F482975

General Info

Members Datasets Scaffolds Average Seq Length
838 382 813 212

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10239976|Ga0068866_102399762
Length 236
Sequence VKCLSNHSQARVHASKYLFLILKPMEAEKILIAIVDDHTLFRNGVAGLMSEFNELKVVFEAENGQQMQYALEKHQLPQVILMDINMPVMDGYDATCWLKKNYPQIRVLALSMFEDDKAVIKMIKCGASGYVLKESRPKDLLEAIKTIHTKGVYINELVSGKLIRSVADDDAPDFTKKELEFLKLCCSELTYKEIADKMFVSPRTVDNYREALFLKLNLKSRTGLVLYAIQNQVFTF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2739367663 Pedobacter sp. YR510 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
11 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
18 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
19 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
20 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
21 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
22 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
23 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
24 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
25 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
26 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
30 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
230 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
231 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
232 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
261 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
262 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
270 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
271 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
274 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
297 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
298 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
318 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
319 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
320 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
321 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
322 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
323 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
327 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
328 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
329 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
330 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
331 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
332 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
333 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
334 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
335 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
336 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
337 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
338 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
339 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
340 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
341 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
342 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
343 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
344 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
345 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
346 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
347 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
348 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
352 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
362 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
363 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
364 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
365 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
366 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
369 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
370 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
375 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
380 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
381 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.12
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.35
Nodule 0
Rhizoplane 0.24
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8140190 2162886012 Unclassified 1396
2 MBSR1b_contig_8930577 2162886012 Bacteria 1898
3 JGI24737J22298_10000227 3300001990 Bacteria 18576
4 JGI24735J21928_10000002 3300002067 Bacteria 624895
5 JGI24744J21845_10020228 3300002077 Bacteria 1314
6 JGI24751J29686_10000015 3300002459 Bacteria 112804
7 JGI25162J39368_1000435 3300002737 Bacteria 33619
8 JGI25157J39369_1009630 3300002741 Bacteria 1294
9 JGI25164J39214_1001884 3300002772 Bacteria 3919
10 JGI25152J39213_1000054 3300002773 Bacteria 76796
11 JGI25150J39212_1000003 3300002774 Bacteria 508651
12 JGI25151J46595_10000002 3300003187 Bacteria 731381
13 JGI25165J46597_1001213 3300003214 Bacteria 15503
14 JGI25153J46596_10000015 3300003215 Bacteria 289820
15 rootH1_10045344 3300003316 Bacteria 1121
16 rootH1_10048329 3300003316 Bacteria 6986
17 rootH1_10057924 3300003316 Bacteria 15146
18 rootH1_10061801 3300003316 Bacteria 3597
19 rootH1_10061802 3300003316 Bacteria 3080
20 rootH1_10061802 3300003323 Bacteria 2799
21 rootH2_10001274 3300003320 Bacteria 94480
22 rootH2_10006602 3300003320 Bacteria 39003
23 rootH2_10035936 3300003320 Bacteria 8028
24 rootH2_10057451 3300003320 Bacteria 8559
25 rootL2_10030820 3300003322 Bacteria 3992
26 rootL2_10063246 3300003322 Bacteria 7963
27 rootL2_10178833 3300003322 Unclassified 2553
28 rootL2_10224865 3300003322 Bacteria 3358
29 rootL2_10306079 3300003322 Bacteria 1618
30 rootL2_10314446 3300003322 Unclassified 1255
31 rootH1_10003362 3300003323 Bacteria 34489
32 rootH1_10036959 3300003323 Bacteria 3914
33 rootH1_10168090 3300003323 Bacteria 4886
34 rootH1_10233864 3300003323 Bacteria 3550
35 rootH1_10326186 3300003323 Bacteria 2400
36 Ga0055536_1000006 3300003781 Bacteria 347733
37 Ga0055530_10002643 3300003791 Bacteria 11212
38 Ga0065714_10002307 3300005288 Bacteria 26043
39 Ga0065714_10021495 3300005288 Bacteria 1078
40 Ga0065714_10073449 3300005288 Bacteria 3182
41 Ga0065714_10074001 3300005288 Bacteria 3097
42 Ga0065714_10083206 3300005288 Bacteria 2263
43 Ga0065714_10090585 3300005288 Unclassified 1939
44 Ga0065714_10124708 3300005288 Bacteria 1301
45 Ga0065714_10137475 3300005288 Bacteria 1197
46 Ga0065714_10220103 3300005288 Bacteria 838
47 Ga0065704_10139651 3300005289 Unclassified 1531
48 Ga0065712_10000430 3300005290 Bacteria 12470
49 Ga0065712_10083690 3300005290 Unclassified 2817
50 Ga0065712_10258451 3300005290 Bacteria 943
51 Ga0065715_10001577 3300005293 Bacteria 6228
52 Ga0065715_10119205 3300005293 Bacteria 2293
53 Ga0070658_10000056 3300005327 Bacteria 114761
54 Ga0070658_10149113 3300005327 Bacteria 1957
55 Ga0070676_10000483 3300005328 Bacteria 18990
56 Ga0070676_10286193 3300005328 Bacteria 1112
57 Ga0070683_100012300 3300005329 Bacteria 7434
58 Ga0070670_100000206 3300005331 Bacteria 54782
59 Ga0070670_100067827 3300005331 Bacteria 3060
60 Ga0070670_100149166 3300005331 Bacteria 2024
61 Ga0070670_100167608 3300005331 Bacteria 1905
62 Ga0068869_100035489 3300005334 Bacteria 3533
63 Ga0068869_100245099 3300005334 Bacteria 1429
64 Ga0068869_100482176 3300005334 Unclassified 1033
65 Ga0070666_10026629 3300005335 Unclassified 3781
66 Ga0070682_100000128 3300005337 Bacteria 65176
67 Ga0070682_100009239 3300005337 Bacteria 5576
68 Ga0070682_100608284 3300005337 Bacteria 864
69 Ga0070682_100753470 3300005337 Bacteria 786
70 Ga0068868_100083750 3300005338 Bacteria 2561
71 Ga0068868_100934516 3300005338 Unclassified 790
72 Ga0070660_100270344 3300005339 Bacteria 1389
73 Ga0070660_101018209 3300005339 Unclassified 700
74 Ga0070689_100000319 3300005340 Bacteria 28095
75 Ga0070689_100051404 3300005340 Bacteria 3186
76 Ga0070689_100436969 3300005340 Bacteria 1111
77 Ga0070691_10022586 3300005341 Bacteria 2919
78 Ga0070692_10006967 3300005345 Bacteria 4948
79 Ga0070692_10218559 3300005345 Unclassified 1125
80 Ga0070668_100013323 3300005347 Bacteria 6137
81 Ga0070668_100184533 3300005347 Unclassified 1706
82 Ga0070669_100000934 3300005353 Bacteria 21298
83 Ga0070669_100102259 3300005353 Bacteria 2163
84 Ga0070675_100021516 3300005354 Bacteria 5155
85 Ga0070674_100038925 3300005356 Unclassified 3208
86 Ga0070673_100006813 3300005364 Bacteria 7463
87 Ga0070673_100014069 3300005364 Bacteria 5558
88 Ga0070688_100000510 3300005365 Bacteria 19613
89 Ga0070659_100018458 3300005366 Bacteria 5265
90 Ga0070667_100138613 3300005367 Bacteria 2128
91 Ga0070667_100143851 3300005367 Unclassified 2090
92 Ga0070703_10009040 3300005406 Bacteria 2809
93 Ga0070701_10077074 3300005438 Unclassified 1796
94 Ga0070701_10170658 3300005438 Bacteria 1266
95 Ga0070701_10397679 3300005438 Bacteria 872
96 Ga0070705_100127967 3300005440 Bacteria 1652
97 Ga0070700_100002107 3300005441 Bacteria 10105
98 Ga0070700_100018150 3300005441 Bacteria 4040
99 Ga0070700_100037482 3300005441 Bacteria 2949
100 Ga0070700_100421096 3300005441 Bacteria 1009
101 Ga0070694_100003543 3300005444 Bacteria 9334
102 Ga0070694_100011567 3300005444 Bacteria 5465
103 Ga0070694_100094247 3300005444 Bacteria 2106
104 Ga0070694_100213837 3300005444 Bacteria 1443
105 Ga0070678_100010530 3300005456 Bacteria 5657
106 Ga0070678_100330095 3300005456 Bacteria 1305
107 Ga0070678_100489903 3300005456 Unclassified 1083
108 Ga0070662_100008951 3300005457 Bacteria 6525
109 Ga0068867_100007419 3300005459 Bacteria 7755
110 Ga0068867_100019363 3300005459 Bacteria 4851
111 Ga0068867_100036014 3300005459 Bacteria 3590
112 Ga0068867_100167260 3300005459 Bacteria 1739
113 Ga0068867_100250559 3300005459 Unclassified 1440
114 Ga0070706_100008371 3300005467 Bacteria 9639
115 Ga0070707_100232970 3300005468 Bacteria 1792
116 Ga0070698_100013520 3300005471 Bacteria 8640
117 Ga0070698_100345486 3300005471 Bacteria 1419
118 Ga0070699_100505253 3300005518 Bacteria 1098
119 Ga0070699_101005853 3300005518 Bacteria 764
120 Ga0070684_100011435 3300005535 Bacteria 7073
121 Ga0070697_100262071 3300005536 Bacteria 1480
122 Ga0068853_100001211 3300005539 Bacteria 18396
123 Ga0068853_100046310 3300005539 Bacteria 3729
124 Ga0068853_100057054 3300005539 Bacteria 3369
125 Ga0068853_100087140 3300005539 Bacteria 2739
126 Ga0068853_100139477 3300005539 Bacteria 2176
127 Ga0068853_100142365 3300005539 Bacteria 2153
128 Ga0068853_100202548 3300005539 Unclassified 1806
129 Ga0068853_100225771 3300005539 Bacteria 1712
130 Ga0068853_100251343 3300005539 Bacteria 1622
131 Ga0068853_100531961 3300005539 Bacteria 1112
132 Ga0070672_100033374 3300005543 Bacteria 3898
133 Ga0070672_100229535 3300005543 Bacteria 1559
134 Ga0070672_100392553 3300005543 Bacteria 1188
135 Ga0070686_100149774 3300005544 Bacteria 1633
136 Ga0070695_100023844 3300005545 Bacteria 3767
137 Ga0070695_100158146 3300005545 Bacteria 1588
138 Ga0070693_100003801 3300005547 Bacteria 7069
139 Ga0070693_100018920 3300005547 Bacteria 3603
140 Ga0070693_100089584 3300005547 Unclassified 1852
141 Ga0070665_100000002 3300005548 Bacteria 849037
142 Ga0070665_100000034 3300005548 Bacteria 324289
143 Ga0070704_100398569 3300005549 Bacteria 1174
144 Ga0070704_100416530 3300005549 Bacteria 1150
145 Ga0068855_100000302 3300005563 Bacteria 61501
146 Ga0068855_100000303 3300005563 Bacteria 61260
147 Ga0068855_100000611 3300005563 Bacteria 43912
148 Ga0068855_100004987 3300005563 Bacteria 16203
149 Ga0068855_100012990 3300005563 Bacteria 10049
150 Ga0068855_100013791 3300005563 Bacteria 9743
151 Ga0068855_100015293 3300005563 Bacteria 9238
152 Ga0068855_100025300 3300005563 Bacteria 7104
153 Ga0068855_100043825 3300005563 Bacteria 5297
154 Ga0068855_100857549 3300005563 Bacteria 962
155 Ga0070664_100166444 3300005564 Unclassified 1953
156 Ga0068857_100014797 3300005577 Bacteria 6806
157 Ga0068857_100061189 3300005577 Bacteria 3345
158 Ga0068857_100143380 3300005577 Unclassified 2160
159 Ga0068857_100365774 3300005577 Unclassified 1337
