||
| 1338 | Ga0207670_11411729 | |||
| 1339 | Ga0207670_11653635 | |||
| 1340 | Ga0207669_10000948 | |||
| 1341 | Ga0207669_10117704 | |||
| 1342 | Ga0207669_10412215 | |||
| 1343 | Ga0207669_10512272 | |||
| 1344 | Ga0207704_10228646 | |||
| 1345 | Ga0207704_10337026 | |||
| 1346 | Ga0207704_10515999 | |||
| 1347 | Ga0207665_10249923 | |||
| 1348 | Ga0207691_10003859 | |||
| 1349 | Ga0207691_10076812 | |||
| 1350 | Ga0207691_10077231 | |||
| 1351 | Ga0207691_10125062 | |||
| 1352 | Ga0207691_10152614 | |||
| 1353 | Ga0207691_10389641 | |||
| 1354 | Ga0207691_10598355 | |||
| 1355 | Ga0207711_10076139 | |||
| 1356 | Ga0207711_10256429 | |||
| 1357 | Ga0207711_10549836 | |||
| 1358 | Ga0207689_10003934 | |||
| 1359 | Ga0207661_10049125 | |||
| 1360 | Ga0207661_10182526 | |||
| 1361 | Ga0207661_10541884 | |||
| 1362 | Ga0207679_10003089 | |||
| 1363 | Ga0207679_10064111 | |||
| 1364 | Ga0207679_10097672 | |||
| 1365 | Ga0207679_10101409 | |||
| 1366 | Ga0207651_10037684 | |||
| 1367 | Ga0207651_10048279 | |||
| 1368 | Ga0207651_10203594 | |||
| 1369 | Ga0207651_10592329 | |||
| 1370 | Ga0207651_10734979 | |||
| 1371 | Ga0207651_11089190 | |||
| 1372 | Ga0207651_11379396 | |||
| 1373 | Ga0207712_10012851 | |||
| 1374 | Ga0207712_10052244 | |||
| 1375 | Ga0207712_10745018 | |||
| 1376 | Ga0207668_10104355 | |||
| 1377 | Ga0207668_10256621 | |||
| 1378 | Ga0207668_10422583 | |||
| 1379 | Ga0207668_10552831 | |||
| 1380 | Ga0207668_10845176 | |||
| 1381 | Ga0207668_11012305 | |||
| 1382 | Ga0207640_10301751 | |||
| 1383 | Ga0207640_10308653 | |||
| 1384 | Ga0207658_10028472 | |||
| 1385 | Ga0207658_10238959 | |||
| 1386 | Ga0207658_10697145 | |||
| 1387 | Ga0207658_11162782 | |||
| 1388 | Ga0207677_10181545 | |||
| 1389 | Ga0207677_10309865 | |||
| 1390 | Ga0207677_11227507 | |||
| 1391 | Ga0207703_10137831 | |||
| 1392 | Ga0207678_10106708 | |||
| 1393 | Ga0207708_10012732 | |||
| 1394 | Ga0207708_10072323 | |||
| 1395 | Ga0207708_10085304 | |||
| 1396 | Ga0207708_10124432 | |||
| 1397 | Ga0207702_11085326 | |||
| 1398 | Ga0207641_10151510 | |||
| 1399 | Ga0207641_10505901 | |||
| 1400 | Ga0207641_11118449 | |||
| 1401 | Ga0207641_11134463 | |||
| 1402 | Ga0207641_11190856 | |||
| 1403 | Ga0207648_10188792 | |||
| 1404 | Ga0207648_10331099 | |||
| 1405 | Ga0207648_12210107 | |||
| 1406 | Ga0207676_10047847 | |||
| 1407 | Ga0207676_10049559 | |||
| 1408 | Ga0207676_10079855 | |||
| 1409 | Ga0207676_10298852 | |||
| 1410 | Ga0207674_10343311 | |||
| 1411 | Ga0207674_10354459 | |||
| 1412 | Ga0207674_10355175 | |||
| 1413 | Ga0207674_10632502 | |||
| 1414 | Ga0207674_10703767 | |||
| 1415 | Ga0207675_100017515 | |||
