F483136

General Info

Members Datasets Scaffolds Average Seq Length
842 359 1684 139

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10972869|Ga0157376_109728691
Length 133
Sequence MKTYILGGLAAVALLLTHHSFAAEFDADKPITLKGIVTKVEWTNPHVWFYVNVKDEKGEVTNWGAEMGPPHGLQRRGWRQNTLKIGEEVTVSGSLAKNGAKRINASKVTLTSTGARPGETLDAASSGSAEKVD

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
27 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
128 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
230 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
231 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
234 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
331 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.1
Metatranscriptomes 13.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.26
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 33.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10972869 3300014969 Bacteria 870
2 JGI24746J21847_1001312 3300001977 Unclassified 3968
3 JGI24746J21847_1002613 3300001977 Unclassified 2854
4 JGI24749J21850_1035925 3300002076 Bacteria 719
5 JGI24751J29686_10079364 3300002459 Unclassified 680
6 Ga0006763J43179_102979 3300002870 Unclassified 714
7 Ga0006762J43184_102821 3300002872 Unclassified 655
8 Ga0006765J45826_102709 3300003161 Bacteria 629
9 Ga0006778J45830_1008035 3300003162 Unclassified 581
10 Ga0006759J45824_1007035 3300003163 Unclassified 1006
11 Ga0006759J45824_1015090 3300003163 Bacteria 567
12 Ga0006759J45824_1018684 3300003163 Unclassified 532
13 JGI25406J46586_10022522 3300003203 Unclassified 2507
14 Ga0006758J48902_1004937 3300003300 Unclassified 736
15 Ga0006770J48903_1009933 3300003305 Unclassified 548
16 Ga0006770J48903_1011447 3300003305 Unclassified 590
17 Ga0006777J48905_1009548 3300003308 Unclassified 590
18 Ga0006777J48905_1023568 3300003308 Bacteria 632
19 Ga0007417J51691_1006602 3300003544 Unclassified 503
20 Ga0007417J51691_1020827 3300003544 Unclassified 549
21 Ga0007427J51700_104200 3300003559 Unclassified 583
22 Ga0006781J51513_1003563 3300003568 Unclassified 625
23 Ga0007410J51695_1118318 3300003574 Unclassified 554
24 Ga0007409J51694_1008062 3300003575 Unclassified 1245
25 Ga0007409J51694_1089376 3300003575 Unclassified 503
26 Ga0007416J51690_1020843 3300003577 Unclassified 535
27 Ga0007429J51699_1011709 3300003579 Unclassified 598
28 Ga0007429J51699_1014819 3300003579 Bacteria 570
29 Ga0007429J51699_1021144 3300003579 Bacteria 570
30 Ga0007411J51799_109537 3300003611 Unclassified 506
31 Ga0007415J51800_105917 3300003613 Unclassified 598
32 Ga0032354_1001770 3300003693 Unclassified 564
33 Ga0032354_1024662 3300003693 Bacteria 564
34 Ga0032354_1044077 3300003693 Bacteria 765
35 Ga0006780_1001386 3300003735 Unclassified 696
36 Ga0058858_1005683 3300004785 Unclassified 1107
37 Ga0058858_1434174 3300004785 Unclassified 709
38 Ga0058859_10026768 3300004798 Bacteria 636
39 Ga0058859_10047863 3300004798 Unclassified 1065
40 Ga0058859_10048081 3300004798 Bacteria 1849
41 Ga0058859_10068287 3300004798 Bacteria 1156
42 Ga0058859_10138439 3300004798 Bacteria 652
43 Ga0058863_11744773 3300004799 Unclassified 619
44 Ga0058863_11851899 3300004799 Bacteria 1211
45 Ga0058861_10045090 3300004800 Unclassified 714
46 Ga0058861_10090615 3300004800 Unclassified 514
47 Ga0058861_11811094 3300004800 Unclassified 835
48 Ga0058861_11984224 3300004800 Bacteria 814
49 Ga0058861_12067518 3300004800 Unclassified 610
50 Ga0058860_10004586 3300004801 Bacteria 597
51 Ga0058860_10022220 3300004801 Unclassified 1347
52 Ga0058860_10053229 3300004801 Unclassified 2521
53 Ga0058860_10053703 3300004801 Unclassified 699
54 Ga0058860_10120934 3300004801 Unclassified 688
55 Ga0058860_12157817 3300004801 Bacteria 555
56 Ga0058860_12194457 3300004801 Unclassified 887
57 Ga0058862_12532843 3300004803 Bacteria 591
58 Ga0058862_12633905 3300004803 Unclassified 601
59 Ga0058862_12868080 3300004803 Unclassified 1057
60 Ga0058862_12874132 3300004803 Unclassified 857
61 Ga0065714_10079673 3300005288 Bacteria 2495
62 Ga0065714_10097205 3300005288 Bacteria 1742
63 Ga0065704_10016305 3300005289 Bacteria 1650
64 Ga0065712_10029825 3300005290 Bacteria 1482
65 Ga0065712_10067852 3300005290 Bacteria 25461
66 Ga0065712_10075103 3300005290 Unclassified 3936
67 Ga0065715_10005596 3300005293 Bacteria 3129
68 Ga0065715_10015619 3300005293 Bacteria 1874
69 Ga0065715_10211374 3300005293 Bacteria 1312
70 Ga0065715_10800613 3300005293 Unclassified 607
71 Ga0065715_10886075 3300005293 Bacteria 579
72 Ga0065707_10015336 3300005295 Bacteria 2148
73 Ga0070658_10375830 3300005327 Unclassified 1218
74 Ga0070676_10030575 3300005328 Bacteria 3072
75 Ga0070676_10260275 3300005328 Bacteria 1161
76 Ga0070676_10410942 3300005328 Bacteria 944
77 Ga0070676_10735737 3300005328 Bacteria 723
78 Ga0070683_100125341 3300005329 Bacteria 2428
79 Ga0070683_100169869 3300005329 Bacteria 2070
80 Ga0070690_100034739 3300005330 Bacteria 3160
81 Ga0070690_100051401 3300005330 Bacteria 2631
82 Ga0070690_100082110 3300005330 Bacteria 2110
83 Ga0070670_100000476 3300005331 Bacteria 32289
84 Ga0070670_100027457 3300005331 Bacteria 4896
85 Ga0070670_101072705 3300005331 Bacteria 734
86 Ga0070677_10002043 3300005333 Bacteria 6421
87 Ga0070677_10086770 3300005333 Unclassified 1352
88 Ga0070677_10229033 3300005333 Unclassified 912
89 Ga0068869_100022580 3300005334 Bacteria 4337
90 Ga0068869_100473526 3300005334 Bacteria 1042
91 Ga0068869_101411936 3300005334 Unclassified 616
92 Ga0070666_10022675 3300005335 Bacteria 4079
93 Ga0070666_10024365 3300005335 Unclassified 3941
94 Ga0070666_10168480 3300005335 Bacteria 1533
95 Ga0070666_10389439 3300005335 Unclassified 1001
96 Ga0070666_10639580 3300005335 Bacteria 778
97 Ga0070680_100101329 3300005336 Bacteria 2390
98 Ga0070680_100395196 3300005336 Bacteria 1178
99 Ga0068868_100663789 3300005338 Unclassified 929
100 Ga0068868_100890840 3300005338 Unclassified 808
101 Ga0068868_100981448 3300005338 Bacteria 772
102 Ga0068868_101199029 3300005338 Bacteria 702
103 Ga0068868_101333898 3300005338 Bacteria 667
104 Ga0070689_100011003 3300005340 Bacteria 6467
105 Ga0070689_100104448 3300005340 Bacteria 2246
106 Ga0070689_100223079 3300005340 Bacteria 1547
107 Ga0070689_100596154 3300005340 Bacteria 957
108 Ga0070687_100010039 3300005343 Bacteria 4076
109 Ga0070687_100018578 3300005343 Bacteria 3219
110 Ga0070687_100124272 3300005343 Bacteria 1480
111 Ga0070687_101045643 3300005343 Bacteria 594
112 Ga0070661_100049848 3300005344 Bacteria 3065
113 Ga0070661_100099422 3300005344 Unclassified 2162
114 Ga0070661_100407031 3300005344 Unclassified 1076
115 Ga0070692_10281658 3300005345 Bacteria 1008
116 Ga0070692_10565910 3300005345 Unclassified 747
117 Ga0070692_10854010 3300005345 Unclassified 626
118 Ga0070668_100021463 3300005347 Bacteria 4879
119 Ga0070668_100136423 3300005347 Unclassified 1974
120 Ga0070668_100494447 3300005347 Bacteria 1058
121 Ga0070668_100688625 3300005347 Unclassified 901
122 Ga0070669_100017963 3300005353 Bacteria 5052
123 Ga0070669_100034057 3300005353 Bacteria 3687
124 Ga0070669_100043507 3300005353 Bacteria 3271
125 Ga0070669_100163591 3300005353 Unclassified 1731
126 Ga0070669_100488722 3300005353 Unclassified 1020
127 Ga0070669_100814540 3300005353 Bacteria 794
128 Ga0070675_100000983 3300005354 Bacteria 20391
129 Ga0070675_100028849 3300005354 Bacteria 4470
130 Ga0070675_100068764 3300005354 Unclassified 2933
131 Ga0070675_100085737 3300005354 Bacteria 2631
132 Ga0070675_100103252 3300005354 Unclassified 2403
133 Ga0070675_100106234 3300005354 Bacteria 2370
134 Ga0070675_100135646 3300005354 Bacteria 2100
135 Ga0070675_100197848 3300005354 Bacteria 1744
136 Ga0070675_100209626 3300005354 Bacteria 1693
137 Ga0070675_100434909 3300005354 Bacteria 1175
138 Ga0070675_100784429 3300005354 Unclassified 870
139 Ga0070675_101199374 3300005354 Unclassified 699
140 Ga0070675_101441126 3300005354 Bacteria 635
141 Ga0070671_100043604 3300005355 Unclassified 3728
142 Ga0070671_100108267 3300005355 Bacteria 2334