160 Ga0068857_100440878 3300005577 Bacteria 1216
161 Ga0068857_100822224 3300005577 Unclassified 888
162 Ga0068854_100057157 3300005578 Bacteria 2814
163 Ga0068854_100178575 3300005578 Bacteria 1657
164 Ga0068856_100000031 3300005614 Bacteria 126668
165 Ga0068856_100007747 3300005614 Bacteria 10489
166 Ga0068856_100072206 3300005614 Bacteria 3417
167 Ga0068856_100086138 3300005614 Bacteria 3121
168 Ga0070702_100086190 3300005615 Bacteria 1894
169 Ga0068852_100002788 3300005616 Bacteria 12103
170 Ga0068852_100006666 3300005616 Bacteria 8369
171 Ga0068852_100601218 3300005616 Unclassified 1104
172 Ga0068859_100013226 3300005617 Bacteria 8280
173 Ga0068859_100015073 3300005617 Bacteria 7760
174 Ga0068859_100111574 3300005617 Bacteria 2797
175 Ga0068859_100138046 3300005617 Bacteria 2511
176 Ga0068859_100168938 3300005617 Unclassified 2268
177 Ga0068864_100005575 3300005618 Bacteria 10321
178 Ga0068864_100011191 3300005618 Bacteria 7415
179 Ga0068864_100031988 3300005618 Bacteria 4466
180 Ga0068864_100378890 3300005618 Bacteria 1340
181 Ga0068866_10022755 3300005718 Bacteria 2905
182 Ga0068866_10087895 3300005718 Bacteria 1685
183 Ga0068866_10239976 3300005718 Bacteria 1103
184 Ga0068861_100004638 3300005719 Bacteria 9225
185 Ga0068861_100005935 3300005719 Bacteria 8297
186 Ga0068861_100083919 3300005719 Unclassified 2500
187 Ga0068851_10002933 3300005834 Bacteria 7538
188 Ga0068851_10342556 3300005834 Bacteria 868
189 Ga0068870_10015867 3300005840 Unclassified 3585
190 Ga0068870_10023032 3300005840 Bacteria 3066
191 Ga0068863_100343107 3300005841 Bacteria 1453
192 Ga0068858_100037895 3300005842 Bacteria 4471
193 Ga0068860_100000003 3300005843 Bacteria 575741
194 Ga0068860_100000991 3300005843 Bacteria 31410
195 Ga0068860_100014093 3300005843 Bacteria 7843
196 Ga0068860_100040178 3300005843 Bacteria 4473
197 Ga0068860_100130922 3300005843 Bacteria 2407
198 Ga0068860_100219588 3300005843 Unclassified 1846
199 Ga0068860_100308835 3300005843 Unclassified 1550
200 Ga0068860_100484107 3300005843 Unclassified 1234
201 Ga0068860_100899216 3300005843 Bacteria 901
202 Ga0068862_100072224 3300005844 Bacteria 2980
203 Ga0068862_100913420 3300005844 Unclassified 864
204 Ga0081540_1006723 3300005983 Bacteria 8316
205 Ga0075366_10011521 3300006195 Bacteria 4993
206 Ga0075366_10012650 3300006195 Bacteria 4792
207 Ga0075366_10014933 3300006195 Bacteria 4441
208 Ga0075366_10101845 3300006195 Bacteria 1724
209 Ga0075366_10174290 3300006195 Bacteria 1305
210 Ga0097621_100002837 3300006237 Bacteria 11885
211 Ga0097621_100445918 3300006237 Bacteria 1165
212 Ga0068871_100000482 3300006358 Bacteria 27275
213 Ga0068871_100218305 3300006358 Unclassified 1651
214 Ga0068871_100246069 3300006358 Bacteria 1556
215 Ga0068871_100349861 3300006358 Bacteria 1307
216 Ga0068871_100812944 3300006358 Unclassified 862
217 Ga0075428_100030804 3300006844 Bacteria 5932
218 Ga0075431_100541691 3300006847 Bacteria 1152
219 Ga0075433_10022890 3300006852 Bacteria 5251
220 Ga0075433_10047752 3300006852 Bacteria 3723
221 Ga0075434_100036829 3300006871 Bacteria 4839
222 Ga0075434_100048996 3300006871 Unclassified 4192
223 Ga0075429_100468412 3300006880 Bacteria 1104
224 Ga0068865_100000055 3300006881 Bacteria 62584
225 Ga0097620_100013226 3300006931 Bacteria 8280
226 Ga0097620_100015073 3300006931 Bacteria 7760
227 Ga0097620_100111571 3300006931 Bacteria 2797
228 Ga0097620_100138049 3300006931 Bacteria 2511
229 Ga0097620_100168944 3300006931 Unclassified 2268
230 Ga0105244_10041432 3300009036 Bacteria 2386
231 Ga0105240_10002527 3300009093 Bacteria 29369
232 Ga0105240_10004693 3300009093 Bacteria 20655
233 Ga0105240_10004802 3300009093 Bacteria 20368
234 Ga0105240_10006961 3300009093 Bacteria 16518
235 Ga0105240_10009628 3300009093 Bacteria 13666
236 Ga0105240_10021720 3300009093 Bacteria 8531
237 Ga0105240_10046065 3300009093 Bacteria 5528
238 Ga0105240_10046113 3300009093 Bacteria 5524
239 Ga0105240_10098107 3300009093 Bacteria 3569
240 Ga0105240_10202882 3300009093 Bacteria 2323
241 Ga0105240_10237008 3300009093 Unclassified 2117
242 Ga0105240_10293724 3300009093 Bacteria 1862
243 Ga0105240_10771533 3300009093 Bacteria 1044
244 Ga0111539_10000962 3300009094 Bacteria 37802
245 Ga0111539_10029922 3300009094 Bacteria 6624
246 Ga0105245_10218194 3300009098 Bacteria 1839
247 Ga0105245_10855581 3300009098 Bacteria 949
248 Ga0105247_10000681 3300009101 Bacteria 26876
249 Ga0105247_10386156 3300009101 Bacteria 994
250 Ga0105247_10406290 3300009101 Unclassified 972
251 Ga0114129_10004031 3300009147 Bacteria 20733
252 Ga0114129_10004843 3300009147 Bacteria 19010
253 Ga0114129_10081799 3300009147 Bacteria 4489
254 Ga0105243_10221755 3300009148 Bacteria 1672
255 Ga0105241_10000864 3300009174 Bacteria 22996
256 Ga0105241_10007631 3300009174 Bacteria 7952
257 Ga0105241_10019765 3300009174 Bacteria 4971
258 Ga0105241_10054759 3300009174 Bacteria 3055
259 Ga0105241_10182222 3300009174 Bacteria 1743
260 Ga0105241_10240211 3300009174 Bacteria 1531
261 Ga0105241_10265602 3300009174 Bacteria 1460
262 Ga0105241_10454451 3300009174 Bacteria 1134
263 Ga0105241_10704681 3300009174 Bacteria 922
264 Ga0105241_10892784 3300009174 Bacteria 825
265 Ga0105242_10152181 3300009176 Bacteria 2018
266 Ga0105242_10250210 3300009176 Bacteria 1597
267 Ga0105248_10068671 3300009177 Unclassified 3979
268 Ga0105248_10152124 3300009177 Bacteria 2611
269 Ga0105248_10170357 3300009177 Unclassified 2454
270 Ga0105248_10229317 3300009177 Bacteria 2091
271 Ga0105248_10516612 3300009177 Bacteria 1347
272 Ga0105237_10001160 3300009545 Bacteria 35249
273 Ga0105237_10001943 3300009545 Bacteria 26329
274 Ga0105237_10004982 3300009545 Bacteria 15141
275 Ga0105237_10007200 3300009545 Bacteria 12215
276 Ga0105237_10007849 3300009545 Bacteria 11633
277 Ga0105237_10011368 3300009545 Bacteria 9417
278 Ga0105237_10011870 3300009545 Bacteria 9211
279 Ga0105237_10015433 3300009545 Bacteria 7950
280 Ga0105237_10021202 3300009545 Bacteria 6683
281 Ga0105237_10022335 3300009545 Bacteria 6493
282 Ga0105237_10048443 3300009545 Unclassified 4271
283 Ga0105237_10136120 3300009545 Bacteria 2451
284 Ga0105237_10155572 3300009545 Bacteria 2283
285 Ga0105238_10000868 3300009551 Bacteria 31217
286 Ga0105238_10005073 3300009551 Bacteria 13016
287 Ga0105238_10010457 3300009551 Bacteria 9313
288 Ga0105238_10180359 3300009551 Unclassified 2089
289 Ga0105238_10303971 3300009551 Bacteria 1579
290 Ga0105249_10001842 3300009553 Bacteria 18441
291 Ga0105249_10040578 3300009553 Bacteria 4228
292 Ga0105249_10050948 3300009553 Bacteria 3775
293 Ga0105249_10710136 3300009553 Unclassified 1066
294 Ga0105239_10000252 3300010375 Bacteria 80006
295 Ga0105239_10004611 3300010375 Bacteria 16401
296 Ga0105239_10004643 3300010375 Bacteria 16327
297 Ga0105239_10008566 3300010375 Bacteria 11606
298 Ga0105239_10008890 3300010375 Bacteria 11370
299 Ga0105239_10011451 3300010375 Bacteria 9892
300 Ga0105239_10024239 3300010375 Bacteria 6683
301 Ga0105239_10034520 3300010375 Bacteria 5555
302 Ga0105239_10041186 3300010375 Bacteria 5062
303 Ga0105239_10042832 3300010375 Bacteria 4961
304 Ga0105239_10059111 3300010375 Unclassified 4207
305 Ga0105239_10341504 3300010375 Unclassified 1690
306 Ga0105239_10360348 3300010375 Bacteria 1642
307 Ga0105239_10576041 3300010375 Bacteria 1283
308 Ga0105239_10971625 3300010375 Bacteria 976
309 Ga0105246_10370339 3300011119 Bacteria 1180
310 Ga0157373_10008702 3300013100 Bacteria 7529
311 Ga0157373_10058910 3300013100 Bacteria 2722
312 Ga0157373_10138219 3300013100 Bacteria 1713
313 Ga0157371_10000117 3300013102 Bacteria 121069
314 Ga0157371_10083390 3300013102 Bacteria 2263
315 Ga0157371_10978574 3300013102 Unclassified 644
316 Ga0157370_10017786 3300013104 Bacteria 7165
317 Ga0157370_10025160 3300013104 Bacteria 5893
318 Ga0157370_10025999 3300013104 Bacteria 5784
319 Ga0157370_10034709 3300013104 Bacteria 4907
320 Ga0157370_10054701 3300013104 Bacteria 3804
321 Ga0157370_10071814 3300013104 Bacteria 3266
322 Ga0157370_10093547 3300013104 Bacteria 2821
323 Ga0157370_10234957 3300013104 Bacteria 1696
324 Ga0157370_10279282 3300013104 Bacteria 1543
325 Ga0157369_10000047 3300013105 Bacteria 172682
326 Ga0157369_10047681 3300013105 Bacteria 4650
327 Ga0157369_10396198 3300013105 Bacteria 1432
328 Ga0157369_10560879 3300013105 Bacteria 1180
329 Ga0157369_10686923 3300013105 Bacteria 1054
330 Ga0157374_10000013 3300013296 Bacteria 461240
331 Ga0157374_10047255 3300013296 Unclassified 3990
332 Ga0157374_10061346 3300013296 Bacteria 3521
333 Ga0157374_10188317 3300013296 Bacteria 2018
334 Ga0157374_10327344 3300013296 Bacteria 1519
335 Ga0157374_10428429 3300013296 Bacteria 1322
336 Ga0157374_11090840 3300013296 Bacteria 819
337 Ga0157378_10028393 3300013297 Bacteria 4936
338 Ga0157378_10031595 3300013297 Bacteria 4676
339 Ga0157378_10107670 3300013297 Unclassified 2551
340 Ga0157378_10150583 3300013297 Bacteria 2167
341 Ga0157378_10264970 3300013297 Unclassified 1650
342 Ga0157378_10477589 3300013297 Bacteria 1241
343 Ga0163162_10000018 3300013306 Bacteria 226257
344 Ga0163162_10000895 3300013306 Bacteria 27750
345 Ga0163162_10001007 3300013306 Bacteria 26190
346 Ga0163162_10007780 3300013306 Bacteria 10447
347 Ga0163162_10019918 3300013306 Bacteria 6589
348 Ga0163162_10147740 3300013306 Unclassified 2467
349 Ga0163162_10383957 3300013306 Bacteria 1538
350 Ga0163162_10739063 3300013306 Bacteria 1104
351 Ga0157372_10001233 3300013307 Bacteria 27695
352 Ga0157372_10005354 3300013307 Bacteria 13628
353 Ga0157372_10056004 3300013307 Unclassified 4405
354 Ga0157372_10076406 3300013307 Bacteria 3781
355 Ga0157372_10095920 3300013307 Bacteria 3379
356 Ga0157375_10008365 3300013308 Bacteria 9063
357 Ga0157375_10141294 3300013308 Bacteria 2535
358 Ga0157375_10172190 3300013308 Bacteria 2313
359 Ga0157375_10286114 3300013308 Bacteria 1811
360 Ga0163163_10000142 3300014325 Bacteria 74753
361 Ga0163163_10200401 3300014325 Bacteria 2044
362 Ga0163163_10205216 3300014325 Unclassified 2019
363 Ga0163163_10357950 3300014325 Bacteria 1516
364 Ga0163163_10506953 3300014325 Bacteria 1269
365 Ga0157380_10015109 3300014326 Bacteria 5666
366 Ga0157380_10045508 3300014326 Bacteria 3444
367 Ga0182008_10000914 3300014497 Bacteria 20553
368 Ga0157377_10029113 3300014745 Bacteria 2979
369 Ga0157377_10095423 3300014745 Bacteria 1763
370 Ga0157377_10374487 3300014745 Bacteria 962
371 Ga0157379_10079921 3300014968 Bacteria 2929
372 Ga0157379_10711937 3300014968 Unclassified 943
373 Ga0157376_10005733 3300014969 Bacteria 8696
374 Ga0182006_1000153 3300015261 Bacteria 73985
375 Ga0182006_1000287 3300015261 Bacteria 44409
376 Ga0182007_10000005 3300015262 Bacteria 442702
377 Ga0182005_1004167 3300015265 Unclassified 4726
378 Ga0183373_1002 3300015682 Bacteria 990153
379 Ga0163161_10001043 3300017792 Bacteria 21096
380 Ga0163161_10002412 3300017792 Bacteria 13408
381 Ga0163161_10002768 3300017792 Bacteria 12458
382 Ga0163161_10006203 3300017792 Bacteria 8284
383 Ga0163161_10166941 3300017792 Bacteria 1681
384 Ga0163161_10592064 3300017792 Bacteria 913
385 Ga0206352_11032327 3300020078 Unclassified 983
386 Ga0213872_10090057 3300021361 Bacteria 1373
387 Ga0213876_10002467 3300021384 Bacteria 10860
388 Ga0209436_102408 3300025208 Bacteria 5661
389 Ga0209563_104170 3300025230 Bacteria 2812
390 Ga0207427_101183 3300025231 Bacteria 10197
391 Ga0209437_100112 3300025233 Bacteria 214292
392 Ga0209258_105671 3300025242 Bacteria 2074
393 Ga0207425_1000003 3300025245 Bacteria 1145342
394 Ga0209646_1000615 3300025246 Bacteria 13711
395 Ga0209646_1001930 3300025246 Bacteria 5022
396 Ga0209026_1000549 3300025250 Bacteria 25871
397 Ga0209026_1009331 3300025250 Bacteria 1938
398 Ga0209129_1000014 3300025258 Bacteria 509018
399 Ga0209233_1000126 3300025261 Bacteria 214298
400 Ga0209233_1022574 3300025261 Bacteria 1608
401 Ga0209455_1003551 3300025272 Bacteria 5457
402 Ga0209676_1000039 3300025292 Bacteria 443158