| 1416 | Ga0207675_100041704 | |||
| 1417 | Ga0207675_100067537 | |||
| 1418 | Ga0207675_100091533 | |||
| 1419 | Ga0207675_100190325 | |||
| 1420 | Ga0207683_10015294 | |||
| 1421 | Ga0207683_10060332 | |||
| 1422 | Ga0207683_10106058 | |||
| 1423 | Ga0207683_10527536 | |||
| 1424 | Ga0207683_10576904 | |||
| 1425 | Ga0207683_10601822 | |||
| 1426 | Ga0207698_10159578 | |||
| 1427 | Ga0209981_1058278 | |||
| 1428 | Ga0209971_1021869 | |||
| 1429 | Ga0209998_10044324 | |||
| 1430 | Ga0209998_10131603 | |||
| 1431 | Ga0209974_10024351 | |||
| 1432 | Ga0207428_10000756 | |||
| 1433 | Ga0207428_10008286 | |||
| 1434 | Ga0207428_10026108 | |||
| 1435 | Ga0207428_10035828 | |||
| 1436 | Ga0207428_10036818 | |||
| 1437 | Ga0207428_10307891 | |||
| 1438 | Ga0207428_10862163 | |||
| 1439 | Ga0268266_10095343 | |||
| 1440 | Ga0268266_10737173 | |||
| 1441 | Ga0268266_11238784 | |||
| 1442 | Ga0268266_11348218 | |||
| 1443 | Ga0268265_10225239 | |||
| 1444 | Ga0268265_10306809 | |||
| 1445 | Ga0268265_10517284 | |||
| 1446 | Ga0268265_10604693 | |||
| 1447 | Ga0268264_10149351 | |||
| 1448 | Ga0307408_101053101 | |||
| 1449 | Ga0307413_11179621 | |||
| 1450 | Ga0307410_10531439 | |||
| 1451 | Ga0307416_102075159 | |||
| 1452 | Ga0307416_102329067 | |||
| 1453 | Ga0373930_0186175 | |||
| 1454 | Ga0373949_0221374 | |||
| 1455 | Ga0373951_0158244 | |||
| 1456 | Ga0373923_0011933 | |||
| 1457 | Ga0373936_0104444 | |||
| 1458 | Ga0373945_0014209 | |||
| 1459 | Ga0373945_0182862 | |||
| 1460 | Ga0373953_0221067 | |||
| 1461 | Ga0373954_0175009 | |||
| 1462 | Ga0373956_0165388 | |||
| 1463 | Ga0373957_0132118 | |||
| 1464 | Ga0373943_0011201 | |||
| 1465 | Ga0373946_0008234 | |||
| 1466 | Ga0373946_0389702 | |||
| 1467 | Ga0373961_0278568 | |||
| 1468 | Ga0373962_0020002 | |||
| 1469 | Ga0373924_0009510 | |||
| 1470 | Ga0373927_0078320 | |||
| 1471 | Ga0373927_0791877 | |||
| 1472 | Ga0373933_0213415 | |||
| 1473 | Ga0373947_0009312 | |||
| 1474 | Ga0373947_0605934 | |||
| 1475 | Ga0373937_0224127 | |||
| 1476 | Ga0373937_0239021 | |||
| 1477 | Ga0373925_0011544 | |||
| 1478 | Ga0395901_1516583 | |||
| 1479 | Ga0436365_0592924 | |||
| 1480 | Ga0439436_0086212 | |||
| 1481 | Ga0439453_0002672 | |||
| 1482 | Ga0451835_0093829 | |||
| 1483 | Ga0451853_2008618 | |||
| 1484 | Ga0439454_034223 | |||
| 1485 | Ga0439446_0113930 | |||
| 1486 | Ga0439435_0144210 | |||
| 1487 | Ga0439444_0138595 | |||
| 1488 | Ga0439464_0082464 | |||
| 1489 | Ga0439464_0085329 | |||
| 1490 | Ga0439460_0044318 | |||
| 1491 | Ga0495592_0049540 | |||
| 1492 | Ga0495580_0142027 | |||
| 1493 | Ga0495580_0287862 | |||
| 1494 | Ga0495580_0529072 | |||
| 1495 | Ga0495580_0947371 | |||