143 Ga0070671_100126417 3300005355 Bacteria 2152
144 Ga0070671_100517561 3300005355 Bacteria 1027
145 Ga0070674_100000340 3300005356 Bacteria 23159
146 Ga0070674_100039459 3300005356 Bacteria 3188
147 Ga0070674_100184987 3300005356 Unclassified 1598
148 Ga0070674_100382366 3300005356 Bacteria 1145
149 Ga0070674_100525732 3300005356 Bacteria 989
150 Ga0070674_100528090 3300005356 Unclassified 987
151 Ga0070674_100786871 3300005356 Bacteria 820
152 Ga0070673_100004440 3300005364 Bacteria 8873
153 Ga0070673_100014441 3300005364 Bacteria 5502
154 Ga0070673_100023051 3300005364 Bacteria 4543
155 Ga0070673_100033322 3300005364 Bacteria 3888
156 Ga0070673_100116060 3300005364 Bacteria 2227
157 Ga0070673_100609279 3300005364 Bacteria 997
158 Ga0070688_100029468 3300005365 Bacteria 3287
159 Ga0070688_100030176 3300005365 Bacteria 3252
160 Ga0070688_100177410 3300005365 Unclassified 1475
161 Ga0070688_100264110 3300005365 Bacteria 1230
162 Ga0070688_101406087 3300005365 Unclassified 566
163 Ga0070659_100020998 3300005366 Bacteria 4966
164 Ga0070659_100270540 3300005366 Bacteria 1412
165 Ga0070659_100611990 3300005366 Bacteria 937
166 Ga0070667_100114115 3300005367 Bacteria 2345
167 Ga0070667_100131754 3300005367 Bacteria 2183
168 Ga0070667_100171194 3300005367 Bacteria 1917
169 Ga0070667_100191322 3300005367 Bacteria 1813
170 Ga0070713_101597591 3300005436 Bacteria 633
171 Ga0070710_10710531 3300005437 Bacteria 710
172 Ga0070701_10028383 3300005438 Bacteria 2751
173 Ga0070701_10097573 3300005438 Bacteria 1622
174 Ga0070701_10469988 3300005438 Unclassified 811
175 Ga0070711_100048763 3300005439 Bacteria 2898
176 Ga0070705_100075017 3300005440 Bacteria 2058
177 Ga0070705_100107388 3300005440 Unclassified 1776
178 Ga0070705_100322905 3300005440 Bacteria 1115
179 Ga0070705_101867420 3300005440 Unclassified 511
180 Ga0070700_100025700 3300005441 Bacteria 3469
181 Ga0070700_100072724 3300005441 Bacteria 2199
182 Ga0070700_100294119 3300005441 Unclassified 1183
183 Ga0070700_100296916 3300005441 Bacteria 1178
184 Ga0070700_100382011 3300005441 Bacteria 1054
185 Ga0070700_100989099 3300005441 Bacteria 691
186 Ga0070694_100208387 3300005444 Bacteria 1461
187 Ga0070694_100438802 3300005444 Unclassified 1029
188 Ga0070694_100492082 3300005444 Bacteria 975
189 Ga0070694_100532510 3300005444 Bacteria 939
190 Ga0070663_100864437 3300005455 Bacteria 779
191 Ga0070663_101537742 3300005455 Unclassified 592
192 Ga0070678_100118169 3300005456 Unclassified 2086
193 Ga0070678_100140738 3300005456 Bacteria 1930
194 Ga0070678_100388712 3300005456 Bacteria 1209
195 Ga0070678_100455709 3300005456 Bacteria 1121
196 Ga0070678_100524155 3300005456 Bacteria 1049
197 Ga0070678_101672746 3300005456 Bacteria 598
198 Ga0070662_100033661 3300005457 Bacteria 3610
199 Ga0070662_100060406 3300005457 Bacteria 2764
200 Ga0070662_100174242 3300005457 Bacteria 1691
201 Ga0070662_100200832 3300005457 Bacteria 1582
202 Ga0070662_100615227 3300005457 Unclassified 914
203 Ga0068867_101001571 3300005459 Bacteria 758
204 Ga0068867_101629087 3300005459 Bacteria 604
205 Ga0068867_102078509 3300005459 Bacteria 538
206 Ga0070685_10009649 3300005466 Bacteria 4996
207 Ga0070685_10073434 3300005466 Unclassified 2033
208 Ga0070685_10745462 3300005466 Unclassified 718
209 Ga0070685_11009110 3300005466 Unclassified 625
210 Ga0070706_101587690 3300005467 Unclassified 597
211 Ga0070707_100345323 3300005468 Bacteria 1446
212 Ga0070698_100603824 3300005471 Bacteria 1038
213 Ga0070699_100521607 3300005518 Unclassified 1080
214 Ga0070697_100150237 3300005536 Bacteria 1963
215 Ga0070672_100011676 3300005543 Bacteria 6132
216 Ga0070672_100030645 3300005543 Bacteria 4043
217 Ga0070672_100112535 3300005543 Bacteria 2221
218 Ga0070672_100156408 3300005543 Bacteria 1888
219 Ga0070672_100239801 3300005543 Bacteria 1525
220 Ga0070672_100394211 3300005543 Bacteria 1186
221 Ga0070672_100682807 3300005543 Bacteria 898
222 Ga0070686_100002629 3300005544 Bacteria 9904
223 Ga0070686_100271202 3300005544 Bacteria 1248
224 Ga0070686_100858289 3300005544 Bacteria 736
225 Ga0070695_100272076 3300005545 Unclassified 1241
226 Ga0070696_100308671 3300005546 Bacteria 1214
227 Ga0070693_100119453 3300005547 Bacteria 1633
228 Ga0070693_100375428 3300005547 Unclassified 979
229 Ga0070693_101057167 3300005547 Unclassified 617
230 Ga0070665_100026135 3300005548 Bacteria 5878
231 Ga0070665_100611302 3300005548 Bacteria 1103
232 Ga0070665_100882824 3300005548 Unclassified 907
233 Ga0070665_101471881 3300005548 Unclassified 690
234 Ga0070704_100277575 3300005549 Bacteria 1387
235 Ga0070704_100324720 3300005549 Bacteria 1291
236 Ga0070704_100515714 3300005549 Bacteria 1040
237 Ga0070704_100844541 3300005549 Bacteria 821
238 Ga0070664_100005370 3300005564 Bacteria 10288
239 Ga0070664_100041960 3300005564 Bacteria 3862
240 Ga0070664_100052057 3300005564 Unclassified 3467
241 Ga0070664_100145346 3300005564 Bacteria 2091
242 Ga0070664_100148300 3300005564 Bacteria 2070
243 Ga0070664_100579614 3300005564 Bacteria 1039
244 Ga0070664_102332596 3300005564 Unclassified 507
245 Ga0068857_100027164 3300005577 Bacteria 5048
246 Ga0068857_100532872 3300005577 Bacteria 1105
247 Ga0068857_101200279 3300005577 Bacteria 735
248 Ga0068854_100353870 3300005578 Unclassified 1203
249 Ga0068856_100440721 3300005614 Bacteria 1323
250 Ga0070702_100449133 3300005615 Bacteria 935
251 Ga0068852_100127277 3300005616 Bacteria 2341
252 Ga0068852_101947732 3300005616 Bacteria 610
253 Ga0068859_100003217 3300005617 Bacteria 16627
254 Ga0068859_100007329 3300005617 Bacteria 11190
255 Ga0068859_100027985 3300005617 Bacteria 5651
256 Ga0068859_100054697 3300005617 Bacteria 4015
257 Ga0068859_101135372 3300005617 Bacteria 860
258 Ga0068859_101739436 3300005617 Bacteria 689
259 Ga0068864_100011606 3300005618 Bacteria 7274
260 Ga0068864_100525708 3300005618 Bacteria 1141
261 Ga0068864_101822508 3300005618 Unclassified 614
262 Ga0068866_10222807 3300005718 Bacteria 1139
263 Ga0068866_10269131 3300005718 Bacteria 1051
264 Ga0068861_100044561 3300005719 Bacteria 3336
265 Ga0068861_100121375 3300005719 Bacteria 2109
266 Ga0068861_100228794 3300005719 Bacteria 1576
267 Ga0068851_11075258 3300005834 Unclassified 510
268 Ga0068870_10010727 3300005840 Bacteria 4219
269 Ga0068870_10059173 3300005840 Unclassified 2053
270 Ga0068870_10093666 3300005840 Bacteria 1685
271 Ga0068870_10159588 3300005840 Unclassified 1336
272 Ga0068870_10477126 3300005840 Unclassified 827
273 Ga0068870_10951807 3300005840 Unclassified 610
274 Ga0068863_100026234 3300005841 Bacteria 5560
275 Ga0068863_100031429 3300005841 Bacteria 5065
276 Ga0068863_100194186 3300005841 Bacteria 1951
277 Ga0068863_100807471 3300005841 Bacteria 936
278 Ga0068863_101344990 3300005841 Unclassified 722
279 Ga0068863_102321419 3300005841 Unclassified 546
280 Ga0068858_100021954 3300005842 Bacteria 5961
281 Ga0068858_102478594 3300005842 Unclassified 512
282 Ga0068860_100071370 3300005843 Bacteria 3300
283 Ga0068860_100489572 3300005843 Unclassified 1226
284 Ga0068860_100704189 3300005843 Unclassified 1020
285 Ga0068862_100001025 3300005844 Bacteria 26893
286 Ga0068862_100166119 3300005844 Unclassified 1973
287 Ga0068862_100586466 3300005844 Bacteria 1068
288 Ga0068862_100598717 3300005844 Bacteria 1058
289 Ga0068862_100618764 3300005844 Bacteria 1042
290 Ga0068862_100753587 3300005844 Bacteria 947
291 Ga0068862_101615021 3300005844 Unclassified 655
292 Ga0068862_101815108 3300005844 Unclassified 619
293 Ga0081455_10146932 3300005937 Bacteria 1822
294 Ga0081539_10005549 3300005985 Bacteria 12785
295 Ga0081539_10200962 3300005985 Bacteria 921
296 Ga0081539_10241490 3300005985 Unclassified 808
297 Ga0075432_10041431 3300006058 Bacteria 1609
298 Ga0070716_100321856 3300006173 Bacteria 1084
299 Ga0097621_100010076 3300006237 Bacteria 6893
300 Ga0097621_100039640 3300006237 Unclassified 3784
301 Ga0097621_100062775 3300006237 Bacteria 3051
302 Ga0097621_100140778 3300006237 Bacteria 2061
303 Ga0097621_100636228 3300006237 Unclassified 978
304 Ga0097621_100750224 3300006237 Bacteria 901