403 Ga0209025_1000007 3300025294 Bacteria 1145109
404 Ga0209758_1000012 3300025297 Bacteria 949866
405 Ga0209050_1000033 3300025298 Bacteria 442615
406 Ga0207426_1002573 3300025302 Bacteria 11311
407 Ga0207697_10126376 3300025315 Unclassified 1103
408 Ga0207656_10005303 3300025321 Bacteria 4548
409 Ga0207653_10004534 3300025885 Bacteria 4353
410 Ga0207642_10050167 3300025899 Bacteria 1881
411 Ga0207710_10000858 3300025900 Bacteria 16391
412 Ga0207688_10137064 3300025901 Bacteria 1438
413 Ga0207680_10032116 3300025903 Unclassified 2981
414 Ga0207647_10031630 3300025904 Bacteria 3404
415 Ga0207647_10177606 3300025904 Unclassified 1238
416 Ga0207647_10317244 3300025904 Unclassified 885
417 Ga0207647_10344552 3300025904 Bacteria 844
418 Ga0207647_10426471 3300025904 Unclassified 745
419 Ga0207699_10328991 3300025906 Bacteria 1074
420 Ga0207645_10000056 3300025907 Bacteria 80880
421 Ga0207645_10420145 3300025907 Unclassified 901
422 Ga0207643_10014568 3300025908 Bacteria 4274
423 Ga0207643_10020936 3300025908 Bacteria 3590
424 Ga0207705_10000028 3300025909 Bacteria 240636
425 Ga0207705_10052660 3300025909 Bacteria 2931
426 Ga0207684_10100971 3300025910 Bacteria 2466
427 Ga0207654_10015752 3300025911 Bacteria 3929
428 Ga0207654_10037185 3300025911 Unclassified 2723
429 Ga0207654_10046925 3300025911 Bacteria 2466
430 Ga0207654_10054537 3300025911 Bacteria 2310
431 Ga0207654_10276514 3300025911 Bacteria 1134
432 Ga0207654_10386451 3300025911 Bacteria 970
433 Ga0207695_10000051 3300025913 Bacteria 399641
434 Ga0207695_10000056 3300025913 Bacteria 382433
435 Ga0207695_10000066 3300025913 Bacteria 334103
436 Ga0207695_10000081 3300025913 Bacteria 284797
437 Ga0207695_10000156 3300025913 Bacteria 204576
438 Ga0207695_10002773 3300025913 Bacteria 25522
439 Ga0207695_10015983 3300025913 Bacteria 8809
440 Ga0207695_10017121 3300025913 Bacteria 8449
441 Ga0207695_10019732 3300025913 Bacteria 7750
442 Ga0207695_10155221 3300025913 Bacteria 2224
443 Ga0207695_10159941 3300025913 Unclassified 2184
444 Ga0207695_10167303 3300025913 Bacteria 2126
445 Ga0207695_10187302 3300025913 Bacteria 1988
446 Ga0207671_10001813 3300025914 Bacteria 23849
447 Ga0207671_10001925 3300025914 Bacteria 23035
448 Ga0207671_10002777 3300025914 Bacteria 18271
449 Ga0207671_10003734 3300025914 Bacteria 15006
450 Ga0207671_10007568 3300025914 Bacteria 9405
451 Ga0207671_10009812 3300025914 Bacteria 7966
452 Ga0207671_10011422 3300025914 Bacteria 7233
453 Ga0207671_10012550 3300025914 Bacteria 6804
454 Ga0207671_10014922 3300025914 Bacteria 6109
455 Ga0207671_10019257 3300025914 Bacteria 5222
456 Ga0207671_10177474 3300025914 Bacteria 1656
457 Ga0207671_10571631 3300025914 Unclassified 901
458 Ga0207662_10516042 3300025918 Bacteria 824
459 Ga0207657_10122884 3300025919 Bacteria 2135
460 Ga0207657_10264322 3300025919 Bacteria 1369
461 Ga0207646_10227045 3300025922 Bacteria 1687
462 Ga0207681_10012023 3300025923 Bacteria 5332
463 Ga0207681_10016048 3300025923 Bacteria 4677
464 Ga0207694_10002363 3300025924 Bacteria 15426
465 Ga0207694_10104418 3300025924 Unclassified 2248
466 Ga0207694_10124867 3300025924 Unclassified 2058
467 Ga0207650_10000017 3300025925 Bacteria 354674
468 Ga0207650_10115834 3300025925 Bacteria 2080
469 Ga0207650_10245444 3300025925 Bacteria 1448
470 Ga0207659_10377078 3300025926 Bacteria 1182
471 Ga0207687_10218090 3300025927 Bacteria 1500
472 Ga0207690_10000123 3300025932 Bacteria 64409
473 Ga0207706_10018091 3300025933 Bacteria 6341
474 Ga0207686_10050235 3300025934 Bacteria 2592
475 Ga0207709_10145319 3300025935 Bacteria 1636
476 Ga0207670_10002115 3300025936 Bacteria 10383
477 Ga0207670_10072836 3300025936 Unclassified 2380
478 Ga0207670_10187541 3300025936 Unclassified 1562
479 Ga0207669_10185910 3300025937 Bacteria 1494
480 Ga0207669_10250083 3300025937 Bacteria 1319
481 Ga0207704_10000229 3300025938 Bacteria 27868
482 Ga0207704_10611016 3300025938 Unclassified 894
483 Ga0207691_10200507 3300025940 Unclassified 1737
484 Ga0207691_10406044 3300025940 Bacteria 1162
485 Ga0207711_10020898 3300025941 Bacteria 5464
486 Ga0207711_10065685 3300025941 Bacteria 3136
487 Ga0207689_10041358 3300025942 Bacteria 3814
488 Ga0207689_10590122 3300025942 Unclassified 934
489 Ga0207689_10921964 3300025942 Bacteria 737
490 Ga0207661_10008165 3300025944 Bacteria 7472
491 Ga0207667_10000477 3300025949 Bacteria 53347
492 Ga0207667_10000713 3300025949 Bacteria 43129
493 Ga0207667_10001082 3300025949 Bacteria 34557
494 Ga0207667_10005555 3300025949 Bacteria 15386
495 Ga0207667_10012719 3300025949 Bacteria 9667
496 Ga0207667_10014605 3300025949 Bacteria 8943
497 Ga0207667_10058197 3300025949 Bacteria 4055
498 Ga0207667_10065263 3300025949 Bacteria 3798
499 Ga0207651_10058557 3300025960 Unclassified 2663
500 Ga0207651_10128212 3300025960 Bacteria 1937
501 Ga0207712_10001192 3300025961 Bacteria 17973
502 Ga0207712_10065778 3300025961 Bacteria 2589
503 Ga0207712_10132384 3300025961 Bacteria 1902
504 Ga0207712_10427477 3300025961 Bacteria 1119
505 Ga0207640_10101047 3300025981 Bacteria 2022
506 Ga0207658_10034061 3300025986 Bacteria 3637
507 Ga0207677_10046290 3300026023 Bacteria 2912
508 Ga0207677_10615541 3300026023 Unclassified 954
509 Ga0207703_10059644 3300026035 Bacteria 3117
510 Ga0207703_10064094 3300026035 Bacteria 3015
511 Ga0207703_10429930 3300026035 Bacteria 1230
512 Ga0207639_10002473 3300026041 Bacteria 12387
513 Ga0207639_10028495 3300026041 Bacteria 4078
514 Ga0207639_10054131 3300026041 Unclassified 3066
515 Ga0207639_10099176 3300026041 Bacteria 2350
516 Ga0207639_10118262 3300026041 Bacteria 2173
517 Ga0207639_10132143 3300026041 Bacteria 2068
518 Ga0207639_10135240 3300026041 Bacteria 2046
519 Ga0207639_10575402 3300026041 Bacteria 1036
520 Ga0207639_10647771 3300026041 Bacteria 977
521 Ga0207708_10013257 3300026075 Bacteria 6155
522 Ga0207708_10013431 3300026075 Bacteria 6122
523 Ga0207708_10391037 3300026075 Bacteria 1148
524 Ga0207708_10993140 3300026075 Unclassified 729
525 Ga0207702_10000071 3300026078 Bacteria 114394
526 Ga0207702_10038000 3300026078 Bacteria 4032
527 Ga0207702_10262543 3300026078 Bacteria 1627
528 Ga0207702_10386946 3300026078 Bacteria 1346
529 Ga0207702_11057425 3300026078 Bacteria 805
530 Ga0207648_10004742 3300026089 Bacteria 13897
531 Ga0207648_10022019 3300026089 Bacteria 5725
532 Ga0207648_10033398 3300026089 Unclassified 4538
533 Ga0207648_10073185 3300026089 Bacteria 2987
534 Ga0207648_10297207 3300026089 Unclassified 1447
535 Ga0207676_10009550 3300026095 Bacteria 6906
536 Ga0207676_10401166 3300026095 Unclassified 1281
537 Ga0207674_10003327 3300026116 Bacteria 19761
538 Ga0207674_10009705 3300026116 Bacteria 10971
539 Ga0207674_10041071 3300026116 Bacteria 4786
540 Ga0207674_10082730 3300026116 Bacteria 3210
541 Ga0207674_10436689 3300026116 Bacteria 1265
542 Ga0207675_100000260 3300026118 Bacteria 50253
543 Ga0207675_100012852 3300026118 Bacteria 7819
544 Ga0207675_100049719 3300026118 Bacteria 3912
545 Ga0207675_100144993 3300026118 Bacteria 2257
546 Ga0207675_100461562 3300026118 Bacteria 1260
547 Ga0207683_10005938 3300026121 Bacteria 10467
548 Ga0207683_10365918 3300026121 Bacteria 1324
549 Ga0207698_10015082 3300026142 Bacteria 5164
550 Ga0207428_10241999 3300027907 Bacteria 1348
551 Ga0268266_10000073 3300028379 Bacteria 232074
552 Ga0268266_10000119 3300028379 Bacteria 162424
553 Ga0268265_10013170 3300028380 Bacteria 5619
554 Ga0268265_11207261 3300028380 Bacteria 754
555 Ga0268264_10000063 3300028381 Bacteria 301702
556 Ga0268264_10006772 3300028381 Bacteria 9624
557 Ga0268264_10015719 3300028381 Bacteria 6199
558 Ga0268264_10025073 3300028381 Bacteria 4873
559 Ga0268264_10032633 3300028381 Bacteria 4273
560 Ga0268264_10085953 3300028381 Bacteria 2701
561 Ga0307517_10002971 3300028786 Bacteria 26793
562 Ga0307515_10001098 3300028794 Bacteria 62024
563 Ga0307515_10004758 3300028794 Bacteria 27824
564 Ga0307515_10006567 3300028794 Bacteria 23231
565 Ga0307515_10011347 3300028794 Bacteria 16910
566 Ga0265324_10106507 3300029957 Unclassified 952
567 Ga0307511_10000232 3300030521 Bacteria 56875
568 Ga0307512_10156020 3300030522 Bacteria 1351
569 Ga0316181_1166948 3300030744 Bacteria 1694
570 Ga0265327_10164210 3300031251 Bacteria 1024
571 Ga0307513_10103824 3300031456 Bacteria 2858
572 Ga0307513_10155986 3300031456 Bacteria 2183
573 Ga0307513_10207758 3300031456 Bacteria 1792
574 Ga0307513_10283975 3300031456 Bacteria 1431
575 Ga0307513_10448906 3300031456 Bacteria 1014
576 Ga0307509_10103378 3300031507 Bacteria 2877
577 Ga0307509_10137330 3300031507 Bacteria 2388
578 Ga0307509_10183593 3300031507 Bacteria 1953
579 Ga0307408_100049523 3300031548 Bacteria 3018
580 Ga0307516_10000768 3300031730 Bacteria 43795
581 Ga0307405_10000009 3300031731 Bacteria 259388
582 Ga0307410_10079764 3300031852 Bacteria 2295
583 Ga0307406_10195874 3300031901 Bacteria 1483
584 Ga0307407_10000001 3300031903 Bacteria 570048
585 Ga0307407_10085975 3300031903 Bacteria 1915
586 Ga0307409_100012342 3300031995 Bacteria 5441
587 Ga0307416_100000008 3300032002 Bacteria 401343
588 Ga0307414_10010770 3300032004 Bacteria 5330
589 Ga0307414_10390173 3300032004 Bacteria 1206
590 Ga0307507_10000071 3300033179 Bacteria 158391
591 Ga0307507_10001977 3300033179 Bacteria 44460
592 Ga0307510_10000637 3300033180 Bacteria 35581
593 Ga0307510_10075388 3300033180 Bacteria 3326
594 Ga0373951_0001316 3300035091 Bacteria 6546
595 Ga0373941_0179980 3300035115 Bacteria 793
596 Ga0373955_0237595 3300035172 Bacteria 1091
597 Ga0373931_0278100 3300035691 Unclassified 1027
598 Ga0395899_0000001 3300037312 Bacteria 1750322
599 Ga0395899_0000462 3300037312 Bacteria 46052
600 Ga0395900_0000141 3300037418 Bacteria 121159
601 Ga0395898_0017800 3300037466 Bacteria 7250
602 Ga0395905_0000124 3300037471 Bacteria 126707
603 Ga0395901_0000138 3300038443 Bacteria 94944
604 Ga0436365_1179973 3300039437 Bacteria 33661
605 Ga0436361_0979080 3300039447 Bacteria 2219
606 Ga0439436_0023300 3300041404 Bacteria 1832
607 Ga0439439_0006062 3300041406 Bacteria 2785
608 Ga0439466_0123634 3300041411 Bacteria 798
609 Ga0451849_1018633 3300041505 Bacteria 1618
610 Ga0451843_0419312 3300041509 Bacteria 923
611 Ga0451843_1695759 3300041509 Bacteria 1478
612 Ga0451853_3921089 3300041512 Bacteria 1079
613 Ga0439448_0072759 3300042005 Bacteria 1146
614 Ga0439432_073451 3300042006 Bacteria 1041
615 Ga0439449_0014731 3300042007 Bacteria 2938
616 Ga0439449_0021859 3300042007 Bacteria 2394
617 Ga0439449_0032968 3300042007 Bacteria 1931
618 Ga0439449_0045301 3300042007 Bacteria 1630
619 Ga0439457_000072 3300042014 Bacteria 22114
620 Ga0439457_003482 3300042014 Bacteria 4280
621 Ga0439457_037178 3300042014 Bacteria 1084
622 Ga0439462_0000326 3300042015 Bacteria 8900
623 Ga0450894_010694 3300042131 Bacteria 1192
624 Ga0450895_012677 3300042132 Bacteria 736
625 Ga0450899_005855 3300042135 Bacteria 1324
626 Ga0439446_0132497 3300042156 Bacteria 809
627 Ga0466972_0000571 3300044658 Bacteria 17952
628 Ga0466972_0019102 3300044658 Bacteria 3427
629 Ga0466972_0075328 3300044658 Unclassified 1608
630 Ga0466965_0050017 3300044683 Bacteria 2072
631 Ga0466966_0000022 3300044684 Bacteria 112729
632 Ga0466961_0421287 3300044693 Bacteria 809
633 Ga0466964_0215057 3300044706 Unclassified 930
634 Ga0453684_0102814 3300044712 Bacteria 3493
635 Ga0466968_0161226 3300044735 Bacteria 1035
636 Ga0466970_0047829 3300044765 Unclassified 2280
637 Ga0466957_0000411 3300044842 Bacteria 20992
638 Ga0466957_0006428 3300044842 Bacteria 6636
639 Ga0466957_0030049 3300044842 Bacteria 3243
640 Ga0466957_0581647 3300044842 Bacteria 783
641 Ga0466959_0000055 3300045049 Bacteria 78801
642 Ga0466959_0005141 3300045049 Bacteria 8913
643 Ga0495638_0042658 3300046460 Bacteria 2865
644 Ga0495638_0165846 3300046460 Bacteria 1271
645 Ga0495638_0167071 3300046460 Bacteria 1265
646 Ga0495651_0121740 3300046462 Bacteria 1916
647 Ga0495650_0000014 3300046471 Bacteria 581606
648 Ga0495650_0043031 3300046471 Bacteria 1920