| 1496 | Ga0495582_0455115 | |||
| 1497 | Ga0495608_0013627 | |||
| 1498 | Ga0495628_0078101 | |||
| 1499 | Ga0495628_0092475 | |||
| 1500 | Ga0495630_0033831 | |||
| 1501 | Ga0495643_0003101 | |||
| 1502 | Ga0495643_0007021 | |||
| 1503 | Ga0495652_0173494 | |||
| 1504 | Ga0495665_0493918 | |||
| 1505 | Ga0495640_0211220 | |||
| 1506 | Ga0495587_0024556 | |||
| 1507 | Ga0495621_0097546 | |||
| 1508 | Ga0495645_0166367 | |||
| 1509 | Ga0495633_0058439 | |||
| 1510 | Ga0495633_0346099 | |||
| 1511 | Ga0495667_0262030 | |||
| 1512 | Ga0495656_0558531 | |||
| 1513 | Ga0495656_0664603 | |||
| 1514 | Ga0495634_0290847 | |||
| 1515 | Ga0495588_0263264 | |||
| 1516 | Ga0495657_0122994 | |||
| 1517 | Ga0495646_0142664 | |||
| 1518 | Ga0495647_0033858 | |||
| 1519 | Ga0495647_0043992 | |||
| 1520 | Ga0495658_0044788 | |||
| 1521 | Ga0495658_0255607 | |||
| 1522 | Ga0495669_0040396 | |||
| 1523 | Ga0495613_0000790 | |||
| 1524 | Ga0495670_0376829 | |||
| 1525 | Ga0495600_0250911 | |||
| 1526 | Ga0495581_0276933 | |||
| 1527 | Ga0495581_0328006 | |||
| 1528 | Ga0495604_0453721 | |||
| 1529 | Ga0495636_0295377 | |||
| 1530 | Ga0495674_0048220 | |||
| 1531 | Ga0495674_0364170 | |||
| 1532 | Ga0495676_0912063 | |||
| 1533 | Ga0495680_0466678 | |||
| 1534 | Ga0495675_0258281 | |||
| 1535 | Ga0495684_0000697 | |||
| 1536 | Ga0495602_0440181 | |||
| 1537 | Ga0496100_0003342 | |||
| 1538 | Ga0496100_0433312 | |||
| 1539 | Ga0496101_0000660 | |||
| 1540 | Ga0496102_0273024 | |||
| 1541 | Ga0496102_1749171 | |||
| 1542 | Ga0496104_0510933 | |||
| 1543 | Ga0496105_0229662 | |||
| 1544 | Ga0496106_0035903 | |||
| 1545 | Ga0496106_0207999 | |||
| 1546 | Ga0496107_0612781 | |||
| 1547 | Ga0496108_0586930 | |||
| 1548 | Ga0496108_0923420 | |||
| 1549 | Ga0496109_0126303 | |||
| 1550 | Ga0496109_0126652 | |||
| 1551 | Ga0496109_0231072 | |||
| 1552 | Ga0496110_0579920 | |||
| 1553 | Ga0496113_0227788 | |||
| 1554 | Ga0496114_0000409 | |||
| 1555 | Ga0496114_0322951 | |||
| 1556 | Ga0501308_025804 | |||
| 1557 | Ga0501308_035943 | |||
| 1558 | Ga0501308_047531 | |||
| 1559 | Ga0501308_070606 | |||
| 1560 | Ga0501309_076386 | |||
| 1561 | Ga0501309_099240 | |||
| 1562 | Ga0501310_028854 | |||
| 1563 | Ga0501305_019899 | |||
| 1564 | Ga0501305_071091 | |||
| 1565 | Ga0501307_091405 | |||
| 1566 | Ga0501311_018930 | |||
| 1567 | Ga0501311_098827 | |||
| 1568 | Ga0501311_105359 | |||
| 1569 | Ga0501312_032754 | |||
| 1570 | Ga0501313_050999 | |||
| 1571 | Ga0501314_041595 | |||
| 1572 | Ga0501315_077919 | |||
| 1573 | Ga0501316_080964 | |||
| 1574 | Ga0501317_084112 | |||
| 1575 | Ga0501320_069639 | |||
| 1576 | Ga0501031_0982666 | |||