305 Ga0097621_101933836 3300006237 Bacteria 563
306 Ga0068871_100003652 3300006358 Bacteria 10572
307 Ga0068871_100018419 3300006358 Bacteria 5306
308 Ga0068871_100131306 3300006358 Bacteria 2124
309 Ga0068871_100225394 3300006358 Bacteria 1625
310 Ga0068871_100284430 3300006358 Bacteria 1447
311 Ga0068871_100483951 3300006358 Unclassified 1113
312 Ga0075428_100002841 3300006844 Bacteria 18885
313 Ga0075428_100062988 3300006844 Bacteria 4060
314 Ga0075428_100311914 3300006844 Unclassified 1691
315 Ga0075428_100479914 3300006844 Bacteria 1331
316 Ga0075430_100008036 3300006846 Bacteria 8916
317 Ga0075430_100187479 3300006846 Unclassified 1720
318 Ga0075431_100015089 3300006847 Bacteria 7823
319 Ga0075431_100024715 3300006847 Bacteria 6160
320 Ga0075431_100039344 3300006847 Unclassified 4872
321 Ga0075431_100298840 3300006847 Bacteria 1627
322 Ga0075433_10000251 3300006852 Bacteria 31061
323 Ga0075433_10001092 3300006852 Bacteria 19562
324 Ga0075433_10025597 3300006852 Bacteria 4989
325 Ga0075433_10191200 3300006852 Bacteria 1821
326 Ga0075434_100406549 3300006871 Bacteria 1382
327 Ga0075434_101072232 3300006871 Bacteria 819
328 Ga0075429_100002679 3300006880 Bacteria 14985
329 Ga0075429_100011793 3300006880 Bacteria 7578
330 Ga0075429_100027208 3300006880 Bacteria 4963
331 Ga0075429_100106941 3300006880 Bacteria 2445
332 Ga0075429_100455720 3300006880 Bacteria 1121
333 Ga0075429_101205586 3300006880 Unclassified 661
334 Ga0068865_100314861 3300006881 Unclassified 1257
335 Ga0068865_100328685 3300006881 Bacteria 1232
336 Ga0068865_100517196 3300006881 Bacteria 998
337 Ga0075436_100539307 3300006914 Bacteria 856
338 Ga0097620_100003217 3300006931 Bacteria 16627
339 Ga0097620_100007329 3300006931 Bacteria 11190
340 Ga0097620_100027989 3300006931 Bacteria 5651
341 Ga0097620_100054698 3300006931 Bacteria 4015
342 Ga0097620_101135261 3300006931 Bacteria 860
343 Ga0097620_101739471 3300006931 Bacteria 689
344 Ga0075435_100005384 3300007076 Bacteria 8927
345 Ga0075435_100010639 3300007076 Bacteria 6734
346 Ga0111539_10000346 3300009094 Bacteria 57056
347 Ga0111539_10007109 3300009094 Bacteria 14347
348 Ga0111539_10007388 3300009094 Bacteria 14075
349 Ga0111539_10069875 3300009094 Bacteria 4146
350 Ga0111539_10185810 3300009094 Bacteria 2427
351 Ga0111539_10316968 3300009094 Bacteria 1815
352 Ga0111539_10815396 3300009094 Unclassified 1086
353 Ga0111539_11041117 3300009094 Unclassified 951
354 Ga0111539_11738661 3300009094 Bacteria 723
355 Ga0105245_10450959 3300009098 Bacteria 1295
356 Ga0105245_11940776 3300009098 Unclassified 642
357 Ga0105245_12174250 3300009098 Bacteria 609
358 Ga0105247_11150718 3300009101 Bacteria 615
359 Ga0114129_10025960 3300009147 Bacteria 8297
360 Ga0114129_10045968 3300009147 Bacteria 6136
361 Ga0114129_10111458 3300009147 Bacteria 3775
362 Ga0114129_10396622 3300009147 Bacteria 1819
363 Ga0114129_11678749 3300009147 Bacteria 776
364 Ga0114129_11744471 3300009147 Bacteria 759
365 Ga0105243_11783189 3300009148 Unclassified 646
366 Ga0105242_10149065 3300009176 Bacteria 2038
367 Ga0105242_11936888 3300009176 Unclassified 630
368 Ga0105248_10025687 3300009177 Bacteria 6551
369 Ga0105248_10163474 3300009177 Bacteria 2510
370 Ga0105248_10292678 3300009177 Bacteria 1834
371 Ga0105248_10777208 3300009177 Unclassified 1081
372 Ga0105237_10654050 3300009545 Unclassified 1058
373 Ga0105238_12264924 3300009551 Unclassified 578
374 Ga0105249_10019650 3300009553 Bacteria 6029
375 Ga0105249_11022792 3300009553 Bacteria 895
376 Ga0105249_11033545 3300009553 Unclassified 891
377 Ga0105249_11520613 3300009553 Unclassified 742
378 Ga0105239_11251973 3300010375 Unclassified 855
379 Ga0105246_10526675 3300011119 Bacteria 1008
380 Ga0105246_10859642 3300011119 Bacteria 810
381 Ga0157313_1022134 3300012503 Bacteria 658
382 Ga0157324_1005969 3300012506 Bacteria 901
383 Ga0157373_11282502 3300013100 Unclassified 554
384 Ga0157371_10278883 3300013102 Bacteria 1207
385 Ga0157369_12670384 3300013105 Unclassified 503
386 Ga0157374_10071768 3300013296 Bacteria 3266
387 Ga0157378_10009365 3300013297 Bacteria 8533
388 Ga0157378_10719441 3300013297 Unclassified 1019
389 Ga0157378_11087727 3300013297 Bacteria 836
390 Ga0157378_12117785 3300013297 Bacteria 613
391 Ga0157378_12745773 3300013297 Unclassified 545
392 Ga0163162_10011291 3300013306 Bacteria 8710
393 Ga0163162_10011337 3300013306 Bacteria 8692
394 Ga0163162_10921463 3300013306 Bacteria 986
395 Ga0163162_10998945 3300013306 Bacteria 946
396 Ga0163162_11424800 3300013306 Bacteria 788
397 Ga0157372_12018816 3300013307 Unclassified 663
398 Ga0157375_10010270 3300013308 Bacteria 8239
399 Ga0157375_10141462 3300013308 Bacteria 2533
400 Ga0157375_10206991 3300013308 Bacteria 2118
401 Ga0157375_10563765 3300013308 Bacteria 1300
402 Ga0157375_11263536 3300013308 Bacteria 867
403 Ga0157375_11988744 3300013308 Bacteria 691
404 Ga0163163_10064680 3300014325 Unclassified 3629
405 Ga0163163_10309143 3300014325 Bacteria 1633
406 Ga0163163_10416754 3300014325 Unclassified 1402
407 Ga0157380_10044593 3300014326 Bacteria 3476
408 Ga0157380_10211833 3300014326 Bacteria 1727
409 Ga0157377_10024608 3300014745 Bacteria 3202
410 Ga0157377_10062614 3300014745 Unclassified 2129
411 Ga0157377_10068383 3300014745 Bacteria 2047
412 Ga0157377_10084779 3300014745 Bacteria 1859
413 Ga0157377_10279846 3300014745 Bacteria 1093
414 Ga0157379_10086884 3300014968 Bacteria 2804
415 Ga0157376_10167116 3300014969 Bacteria 2000
416 Ga0157376_12137937 3300014969 Bacteria 598
417 Ga0157376_12367905 3300014969 Bacteria 570
418 Ga0182007_10248501 3300015262 Unclassified 637
419 Ga0163161_10038785 3300017792 Bacteria 3418
420 Ga0163161_10111626 3300017792 Bacteria 2044
421 Ga0163161_10530284 3300017792 Unclassified 962
422 Ga0163161_11051717 3300017792 Bacteria 697
423 Ga0206356_11730128 3300020070 Bacteria 510
424 Ga0206351_10788732 3300020077 Bacteria 610
425 Ga0206352_10552676 3300020078 Bacteria 708
426 Ga0206352_10946638 3300020078 Bacteria 547
427 Ga0206352_11266020 3300020078 Unclassified 573
428 Ga0207673_1007456 3300025290 Bacteria 1373
429 Ga0207697_10000815 3300025315 Bacteria 17655
430 Ga0207682_10001377 3300025893 Bacteria 11222
431 Ga0207682_10018403 3300025893 Bacteria 2731
432 Ga0207682_10173463 3300025893 Bacteria 982
433 Ga0207642_10316141 3300025899 Bacteria 910
434 Ga0207688_10016453 3300025901 Bacteria 4011
435 Ga0207680_10067471 3300025903 Unclassified 2204
436 Ga0207680_10084265 3300025903 Bacteria 2005
437 Ga0207680_10301161 3300025903 Unclassified 1118
438 Ga0207647_10092929 3300025904 Bacteria 1798
439 Ga0207645_10002151 3300025907 Bacteria 15755
440 Ga0207645_10116427 3300025907 Bacteria 1733
441 Ga0207645_10201849 3300025907 Bacteria 1308
442 Ga0207645_10304298 3300025907 Bacteria 1062
443 Ga0207643_10000847 3300025908 Bacteria 18546
444 Ga0207643_10050557 3300025908 Bacteria 2357
445 Ga0207643_10107599 3300025908 Unclassified 1640
446 Ga0207643_10159840 3300025908 Unclassified 1355
447 Ga0207663_10466388 3300025916 Bacteria 976
448 Ga0207660_10429331 3300025917 Bacteria 1067
449 Ga0207660_10617702 3300025917 Bacteria 883
450 Ga0207662_10027222 3300025918 Bacteria 3300
451 Ga0207662_10053348 3300025918 Bacteria 2409
452 Ga0207662_10539908 3300025918 Bacteria 806
453 Ga0207662_11036457 3300025918 Unclassified 583
454 Ga0207657_10471146 3300025919 Bacteria 985
455 Ga0207649_10020915 3300025920 Bacteria 3757
456 Ga0207646_10386213 3300025922 Bacteria 1265
457 Ga0207681_10014630 3300025923 Bacteria 4883
458 Ga0207681_10156615 3300025923 Bacteria 1712
459 Ga0207681_10194962 3300025923 Bacteria 1552
460 Ga0207681_10336887 3300025923 Bacteria 1204
461 Ga0207681_10970724 3300025923 Bacteria 712
462 Ga0207650_10027746 3300025925 Unclassified 4055
463 Ga0207650_10287977 3300025925 Bacteria 1339
464 Ga0207650_11220780 3300025925 Unclassified 640
465 Ga0207659_10013636 3300025926 Bacteria 5213
466 Ga0207659_10015545 3300025926 Bacteria 4935
467 Ga0207659_10019068 3300025926 Unclassified 4507
468 Ga0207659_10019983 3300025926 Bacteria 4419