649 Ga0495585_0000723 3300046492 Bacteria 29538
650 Ga0495585_0000917 3300046492 Bacteria 24965
651 Ga0495585_0001092 3300046492 Bacteria 22350
652 Ga0495585_0003748 3300046492 Bacteria 10145
653 Ga0495606_0000003 3300046507 Bacteria 449402
654 Ga0495606_0000096 3300046507 Bacteria 151500
655 Ga0495606_0005679 3300046507 Bacteria 11808
656 Ga0495606_0034004 3300046507 Bacteria 3506
657 Ga0495606_0059081 3300046507 Bacteria 2461
658 Ga0495606_0063050 3300046507 Bacteria 2363
659 Ga0495610_0000076 3300046512 Bacteria 118246
660 Ga0495610_0000273 3300046512 Bacteria 53916
661 Ga0495610_0000427 3300046512 Bacteria 43336
662 Ga0495610_0003649 3300046512 Bacteria 11848
663 Ga0495616_0027571 3300046513 Bacteria 3013
664 Ga0495631_0018599 3300046518 Bacteria 3269
665 Ga0495632_0106654 3300046519 Bacteria 1318
666 Ga0495637_0030977 3300046520 Bacteria 2369
667 Ga0495643_0096259 3300046522 Unclassified 1522
668 Ga0495648_0011656 3300046524 Bacteria 6605
669 Ga0495648_0013028 3300046524 Bacteria 6171
670 Ga0495648_0037682 3300046524 Bacteria 3103
671 Ga0495652_0120370 3300046529 Bacteria 2095
672 Ga0495652_0261294 3300046529 Bacteria 1278
673 Ga0495609_0010151 3300046538 Bacteria 4528
674 Ga0495609_0035849 3300046538 Bacteria 2243
675 Ga0495621_0005520 3300046539 Bacteria 3638
676 Ga0495622_0046331 3300046557 Bacteria 2020
677 Ga0495622_0109395 3300046557 Bacteria 1265
678 Ga0495633_0000269 3300046558 Bacteria 61152
679 Ga0495633_0016633 3300046558 Bacteria 3786
680 Ga0495668_0000032 3300046616 Bacteria 254951
681 Ga0495668_0001067 3300046616 Bacteria 28949
682 Ga0495611_0004900 3300046648 Bacteria 5745
683 Ga0495625_0000003 3300046660 Bacteria 686847
684 Ga0495625_0000304 3300046660 Bacteria 75543
685 Ga0495625_0000647 3300046660 Bacteria 50043
686 Ga0495625_0000993 3300046660 Bacteria 37558
687 Ga0495625_0001005 3300046660 Bacteria 37265
688 Ga0495625_0086610 3300046660 Bacteria 2173
689 Ga0495625_0099570 3300046660 Unclassified 1998
690 Ga0495625_0229107 3300046660 Bacteria 1214
691 Ga0495625_0263913 3300046660 Unclassified 1113
692 Ga0495661_0001756 3300046665 Bacteria 17434
693 Ga0495661_0028328 3300046665 Bacteria 3587
694 Ga0495661_0061413 3300046665 Bacteria 2231
695 Ga0495661_0270470 3300046665 Bacteria 860
696 Ga0495658_0012865 3300046683 Bacteria 4251
697 Ga0495658_0141113 3300046683 Bacteria 1473
698 Ga0495671_0212222 3300046692 Bacteria 938
699 Ga0495649_0000002 3300046694 Bacteria 1093458
700 Ga0495649_0032101 3300046694 Bacteria 2895
701 Ga0495649_0376623 3300046694 Unclassified 715
702 Ga0495600_0229575 3300046809 Bacteria 1185
703 Ga0495660_0013907 3300046810 Bacteria 4664
704 Ga0495660_0045669 3300046810 Bacteria 2404
705 Ga0495660_0075393 3300046810 Bacteria 1780
706 Ga0495674_0462146 3300047319 Unclassified 1019
707 Ga0495683_0034477 3300047323 Bacteria 2574
708 Ga0495687_000040 3300047443 Bacteria 230786
709 Ga0495687_001602 3300047443 Bacteria 20428
710 Ga0495673_0047765 3300047469 Bacteria 1890
711 Ga0495686_0000010 3300047472 Bacteria 573229
712 Ga0495686_0060268 3300047472 Bacteria 2359
713 Ga0495686_0066871 3300047472 Bacteria 2220
714 Ga0495614_0010900 3300048089 Bacteria 4001
715 Ga0496112_0258335 3300048915 Bacteria 1692
716 Ga0495678_005512 3300049459 Bacteria 6968
717 Ga0501291_008663 3300049514 Unclassified 1409
718 Ga0501292_007492 3300049515 Bacteria 1578
719 Ga0501293_005939 3300049516 Unclassified 987
720 Ga0501293_013252 3300049516 Unclassified 739
721 Ga0501296_001357 3300049519 Unclassified 2473
722 Ga0501298_028333 3300049521 Bacteria 1086
723 Ga0501298_078843 3300049521 Unclassified 722
724 Ga0501299_001015 3300049522 Bacteria 3492
725 Ga0501299_004193 3300049522 Bacteria 2139
726 Ga0501303_005616 3300049526 Bacteria 1074
727 Ga0501037_0503059 3300049573 Bacteria 822
728 Ga0501047_0065903 3300049581 Bacteria 3491
729 Ga0501198_038527 3300049649 Unclassified 821
730 Ga0501202_005457 3300049652 Bacteria 2253
731 Ga0501206_003896 3300049653 Unclassified 1895
732 Ga0501207_043283 3300049654 Unclassified 787
733 Ga0501216_000648 3300049660 Bacteria 4262
734 Ga0501216_006035 3300049660 Unclassified 1845
735 Ga0501217_001584 3300049661 Unclassified 4303
736 Ga0501223_004821 3300049663 Bacteria 2866
737 Ga0501235_000446 3300049669 Bacteria 8040
738 Ga0501235_001982 3300049669 Bacteria 4388
739 Ga0501250_001004 3300049680 Bacteria 2166
740 Ga0501253_001218 3300049683 Bacteria 2552
741 Ga0501253_003832 3300049683 Bacteria 1845
742 Ga0501255_006525 3300049684 Unclassified 1207
743 Ga0501255_037644 3300049684 Unclassified 698
744 Ga0501256_000923 3300049685 Unclassified 2037
745 Ga0501257_089268 3300049686 Unclassified 801
746 Ga0501261_000342 3300049690 Bacteria 6294
747 Ga0501219_000156 3300049703 Bacteria 12392
748 Ga0501221_019499 3300049704 Unclassified 1316
749 Ga0501221_080821 3300049704 Unclassified 782
750 Ga0501225_0000860 3300049705 Bacteria 9430
751 Ga0501225_0003107 3300049705 Bacteria 5075
752 Ga0501225_0013777 3300049705 Bacteria 2260
753 Ga0501234_009803 3300049707 Unclassified 1494
754 Ga0501245_001963 3300049708 Bacteria 2715
755 Ga0501241_014210 3300049758 Unclassified 1447
756 Ga0501262_004892 3300049759 Unclassified 1568
757 Ga0501270_001709 3300049767 Bacteria 2151
758 Ga0501278_006290 3300049774 Unclassified 887
759 Ga0501035_0082398 3300049822 Bacteria 2839
760 Ga0501044_0003835 3300049823 Bacteria 16872
761 Ga0501204_005235 3300049850 Unclassified 1416
762 nmdc:mga0k408_21815_c1 3300050493 Bacteria 3601
763 nmdc:mga0k408_288582_c1 3300050493 Unclassified 979
764 nmdc:mga0k408_42372_c1 3300050493 Bacteria 2622
765 nmdc:mga0k408_713_c1 3300050493 Bacteria 4816
766 nmdc:mga07m45_425316_c1 3300050496 Bacteria 770
767 nmdc:mga05p37_114902_c1 3300050507 Bacteria 3309
768 nmdc:mga05p37_23907_c1 3300050507 Bacteria 7419
769 nmdc:mga05p37_3277_c1 3300050507 Bacteria 18866
770 nmdc:mga06r32_749482_c1 3300050510 Bacteria 940
771 nmdc:mga08y16_248297_c1 3300050511 Bacteria 1839
772 nmdc:mga08y16_444052_c1 3300050511 Bacteria 1324
773 nmdc:mga0n895_121843_c1 3300050512 Bacteria 2629
774 nmdc:mga0n895_64239_c1 3300050512 Unclassified 3631
775 nmdc:mga0a205_44537_c1 3300050515 Bacteria 4278
776 Ga0500635_0001446 3300053080 Bacteria 5711
777 Ga0500578_0000010 3300053086 Bacteria 217642
778 Ga0500578_0078696 3300053086 Bacteria 2098
779 Ga0500578_0265995 3300053086 Bacteria 1028
780 Ga0500644_0033077 3300053088 Bacteria 1657
781 Ga0500646_0007943 3300053090 Bacteria 2712
782 Ga0500646_0092397 3300053090 Bacteria 938
783 Ga0500647_0125587 3300053091 Bacteria 1212
784 Ga0500583_0000039 3300053092 Bacteria 87189
785 Ga0500583_0000648 3300053092 Bacteria 10329
786 Ga0500583_0000663 3300053092 Bacteria 10165
787 Ga0500583_0098232 3300053092 Bacteria 1432
788 Ga0500583_0099898 3300053092 Unclassified 1420
789 Ga0500583_0122585 3300053092 Bacteria 1287
790 Ga0500651_0168522 3300053093 Unclassified 1307
791 Ga0500650_0196838 3300053098 Bacteria 919
792 Ga0500555_022008 3300053103 Bacteria 1834
793 Ga0500608_031671 3300053122 Bacteria 2510
794 Ga0500608_076100 3300053122 Bacteria 1590
795 Ga0500614_029038 3300053123 Bacteria 1340
796 Ga0500618_000142 3300053125 Bacteria 59775
797 Ga0500618_000150 3300053125 Bacteria 57266
798 Ga0500642_0006554 3300053130 Unclassified 3844
799 Ga0500642_0154709 3300053130 Unclassified 1076
800 Ga0500652_030756 3300053131 Bacteria 2101
801 Ga0500652_124333 3300053131 Bacteria 1078
802 Ga0500568_0027829 3300053139 Unclassified 2361
803 Ga0500588_0038722 3300053146 Bacteria 1424
804 Ga0500589_044855 3300053147 Bacteria 2060
805 Ga0500589_111600 3300053147 Bacteria 1172
806 Ga0500622_0004994 3300053156 Bacteria 8081
807 Ga0500622_0023303 3300053156 Bacteria 3279
808 Ga0500639_167792 3300053163 Unclassified 989
809 Ga0500636_0069537 3300053177 Bacteria 2043
810 Ga0500637_0269298 3300053178 Bacteria 943
811 Ga0500611_019062 3300053727 Bacteria 1275
812 Ga0590075_000806 3300059424 Bacteria 8262
813 Ga0466962_0170410 3300061719 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049649 Ga0501198_038527 Ga0501198_038527_248_778 175
2 3300049684 Ga0501255_006525 Ga0501255_006525_658_1188 175
3 3300046665 Ga0495661_0061413 Ga0495661_0061413_1622_2215 178
4 3300005539 Ga0068853_100057054 Ga0068853_1000570545 180
5 3300046492 Ga0495585_0001092 Ga0495585_0001092_14041_14706 181
6 3300047443 Ga0495687_001602 Ga0495687_001602_19573_20238 181
7 3300005563 Ga0068855_100004987 Ga0068855_1000049876 183
8 3300006195 Ga0075366_10011521 Ga0075366_100115212 183
9 3300025949 Ga0207667_10058197 Ga0207667_100581976 183
10 3300050493 nmdc:mga0k408_42372_c1 nmdc:mga0k408_42372_c1_1582_2247 183
11 3300050496 nmdc:mga07m45_425316_c1 nmdc:mga07m45_425316_c1_94_759 183
12 3300005844 Ga0068862_100913420 Ga0068862_1009134201 184
13 3300049685 Ga0501256_000923 Ga0501256_000923_1464_2024 185
14 3300042005 Ga0439448_0072759 Ga0439448_0072759_544_1113 189
15 3300046460 Ga0495638_0167071 Ga0495638_0167071_19_594 190
16 3300046660 Ga0495625_0001005 Ga0495625_0001005_17102_17734 191
17 3300005290 Ga0065712_10258451 Ga0065712_102584511 193
18 3300005340 Ga0070689_100436969 Ga0070689_1004369692 193
19 3300005444 Ga0070694_100213837 Ga0070694_1002138372 193
20 3300005468 Ga0070707_100232970 Ga0070707_1002329701 193
21 3300005471 Ga0070698_100013520 Ga0070698_1000135208 193
22 3300005536 Ga0070697_100262071 Ga0070697_1002620712 193
23 3300005545 Ga0070695_100158146 Ga0070695_1001581462 193
24 3300005577 Ga0068857_100365774 Ga0068857_1003657741 193
25 3300005578 Ga0068854_100178575 Ga0068854_1001785753 193
26 3300005618 Ga0068864_100011191 Ga0068864_1000111912 193
27 3300005618 Ga0068864_100378890 Ga0068864_1003788902 193
28 3300006844 Ga0075428_100030804 Ga0075428_1000308044 193
29 3300006847 Ga0075431_100541691 Ga0075431_1005416911 193
30 3300006852 Ga0075433_10022890 Ga0075433_100228903 193
31 3300006871 Ga0075434_100048996 Ga0075434_1000489963 193
32 3300006880 Ga0075429_100468412 Ga0075429_1004684121 193
33 3300009093 Ga0105240_10771533 Ga0105240_107715332 193
34 3300009101 Ga0105247_10000681 Ga0105247_1000068114 193
35 3300009147 Ga0114129_10081799 Ga0114129_100817992 193
36 3300009177 Ga0105248_10068671 Ga0105248_100686712 193
37 3300009177 Ga0105248_10152124 Ga0105248_101521242 193
38 3300010375 Ga0105239_10042832 Ga0105239_100428322 193
39 3300013102 Ga0157371_10978574 Ga0157371_109785741 193
40 3300014325 Ga0163163_10200401 Ga0163163_102004012 193
41 3300025904 Ga0207647_10426471 Ga0207647_104264711 193
42 3300025941 Ga0207711_10065685 Ga0207711_100656853 193
43 3300025961 Ga0207712_10001192 Ga0207712_100011927 193
44 3300026116 Ga0207674_10436689 Ga0207674_104366892 193
45 3300028380 Ga0268265_11207261 Ga0268265_112072611 193
46 3300049516 Ga0501293_013252 Ga0501293_013252_20_604 193
47 3300050507 nmdc:mga05p37_114902_c1 nmdc:mga05p37_114902_c1_1990_2574 193
48 3300050512 nmdc:mga0n895_121843_c1 nmdc:mga0n895_121843_c1_546_1130 193
49 3300050512 nmdc:mga0n895_64239_c1 nmdc:mga0n895_64239_c1_2214_2798 193
50 3300050515 nmdc:mga0a205_44537_c1 nmdc:mga0a205_44537_c1_2340_2924 193
51 3300003322 rootL2_10063246 rootL2_100632468 194
52 3300005335 Ga0070666_10026629 Ga0070666_100266292 194
53 3300005341 Ga0070691_10022586 Ga0070691_100225862 194
54 3300005539 Ga0068853_100046310 Ga0068853_1000463103 194
55 3300005616 Ga0068852_100601218 Ga0068852_1006012182 194
56 3300025914 Ga0207671_10002777 Ga0207671_1000277710 194
57 3300025924 Ga0207694_10104418 Ga0207694_101044182 194
58 3300003322 rootL2_10178833 rootL2_101788332 197
59 3300046471 Ga0495650_0000014 Ga0495650_0000014_125382_126047 198
60 3300046512 Ga0495610_0000427 Ga0495610_0000427_22240_22905 198
61 3300046660 Ga0495625_0000003 Ga0495625_0000003_110040_110705 198
62 3300046665 Ga0495661_0001756 Ga0495661_0001756_2925_3590 198
63 3300046692 Ga0495671_0212222 Ga0495671_0212222_156_821 198
64 3300046694 Ga0495649_0000002 Ga0495649_0000002_896259_896924 198