| 1577 | Ga0501033_0220332 | |||
| 1578 | Ga0501036_1266168 | |||
| 1579 | Ga0501039_0094607 | |||
| 1580 | Ga0501040_0029386 | |||
| 1581 | Ga0501040_0290299 | |||
| 1582 | Ga0501042_0026619 | |||
| 1583 | Ga0501046_0913457 | |||
| 1584 | Ga0501068_0270890 | |||
| 1585 | Ga0501071_0123927 | |||
| 1586 | Ga0501071_0616179 | |||
| 1587 | Ga0501073_0649364 | |||
| 1588 | Ga0501074_0357905 | |||
| 1589 | Ga0501075_0051252 | |||
| 1590 | Ga0501075_0203823 | |||
| 1591 | Ga0501075_0578138 | |||
| 1592 | Ga0501076_0690170 | |||
| 1593 | Ga0501076_0778170 | |||
| 1594 | Ga0501079_0787633 | |||
| 1595 | Ga0501079_0807239 | |||
| 1596 | Ga0501079_1247548 | |||
| 1597 | Ga0501079_1272131 | |||
| 1598 | Ga0501080_0672587 | |||
| 1599 | Ga0501080_1841595 | |||
| 1600 | Ga0501081_0035653 | |||
| 1601 | Ga0501081_0498126 | |||
| 1602 | Ga0501035_1154597 | |||
| 1603 | Ga0501045_0104482 | |||
| 1604 | nmdc:mga05p37_117687_c1 | |||
| 1605 | nmdc:mga05p37_19854_c1 | |||
| 1606 | nmdc:mga05p37_49082_c1 | |||
| 1607 | nmdc:mga09592_139459_c1 | |||
| 1608 | nmdc:mga09592_142615_c1 | |||
| 1609 | nmdc:mga09592_340389_c1 | |||
| 1610 | nmdc:mga09592_396027_c1 | |||
| 1611 | nmdc:mga09592_74566_c1 | |||
| 1612 | nmdc:mga09592_846_c1 | |||
| 1613 | nmdc:mga0qj67_136564_c1 | |||
| 1614 | nmdc:mga0qj67_137991_c1 | |||
| 1615 | nmdc:mga0qj67_9598_c1 | |||
| 1616 | nmdc:mga06r32_1315493_c1 | |||
| 1617 | nmdc:mga06r32_2905_c1 | |||
| 1618 | nmdc:mga06r32_373624_c1 | |||
| 1619 | nmdc:mga06r32_39065_c1 | |||
| 1620 | nmdc:mga06r32_60325_c1 | |||
| 1621 | nmdc:mga08y16_1485269_c1 | |||
| 1622 | nmdc:mga08y16_1867064_c1 | |||
| 1623 | nmdc:mga08y16_2011487_c1 | |||
| 1624 | nmdc:mga08y16_30452_c1 | |||
| 1625 | nmdc:mga08y16_40972_c1 | |||
| 1626 | nmdc:mga08y16_479493_c1 | |||
| 1627 | nmdc:mga08y16_539922_c1 | |||
| 1628 | nmdc:mga08y16_633_c1 | |||
| 1629 | nmdc:mga08y16_6429_c1 | |||
| 1630 | nmdc:mga0rr50_50168_c1 | |||
| 1631 | nmdc:mga08x19_650164_c1 | |||
| 1632 | nmdc:mga08x19_772985_c1 | |||
| 1633 | nmdc:mga0a205_260959_c1 | |||
| 1634 | nmdc:mga0a205_81787_c1 | |||
| 1635 | nmdc:mga0a205_9233_c1 | |||
| 1636 | Ga0495601_0123718 | |||
| 1637 | Ga0495612_0073802 | |||
| 1638 | Ga0495595_0044489 | |||
| 1639 | Ga0495595_0117905 | |||
| 1640 | Ga0495619_0003275 | |||
| 1641 | Ga0495619_0552065 | |||
| 1642 | Ga0501084_0008598 | |||
| 1643 | Ga0501084_0463183 | |||
| 1644 | Ga0590075_129046 | |||
| 1645 | Ga0587084_045894 | |||
| 1646 | Ga0587066_065413 | |||
| 1647 | Ga0587066_080622 | |||
| 1648 | Ga0587070_097305 | |||
| 1649 | Ga0587073_0062478 | |||
| 1650 | Ga0587077_128274 | |||
| 1651 | Ga0587077_222994 | |||
| 1652 | Ga0587080_063049 | |||