469 Ga0207659_10146462 3300025926 Bacteria 1839
470 Ga0207659_10178869 3300025926 Bacteria 1679
471 Ga0207659_10245530 3300025926 Bacteria 1450
472 Ga0207659_10387244 3300025926 Bacteria 1167
473 Ga0207659_10394427 3300025926 Bacteria 1156
474 Ga0207659_10608280 3300025926 Unclassified 932
475 Ga0207659_10847005 3300025926 Unclassified 786
476 Ga0207659_10856438 3300025926 Bacteria 781
477 Ga0207687_11009238 3300025927 Bacteria 714
478 Ga0207644_10149878 3300025931 Unclassified 1804
479 Ga0207644_10182674 3300025931 Bacteria 1645
480 Ga0207644_10457123 3300025931 Bacteria 1049
481 Ga0207644_10729311 3300025931 Bacteria 827
482 Ga0207644_11207630 3300025931 Unclassified 636
483 Ga0207690_10248329 3300025932 Bacteria 1373
484 Ga0207690_10808634 3300025932 Unclassified 775
485 Ga0207706_10016778 3300025933 Bacteria 6609
486 Ga0207706_10038510 3300025933 Bacteria 4241
487 Ga0207706_10139232 3300025933 Bacteria 2135
488 Ga0207706_10229892 3300025933 Bacteria 1623
489 Ga0207706_10278741 3300025933 Bacteria 1458
490 Ga0207706_10307661 3300025933 Bacteria 1380
491 Ga0207706_10701344 3300025933 Bacteria 865
492 Ga0207686_11040579 3300025934 Unclassified 666
493 Ga0207670_10146986 3300025936 Bacteria 1744
494 Ga0207670_10294631 3300025936 Unclassified 1268
495 Ga0207670_11122675 3300025936 Bacteria 664
496 Ga0207670_11411729 3300025936 Unclassified 591
497 Ga0207670_11653635 3300025936 Unclassified 545
498 Ga0207669_10000948 3300025937 Bacteria 12283
499 Ga0207669_10117704 3300025937 Bacteria 1796
500 Ga0207669_10412215 3300025937 Bacteria 1061
501 Ga0207669_10512272 3300025937 Bacteria 962
502 Ga0207704_10228646 3300025938 Bacteria 1382
503 Ga0207704_10337026 3300025938 Bacteria 1169
504 Ga0207704_10515999 3300025938 Unclassified 966
505 Ga0207665_10249923 3300025939 Bacteria 1310
506 Ga0207691_10003859 3300025940 Bacteria 14545
507 Ga0207691_10076812 3300025940 Bacteria 3009
508 Ga0207691_10077231 3300025940 Unclassified 3000
509 Ga0207691_10125062 3300025940 Bacteria 2276
510 Ga0207691_10152614 3300025940 Bacteria 2030
511 Ga0207691_10389641 3300025940 Bacteria 1189
512 Ga0207691_10598355 3300025940 Bacteria 934
513 Ga0207711_10076139 3300025941 Bacteria 2921
514 Ga0207711_10256429 3300025941 Bacteria 1607
515 Ga0207711_10549836 3300025941 Unclassified 1077
516 Ga0207689_10003934 3300025942 Bacteria 13528
517 Ga0207661_10049125 3300025944 Bacteria 3357
518 Ga0207661_10182526 3300025944 Bacteria 1834
519 Ga0207661_10541884 3300025944 Unclassified 1066
520 Ga0207679_10003089 3300025945 Bacteria 10307
521 Ga0207679_10064111 3300025945 Unclassified 2745
522 Ga0207679_10097672 3300025945 Bacteria 2288
523 Ga0207679_10101409 3300025945 Bacteria 2252
524 Ga0207651_10037684 3300025960 Bacteria 3169
525 Ga0207651_10048279 3300025960 Unclassified 2876
526 Ga0207651_10203594 3300025960 Bacteria 1588
527 Ga0207651_10592329 3300025960 Bacteria 968
528 Ga0207651_10734979 3300025960 Unclassified 871
529 Ga0207651_11089190 3300025960 Bacteria 716
530 Ga0207651_11379396 3300025960 Bacteria 634
531 Ga0207712_10012851 3300025961 Bacteria 5356
532 Ga0207712_10052244 3300025961 Bacteria 2862
533 Ga0207712_10745018 3300025961 Bacteria 858
534 Ga0207668_10104355 3300025972 Bacteria 2113
535 Ga0207668_10256621 3300025972 Unclassified 1423
536 Ga0207668_10422583 3300025972 Bacteria 1132
537 Ga0207668_10552831 3300025972 Bacteria 997
538 Ga0207668_10845176 3300025972 Bacteria 812
539 Ga0207668_11012305 3300025972 Bacteria 743
540 Ga0207640_10301751 3300025981 Unclassified 1267
541 Ga0207640_10308653 3300025981 Bacteria 1255
542 Ga0207658_10028472 3300025986 Bacteria 3934
543 Ga0207658_10238959 3300025986 Bacteria 1538
544 Ga0207658_10697145 3300025986 Unclassified 917
545 Ga0207658_11162782 3300025986 Bacteria 705
546 Ga0207677_10181545 3300026023 Bacteria 1656
547 Ga0207677_10309865 3300026023 Unclassified 1307
548 Ga0207677_11227507 3300026023 Bacteria 687
549 Ga0207703_10137831 3300026035 Bacteria 2114
550 Ga0207678_10106708 3300026067 Bacteria 2389
551 Ga0207708_10012732 3300026075 Bacteria 6273
552 Ga0207708_10072323 3300026075 Bacteria 2642
553 Ga0207708_10085304 3300026075 Bacteria 2429
554 Ga0207708_10124432 3300026075 Bacteria 2011
555 Ga0207702_11085326 3300026078 Unclassified 794
556 Ga0207641_10151510 3300026088 Bacteria 2100
557 Ga0207641_10505901 3300026088 Unclassified 1174
558 Ga0207641_11118449 3300026088 Unclassified 786
559 Ga0207641_11134463 3300026088 Bacteria 781
560 Ga0207641_11190856 3300026088 Bacteria 761
561 Ga0207648_10188792 3300026089 Bacteria 1826
562 Ga0207648_10331099 3300026089 Unclassified 1370
563 Ga0207648_12210107 3300026089 Bacteria 511
564 Ga0207676_10047847 3300026095 Unclassified 3316
565 Ga0207676_10049559 3300026095 Bacteria 3268
566 Ga0207676_10079855 3300026095 Bacteria 2654
567 Ga0207676_10298852 3300026095 Bacteria 1469
568 Ga0207674_10343311 3300026116 Unclassified 1444
569 Ga0207674_10354459 3300026116 Bacteria 1418
570 Ga0207674_10355175 3300026116 Unclassified 1417
571 Ga0207674_10632502 3300026116 Bacteria 1033
572 Ga0207674_10703767 3300026116 Unclassified 975
573 Ga0207675_100017515 3300026118 Bacteria 6686
574 Ga0207675_100041704 3300026118 Bacteria 4285
575 Ga0207675_100067537 3300026118 Bacteria 3342
576 Ga0207675_100091533 3300026118 Bacteria 2860
577 Ga0207675_100190325 3300026118 Bacteria 1968
578 Ga0207683_10015294 3300026121 Bacteria 6532
579 Ga0207683_10060332 3300026121 Bacteria 3334
580 Ga0207683_10106058 3300026121 Unclassified 2512
581 Ga0207683_10527536 3300026121 Bacteria 1091
582 Ga0207683_10576904 3300026121 Bacteria 1040
583 Ga0207683_10601822 3300026121 Bacteria 1017
584 Ga0207698_10159578 3300026142 Bacteria 1970
585 Ga0209981_1058278 3300027378 Unclassified 590
586 Ga0209971_1021869 3300027682 Unclassified 1522
587 Ga0209998_10044324 3300027717 Bacteria 1016
588 Ga0209998_10131603 3300027717 Unclassified 635
589 Ga0209974_10024351 3300027876 Bacteria 2003
590 Ga0207428_10000756 3300027907 Bacteria 36837
591 Ga0207428_10008286 3300027907 Bacteria 9398
592 Ga0207428_10026108 3300027907 Bacteria 4879
593 Ga0207428_10035828 3300027907 Bacteria 4053
594 Ga0207428_10036818 3300027907 Bacteria 3986
595 Ga0207428_10307891 3300027907 Bacteria 1172
596 Ga0207428_10862163 3300027907 Bacteria 641
597 Ga0268266_10095343 3300028379 Bacteria 2613
598 Ga0268266_10737173 3300028379 Unclassified 951
599 Ga0268266_11238784 3300028379 Bacteria 721
600 Ga0268266_11348218 3300028379 Bacteria 689
601 Ga0268265_10225239 3300028380 Bacteria 1644
602 Ga0268265_10306809 3300028380 Unclassified 1431
603 Ga0268265_10517284 3300028380 Bacteria 1127
604 Ga0268265_10604693 3300028380 Bacteria 1048
605 Ga0268264_10149351 3300028381 Bacteria 2094
606 Ga0307408_101053101 3300031548 Bacteria 752
607 Ga0307413_11179621 3300031824 Unclassified 665
608 Ga0307410_10531439 3300031852 Bacteria 972
609 Ga0307416_102075159 3300032002 Bacteria 671
610 Ga0307416_102329067 3300032002 Bacteria 636
611 Ga0373930_0186175 3300034816 Bacteria 535
612 Ga0373949_0221374 3300035090 Bacteria 575
613 Ga0373951_0158244 3300035091 Unclassified 639
614 Ga0373923_0011933 3300035111 Bacteria 3200
615 Ga0373936_0104444 3300035113 Bacteria 1198
616 Ga0373945_0014209 3300035116 Bacteria 2663
617 Ga0373945_0182862 3300035116 Unclassified 864
618 Ga0373953_0221067 3300035117 Bacteria 820
619 Ga0373954_0175009 3300035118 Bacteria 1052
620 Ga0373956_0165388 3300035119 Bacteria 1043
621 Ga0373957_0132118 3300035120 Unclassified 1017
622 Ga0373943_0011201 3300035170 Bacteria 4033
623 Ga0373946_0008234 3300035171 Bacteria 3827
624 Ga0373946_0389702 3300035171 Unclassified 702
625 Ga0373961_0278568 3300035241 Bacteria 613
626 Ga0373962_0020002 3300035242 Bacteria 1755
627 Ga0373924_0009510 3300035410 Bacteria 3564
628 Ga0373927_0078320 3300035695 Unclassified 2141
629 Ga0373927_0791877 3300035695 Unclassified 626
630 Ga0373933_0213415 3300035724 Unclassified 1237
631 Ga0373947_0009312 3300035725 Bacteria 5642
632 Ga0373947_0605934 3300035725 Bacteria 746
633 Ga0373937_0224127 3300036401 Bacteria 1770