65 3300013306 Ga0163162_10019918 Ga0163162_100199187 199
66 3300046507 Ga0495606_0000096 Ga0495606_0000096_105171_105836 199
67 3300047469 Ga0495673_0047765 Ga0495673_0047765_933_1598 199
68 3300003316 rootH1_10057924 rootH1_1005792413 200
69 3300026041 Ga0207639_10099176 Ga0207639_100991763 200
70 3300014745 Ga0157377_10374487 Ga0157377_103744871 203
71 3300005366 Ga0070659_100018458 Ga0070659_1000184583 204
72 3300009101 Ga0105247_10406290 Ga0105247_104062902 204
73 3300005337 Ga0070682_100000128 Ga0070682_1000001286 205
74 3300005338 Ga0068868_100934516 Ga0068868_1009345162 205
75 3300005539 Ga0068853_100251343 Ga0068853_1002513432 205
76 3300005547 Ga0070693_100018920 Ga0070693_1000189202 205
77 3300005843 Ga0068860_100899216 Ga0068860_1008992162 205
78 3300013306 Ga0163162_10007780 Ga0163162_100077801 205
79 3300044712 Ga0453684_0102814 Ga0453684_0102814_1644_2294 205
80 3300002459 JGI24751J29686_10000015 JGI24751J29686_1000001569 206
81 3300003322 rootL2_10314446 rootL2_103144461 206
82 3300005331 Ga0070670_100000206 Ga0070670_10000020634 206
83 3300005331 Ga0070670_100067827 Ga0070670_1000678273 206
84 3300005331 Ga0070670_100167608 Ga0070670_1001676082 206
85 3300005334 Ga0068869_100482176 Ga0068869_1004821761 206
86 3300005337 Ga0070682_100009239 Ga0070682_1000092394 206
87 3300005340 Ga0070689_100000319 Ga0070689_1000003196 206
88 3300005345 Ga0070692_10006967 Ga0070692_100069674 206
89 3300005345 Ga0070692_10218559 Ga0070692_102185592 206
90 3300005353 Ga0070669_100102259 Ga0070669_1001022592 206
91 3300005406 Ga0070703_10009040 Ga0070703_100090403 206
92 3300005438 Ga0070701_10077074 Ga0070701_100770742 206
93 3300005438 Ga0070701_10397679 Ga0070701_103976791 206
94 3300005440 Ga0070705_100127967 Ga0070705_1001279672 206
95 3300005441 Ga0070700_100002107 Ga0070700_1000021078 206
96 3300005441 Ga0070700_100018150 Ga0070700_1000181503 206
97 3300005441 Ga0070700_100421096 Ga0070700_1004210961 206
98 3300005444 Ga0070694_100003543 Ga0070694_1000035438 206
99 3300005444 Ga0070694_100011567 Ga0070694_1000115672 206
100 3300005444 Ga0070694_100094247 Ga0070694_1000942472 206
101 3300005456 Ga0070678_100330095 Ga0070678_1003300952 206
102 3300005459 Ga0068867_100167260 Ga0068867_1001672602 206
103 3300005459 Ga0068867_100250559 Ga0068867_1002505591 206
104 3300005467 Ga0070706_100008371 Ga0070706_1000083716 206
105 3300005518 Ga0070699_100505253 Ga0070699_1005052532 206
106 3300005545 Ga0070695_100023844 Ga0070695_1000238443 206
107 3300005547 Ga0070693_100003801 Ga0070693_1000038013 206
108 3300005547 Ga0070693_100089584 Ga0070693_1000895841 206
109 3300005549 Ga0070704_100398569 Ga0070704_1003985692 206
110 3300005577 Ga0068857_100143380 Ga0068857_1001433802 206
111 3300005577 Ga0068857_100440878 Ga0068857_1004408782 206
112 3300005615 Ga0070702_100086190 Ga0070702_1000861902 206
113 3300005617 Ga0068859_100015073 Ga0068859_1000150738 206
114 3300005617 Ga0068859_100138046 Ga0068859_1001380462 206
115 3300005617 Ga0068859_100168938 Ga0068859_1001689382 206
116 3300005618 Ga0068864_100005575 Ga0068864_1000055756 206
117 3300005618 Ga0068864_100031988 Ga0068864_1000319884 206
118 3300005719 Ga0068861_100005935 Ga0068861_1000059355 206
119 3300005719 Ga0068861_100083919 Ga0068861_1000839192 206
120 3300005834 Ga0068851_10002933 Ga0068851_100029332 206
121 3300005834 Ga0068851_10342556 Ga0068851_103425562 206
122 3300005840 Ga0068870_10015867 Ga0068870_100158672 206
123 3300005842 Ga0068858_100037895 Ga0068858_1000378952 206
124 3300005843 Ga0068860_100219588 Ga0068860_1002195882 206
125 3300005843 Ga0068860_100308835 Ga0068860_1003088352 206
126 3300005843 Ga0068860_100484107 Ga0068860_1004841071 206
127 3300006852 Ga0075433_10047752 Ga0075433_100477524 206
128 3300006871 Ga0075434_100036829 Ga0075434_1000368292 206
129 3300006931 Ga0097620_100015073 Ga0097620_1000150732 206
130 3300006931 Ga0097620_100138049 Ga0097620_1001380493 206
131 3300006931 Ga0097620_100168944 Ga0097620_1001689442 206
132 3300009094 Ga0111539_10029922 Ga0111539_100299225 206
133 3300009101 Ga0105247_10386156 Ga0105247_103861562 206
134 3300009148 Ga0105243_10221755 Ga0105243_102217552 206
135 3300009174 Ga0105241_10240211 Ga0105241_102402112 206
136 3300009174 Ga0105241_10265602 Ga0105241_102656021 206
137 3300009176 Ga0105242_10250210 Ga0105242_102502102 206
138 3300009177 Ga0105248_10170357 Ga0105248_101703572 206
139 3300009177 Ga0105248_10229317 Ga0105248_102293172 206
140 3300009177 Ga0105248_10516612 Ga0105248_105166122 206
141 3300009545 Ga0105237_10001943 Ga0105237_1000194317 206
142 3300009551 Ga0105238_10000868 Ga0105238_1000086826 206
143 3300009553 Ga0105249_10001842 Ga0105249_100018427 206
144 3300009553 Ga0105249_10710136 Ga0105249_107101361 206
145 3300013296 Ga0157374_10188317 Ga0157374_101883172 206
146 3300013296 Ga0157374_11090840 Ga0157374_110908402 206
147 3300013308 Ga0157375_10141294 Ga0157375_101412941 206
148 3300013308 Ga0157375_10286114 Ga0157375_102861142 206
149 3300014325 Ga0163163_10000142 Ga0163163_1000014242 206
150 3300014325 Ga0163163_10205216 Ga0163163_102052162 206
151 3300014325 Ga0163163_10506953 Ga0163163_105069532 206
152 3300014326 Ga0157380_10045508 Ga0157380_100455083 206
153 3300014745 Ga0157377_10095423 Ga0157377_100954232 206
154 3300014968 Ga0157379_10079921 Ga0157379_100799212 206
155 3300014968 Ga0157379_10711937 Ga0157379_107119371 206
156 3300025321 Ga0207656_10005303 Ga0207656_100053036 206
157 3300025885 Ga0207653_10004534 Ga0207653_100045344 206
158 3300025901 Ga0207688_10137064 Ga0207688_101370642 206
159 3300025908 Ga0207643_10014568 Ga0207643_100145681 206
160 3300025910 Ga0207684_10100971 Ga0207684_101009712 206
161 3300025914 Ga0207671_10003734 Ga0207671_1000373410 206
162 3300025918 Ga0207662_10516042 Ga0207662_105160421 206
163 3300025922 Ga0207646_10227045 Ga0207646_102270452 206
164 3300025923 Ga0207681_10016048 Ga0207681_100160483 206
165 3300025924 Ga0207694_10002363 Ga0207694_1000236319 206
166 3300025925 Ga0207650_10000017 Ga0207650_1000001740 206
167 3300025925 Ga0207650_10245444 Ga0207650_102454442 206
168 3300025934 Ga0207686_10050235 Ga0207686_100502352 206
169 3300025935 Ga0207709_10145319 Ga0207709_101453191 206
170 3300025936 Ga0207670_10002115 Ga0207670_100021156 206
171 3300025936 Ga0207670_10187541 Ga0207670_101875412 206
172 3300025940 Ga0207691_10200507 Ga0207691_102005071 206
173 3300025941 Ga0207711_10020898 Ga0207711_100208986 206
174 3300025942 Ga0207689_10590122 Ga0207689_105901222 206
175 3300025961 Ga0207712_10427477 Ga0207712_104274772 206
176 3300026023 Ga0207677_10615541 Ga0207677_106155412 206
177 3300026035 Ga0207703_10059644 Ga0207703_100596442 206
178 3300026035 Ga0207703_10429930 Ga0207703_104299302 206
179 3300026075 Ga0207708_10013257 Ga0207708_100132575 206
180 3300026075 Ga0207708_10013431 Ga0207708_100134316 206
181 3300026075 Ga0207708_10391037 Ga0207708_103910372 206
182 3300026089 Ga0207648_10033398 Ga0207648_100333983 206
183 3300026089 Ga0207648_10073185 Ga0207648_100731854 206
184 3300026089 Ga0207648_10297207 Ga0207648_102972072 206
185 3300026095 Ga0207676_10009550 Ga0207676_100095507 206
186 3300026095 Ga0207676_10401166 Ga0207676_104011661 206
187 3300026116 Ga0207674_10041071 Ga0207674_100410714 206
188 3300026118 Ga0207675_100012852 Ga0207675_1000128525 206
189 3300026118 Ga0207675_100049719 Ga0207675_1000497193 206
190 3300026118 Ga0207675_100461562 Ga0207675_1004615622 206
191 3300026121 Ga0207683_10365918 Ga0207683_103659182 206
192 3300028381 Ga0268264_10015719 Ga0268264_100157192 206
193 3300031548 Ga0307408_100049523 Ga0307408_1000495232 206
194 3300031903 Ga0307407_10085975 Ga0307407_100859752 206
195 3300035091 Ga0373951_0001316 Ga0373951_0001316_2893_3516 206
196 3300035691 Ga0373931_0278100 Ga0373931_0278100_173_796 206
197 3300046539 Ga0495621_0005520 Ga0495621_0005520_899_1525 206
198 3300048915 Ga0496112_0258335 Ga0496112_0258335_344_967 206
199 3300049514 Ga0501291_008663 Ga0501291_008663_288_911 206
200 3300049515 Ga0501292_007492 Ga0501292_007492_172_795 206
201 3300049516 Ga0501293_005939 Ga0501293_005939_87_710 206
202 3300049519 Ga0501296_001357 Ga0501296_001357_1793_2416 206
203 3300049521 Ga0501298_028333 Ga0501298_028333_41_664 206
204 3300049521 Ga0501298_078843 Ga0501298_078843_46_669 206
205 3300049522 Ga0501299_001015 Ga0501299_001015_941_1564 206
206 3300049522 Ga0501299_004193 Ga0501299_004193_115_738 206
207 3300049526 Ga0501303_005616 Ga0501303_005616_31_654 206
208 3300049652 Ga0501202_005457 Ga0501202_005457_1065_1688 206
209 3300049653 Ga0501206_003896 Ga0501206_003896_301_924 206
210 3300049654 Ga0501207_043283 Ga0501207_043283_78_701 206
211 3300049660 Ga0501216_000648 Ga0501216_000648_2584_3207 206
212 3300049660 Ga0501216_006035 Ga0501216_006035_1001_1624 206
213 3300049661 Ga0501217_001584 Ga0501217_001584_86_709 206
214 3300049663 Ga0501223_004821 Ga0501223_004821_318_941 206
215 3300049669 Ga0501235_000446 Ga0501235_000446_7383_8006 206
216 3300049669 Ga0501235_001982 Ga0501235_001982_1803_2426 206
217 3300049680 Ga0501250_001004 Ga0501250_001004_182_805 206
218 3300049683 Ga0501253_001218 Ga0501253_001218_149_772 206
219 3300049683 Ga0501253_003832 Ga0501253_003832_777_1400 206
220 3300049684 Ga0501255_037644 Ga0501255_037644_35_658 206
221 3300049690 Ga0501261_000342 Ga0501261_000342_4990_5613 206
222 3300049704 Ga0501221_019499 Ga0501221_019499_673_1296 206
223 3300049704 Ga0501221_080821 Ga0501221_080821_10_633 206
224 3300049705 Ga0501225_0003107 Ga0501225_0003107_3801_4424 206
225 3300049705 Ga0501225_0013777 Ga0501225_0013777_1534_2157 206
226 3300049707 Ga0501234_009803 Ga0501234_009803_786_1409 206
227 3300049708 Ga0501245_001963 Ga0501245_001963_690_1313 206
228 3300049758 Ga0501241_014210 Ga0501241_014210_698_1321 206
229 3300049759 Ga0501262_004892 Ga0501262_004892_423_1046 206
230 3300049767 Ga0501270_001709 Ga0501270_001709_569_1192 206
231 3300049774 Ga0501278_006290 Ga0501278_006290_144_767 206
232 3300049850 Ga0501204_005235 Ga0501204_005235_10_633 206
233 3300050510 nmdc:mga06r32_749482_c1 nmdc:mga06r32_749482_c1_142_765 206
234 3300050511 nmdc:mga08y16_248297_c1 nmdc:mga08y16_248297_c1_109_732 206
235 3300053146 Ga0500588_0038722 Ga0500588_0038722_637_1260 207
236 iso_pu_bacteria 2902048731 2902051317 207
237 3300005290 Ga0065712_10000430 Ga0065712_100004308 208
238 3300005293 Ga0065715_10001577 Ga0065715_100015773 208
239 3300005544 Ga0070686_100149774 Ga0070686_1001497741 208
240 3300005577 Ga0068857_100822224 Ga0068857_1008222241 208
241 3300005617 Ga0068859_100111574 Ga0068859_1001115742 208
242 3300005843 Ga0068860_100014093 Ga0068860_1000140936 208
243 3300006931 Ga0097620_100111571 Ga0097620_1001115712 208
244 3300025900 Ga0207710_10000858 Ga0207710_1000085812 208
245 3300025904 Ga0207647_10177606 Ga0207647_101776062 208
246 3300025914 Ga0207671_10571631 Ga0207671_105716311 208
247 3300025927 Ga0207687_10218090 Ga0207687_102180902 208
248 3300025960 Ga0207651_10128212 Ga0207651_101282121 208
249 3300026035 Ga0207703_10064094 Ga0207703_100640942 208
250 3300028381 Ga0268264_10025073 Ga0268264_100250732 208
251 iso_pu_bacteria 2945997725 2946003203 208
252 3300050493 nmdc:mga0k408_288582_c1 nmdc:mga0k408_288582_c1_82_735 209
253 iso_pu_bacteria 2585427687 2586208787 209
254 iso_pu_bacteria 2738541302 2738854865 209
255 iso_pu_bacteria 2739367651 2739587021 209
256 iso_pu_bacteria 2739367656 2739618211 209
257 iso_pu_bacteria 2739367663 2739646316 209
258 iso_pu_bacteria 2818991437 2819547474 209
259 iso_pu_bacteria 2842722452 2842727535 209
260 iso_pu_bacteria 2842909656 2842911257 209
261 iso_pu_bacteria 2849281842 2849283212 209
262 iso_pu_bacteria 2857627736 2857631500 209
263 iso_pu_bacteria 2904445276 2904449708 209
264 iso_pu_bacteria 2932082852 2932085895 209
265 iso_pu_bacteria 2954016120 2954020060 209
266 3300003322 rootL2_10030820 rootL2_100308207 210
267 3300005288 Ga0065714_10137475 Ga0065714_101374752 210