| 1653 | Ga0587082_055398 | |||
| 1654 | Ga0587082_059561 | |||
| 1655 | Ga0587083_0131972 | |||
| 1656 | Ga0587085_038277 | |||
| 1657 | Ga0587085_089006 | |||
| 1658 | Ga0587085_171837 | |||
| 1659 | Ga0587090_055536 | |||
| 1660 | Ga0587091_074401 | |||
| 1661 | Ga0587092_052880 | |||
| 1662 | Ga0587092_066559 | |||
| 1663 | Ga0587094_061503 | |||
| 1664 | Ga0587125_036131 | |||
| 1665 | Ga0587101_002563 | |||
| 1666 | Ga0587101_042625 | |||
| 1667 | Ga0587101_063952 | |||
| 1668 | Ga0587115_032401 | |||
| 1669 | Ga0587115_057822 | |||
| 1670 | Ga0587130_042373 | |||
| 1671 | Ga0587062_053577 | |||
| 1672 | Ga0587067_091741 | |||
| 1673 | Ga0587068_058512 | |||
| 1674 | Ga0587072_065690 | |||
| 1675 | Ga0587072_156616 | |||
| 1676 | Ga0587075_038076 | |||
| 1677 | Ga0587100_015058 | |||
| 1678 | Ga0587102_030159 | |||
| 1679 | Ga0587107_065921 | |||
| 1680 | Ga0587071_067690 | |||
| 1681 | Ga0587111_0044458 | |||
| 1682 | Ga0587111_0113504 | |||
| 1683 | Ga0501082_0106233 | |||
| 1684 | Ga0530510_0414040 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l8k-assembly1.cif.gz_A | t cell protein-tyrosine phosphatase structure | 0.8174 | 43 | 73 |
| 6cqm-assembly2.cif.gz_H-3 | crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) | 0.8033 | 35 | 121 |
| 3amt-assembly1.cif.gz_A | crystal structure of the tias-trna(ile2)-atp complex | 0.7888 | 32 | 121 |
| 2b49-assembly1.cif.gz_A | crystal structure of the catalytic domain of protein tyrosine phosphatase, non-receptor type 3 | 0.787 | 43 | 73 |
| 3i36-assembly1.cif.gz_A | crystal structure of rat protein tyrosine phosphatase eta catalytic domain | 0.786 | 43 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9W0G1_13_309_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8564 | 43 | 73 | 3.90.190.10 |
| af_Q64512_2131_2444_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8486 | 43 | 73 | 3.90.190.10 |
| 2awoD03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8058 | 37 | 97 | 2.40.50.140 |
| af_O44548_20_108_2.60.40.1910 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7867 | 41 | 72 | 2.60.40.1910 |
| af_A0A486WUL5_1_92_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.784 | 30 | 71 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8NP93-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.967 | 23 | 130 |
|
| AF-A0A521RFX0-F1-model_v4 | Uncharacterized protein | 0.9654 | 31 | 129 |
|
| AF-A0A2V8NMZ2-F1-model_v4 | DUF5666 domain-containing protein | 0.964 | 24 | 130 |
GO:0016020
|
| AF-A0A383CUF3-F1-model_v4 | OB domain-containing protein | 0.9608 | 32 | 130 |
|
| AF-A0A2W4Q999-F1-model_v4 | DUF5666 domain-containing protein | 0.9585 | 31 | 129 |
|