634 Ga0373937_0239021 3300036401 Unclassified 1711
635 Ga0373925_0011544 3300037068 Bacteria 6392
636 Ga0395901_1516583 3300038443 Unclassified 626
637 Ga0436365_0592924 3300039437 Unclassified 4847
638 Ga0439436_0086212 3300041404 Unclassified 874
639 Ga0439453_0002672 3300041408 Unclassified 2484
640 Ga0451835_0093829 3300041492 Unclassified 539
641 Ga0451853_2008618 3300041512 Unclassified 843
642 Ga0439454_034223 3300042011 Unclassified 809
643 Ga0439446_0113930 3300042156 Unclassified 865
644 Ga0439435_0144210 3300042436 Bacteria 760
645 Ga0439444_0138595 3300042437 Unclassified 580
646 Ga0439464_0082464 3300042439 Bacteria 962
647 Ga0439464_0085329 3300042439 Unclassified 947
648 Ga0439460_0044318 3300042461 Bacteria 1317
649 Ga0495592_0049540 3300046454 Bacteria 3123
650 Ga0495580_0142027 3300046472 Bacteria 1664
651 Ga0495580_0287862 3300046472 Bacteria 1120
652 Ga0495580_0529072 3300046472 Bacteria 785
653 Ga0495580_0947371 3300046472 Bacteria 551
654 Ga0495582_0455115 3300046473 Unclassified 739
655 Ga0495608_0013627 3300046511 Bacteria 5640
656 Ga0495628_0078101 3300046516 Bacteria 2574
657 Ga0495628_0092475 3300046516 Unclassified 2339
658 Ga0495630_0033831 3300046517 Unclassified 3812
659 Ga0495643_0003101 3300046522 Bacteria 12441
660 Ga0495643_0007021 3300046522 Bacteria 7316
661 Ga0495652_0173494 3300046529 Bacteria 1662
662 Ga0495665_0493918 3300046531 Bacteria 617
663 Ga0495640_0211220 3300046533 Bacteria 1227
664 Ga0495587_0024556 3300046536 Bacteria 3692
665 Ga0495621_0097546 3300046539 Unclassified 1115
666 Ga0495645_0166367 3300046543 Unclassified 1520
667 Ga0495633_0058439 3300046558 Bacteria 1810
668 Ga0495633_0346099 3300046558 Bacteria 674
669 Ga0495667_0262030 3300046559 Bacteria 1099
670 Ga0495656_0558531 3300046615 Unclassified 610
671 Ga0495656_0664603 3300046615 Unclassified 560
672 Ga0495634_0290847 3300046642 Bacteria 990
673 Ga0495588_0263264 3300046674 Bacteria 909
674 Ga0495657_0122994 3300046675 Unclassified 1633
675 Ga0495646_0142664 3300046680 Bacteria 1338
676 Ga0495647_0033858 3300046681 Unclassified 1911
677 Ga0495647_0043992 3300046681 Bacteria 1711
678 Ga0495658_0044788 3300046683 Bacteria 2480
679 Ga0495658_0255607 3300046683 Bacteria 1102
680 Ga0495669_0040396 3300046684 Bacteria 2069
681 Ga0495613_0000790 3300046689 Bacteria 24652
682 Ga0495670_0376829 3300046691 Unclassified 765
683 Ga0495600_0250911 3300046809 Bacteria 1125
684 Ga0495581_0276933 3300047315 Bacteria 981
685 Ga0495581_0328006 3300047315 Bacteria 894
686 Ga0495604_0453721 3300047317 Bacteria 837
687 Ga0495636_0295377 3300047318 Bacteria 757
688 Ga0495674_0048220 3300047319 Bacteria 3771
689 Ga0495674_0364170 3300047319 Bacteria 1172
690 Ga0495676_0912063 3300047321 Unclassified 563
691 Ga0495680_0466678 3300047322 Bacteria 862
692 Ga0495675_0258281 3300047444 Unclassified 1044
693 Ga0495684_0000697 3300047471 Bacteria 26977
694 Ga0495602_0440181 3300048088 Bacteria 922
695 Ga0496100_0003342 3300048903 Bacteria 8357
696 Ga0496100_0433312 3300048903 Bacteria 1006
697 Ga0496101_0000660 3300048904 Bacteria 20776
698 Ga0496102_0273024 3300048905 Bacteria 1594
699 Ga0496102_1749171 3300048905 Bacteria 539
700 Ga0496104_0510933 3300048907 Bacteria 1113
701 Ga0496105_0229662 3300048908 Unclassified 1508
702 Ga0496106_0035903 3300048909 Bacteria 3708
703 Ga0496106_0207999 3300048909 Bacteria 1558
704 Ga0496107_0612781 3300048910 Unclassified 804
705 Ga0496108_0586930 3300048911 Unclassified 971
706 Ga0496108_0923420 3300048911 Bacteria 748
707 Ga0496109_0126303 3300048912 Bacteria 2385
708 Ga0496109_0126652 3300048912 Unclassified 2382
709 Ga0496109_0231072 3300048912 Unclassified 1740
710 Ga0496110_0579920 3300048913 Bacteria 1018
711 Ga0496113_0227788 3300048916 Bacteria 1486
712 Ga0496114_0000409 3300048917 Bacteria 31807
713 Ga0496114_0322951 3300048917 Bacteria 1364
714 Ga0501308_025804 3300049128 Unclassified 763
715 Ga0501308_035943 3300049128 Unclassified 682
716 Ga0501308_047531 3300049128 Unclassified 621
717 Ga0501308_070606 3300049128 Bacteria 542
718 Ga0501309_076386 3300049129 Bacteria 557
719 Ga0501309_099240 3300049129 Unclassified 503
720 Ga0501310_028854 3300049130 Unclassified 729
721 Ga0501305_019899 3300049161 Unclassified 983
722 Ga0501305_071091 3300049161 Unclassified 612
723 Ga0501307_091405 3300049162 Unclassified 508
724 Ga0501311_018930 3300049527 Unclassified 919
725 Ga0501311_098827 3300049527 Bacteria 515
726 Ga0501311_105359 3300049527 Unclassified 503
727 Ga0501312_032754 3300049528 Unclassified 822
728 Ga0501313_050999 3300049529 Unclassified 572
729 Ga0501314_041595 3300049530 Unclassified 537
730 Ga0501315_077919 3300049531 Bacteria 559
731 Ga0501316_080964 3300049532 Unclassified 502
732 Ga0501317_084112 3300049533 Unclassified 554
733 Ga0501320_069639 3300049536 Unclassified 507
734 Ga0501031_0982666 3300049568 Unclassified 540
735 Ga0501033_0220332 3300049570 Unclassified 1351
736 Ga0501036_1266168 3300049572 Unclassified 600
737 Ga0501039_0094607 3300049575 Bacteria 2329
738 Ga0501040_0029386 3300049576 Bacteria 3710
739 Ga0501040_0290299 3300049576 Unclassified 1169
740 Ga0501042_0026619 3300049578 Bacteria 4063
741 Ga0501046_0913457 3300049580 Bacteria 612
742 Ga0501068_0270890 3300049584 Unclassified 1084
743 Ga0501071_0123927 3300049587 Bacteria 1917
744 Ga0501071_0616179 3300049587 Unclassified 835
745 Ga0501073_0649364 3300049589 Bacteria 728
746 Ga0501074_0357905 3300049590 Bacteria 1036
747 Ga0501075_0051252 3300049591 Unclassified 3103
748 Ga0501075_0203823 3300049591 Unclassified 1509
749 Ga0501075_0578138 3300049591 Unclassified 857
750 Ga0501076_0690170 3300049592 Unclassified 843
751 Ga0501076_0778170 3300049592 Unclassified 790
752 Ga0501079_0787633 3300049741 Unclassified 748
753 Ga0501079_0807239 3300049741 Unclassified 739
754 Ga0501079_1247548 3300049741 Unclassified 585
755 Ga0501079_1272131 3300049741 Unclassified 579
756 Ga0501080_0672587 3300049742 Bacteria 915
757 Ga0501080_1841595 3300049742 Unclassified 508
758 Ga0501081_0035653 3300049743 Bacteria 3387
759 Ga0501081_0498126 3300049743 Bacteria 908
760 Ga0501035_1154597 3300049822 Unclassified 603
761 Ga0501045_0104482 3300049824 Bacteria 2099
762 nmdc:mga05p37_117687_c1 3300050507 Bacteria 3265
763 nmdc:mga05p37_19854_c1 3300050507 Bacteria 2752
764 nmdc:mga05p37_49082_c1 3300050507 Bacteria 5191
765 nmdc:mga09592_139459_c1 3300050508 Unclassified 2089
766 nmdc:mga09592_142615_c1 3300050508 Bacteria 2065
767 nmdc:mga09592_340389_c1 3300050508 Bacteria 1298
768 nmdc:mga09592_396027_c1 3300050508 Bacteria 1194
769 nmdc:mga09592_74566_c1 3300050508 Unclassified 2883
770 nmdc:mga09592_846_c1 3300050508 Bacteria 23790
771 nmdc:mga0qj67_136564_c1 3300050509 Unclassified 1987
772 nmdc:mga0qj67_137991_c1 3300050509 Bacteria 1976
773 nmdc:mga0qj67_9598_c1 3300050509 Bacteria 7213
774 nmdc:mga06r32_1315493_c1 3300050510 Bacteria 666
775 nmdc:mga06r32_2905_c1 3300050510 Bacteria 15383
776 nmdc:mga06r32_373624_c1 3300050510 Unclassified 1409
777 nmdc:mga06r32_39065_c1 3300050510 Unclassified 4502
778 nmdc:mga06r32_60325_c1 3300050510 Unclassified 3650
779 nmdc:mga08y16_1485269_c1 3300050511 Bacteria 639
780 nmdc:mga08y16_1867064_c1 3300050511 Bacteria 552
781 nmdc:mga08y16_2011487_c1 3300050511 Unclassified 527
782 nmdc:mga08y16_30452_c1 3300050511 Bacteria 5680
783 nmdc:mga08y16_40972_c1 3300050511 Bacteria 4852
784 nmdc:mga08y16_479493_c1 3300050511 Bacteria 1266
785 nmdc:mga08y16_539922_c1 3300050511 Bacteria 1181
786 nmdc:mga08y16_633_c1 3300050511 Bacteria 32997
787 nmdc:mga08y16_6429_c1 3300050511 Bacteria 12319
788 nmdc:mga0rr50_50168_c1 3300050513 Bacteria 3091
789 nmdc:mga08x19_650164_c1 3300050514 Bacteria 748
790 nmdc:mga08x19_772985_c1 3300050514 Unclassified 682
791 nmdc:mga0a205_260959_c1 3300050515 Unclassified 1610
792 nmdc:mga0a205_81787_c1 3300050515 Bacteria 1945
793 nmdc:mga0a205_9233_c1 3300050515 Bacteria 9004
794 Ga0495601_0123718 3300053077 Unclassified 1681
795 Ga0495612_0073802 3300053078 Bacteria 1426