268 3300005289 Ga0065704_10139651 Ga0065704_101396512 210
269 3300005328 Ga0070676_10286193 Ga0070676_102861932 210
270 3300005438 Ga0070701_10170658 Ga0070701_101706582 210
271 3300005549 Ga0070704_100416530 Ga0070704_1004165302 210
272 3300005840 Ga0068870_10023032 Ga0068870_100230323 210
273 3300025904 Ga0207647_10317244 Ga0207647_103172442 210
274 3300025907 Ga0207645_10420145 Ga0207645_104201451 210
275 3300025938 Ga0207704_10611016 Ga0207704_106110162 210
276 3300026075 Ga0207708_10993140 Ga0207708_109931401 210
277 3300027907 Ga0207428_10241999 Ga0207428_102419992 210
278 3300030744 Ga0316181_1166948 Ga0316181_11669482 210
279 3300046507 Ga0495606_0063050 Ga0495606_0063050_535_1167 210
280 3300003322 rootL2_10306079 rootL2_103060792 211
281 3300005288 Ga0065714_10220103 Ga0065714_102201031 211
282 3300002737 JGI25162J39368_1000435 JGI25162J39368_100043518 212
283 3300002772 JGI25164J39214_1001884 JGI25164J39214_10018844 212
284 3300003214 JGI25165J46597_1001213 JGI25165J46597_10012133 212
285 3300003323 rootH1_10003362 rootH1_1000336224 212
286 3300003323 rootH1_10036959 rootH1_100369594 212
287 3300005327 Ga0070658_10000056 Ga0070658_10000056117 212
288 3300005339 Ga0070660_101018209 Ga0070660_1010182091 212
289 3300005356 Ga0070674_100038925 Ga0070674_1000389252 212
290 3300005539 Ga0068853_100531961 Ga0068853_1005319611 212
291 3300005563 Ga0068855_100043825 Ga0068855_1000438255 212
292 3300005614 Ga0068856_100007747 Ga0068856_1000077472 212
293 3300005718 Ga0068866_10239976 Ga0068866_102399762 212
294 3300009093 Ga0105240_10046113 Ga0105240_100461135 212
295 3300009098 Ga0105245_10218194 Ga0105245_102181942 212
296 3300009174 Ga0105241_10019765 Ga0105241_100197653 212
297 3300009174 Ga0105241_10704681 Ga0105241_107046811 212
298 3300010375 Ga0105239_10576041 Ga0105239_105760412 212
299 3300013296 Ga0157374_10428429 Ga0157374_104284292 212
300 3300013297 Ga0157378_10477589 Ga0157378_104775892 212
301 3300025230 Ga0209563_104170 Ga0209563_1041702 212
302 3300025231 Ga0207427_101183 Ga0207427_1011833 212
303 3300025233 Ga0209437_100112 Ga0209437_10011216 212
304 3300025250 Ga0209026_1009331 Ga0209026_10093312 212
305 3300025261 Ga0209233_1000126 Ga0209233_1000126165 212
306 3300025261 Ga0209233_1022574 Ga0209233_10225742 212
307 3300025272 Ga0209455_1003551 Ga0209455_10035512 212
308 3300025909 Ga0207705_10000028 Ga0207705_1000002812 212
309 3300025911 Ga0207654_10054537 Ga0207654_100545373 212
310 3300025911 Ga0207654_10386451 Ga0207654_103864511 212
311 3300025913 Ga0207695_10155221 Ga0207695_101552212 212
312 3300025919 Ga0207657_10122884 Ga0207657_101228843 212
313 3300025937 Ga0207669_10185910 Ga0207669_101859102 212
314 3300025949 Ga0207667_10065263 Ga0207667_100652634 212
315 3300026041 Ga0207639_10575402 Ga0207639_105754022 212
316 3300026078 Ga0207702_10386946 Ga0207702_103869461 212
317 3300028786 Ga0307517_10002971 Ga0307517_1000297118 212
318 3300031251 Ga0265327_10164210 Ga0265327_101642102 212
319 3300031507 Ga0307509_10103378 Ga0307509_101033784 212
320 3300032004 Ga0307414_10390173 Ga0307414_103901732 212
321 3300033180 Ga0307510_10075388 Ga0307510_100753883 212
322 3300046518 Ga0495631_0018599 Ga0495631_0018599_770_1408 212
323 3300046529 Ga0495652_0261294 Ga0495652_0261294_454_1092 212
324 3300046660 Ga0495625_0086610 Ga0495625_0086610_707_1345 212
325 3300047323 Ga0495683_0034477 Ga0495683_0034477_285_923 212
326 3300002077 JGI24744J21845_10020228 JGI24744J21845_100202282 213
327 3300002741 JGI25157J39369_1009630 JGI25157J39369_10096302 213
328 3300002773 JGI25152J39213_1000054 JGI25152J39213_100005431 213
329 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003243 213
330 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002243 213
331 3300003215 JGI25153J46596_10000015 JGI25153J46596_1000001554 213
332 3300003316 rootH1_10048329 rootH1_100483296 213
333 3300003320 rootH2_10001274 rootH2_1000127451 213
334 3300003322 rootL2_10224865 rootL2_102248655 213
335 3300003781 Ga0055536_1000006 Ga0055536_1000006167 213
336 3300003791 Ga0055530_10002643 Ga0055530_100026436 213
337 3300005288 Ga0065714_10002307 Ga0065714_1000230711 213
338 3300005288 Ga0065714_10021495 Ga0065714_100214951 213
339 3300005288 Ga0065714_10074001 Ga0065714_100740012 213
340 3300005288 Ga0065714_10083206 Ga0065714_100832062 213
341 3300005327 Ga0070658_10149113 Ga0070658_101491132 213
342 3300005328 Ga0070676_10000483 Ga0070676_1000048317 213
343 3300005334 Ga0068869_100245099 Ga0068869_1002450991 213
344 3300005338 Ga0068868_100083750 Ga0068868_1000837502 213
345 3300005339 Ga0070660_100270344 Ga0070660_1002703442 213
346 3300005364 Ga0070673_100006813 Ga0070673_1000068133 213
347 3300005456 Ga0070678_100010530 Ga0070678_1000105307 213
348 3300005459 Ga0068867_100036014 Ga0068867_1000360142 213
349 3300005539 Ga0068853_100087140 Ga0068853_1000871403 213
350 3300005539 Ga0068853_100139477 Ga0068853_1001394772 213
351 3300005543 Ga0070672_100392553 Ga0070672_1003925532 213
352 3300005548 Ga0070665_100000034 Ga0070665_100000034166 213
353 3300005563 Ga0068855_100000302 Ga0068855_10000030245 213
354 3300005563 Ga0068855_100000611 Ga0068855_10000061110 213
355 3300005563 Ga0068855_100013791 Ga0068855_1000137914 213
356 3300005614 Ga0068856_100000031 Ga0068856_10000003187 213
357 3300005614 Ga0068856_100072206 Ga0068856_1000722061 213
358 3300005616 Ga0068852_100006666 Ga0068852_1000066667 213
359 3300005718 Ga0068866_10022755 Ga0068866_100227552 213
360 3300006237 Ga0097621_100002837 Ga0097621_1000028379 213
361 3300006358 Ga0068871_100000482 Ga0068871_10000048229 213
362 3300006881 Ga0068865_100000055 Ga0068865_10000005564 213
363 3300009036 Ga0105244_10041432 Ga0105244_100414321 213
364 3300009093 Ga0105240_10006961 Ga0105240_100069619 213
365 3300009093 Ga0105240_10202882 Ga0105240_102028823 213
366 3300009098 Ga0105245_10855581 Ga0105245_108555811 213
367 3300009174 Ga0105241_10007631 Ga0105241_100076318 213
368 3300009174 Ga0105241_10182222 Ga0105241_101822221 213
369 3300009174 Ga0105241_10454451 Ga0105241_104544512 213
370 3300009545 Ga0105237_10001160 Ga0105237_1000116021 213
371 3300009545 Ga0105237_10021202 Ga0105237_100212028 213
372 3300009545 Ga0105237_10022335 Ga0105237_100223352 213
373 3300009545 Ga0105237_10136120 Ga0105237_101361204 213
374 3300009551 Ga0105238_10010457 Ga0105238_100104574 213
375 3300010375 Ga0105239_10004643 Ga0105239_1000464310 213
376 3300011119 Ga0105246_10370339 Ga0105246_103703392 213
377 3300013100 Ga0157373_10008702 Ga0157373_100087029 213
378 3300013102 Ga0157371_10000117 Ga0157371_1000011739 213
379 3300013104 Ga0157370_10017786 Ga0157370_100177863 213
380 3300013104 Ga0157370_10025999 Ga0157370_100259993 213
381 3300013104 Ga0157370_10054701 Ga0157370_100547016 213
382 3300013104 Ga0157370_10071814 Ga0157370_100718143 213
383 3300013104 Ga0157370_10093547 Ga0157370_100935473 213
384 3300013104 Ga0157370_10279282 Ga0157370_102792822 213
385 3300013105 Ga0157369_10000047 Ga0157369_1000004782 213
386 3300013105 Ga0157369_10560879 Ga0157369_105608792 213
387 3300013296 Ga0157374_10047255 Ga0157374_100472553 213
388 3300013297 Ga0157378_10028393 Ga0157378_100283935 213
389 3300013297 Ga0157378_10031595 Ga0157378_100315955 213
390 3300013297 Ga0157378_10150583 Ga0157378_101505832 213
391 3300013306 Ga0163162_10000018 Ga0163162_10000018137 213
392 3300013306 Ga0163162_10000895 Ga0163162_1000089511 213
393 3300013308 Ga0157375_10172190 Ga0157375_101721902 213
394 3300014497 Ga0182008_10000914 Ga0182008_1000091410 213
395 3300015261 Ga0182006_1000153 Ga0182006_10001539 213
396 3300015261 Ga0182006_1000287 Ga0182006_100028736 213
397 3300015262 Ga0182007_10000005 Ga0182007_10000005168 213
398 3300015682 Ga0183373_1002 Ga0183373_1002756 213
399 3300017792 Ga0163161_10002412 Ga0163161_100024126 213
400 3300017792 Ga0163161_10002768 Ga0163161_1000276811 213
401 3300017792 Ga0163161_10006203 Ga0163161_100062036 213
402 3300017792 Ga0163161_10166941 Ga0163161_101669412 213
403 3300021361 Ga0213872_10090057 Ga0213872_100900573 213
404 3300025245 Ga0207425_1000003 Ga0207425_1000003599 213
405 3300025250 Ga0209026_1000549 Ga0209026_100054914 213
406 3300025258 Ga0209129_1000014 Ga0209129_1000014234 213
407 3300025292 Ga0209676_1000039 Ga0209676_1000039259 213
408 3300025294 Ga0209025_1000007 Ga0209025_1000007598 213
409 3300025297 Ga0209758_1000012 Ga0209758_1000012599 213
410 3300025298 Ga0209050_1000033 Ga0209050_1000033189 213
411 3300025907 Ga0207645_10000056 Ga0207645_100000568 213
412 3300025909 Ga0207705_10052660 Ga0207705_100526602 213
413 3300025911 Ga0207654_10046925 Ga0207654_100469252 213
414 3300025911 Ga0207654_10276514 Ga0207654_102765142 213
415 3300025913 Ga0207695_10015983 Ga0207695_1001598310 213
416 3300025913 Ga0207695_10167303 Ga0207695_101673032 213
417 3300025914 Ga0207671_10001813 Ga0207671_1000181321 213
418 3300025914 Ga0207671_10012550 Ga0207671_100125502 213
419 3300025914 Ga0207671_10019257 Ga0207671_100192573 213
420 3300025919 Ga0207657_10264322 Ga0207657_102643222 213
421 3300025932 Ga0207690_10000123 Ga0207690_1000012340 213
422 3300025938 Ga0207704_10000229 Ga0207704_1000022911 213
423 3300025942 Ga0207689_10921964 Ga0207689_109219641 213
424 3300025949 Ga0207667_10000477 Ga0207667_1000047741 213
425 3300025949 Ga0207667_10005555 Ga0207667_1000555514 213
426 3300025949 Ga0207667_10012719 Ga0207667_1001271910 213
427 3300026023 Ga0207677_10046290 Ga0207677_100462903 213
428 3300026041 Ga0207639_10028495 Ga0207639_100284953 213
429 3300026041 Ga0207639_10118262 Ga0207639_101182623 213
430 3300026078 Ga0207702_10000071 Ga0207702_1000007188 213
431 3300026078 Ga0207702_11057425 Ga0207702_110574251 213
432 3300026089 Ga0207648_10004742 Ga0207648_100047429 213
433 3300026121 Ga0207683_10005938 Ga0207683_100059387 213
434 3300028379 Ga0268266_10000119 Ga0268266_1000011910 213
435 3300028794 Ga0307515_10001098 Ga0307515_1000109822 213
436 3300028794 Ga0307515_10006567 Ga0307515_1000656713 213
437 3300031731 Ga0307405_10000009 Ga0307405_10000009105 213
438 3300031903 Ga0307407_10000001 Ga0307407_10000001281 213
439 3300031995 Ga0307409_100012342 Ga0307409_1000123425 213
440 3300032002 Ga0307416_100000008 Ga0307416_100000008108 213
441 3300032004 Ga0307414_10010770 Ga0307414_100107702 213
442 3300033179 Ga0307507_10000071 Ga0307507_1000007113 213
443 3300037312 Ga0395899_0000462 Ga0395899_0000462_22782_23423 213
444 3300037418 Ga0395900_0000141 Ga0395900_0000141_40780_41421 213
445 3300037466 Ga0395898_0017800 Ga0395898_0017800_5513_6154 213
446 3300037471 Ga0395905_0000124 Ga0395905_0000124_94234_94875 213
447 3300038443 Ga0395901_0000138 Ga0395901_0000138_44345_44986 213
448 3300039447 Ga0436361_0979080 Ga0436361_0979080_711_1352 213
449 3300046492 Ga0495585_0000917 Ga0495585_0000917_8474_9115 213
450 3300046507 Ga0495606_0034004 Ga0495606_0034004_2180_2821 213
451 3300046512 Ga0495610_0000076 Ga0495610_0000076_32477_33118 213
452 3300046512 Ga0495610_0003649 Ga0495610_0003649_2160_2801 213
453 3300046520 Ga0495637_0030977 Ga0495637_0030977_1422_2063 213
454 3300046524 Ga0495648_0013028 Ga0495648_0013028_897_1538 213
455 3300046557 Ga0495622_0109395 Ga0495622_0109395_57_698 213
456 3300046660 Ga0495625_0000647 Ga0495625_0000647_36762_37403 213
457 3300046660 Ga0495625_0099570 Ga0495625_0099570_1135_1776 213
458 3300046665 Ga0495661_0270470 Ga0495661_0270470_160_807 213
459 3300046683 Ga0495658_0012865 Ga0495658_0012865_420_1061 213
460 3300046810 Ga0495660_0075393 Ga0495660_0075393_388_1032 213
461 3300053080 Ga0500635_0001446 Ga0500635_0001446_2250_2894 213
462 3300053122 Ga0500608_031671 Ga0500608_031671_408_1052 213
463 3300053125 Ga0500618_000142 Ga0500618_000142_30976_31620 213
464 3300059424 Ga0590075_000806 Ga0590075_000806_669_1316 213
465 iso_pu_bacteria 2818991442 2819577641 213
466 iso_pu_bacteria 2821136567 2821142184 213
467 iso_pu_bacteria 2852623160 2852624962 213
468 iso_pu_bacteria 2884933994 2884936012 213
469 iso_pu_bacteria 2904467357 2904470647 213
470 3300005288 Ga0065714_10090585 Ga0065714_100905853 214
471 iso_pu_bacteria 2738541278 2738724770 214
472 iso_pu_bacteria 2919437846 2919438807 214
473 3300021384 Ga0213876_10002467 Ga0213876_100024679 216
474 3300039437 Ga0436365_1179973 Ga0436365_1179973_14407_15060 216
475 3300046810 Ga0495660_0013907 Ga0495660_0013907_471_1121 216
476 3300001990 JGI24737J22298_10000227 JGI24737J22298_1000022716 217
477 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002448 217
478 3300003316 rootH1_10045344 rootH1_100453442 217
479 3300003323 rootH1_10168090 rootH1_101680902 217
480 3300003323 rootH1_10233864 rootH1_102338642 217
481 3300005288 Ga0065714_10073449 Ga0065714_100734492 217
482 3300005288 Ga0065714_10124708 Ga0065714_101247081 217
483 3300005539 Ga0068853_100142365 Ga0068853_1001423653 217
484 3300005539 Ga0068853_100202548 Ga0068853_1002025481 217
485 3300006195 Ga0075366_10012650 Ga0075366_100126501 217
486 3300009093 Ga0105240_10293724 Ga0105240_102937241 217
487 3300009147 Ga0114129_10004031 Ga0114129_100040312 217
488 3300009174 Ga0105241_10892784 Ga0105241_108927842 217
489 3300009545 Ga0105237_10155572 Ga0105237_101555722 217
490 3300010375 Ga0105239_10004611 Ga0105239_100046112 217
491 3300010375 Ga0105239_10008566 Ga0105239_1000856610 217
492 3300010375 Ga0105239_10341504 Ga0105239_103415042 217
493 3300010375 Ga0105239_10971625 Ga0105239_109716252 217
494 3300013102 Ga0157371_10083390 Ga0157371_100833904 217
495 3300013104 Ga0157370_10234957 Ga0157370_102349571 217
496 3300013105 Ga0157369_10047681 Ga0157369_100476811 217
497 3300013296 Ga0157374_10327344 Ga0157374_103273442 217
498 3300013306 Ga0163162_10383957 Ga0163162_103839573 217
499 3300013307 Ga0157372_10001233 Ga0157372_100012331 217
500 3300015265 Ga0182005_1004167 Ga0182005_10041674 217
501 3300017792 Ga0163161_10001043 Ga0163161_1000104312 217
502 3300017792 Ga0163161_10592064 Ga0163161_105920642 217
503 3300025208 Ga0209436_102408 Ga0209436_1024089 217
504 3300025246 Ga0209646_1001930 Ga0209646_10019306 217
505 3300025302 Ga0207426_1002573 Ga0207426_10025732 217
506 3300025913 Ga0207695_10187302 Ga0207695_101873021 217
507 3300025914 Ga0207671_10011422 Ga0207671_100114225 217
508 3300026041 Ga0207639_10132143 Ga0207639_101321433 217
509 3300026041 Ga0207639_10135240 Ga0207639_101352403 217
510 3300028794 Ga0307515_10004758 Ga0307515_1000475813 217
511 3300028794 Ga0307515_10011347 Ga0307515_100113478 217
512 3300031456 Ga0307513_10207758 Ga0307513_102077583 217
513 3300031456 Ga0307513_10283975 Ga0307513_102839751 217
514 3300031507 Ga0307509_10183593 Ga0307509_101835931 217
515 3300033179 Ga0307507_10001977 Ga0307507_1000197740 217
516 3300037312 Ga0395899_0000001 Ga0395899_0000001_117924_118577 217
517 3300041509 Ga0451843_1695759 Ga0451843_1695759_13_666 217
518 3300044842 Ga0466957_0006428 Ga0466957_0006428_4909_5562 217
519 3300046462 Ga0495651_0121740 Ga0495651_0121740_514_1167 217
520 3300046492 Ga0495585_0000723 Ga0495585_0000723_2937_3590 217
521 3300046492 Ga0495585_0003748 Ga0495585_0003748_8710_9363 217
522 3300046507 Ga0495606_0000003 Ga0495606_0000003_313747_314400 217
523 3300046507 Ga0495606_0059081 Ga0495606_0059081_660_1313 217
524 3300046512 Ga0495610_0000273 Ga0495610_0000273_31230_31883 217
525 3300046513 Ga0495616_0027571 Ga0495616_0027571_499_1158 217
526 3300046524 Ga0495648_0037682 Ga0495648_0037682_889_1542 217
527 3300046529 Ga0495652_0120370 Ga0495652_0120370_340_999 217
528 3300046538 Ga0495609_0010151 Ga0495609_0010151_1325_1978 217
529 3300046538 Ga0495609_0035849 Ga0495609_0035849_758_1411 217
530 3300046557 Ga0495622_0046331 Ga0495622_0046331_1325_1978 217
531 3300046558 Ga0495633_0000269 Ga0495633_0000269_50218_50871 217
532 3300046558 Ga0495633_0016633 Ga0495633_0016633_2436_3089 217
533 3300046616 Ga0495668_0000032 Ga0495668_0000032_244160_244813 217
534 3300046660 Ga0495625_0000304 Ga0495625_0000304_47542_48195 217
535 3300046660 Ga0495625_0000993 Ga0495625_0000993_32094_32747 217
536 3300046660 Ga0495625_0229107 Ga0495625_0229107_201_854 217
537 3300046660 Ga0495625_0263913 Ga0495625_0263913_70_729 217
538 3300046665 Ga0495661_0028328 Ga0495661_0028328_2037_2690 217
539 3300046683 Ga0495658_0141113 Ga0495658_0141113_168_821 217
540 3300046809 Ga0495600_0229575 Ga0495600_0229575_315_968 217
541 3300046810 Ga0495660_0045669 Ga0495660_0045669_154_807 217
542 3300047472 Ga0495686_0060268 Ga0495686_0060268_1315_1974 217
543 3300048089 Ga0495614_0010900 Ga0495614_0010900_2800_3453 217
544 3300049459 Ga0495678_005512 Ga0495678_005512_6252_6911 217
545 3300050493 nmdc:mga0k408_713_c1 nmdc:mga0k408_713_c1_64_717 217
546 3300050507 nmdc:mga05p37_23907_c1 nmdc:mga05p37_23907_c1_148_801 217
547 3300053090 Ga0500646_0007943 Ga0500646_0007943_179_832 217
548 3300053091 Ga0500647_0125587 Ga0500647_0125587_99_752 217
549 3300053092 Ga0500583_0000648 Ga0500583_0000648_2809_3462 217
550 3300053122 Ga0500608_076100 Ga0500608_076100_436_1089 217
551 3300053123 Ga0500614_029038 Ga0500614_029038_145_798 217
552 3300053125 Ga0500618_000150 Ga0500618_000150_45141_45794 217
553 3300053131 Ga0500652_124333 Ga0500652_124333_68_721 217
554 3300053147 Ga0500589_044855 Ga0500589_044855_173_826 217
555 3300053163 Ga0500639_167792 Ga0500639_167792_44_697 217
556 3300053727 Ga0500611_019062 Ga0500611_019062_585_1238 217
557 iso_pu_bacteria 2599185184 2599478506 217
558 iso_pu_bacteria 2928078545 2928080442 217
559 iso_pu_bacteria 2928147474 2928149386 217
560 iso_pu_bacteria 2932082852 2932083217 217
561 3300003316 rootH1_10061801 rootH1_100618011 218
562 3300003323 rootH1_10326186 rootH1_103261863 218
563 3300005539 Ga0068853_100225771 Ga0068853_1002257713 218
564 3300005563 Ga0068855_100012990 Ga0068855_1000129906 218
565 3300005563 Ga0068855_100857549 Ga0068855_1008575492 218
566 3300005577 Ga0068857_100061189 Ga0068857_1000611893 218
567 3300005843 Ga0068860_100130922 Ga0068860_1001309222 218
568 3300006195 Ga0075366_10014933 Ga0075366_100149332 218
569 3300006195 Ga0075366_10101845 Ga0075366_101018453 218
570 3300006195 Ga0075366_10174290 Ga0075366_101742903 218
571 3300009147 Ga0114129_10004843 Ga0114129_100048436 218
572 3300009174 Ga0105241_10054759 Ga0105241_100547592 218
573 3300009545 Ga0105237_10011368 Ga0105237_100113686 218
574 3300010375 Ga0105239_10011451 Ga0105239_100114515 218
575 3300013296 Ga0157374_10061346 Ga0157374_100613462 218
576 3300025242 Ga0209258_105671 Ga0209258_1056712 218
577 3300025246 Ga0209646_1000615 Ga0209646_10006155 218
578 3300025911 Ga0207654_10015752 Ga0207654_100157523 218
579 3300025949 Ga0207667_10014605 Ga0207667_100146052 218
580 3300026041 Ga0207639_10647771 Ga0207639_106477712 218
581 3300026078 Ga0207702_10038000 Ga0207702_100380003 218
582 3300026116 Ga0207674_10082730 Ga0207674_100827303 218
583 3300028381 Ga0268264_10085953 Ga0268264_100859532 218
584 3300030522 Ga0307512_10156020 Ga0307512_101560201 218
585 3300031456 Ga0307513_10103824 Ga0307513_101038243 218
586 3300031456 Ga0307513_10155986 Ga0307513_101559862 218
587 3300031456 Ga0307513_10448906 Ga0307513_104489061 218
588 3300041404 Ga0439436_0023300 Ga0439436_0023300_553_1209 218
589 3300041505 Ga0451849_1018633 Ga0451849_1018633_491_1147 218
590 3300041512 Ga0451853_3921089 Ga0451853_3921089_280_936 218
591 3300042007 Ga0439449_0014731 Ga0439449_0014731_755_1411 218
592 3300042007 Ga0439449_0021859 Ga0439449_0021859_1508_2164 218
593 3300042007 Ga0439449_0045301 Ga0439449_0045301_416_1072 218
594 3300042014 Ga0439457_000072 Ga0439457_000072_12709_13365 218
595 3300042014 Ga0439457_037178 Ga0439457_037178_296_952 218
596 3300042015 Ga0439462_0000326 Ga0439462_0000326_6642_7298 218
597 3300044658 Ga0466972_0000571 Ga0466972_0000571_14384_15040 218
598 3300044658 Ga0466972_0019102 Ga0466972_0019102_135_791 218
599 3300044684 Ga0466966_0000022 Ga0466966_0000022_73361_74017 218
600 3300044693 Ga0466961_0421287 Ga0466961_0421287_14_670 218
601 3300044706 Ga0466964_0215057 Ga0466964_0215057_86_742 218
602 3300044735 Ga0466968_0161226 Ga0466968_0161226_201_857 218
603 3300044842 Ga0466957_0000411 Ga0466957_0000411_6320_6976 218
604 3300044842 Ga0466957_0030049 Ga0466957_0030049_223_882 218
605 3300045049 Ga0466959_0000055 Ga0466959_0000055_73040_73696 218
606 3300046519 Ga0495632_0106654 Ga0495632_0106654_363_1019 218
607 3300046616 Ga0495668_0001067 Ga0495668_0001067_16596_17252 218
608 3300049573 Ga0501037_0503059 Ga0501037_0503059_14_670 218
609 3300049581 Ga0501047_0065903 Ga0501047_0065903_2775_3431 218
610 3300049686 Ga0501257_089268 Ga0501257_089268_50_706 218
611 3300049703 Ga0501219_000156 Ga0501219_000156_9400_10056 218
612 3300049705 Ga0501225_0000860 Ga0501225_0000860_8479_9135 218
613 3300049822 Ga0501035_0082398 Ga0501035_0082398_1992_2648 218
614 3300049823 Ga0501044_0003835 Ga0501044_0003835_3188_3844 218
615 3300050493 nmdc:mga0k408_21815_c1 nmdc:mga0k408_21815_c1_1308_1964 218
616 3300050507 nmdc:mga05p37_3277_c1 nmdc:mga05p37_3277_c1_7447_8103 218
617 3300053086 Ga0500578_0000010 Ga0500578_0000010_36556_37212 218
618 3300053086 Ga0500578_0078696 Ga0500578_0078696_1414_2070 218
619 3300053088 Ga0500644_0033077 Ga0500644_0033077_925_1581 218
620 3300053090 Ga0500646_0092397 Ga0500646_0092397_120_776 218
621 3300053092 Ga0500583_0000039 Ga0500583_0000039_74252_74908 218
622 3300053092 Ga0500583_0000663 Ga0500583_0000663_3948_4604 218
623 3300053092 Ga0500583_0098232 Ga0500583_0098232_158_814 218
624 3300053092 Ga0500583_0122585 Ga0500583_0122585_142_798 218
625 3300053103 Ga0500555_022008 Ga0500555_022008_279_935 218
626 3300053130 Ga0500642_0154709 Ga0500642_0154709_317_973 218
627 3300053131 Ga0500652_030756 Ga0500652_030756_538_1194 218
628 3300053147 Ga0500589_111600 Ga0500589_111600_399_1055 218
629 3300053156 Ga0500622_0023303 Ga0500622_0023303_1317_1973 218
630 3300053177 Ga0500636_0069537 Ga0500636_0069537_1355_2011 218
631 3300053178 Ga0500637_0269298 Ga0500637_0269298_110_766 218
632 3300061719 Ga0466962_0170410 Ga0466962_0170410_388_1044 218
633 2162886012 MBSR1b_contig_8140190 MBSR1b_0158.00001050 219
634 2162886012 MBSR1b_contig_8930577 MBSR1b_0106.00000740 219
635 3300003316 rootH1_10061802 rootH1_100618024 219
636 3300003320 rootH2_10006602 rootH2_1000660226 219
637 3300003320 rootH2_10035936 rootH2_100359365 219
638 3300003320 rootH2_10057451 rootH2_100574515 219
639 3300005290 Ga0065712_10083690 Ga0065712_100836904 219
640 3300005293 Ga0065715_10119205 Ga0065715_101192052 219
641 3300005329 Ga0070683_100012300 Ga0070683_1000123003 219
642 3300005331 Ga0070670_100149166 Ga0070670_1001491663 219
643 3300005334 Ga0068869_100035489 Ga0068869_1000354892 219
644 3300005337 Ga0070682_100608284 Ga0070682_1006082842 219
645 3300005337 Ga0070682_100753470 Ga0070682_1007534702 219
646 3300005340 Ga0070689_100051404 Ga0070689_1000514043 219
647 3300005347 Ga0070668_100013323 Ga0070668_1000133233 219
648 3300005347 Ga0070668_100184533 Ga0070668_1001845332 219
649 3300005353 Ga0070669_100000934 Ga0070669_10000093418 219
650 3300005354 Ga0070675_100021516 Ga0070675_1000215165 219
651 3300005364 Ga0070673_100014069 Ga0070673_1000140693 219
652 3300005365 Ga0070688_100000510 Ga0070688_1000005105 219
653 3300005367 Ga0070667_100138613 Ga0070667_1001386132 219
654 3300005367 Ga0070667_100143851 Ga0070667_1001438512 219
655 3300005441 Ga0070700_100037482 Ga0070700_1000374825 219
656 3300005456 Ga0070678_100489903 Ga0070678_1004899031 219
657 3300005457 Ga0070662_100008951 Ga0070662_1000089516 219
658 3300005459 Ga0068867_100007419 Ga0068867_1000074193 219
659 3300005459 Ga0068867_100019363 Ga0068867_1000193633 219
660 3300005471 Ga0070698_100345486 Ga0070698_1003454862 219
661 3300005518 Ga0070699_101005853 Ga0070699_1010058531 219
662 3300005535 Ga0070684_100011435 Ga0070684_1000114356 219
663 3300005539 Ga0068853_100001211 Ga0068853_1000012112 219
664 3300005543 Ga0070672_100033374 Ga0070672_1000333746 219