796 Ga0495595_0044489 3300053084 Unclassified 2040
797 Ga0495595_0117905 3300053084 Bacteria 1291
798 Ga0495619_0003275 3300053085 Bacteria 10470
799 Ga0495619_0552065 3300053085 Unclassified 790
800 Ga0501084_0008598 3300054114 Bacteria 8440
801 Ga0501084_0463183 3300054114 Bacteria 1072
802 Ga0590075_129046 3300059424 Unclassified 663
803 Ga0587084_045894 3300059477 Unclassified 758
804 Ga0587066_065413 3300059490 Unclassified 753
805 Ga0587066_080622 3300059490 Unclassified 704
806 Ga0587070_097305 3300059491 Unclassified 671
807 Ga0587073_0062478 3300059492 Unclassified 878
808 Ga0587077_128274 3300059493 Bacteria 641
809 Ga0587077_222994 3300059493 Bacteria 532
810 Ga0587080_063049 3300059503 Unclassified 726
811 Ga0587082_055398 3300059504 Unclassified 768
812 Ga0587082_059561 3300059504 Bacteria 750
813 Ga0587083_0131972 3300059505 Unclassified 656
814 Ga0587085_038277 3300059506 Unclassified 823
815 Ga0587085_089006 3300059506 Unclassified 634
816 Ga0587085_171837 3300059506 Bacteria 514
817 Ga0587090_055536 3300059510 Unclassified 737
818 Ga0587091_074401 3300059511 Bacteria 750
819 Ga0587092_052880 3300059512 Unclassified 740
820 Ga0587092_066559 3300059512 Bacteria 685
821 Ga0587094_061503 3300059513 Bacteria 658
822 Ga0587125_036131 3300059607 Unclassified 650
823 Ga0587101_002563 3300059623 Bacteria 1752
824 Ga0587101_042625 3300059623 Unclassified 754
825 Ga0587101_063952 3300059623 Unclassified 664
826 Ga0587115_032401 3300059626 Bacteria 783
827 Ga0587115_057822 3300059626 Unclassified 644
828 Ga0587130_042373 3300059631 Unclassified 553
829 Ga0587062_053577 3300059639 Unclassified 690
830 Ga0587067_091741 3300059640 Unclassified 689
831 Ga0587068_058512 3300059641 Unclassified 737
832 Ga0587072_065690 3300059643 Unclassified 756
833 Ga0587072_156616 3300059643 Bacteria 554
834 Ga0587075_038076 3300059644 Unclassified 795
835 Ga0587100_015058 3300059648 Unclassified 704
836 Ga0587102_030159 3300059649 Unclassified 659
837 Ga0587107_065921 3300059652 Unclassified 650
838 Ga0587071_067690 3300060344 Bacteria 771
839 Ga0587111_0044458 3300060346 Bacteria 959
840 Ga0587111_0113504 3300060346 Unclassified 689
841 Ga0501082_0106233 3300060353 Bacteria 2429
842 Ga0530510_0414040 3300061734 Unclassified 1017
843 Ga0157376_10972869
844 JGI24746J21847_1001312
845 JGI24746J21847_1002613
846 JGI24749J21850_1035925
847 JGI24751J29686_10079364
848 Ga0006763J43179_102979
849 Ga0006762J43184_102821
850 Ga0006765J45826_102709
851 Ga0006778J45830_1008035
852 Ga0006759J45824_1007035
853 Ga0006759J45824_1015090
854 Ga0006759J45824_1018684
855 JGI25406J46586_10022522
856 Ga0006758J48902_1004937
857 Ga0006770J48903_1009933
858 Ga0006770J48903_1011447
859 Ga0006777J48905_1009548
860 Ga0006777J48905_1023568
861 Ga0007417J51691_1006602
862 Ga0007417J51691_1020827
863 Ga0007427J51700_104200
864 Ga0006781J51513_1003563
865 Ga0007410J51695_1118318
866 Ga0007409J51694_1008062
867 Ga0007409J51694_1089376
868 Ga0007416J51690_1020843
869 Ga0007429J51699_1011709
870 Ga0007429J51699_1014819
871 Ga0007429J51699_1021144
872 Ga0007411J51799_109537
873 Ga0007415J51800_105917
874 Ga0032354_1001770
875 Ga0032354_1024662
876 Ga0032354_1044077
877 Ga0006780_1001386
878 Ga0058858_1005683
879 Ga0058858_1434174
880 Ga0058859_10026768
881 Ga0058859_10047863
882 Ga0058859_10048081
883 Ga0058859_10068287
884 Ga0058859_10138439
885 Ga0058863_11744773
886 Ga0058863_11851899
887 Ga0058861_10045090
888 Ga0058861_10090615
889 Ga0058861_11811094
890 Ga0058861_11984224
891 Ga0058861_12067518
892 Ga0058860_10004586
893 Ga0058860_10022220
894 Ga0058860_10053229
895 Ga0058860_10053703
896 Ga0058860_10120934
897 Ga0058860_12157817
898 Ga0058860_12194457
899 Ga0058862_12532843
900 Ga0058862_12633905
901 Ga0058862_12868080
902 Ga0058862_12874132
903 Ga0065714_10079673
904 Ga0065714_10097205
905 Ga0065704_10016305
906 Ga0065712_10029825
907 Ga0065712_10067852
908 Ga0065712_10075103
909 Ga0065715_10005596
910 Ga0065715_10015619
911 Ga0065715_10211374
912 Ga0065715_10800613
913 Ga0065715_10886075
914 Ga0065707_10015336
915 Ga0070658_10375830
916 Ga0070676_10030575
917 Ga0070676_10260275
918 Ga0070676_10410942
919 Ga0070676_10735737
920 Ga0070683_100125341
921 Ga0070683_100169869
922 Ga0070690_100034739
923 Ga0070690_100051401
924 Ga0070690_100082110
925 Ga0070670_100000476
926 Ga0070670_100027457
927 Ga0070670_101072705
928 Ga0070677_10002043
929 Ga0070677_10086770
930 Ga0070677_10229033
931 Ga0068869_100022580
932 Ga0068869_100473526
933 Ga0068869_101411936
934 Ga0070666_10022675
935 Ga0070666_10024365
936 Ga0070666_10168480
937 Ga0070666_10389439
938 Ga0070666_10639580
939 Ga0070680_100101329
940 Ga0070680_100395196
941 Ga0068868_100663789
942 Ga0068868_100890840
943 Ga0068868_100981448
944 Ga0068868_101199029
945 Ga0068868_101333898
946 Ga0070689_100011003
947 Ga0070689_100104448
948 Ga0070689_100223079
949 Ga0070689_100596154
950 Ga0070687_100010039
951 Ga0070687_100018578
952 Ga0070687_100124272
953 Ga0070687_101045643
954 Ga0070661_100049848
955 Ga0070661_100099422
956 Ga0070661_100407031
957 Ga0070692_10281658
958 Ga0070692_10565910
959 Ga0070692_10854010
960 Ga0070668_100021463
961 Ga0070668_100136423
962 Ga0070668_100494447
963 Ga0070668_100688625
964 Ga0070669_100017963
965 Ga0070669_100034057
966 Ga0070669_100043507
967 Ga0070669_100163591
968 Ga0070669_100488722
969 Ga0070669_100814540
970 Ga0070675_100000983
971 Ga0070675_100028849
972 Ga0070675_100068764
973 Ga0070675_100085737
974 Ga0070675_100103252
975 Ga0070675_100106234
976 Ga0070675_100135646
977 Ga0070675_100197848
978 Ga0070675_100209626
979 Ga0070675_100434909
980 Ga0070675_100784429
981 Ga0070675_101199374
982 Ga0070675_101441126
983 Ga0070671_100043604
984 Ga0070671_100108267
985 Ga0070671_100126417
986 Ga0070671_100517561
987 Ga0070674_100000340
988 Ga0070674_100039459
989 Ga0070674_100184987
990 Ga0070674_100382366
991 Ga0070674_100525732
992 Ga0070674_100528090
993 Ga0070674_100786871
994 Ga0070673_100004440
995 Ga0070673_100014441
996 Ga0070673_100023051
997 Ga0070673_100033322
998 Ga0070673_100116060
999 Ga0070673_100609279
1000 Ga0070688_100029468
1001 Ga0070688_100030176
1002 Ga0070688_100177410
1003 Ga0070688_100264110
1004 Ga0070688_101406087
1005 Ga0070659_100020998
1006 Ga0070659_100270540
1007 Ga0070659_100611990
1008 Ga0070667_100114115
1009 Ga0070667_100131754
1010 Ga0070667_100171194
1011 Ga0070667_100191322
1012 Ga0070713_101597591
1013 Ga0070710_10710531
1014 Ga0070701_10028383
1015 Ga0070701_10097573
1016 Ga0070701_10469988
1017 Ga0070711_100048763
1018 Ga0070705_100075017
1019 Ga0070705_100107388
1020 Ga0070705_100322905
1021 Ga0070705_101867420
1022 Ga0070700_100025700
1023 Ga0070700_100072724
1024 Ga0070700_100294119
1025 Ga0070700_100296916
1026 Ga0070700_100382011
1027 Ga0070700_100989099
1028 Ga0070694_100208387
1029 Ga0070694_100438802
1030 Ga0070694_100492082
1031 Ga0070694_100532510
1032 Ga0070663_100864437
1033 Ga0070663_101537742
1034 Ga0070678_100118169
1035 Ga0070678_100140738
1036 Ga0070678_100388712
1037 Ga0070678_100455709
1038 Ga0070678_100524155
1039 Ga0070678_101672746
1040 Ga0070662_100033661
1041 Ga0070662_100060406
1042 Ga0070662_100174242
1043 Ga0070662_100200832
1044 Ga0070662_100615227
1045 Ga0068867_101001571
1046 Ga0068867_101629087
1047 Ga0068867_102078509
1048 Ga0070685_10009649
1049 Ga0070685_10073434
1050 Ga0070685_10745462
1051 Ga0070685_11009110
1052 Ga0070706_101587690
1053 Ga0070707_100345323
1054 Ga0070698_100603824
1055 Ga0070699_100521607
1056 Ga0070697_100150237
1057 Ga0070672_100011676
1058 Ga0070672_100030645
1059 Ga0070672_100112535
1060 Ga0070672_100156408
1061 Ga0070672_100239801
1062 Ga0070672_100394211
1063 Ga0070672_100682807
1064 Ga0070686_100002629
1065 Ga0070686_100271202
1066 Ga0070686_100858289
1067 Ga0070695_100272076
1068 Ga0070696_100308671
1069 Ga0070693_100119453
1070 Ga0070693_100375428
1071 Ga0070693_101057167
1072 Ga0070665_100026135
1073 Ga0070665_100611302
1074 Ga0070665_100882824
1075 Ga0070665_101471881
1076 Ga0070704_100277575
1077 Ga0070704_100324720
1078 Ga0070704_100515714