665 3300005543 Ga0070672_100229535 Ga0070672_1002295352 219
666 3300005548 Ga0070665_100000002 Ga0070665_100000002469 219
667 3300005563 Ga0068855_100000303 Ga0068855_10000030332 219
668 3300005563 Ga0068855_100015293 Ga0068855_1000152936 219
669 3300005563 Ga0068855_100025300 Ga0068855_1000253004 219
670 3300005564 Ga0070664_100166444 Ga0070664_1001664443 219
671 3300005577 Ga0068857_100014797 Ga0068857_1000147973 219
672 3300005578 Ga0068854_100057157 Ga0068854_1000571573 219
673 3300005614 Ga0068856_100086138 Ga0068856_1000861384 219
674 3300005616 Ga0068852_100002788 Ga0068852_1000027886 219
675 3300005617 Ga0068859_100013226 Ga0068859_1000132268 219
676 3300005718 Ga0068866_10087895 Ga0068866_100878952 219
677 3300005719 Ga0068861_100004638 Ga0068861_1000046382 219
678 3300005841 Ga0068863_100343107 Ga0068863_1003431072 219
679 3300005843 Ga0068860_100000003 Ga0068860_10000000385 219
680 3300005843 Ga0068860_100000991 Ga0068860_10000099122 219
681 3300005843 Ga0068860_100040178 Ga0068860_1000401782 219
682 3300005844 Ga0068862_100072224 Ga0068862_1000722243 219
683 3300005983 Ga0081540_1006723 Ga0081540_10067234 219
684 3300006237 Ga0097621_100445918 Ga0097621_1004459182 219
685 3300006358 Ga0068871_100218305 Ga0068871_1002183052 219
686 3300006358 Ga0068871_100246069 Ga0068871_1002460691 219
687 3300006358 Ga0068871_100349861 Ga0068871_1003498612 219
688 3300006358 Ga0068871_100812944 Ga0068871_1008129441 219
689 3300006931 Ga0097620_100013226 Ga0097620_1000132268 219
690 3300009093 Ga0105240_10002527 Ga0105240_1000252718 219
691 3300009093 Ga0105240_10004693 Ga0105240_100046938 219
692 3300009093 Ga0105240_10004802 Ga0105240_100048027 219
693 3300009093 Ga0105240_10009628 Ga0105240_100096287 219
694 3300009093 Ga0105240_10021720 Ga0105240_100217205 219
695 3300009093 Ga0105240_10046065 Ga0105240_100460653 219
696 3300009093 Ga0105240_10098107 Ga0105240_100981071 219
697 3300009093 Ga0105240_10237008 Ga0105240_102370082 219
698 3300009094 Ga0111539_10000962 Ga0111539_1000096217 219
699 3300009174 Ga0105241_10000864 Ga0105241_100008645 219
700 3300009176 Ga0105242_10152181 Ga0105242_101521812 219
701 3300009545 Ga0105237_10004982 Ga0105237_1000498211 219
702 3300009545 Ga0105237_10007200 Ga0105237_100072007 219
703 3300009545 Ga0105237_10007849 Ga0105237_100078493 219
704 3300009545 Ga0105237_10011870 Ga0105237_100118708 219
705 3300009545 Ga0105237_10015433 Ga0105237_100154337 219
706 3300009545 Ga0105237_10048443 Ga0105237_100484433 219
707 3300009551 Ga0105238_10005073 Ga0105238_100050732 219
708 3300009551 Ga0105238_10180359 Ga0105238_101803592 219
709 3300009551 Ga0105238_10303971 Ga0105238_103039712 219
710 3300009553 Ga0105249_10040578 Ga0105249_100405784 219
711 3300009553 Ga0105249_10050948 Ga0105249_100509482 219
712 3300010375 Ga0105239_10000252 Ga0105239_1000025247 219
713 3300010375 Ga0105239_10008890 Ga0105239_100088909 219
714 3300010375 Ga0105239_10024239 Ga0105239_100242392 219
715 3300010375 Ga0105239_10034520 Ga0105239_100345202 219
716 3300010375 Ga0105239_10041186 Ga0105239_100411863 219
717 3300010375 Ga0105239_10059111 Ga0105239_100591112 219
718 3300010375 Ga0105239_10360348 Ga0105239_103603482 219
719 3300013100 Ga0157373_10058910 Ga0157373_100589103 219
720 3300013100 Ga0157373_10138219 Ga0157373_101382192 219
721 3300013104 Ga0157370_10025160 Ga0157370_100251604 219
722 3300013104 Ga0157370_10034709 Ga0157370_100347095 219
723 3300013105 Ga0157369_10396198 Ga0157369_103961982 219
724 3300013105 Ga0157369_10686923 Ga0157369_106869231 219
725 3300013296 Ga0157374_10000013 Ga0157374_10000013201 219
726 3300013297 Ga0157378_10107670 Ga0157378_101076702 219
727 3300013297 Ga0157378_10264970 Ga0157378_102649702 219
728 3300013306 Ga0163162_10001007 Ga0163162_1000100718 219
729 3300013306 Ga0163162_10147740 Ga0163162_101477403 219
730 3300013306 Ga0163162_10739063 Ga0163162_107390632 219
731 3300013307 Ga0157372_10005354 Ga0157372_1000535410 219
732 3300013307 Ga0157372_10056004 Ga0157372_100560042 219
733 3300013307 Ga0157372_10076406 Ga0157372_100764062 219
734 3300013307 Ga0157372_10095920 Ga0157372_100959202 219
735 3300013308 Ga0157375_10008365 Ga0157375_100083653 219
736 3300014325 Ga0163163_10357950 Ga0163163_103579502 219
737 3300014326 Ga0157380_10015109 Ga0157380_100151096 219
738 3300014745 Ga0157377_10029113 Ga0157377_100291132 219
739 3300014969 Ga0157376_10005733 Ga0157376_100057336 219
740 3300020078 Ga0206352_11032327 Ga0206352_110323272 219
741 3300025315 Ga0207697_10126376 Ga0207697_101263763 219
742 3300025899 Ga0207642_10050167 Ga0207642_100501672 219
743 3300025903 Ga0207680_10032116 Ga0207680_100321162 219
744 3300025904 Ga0207647_10031630 Ga0207647_100316303 219
745 3300025904 Ga0207647_10344552 Ga0207647_103445522 219
746 3300025906 Ga0207699_10328991 Ga0207699_103289912 219
747 3300025908 Ga0207643_10020936 Ga0207643_100209363 219
748 3300025911 Ga0207654_10037185 Ga0207654_100371852 219
749 3300025913 Ga0207695_10000051 Ga0207695_1000005138 219
750 3300025913 Ga0207695_10000056 Ga0207695_10000056204 219
751 3300025913 Ga0207695_10000066 Ga0207695_1000006696 219
752 3300025913 Ga0207695_10000081 Ga0207695_1000008138 219
753 3300025913 Ga0207695_10000156 Ga0207695_1000015614 219
754 3300025913 Ga0207695_10002773 Ga0207695_1000277314 219
755 3300025913 Ga0207695_10017121 Ga0207695_100171214 219
756 3300025913 Ga0207695_10019732 Ga0207695_100197322 219
757 3300025913 Ga0207695_10159941 Ga0207695_101599412 219
758 3300025914 Ga0207671_10001925 Ga0207671_100019255 219
759 3300025914 Ga0207671_10007568 Ga0207671_100075682 219
760 3300025914 Ga0207671_10009812 Ga0207671_100098124 219
761 3300025914 Ga0207671_10014922 Ga0207671_100149223 219
762 3300025914 Ga0207671_10177474 Ga0207671_101774741 219
763 3300025923 Ga0207681_10012023 Ga0207681_100120236 219
764 3300025924 Ga0207694_10124867 Ga0207694_101248672 219
765 3300025925 Ga0207650_10115834 Ga0207650_101158342 219
766 3300025926 Ga0207659_10377078 Ga0207659_103770782 219
767 3300025933 Ga0207706_10018091 Ga0207706_100180917 219
768 3300025936 Ga0207670_10072836 Ga0207670_100728362 219
769 3300025937 Ga0207669_10250083 Ga0207669_102500832 219
770 3300025940 Ga0207691_10406044 Ga0207691_104060442 219
771 3300025942 Ga0207689_10041358 Ga0207689_100413582 219
772 3300025944 Ga0207661_10008165 Ga0207661_100081653 219
773 3300025949 Ga0207667_10000713 Ga0207667_1000071325 219
774 3300025949 Ga0207667_10001082 Ga0207667_100010823 219
775 3300025960 Ga0207651_10058557 Ga0207651_100585572 219
776 3300025961 Ga0207712_10065778 Ga0207712_100657782 219
777 3300025961 Ga0207712_10132384 Ga0207712_101323842 219
778 3300025981 Ga0207640_10101047 Ga0207640_101010471 219
779 3300025986 Ga0207658_10034061 Ga0207658_100340612 219
780 3300026041 Ga0207639_10002473 Ga0207639_100024734 219
781 3300026041 Ga0207639_10054131 Ga0207639_100541312 219
782 3300026078 Ga0207702_10262543 Ga0207702_102625431 219
783 3300026089 Ga0207648_10022019 Ga0207648_100220194 219
784 3300026116 Ga0207674_10003327 Ga0207674_100033273 219
785 3300026116 Ga0207674_10009705 Ga0207674_100097058 219
786 3300026118 Ga0207675_100000260 Ga0207675_10000026027 219
787 3300026118 Ga0207675_100144993 Ga0207675_1001449932 219
788 3300026142 Ga0207698_10015082 Ga0207698_100150822 219
789 3300028379 Ga0268266_10000073 Ga0268266_1000007334 219
790 3300028380 Ga0268265_10013170 Ga0268265_100131707 219
791 3300028381 Ga0268264_10000063 Ga0268264_100000633 219
792 3300028381 Ga0268264_10006772 Ga0268264_100067723 219
793 3300028381 Ga0268264_10032633 Ga0268264_100326332 219
794 3300029957 Ga0265324_10106507 Ga0265324_101065072 219
795 3300030521 Ga0307511_10000232 Ga0307511_1000023213 219
796 3300031507 Ga0307509_10137330 Ga0307509_101373303 219
797 3300031730 Ga0307516_10000768 Ga0307516_1000076837 219
798 3300031852 Ga0307410_10079764 Ga0307410_100797642 219
799 3300031901 Ga0307406_10195874 Ga0307406_101958742 219
800 3300033180 Ga0307510_10000637 Ga0307510_1000063717 219
801 3300035115 Ga0373941_0179980 Ga0373941_0179980_61_720 219
802 3300035172 Ga0373955_0237595 Ga0373955_0237595_275_934 219
803 3300041406 Ga0439439_0006062 Ga0439439_0006062_490_1149 219
804 3300041411 Ga0439466_0123634 Ga0439466_0123634_22_681 219
805 3300041509 Ga0451843_0419312 Ga0451843_0419312_115_774 219
806 3300042006 Ga0439432_073451 Ga0439432_073451_32_691 219
807 3300042007 Ga0439449_0032968 Ga0439449_0032968_1183_1842 219
808 3300042014 Ga0439457_003482 Ga0439457_003482_1479_2138 219
809 3300042131 Ga0450894_010694 Ga0450894_010694_260_919 219
810 3300042132 Ga0450895_012677 Ga0450895_012677_34_693 219
811 3300042135 Ga0450899_005855 Ga0450899_005855_615_1274 219
812 3300042156 Ga0439446_0132497 Ga0439446_0132497_14_673 219
813 3300044658 Ga0466972_0075328 Ga0466972_0075328_530_1189 219
814 3300044683 Ga0466965_0050017 Ga0466965_0050017_865_1524 219
815 3300044765 Ga0466970_0047829 Ga0466970_0047829_66_728 219
816 3300044842 Ga0466957_0581647 Ga0466957_0581647_62_721 219
817 3300045049 Ga0466959_0005141 Ga0466959_0005141_8092_8754 219
818 3300046460 Ga0495638_0042658 Ga0495638_0042658_668_1327 219
819 3300046460 Ga0495638_0165846 Ga0495638_0165846_142_801 219
820 3300046471 Ga0495650_0043031 Ga0495650_0043031_1010_1669 219
821 3300046507 Ga0495606_0005679 Ga0495606_0005679_3006_3665 219
822 3300046522 Ga0495643_0096259 Ga0495643_0096259_632_1291 219
823 3300046524 Ga0495648_0011656 Ga0495648_0011656_4532_5191 219
824 3300046648 Ga0495611_0004900 Ga0495611_0004900_4714_5373 219
825 3300046694 Ga0495649_0032101 Ga0495649_0032101_1479_2138 219
826 3300046694 Ga0495649_0376623 Ga0495649_0376623_13_672 219
827 3300047319 Ga0495674_0462146 Ga0495674_0462146_20_682 219
828 3300047443 Ga0495687_000040 Ga0495687_000040_8329_8988 219
829 3300047472 Ga0495686_0000010 Ga0495686_0000010_345915_346574 219
830 3300047472 Ga0495686_0066871 Ga0495686_0066871_931_1590 219
831 3300050511 nmdc:mga08y16_444052_c1 nmdc:mga08y16_444052_c1_397_1056 219
832 3300053086 Ga0500578_0265995 Ga0500578_0265995_76_735 219
833 3300053092 Ga0500583_0099898 Ga0500583_0099898_438_1097 219
834 3300053093 Ga0500651_0168522 Ga0500651_0168522_232_891 219
835 3300053098 Ga0500650_0196838 Ga0500650_0196838_206_865 219
836 3300053130 Ga0500642_0006554 Ga0500642_0006554_340_999 219
837 3300053139 Ga0500568_0027829 Ga0500568_0027829_171_830 219
838 3300053156 Ga0500622_0004994 Ga0500622_0004994_2840_3499 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

172

228

0.97

PF00072

Response_reg

Response regulator receiver domain

32

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9547 156 211
1qmp-assembly2.cif.gz_B phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a 0.9464 8 125
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9461 157 217
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9458 156 219
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9446 157 217
ID Description Score Start End Superfamily
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9547 156 211 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9487 157 211 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9465 157 211 1.10.10.10
1qmpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9464 8 125 3.40.50.2300
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9443 151 214 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3WAF0-F1-model_v4 Response regulator transcription factor 0.9864 5 143 GO:0000160
AF-A0A7G6YP66-F1-model_v4 Response regulator transcription factor 0.9731 1 127 GO:0000160
GO:0016020
AF-A0A4Q3WAF0-F1-model_v4 Response regulator transcription factor 0.9726 5 143 GO:0000160
AF-A0A1M7AU28-F1-model_v4 Response regulator receiver domain-containing protein 0.9716 1 127 GO:0000160
AF-A0A519S1Y2-F1-model_v4 Response regulator transcription factor 0.9699 8 136 GO:0000160

Feature Viewer

pLDDT pTM Quality
86.36 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map