1079 Ga0070704_100844541
1080 Ga0070664_100005370
1081 Ga0070664_100041960
1082 Ga0070664_100052057
1083 Ga0070664_100145346
1084 Ga0070664_100148300
1085 Ga0070664_100579614
1086 Ga0070664_102332596
1087 Ga0068857_100027164
1088 Ga0068857_100532872
1089 Ga0068857_101200279
1090 Ga0068854_100353870
1091 Ga0068856_100440721
1092 Ga0070702_100449133
1093 Ga0068852_100127277
1094 Ga0068852_101947732
1095 Ga0068859_100003217
1096 Ga0068859_100007329
1097 Ga0068859_100027985
1098 Ga0068859_100054697
1099 Ga0068859_101135372
1100 Ga0068859_101739436
1101 Ga0068864_100011606
1102 Ga0068864_100525708
1103 Ga0068864_101822508
1104 Ga0068866_10222807
1105 Ga0068866_10269131
1106 Ga0068861_100044561
1107 Ga0068861_100121375
1108 Ga0068861_100228794
1109 Ga0068851_11075258
1110 Ga0068870_10010727
1111 Ga0068870_10059173
1112 Ga0068870_10093666
1113 Ga0068870_10159588
1114 Ga0068870_10477126
1115 Ga0068870_10951807
1116 Ga0068863_100026234
1117 Ga0068863_100031429
1118 Ga0068863_100194186
1119 Ga0068863_100807471
1120 Ga0068863_101344990
1121 Ga0068863_102321419
1122 Ga0068858_100021954
1123 Ga0068858_102478594
1124 Ga0068860_100071370
1125 Ga0068860_100489572
1126 Ga0068860_100704189
1127 Ga0068862_100001025
1128 Ga0068862_100166119
1129 Ga0068862_100586466
1130 Ga0068862_100598717
1131 Ga0068862_100618764
1132 Ga0068862_100753587
1133 Ga0068862_101615021
1134 Ga0068862_101815108
1135 Ga0081455_10146932
1136 Ga0081539_10005549
1137 Ga0081539_10200962
1138 Ga0081539_10241490
1139 Ga0075432_10041431
1140 Ga0070716_100321856
1141 Ga0097621_100010076
1142 Ga0097621_100039640
1143 Ga0097621_100062775
1144 Ga0097621_100140778
1145 Ga0097621_100636228
1146 Ga0097621_100750224
1147 Ga0097621_101933836
1148 Ga0068871_100003652
1149 Ga0068871_100018419
1150 Ga0068871_100131306
1151 Ga0068871_100225394
1152 Ga0068871_100284430
1153 Ga0068871_100483951
1154 Ga0075428_100002841
1155 Ga0075428_100062988
1156 Ga0075428_100311914
1157 Ga0075428_100479914
1158 Ga0075430_100008036
1159 Ga0075430_100187479
1160 Ga0075431_100015089
1161 Ga0075431_100024715
1162 Ga0075431_100039344
1163 Ga0075431_100298840
1164 Ga0075433_10000251
1165 Ga0075433_10001092
1166 Ga0075433_10025597
1167 Ga0075433_10191200
1168 Ga0075434_100406549
1169 Ga0075434_101072232
1170 Ga0075429_100002679
1171 Ga0075429_100011793
1172 Ga0075429_100027208
1173 Ga0075429_100106941
1174 Ga0075429_100455720
1175 Ga0075429_101205586
1176 Ga0068865_100314861
1177 Ga0068865_100328685
1178 Ga0068865_100517196
1179 Ga0075436_100539307
1180 Ga0097620_100003217
1181 Ga0097620_100007329
1182 Ga0097620_100027989
1183 Ga0097620_100054698
1184 Ga0097620_101135261
1185 Ga0097620_101739471
1186 Ga0075435_100005384
1187 Ga0075435_100010639
1188 Ga0111539_10000346
1189 Ga0111539_10007109
1190 Ga0111539_10007388
1191 Ga0111539_10069875
1192 Ga0111539_10185810
1193 Ga0111539_10316968
1194 Ga0111539_10815396
1195 Ga0111539_11041117
1196 Ga0111539_11738661
1197 Ga0105245_10450959
1198 Ga0105245_11940776
1199 Ga0105245_12174250
1200 Ga0105247_11150718
1201 Ga0114129_10025960
1202 Ga0114129_10045968
1203 Ga0114129_10111458
1204 Ga0114129_10396622
1205 Ga0114129_11678749
1206 Ga0114129_11744471
1207 Ga0105243_11783189
1208 Ga0105242_10149065
1209 Ga0105242_11936888
1210 Ga0105248_10025687
1211 Ga0105248_10163474
1212 Ga0105248_10292678
1213 Ga0105248_10777208
1214 Ga0105237_10654050
1215 Ga0105238_12264924
1216 Ga0105249_10019650
1217 Ga0105249_11022792
1218 Ga0105249_11033545
1219 Ga0105249_11520613
1220 Ga0105239_11251973
1221 Ga0105246_10526675
1222 Ga0105246_10859642
1223 Ga0157313_1022134
1224 Ga0157324_1005969
1225 Ga0157373_11282502
1226 Ga0157371_10278883
1227 Ga0157369_12670384
1228 Ga0157374_10071768
1229 Ga0157378_10009365
1230 Ga0157378_10719441
1231 Ga0157378_11087727
1232 Ga0157378_12117785
1233 Ga0157378_12745773
1234 Ga0163162_10011291
1235 Ga0163162_10011337
1236 Ga0163162_10921463
1237 Ga0163162_10998945
1238 Ga0163162_11424800
1239 Ga0157372_12018816
1240 Ga0157375_10010270
1241 Ga0157375_10141462
1242 Ga0157375_10206991
1243 Ga0157375_10563765
1244 Ga0157375_11263536
1245 Ga0157375_11988744
1246 Ga0163163_10064680
1247 Ga0163163_10309143
1248 Ga0163163_10416754
1249 Ga0157380_10044593
1250 Ga0157380_10211833
1251 Ga0157377_10024608
1252 Ga0157377_10062614
1253 Ga0157377_10068383
1254 Ga0157377_10084779
1255 Ga0157377_10279846
1256 Ga0157379_10086884
1257 Ga0157376_10167116
1258 Ga0157376_12137937
1259 Ga0157376_12367905
1260 Ga0182007_10248501
1261 Ga0163161_10038785
1262 Ga0163161_10111626
1263 Ga0163161_10530284
1264 Ga0163161_11051717
1265 Ga0206356_11730128
1266 Ga0206351_10788732
1267 Ga0206352_10552676
1268 Ga0206352_10946638
1269 Ga0206352_11266020
1270 Ga0207673_1007456
1271 Ga0207697_10000815
1272 Ga0207682_10001377
1273 Ga0207682_10018403
1274 Ga0207682_10173463
1275 Ga0207642_10316141
1276 Ga0207688_10016453
1277 Ga0207680_10067471
1278 Ga0207680_10084265
1279 Ga0207680_10301161
1280 Ga0207647_10092929
1281 Ga0207645_10002151
1282 Ga0207645_10116427
1283 Ga0207645_10201849
1284 Ga0207645_10304298
1285 Ga0207643_10000847
1286 Ga0207643_10050557
1287 Ga0207643_10107599
1288 Ga0207643_10159840
1289 Ga0207663_10466388
1290 Ga0207660_10429331
1291 Ga0207660_10617702
1292 Ga0207662_10027222
1293 Ga0207662_10053348
1294 Ga0207662_10539908
1295 Ga0207662_11036457
1296 Ga0207657_10471146
1297 Ga0207649_10020915
1298 Ga0207646_10386213
1299 Ga0207681_10014630
1300 Ga0207681_10156615
1301 Ga0207681_10194962
1302 Ga0207681_10336887
1303 Ga0207681_10970724
1304 Ga0207650_10027746
1305 Ga0207650_10287977
1306 Ga0207650_11220780
1307 Ga0207659_10013636
1308 Ga0207659_10015545
1309 Ga0207659_10019068
1310 Ga0207659_10019983
1311 Ga0207659_10146462
1312 Ga0207659_10178869
1313 Ga0207659_10245530
1314 Ga0207659_10387244
1315 Ga0207659_10394427
1316 Ga0207659_10608280
1317 Ga0207659_10847005
1318 Ga0207659_10856438
1319 Ga0207687_11009238
1320 Ga0207644_10149878
1321 Ga0207644_10182674
1322 Ga0207644_10457123
1323 Ga0207644_10729311
1324 Ga0207644_11207630
1325 Ga0207690_10248329
1326 Ga0207690_10808634
1327 Ga0207706_10016778
1328 Ga0207706_10038510
1329 Ga0207706_10139232
1330 Ga0207706_10229892
1331 Ga0207706_10278741
1332 Ga0207706_10307661
1333 Ga0207706_10701344
1334 Ga0207686_11040579
1335 Ga0207670_10146986
1336 Ga0207670_10294631
1337 Ga0207670_11122675
1338 Ga0207670_11411729
1339 Ga0207670_11653635
1340 Ga0207669_10000948
1341 Ga0207669_10117704
1342 Ga0207669_10412215
1343 Ga0207669_10512272
1344 Ga0207704_10228646
1345 Ga0207704_10337026
1346 Ga0207704_10515999
1347 Ga0207665_10249923
1348 Ga0207691_10003859
1349 Ga0207691_10076812
1350 Ga0207691_10077231
1351 Ga0207691_10125062
1352 Ga0207691_10152614
1353 Ga0207691_10389641
1354 Ga0207691_10598355
1355 Ga0207711_10076139
1356 Ga0207711_10256429
1357 Ga0207711_10549836
1358 Ga0207689_10003934
1359 Ga0207661_10049125
1360 Ga0207661_10182526
1361 Ga0207661_10541884
1362 Ga0207679_10003089
1363 Ga0207679_10064111
1364 Ga0207679_10097672
1365 Ga0207679_10101409
1366 Ga0207651_10037684
1367 Ga0207651_10048279
1368 Ga0207651_10203594
1369 Ga0207651_10592329
1370 Ga0207651_10734979
1371 Ga0207651_11089190
1372 Ga0207651_11379396
1373 Ga0207712_10012851
1374 Ga0207712_10052244
1375 Ga0207712_10745018
1376 Ga0207668_10104355
1377 Ga0207668_10256621
1378 Ga0207668_10422583
1379 Ga0207668_10552831
1380 Ga0207668_10845176
1381 Ga0207668_11012305
1382 Ga0207640_10301751
1383 Ga0207640_10308653
1384 Ga0207658_10028472
1385 Ga0207658_10238959
1386 Ga0207658_10697145
1387 Ga0207658_11162782
1388 Ga0207677_10181545
1389 Ga0207677_10309865
1390 Ga0207677_11227507
1391 Ga0207703_10137831
1392 Ga0207678_10106708
1393 Ga0207708_10012732
1394 Ga0207708_10072323
1395 Ga0207708_10085304
1396 Ga0207708_10124432
1397 Ga0207702_11085326
1398 Ga0207641_10151510
1399 Ga0207641_10505901
1400 Ga0207641_11118449
1401 Ga0207641_11134463
1402 Ga0207641_11190856
1403 Ga0207648_10188792
1404 Ga0207648_10331099
1405 Ga0207648_12210107
1406 Ga0207676_10047847
1407 Ga0207676_10049559
1408 Ga0207676_10079855
1409 Ga0207676_10298852
1410 Ga0207674_10343311
1411 Ga0207674_10354459
1412 Ga0207674_10355175
1413 Ga0207674_10632502
1414 Ga0207674_10703767
1415 Ga0207675_100017515
1416 Ga0207675_100041704
1417 Ga0207675_100067537
1418 Ga0207675_100091533
1419 Ga0207675_100190325
1420 Ga0207683_10015294
1421 Ga0207683_10060332
1422 Ga0207683_10106058
1423 Ga0207683_10527536
1424 Ga0207683_10576904
1425 Ga0207683_10601822
1426 Ga0207698_10159578
1427 Ga0209981_1058278
1428 Ga0209971_1021869
1429 Ga0209998_10044324
1430 Ga0209998_10131603
1431 Ga0209974_10024351
1432 Ga0207428_10000756
1433 Ga0207428_10008286
1434 Ga0207428_10026108
1435 Ga0207428_10035828
1436 Ga0207428_10036818
1437 Ga0207428_10307891
1438 Ga0207428_10862163
1439 Ga0268266_10095343
1440 Ga0268266_10737173
1441 Ga0268266_11238784
1442 Ga0268266_11348218
1443 Ga0268265_10225239
1444 Ga0268265_10306809
1445 Ga0268265_10517284
1446 Ga0268265_10604693
1447 Ga0268264_10149351
1448 Ga0307408_101053101
1449 Ga0307413_11179621
1450 Ga0307410_10531439
1451 Ga0307416_102075159
1452 Ga0307416_102329067
1453 Ga0373930_0186175
1454 Ga0373949_0221374
1455 Ga0373951_0158244
1456 Ga0373923_0011933
1457 Ga0373936_0104444
1458 Ga0373945_0014209
1459 Ga0373945_0182862
1460 Ga0373953_0221067
1461 Ga0373954_0175009
1462 Ga0373956_0165388
1463 Ga0373957_0132118
1464 Ga0373943_0011201
1465 Ga0373946_0008234
1466 Ga0373946_0389702
1467 Ga0373961_0278568
1468 Ga0373962_0020002
1469 Ga0373924_0009510
1470 Ga0373927_0078320
1471 Ga0373927_0791877
1472 Ga0373933_0213415
1473 Ga0373947_0009312
1474 Ga0373947_0605934
1475 Ga0373937_0224127
1476 Ga0373937_0239021
1477 Ga0373925_0011544
1478 Ga0395901_1516583
1479 Ga0436365_0592924
1480 Ga0439436_0086212
1481 Ga0439453_0002672
1482 Ga0451835_0093829
1483 Ga0451853_2008618
1484 Ga0439454_034223
1485 Ga0439446_0113930
1486 Ga0439435_0144210
1487 Ga0439444_0138595
1488 Ga0439464_0082464
1489 Ga0439464_0085329
1490 Ga0439460_0044318
1491 Ga0495592_0049540
1492 Ga0495580_0142027
1493 Ga0495580_0287862
1494 Ga0495580_0529072
1495 Ga0495580_0947371
1496 Ga0495582_0455115
1497 Ga0495608_0013627
1498 Ga0495628_0078101
1499 Ga0495628_0092475
1500 Ga0495630_0033831
1501 Ga0495643_0003101
1502 Ga0495643_0007021
1503 Ga0495652_0173494
1504 Ga0495665_0493918
1505 Ga0495640_0211220
1506 Ga0495587_0024556
1507 Ga0495621_0097546
1508 Ga0495645_0166367
1509 Ga0495633_0058439
1510 Ga0495633_0346099
1511 Ga0495667_0262030
1512 Ga0495656_0558531
1513 Ga0495656_0664603
1514 Ga0495634_0290847
1515 Ga0495588_0263264
1516 Ga0495657_0122994
1517 Ga0495646_0142664
1518 Ga0495647_0033858
1519 Ga0495647_0043992
1520 Ga0495658_0044788
1521 Ga0495658_0255607
1522 Ga0495669_0040396
1523 Ga0495613_0000790
1524 Ga0495670_0376829
1525 Ga0495600_0250911
1526 Ga0495581_0276933
1527 Ga0495581_0328006
1528 Ga0495604_0453721
1529 Ga0495636_0295377
1530 Ga0495674_0048220
1531 Ga0495674_0364170
1532 Ga0495676_0912063
1533 Ga0495680_0466678
1534 Ga0495675_0258281
1535 Ga0495684_0000697
1536 Ga0495602_0440181
1537 Ga0496100_0003342
1538 Ga0496100_0433312
1539 Ga0496101_0000660
1540 Ga0496102_0273024
1541 Ga0496102_1749171
1542 Ga0496104_0510933
1543 Ga0496105_0229662
1544 Ga0496106_0035903
1545 Ga0496106_0207999
1546 Ga0496107_0612781
1547 Ga0496108_0586930
1548 Ga0496108_0923420
1549 Ga0496109_0126303
1550 Ga0496109_0126652
1551 Ga0496109_0231072
1552 Ga0496110_0579920
1553 Ga0496113_0227788
1554 Ga0496114_0000409
1555 Ga0496114_0322951
1556 Ga0501308_025804
1557 Ga0501308_035943
1558 Ga0501308_047531
1559 Ga0501308_070606
1560 Ga0501309_076386
1561 Ga0501309_099240
1562 Ga0501310_028854
1563 Ga0501305_019899
1564 Ga0501305_071091
1565 Ga0501307_091405
1566 Ga0501311_018930
1567 Ga0501311_098827
1568 Ga0501311_105359
1569 Ga0501312_032754
1570 Ga0501313_050999
1571 Ga0501314_041595
1572 Ga0501315_077919
1573 Ga0501316_080964
1574 Ga0501317_084112
1575 Ga0501320_069639
1576 Ga0501031_0982666
1577 Ga0501033_0220332
1578 Ga0501036_1266168
1579 Ga0501039_0094607
1580 Ga0501040_0029386
1581 Ga0501040_0290299
1582 Ga0501042_0026619
1583 Ga0501046_0913457
1584 Ga0501068_0270890
1585 Ga0501071_0123927
1586 Ga0501071_0616179
1587 Ga0501073_0649364
1588 Ga0501074_0357905
1589 Ga0501075_0051252
1590 Ga0501075_0203823
1591 Ga0501075_0578138
1592 Ga0501076_0690170
1593 Ga0501076_0778170
1594 Ga0501079_0787633
1595 Ga0501079_0807239
1596 Ga0501079_1247548
1597 Ga0501079_1272131
1598 Ga0501080_0672587
1599 Ga0501080_1841595
1600 Ga0501081_0035653
1601 Ga0501081_0498126
1602 Ga0501035_1154597
1603 Ga0501045_0104482
1604 nmdc:mga05p37_117687_c1
1605 nmdc:mga05p37_19854_c1
1606 nmdc:mga05p37_49082_c1
1607 nmdc:mga09592_139459_c1
1608 nmdc:mga09592_142615_c1
1609 nmdc:mga09592_340389_c1
1610 nmdc:mga09592_396027_c1
1611 nmdc:mga09592_74566_c1
1612 nmdc:mga09592_846_c1
1613 nmdc:mga0qj67_136564_c1
1614 nmdc:mga0qj67_137991_c1
1615 nmdc:mga0qj67_9598_c1
1616 nmdc:mga06r32_1315493_c1
1617 nmdc:mga06r32_2905_c1
1618 nmdc:mga06r32_373624_c1
1619 nmdc:mga06r32_39065_c1
1620 nmdc:mga06r32_60325_c1
1621 nmdc:mga08y16_1485269_c1
1622 nmdc:mga08y16_1867064_c1
1623 nmdc:mga08y16_2011487_c1
1624 nmdc:mga08y16_30452_c1
1625 nmdc:mga08y16_40972_c1
1626 nmdc:mga08y16_479493_c1
1627 nmdc:mga08y16_539922_c1
1628 nmdc:mga08y16_633_c1
1629 nmdc:mga08y16_6429_c1
1630 nmdc:mga0rr50_50168_c1
1631 nmdc:mga08x19_650164_c1
1632 nmdc:mga08x19_772985_c1
1633 nmdc:mga0a205_260959_c1
1634 nmdc:mga0a205_81787_c1
1635 nmdc:mga0a205_9233_c1
1636 Ga0495601_0123718
1637 Ga0495612_0073802
1638 Ga0495595_0044489
1639 Ga0495595_0117905
1640 Ga0495619_0003275
1641 Ga0495619_0552065
1642 Ga0501084_0008598
1643 Ga0501084_0463183
1644 Ga0590075_129046
1645 Ga0587084_045894
1646 Ga0587066_065413
1647 Ga0587066_080622
1648 Ga0587070_097305
1649 Ga0587073_0062478
1650 Ga0587077_128274
1651 Ga0587077_222994
1652 Ga0587080_063049
1653 Ga0587082_055398
1654 Ga0587082_059561
1655 Ga0587083_0131972
1656 Ga0587085_038277
1657 Ga0587085_089006
1658 Ga0587085_171837
1659 Ga0587090_055536
1660 Ga0587091_074401
1661 Ga0587092_052880
1662 Ga0587092_066559
1663 Ga0587094_061503
1664 Ga0587125_036131
1665 Ga0587101_002563
1666 Ga0587101_042625
1667 Ga0587101_063952
1668 Ga0587115_032401
1669 Ga0587115_057822
1670 Ga0587130_042373
1671 Ga0587062_053577
1672 Ga0587067_091741
1673 Ga0587068_058512
1674 Ga0587072_065690
1675 Ga0587072_156616
1676 Ga0587075_038076
1677 Ga0587100_015058
1678 Ga0587102_030159
1679 Ga0587107_065921
1680 Ga0587071_067690
1681 Ga0587111_0044458
1682 Ga0587111_0113504
1683 Ga0501082_0106233
1684 Ga0530510_0414040

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

7

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l8k-assembly1.cif.gz_A t cell protein-tyrosine phosphatase structure 0.8174 43 73
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.8033 35 121
3amt-assembly1.cif.gz_A crystal structure of the tias-trna(ile2)-atp complex 0.7888 32 121
2b49-assembly1.cif.gz_A crystal structure of the catalytic domain of protein tyrosine phosphatase, non-receptor type 3 0.787 43 73
3i36-assembly1.cif.gz_A crystal structure of rat protein tyrosine phosphatase eta catalytic domain 0.786 43 73
ID Description Score Start End Superfamily
af_Q9W0G1_13_309_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8564 43 73 3.90.190.10
af_Q64512_2131_2444_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8486 43 73 3.90.190.10
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8058 37 97 2.40.50.140
af_O44548_20_108_2.60.40.1910 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7867 41 72 2.60.40.1910
af_A0A486WUL5_1_92_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.784 30 71 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A2V8NP93-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.967 23 130
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9654 31 129
AF-A0A2V8NMZ2-F1-model_v4 DUF5666 domain-containing protein 0.964 24 130 GO:0016020
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9608 32 130
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9585 31 129

Map