F482975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 838 | 382 | 813 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300005718|Ga0068866_10239976|Ga0068866_102399762 |
| Length | 236 |
| Sequence | VKCLSNHSQARVHASKYLFLILKPMEAEKILIAIVDDHTLFRNGVAGLMSEFNELKVVFEAENGQQMQYALEKHQLPQVILMDINMPVMDGYDATCWLKKNYPQIRVLALSMFEDDKAVIKMIKCGASGYVLKESRPKDLLEAIKTIHTKGVYINELVSGKLIRSVADDDAPDFTKKELEFLKLCCSELTYKEIADKMFVSPRTVDNYREALFLKLNLKSRTGLVLYAIQNQVFTF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 5 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 6 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 7 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 8 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 9 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 10 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 11 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 12 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 13 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 14 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 15 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 16 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 17 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 18 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 19 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 20 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 21 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 22 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 23 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 24 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 25 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 26 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 30 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 31 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 32 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 33 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 34 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 35 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 43 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 48 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 231 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 232 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 259 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 260 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 261 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 262 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 263 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 268 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 269 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 270 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 271 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 274 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 280 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 320 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 321 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 322 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 323 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 328 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 329 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 330 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 331 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 332 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 336 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 337 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 339 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 341 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 342 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 345 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 346 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 347 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 348 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 360 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 361 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 363 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 364 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 365 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 366 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 367 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 369 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 370 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 372 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 375 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 378 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 380 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 381 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.78 |
| Metatranscriptomes | 0.12 |
| Isolates | 3.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.35 |
| Nodule | 0 |
| Rhizoplane | 0.24 |
| Rhizosphere | 83.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_8140190 | 2162886012 | Unclassified | 1396 |
| 2 | MBSR1b_contig_8930577 | 2162886012 | Bacteria | 1898 |
| 3 | JGI24737J22298_10000227 | 3300001990 | Bacteria | 18576 |
| 4 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 5 | JGI24744J21845_10020228 | 3300002077 | Bacteria | 1314 |
| 6 | JGI24751J29686_10000015 | 3300002459 | Bacteria | 112804 |
| 7 | JGI25162J39368_1000435 | 3300002737 | Bacteria | 33619 |
| 8 | JGI25157J39369_1009630 | 3300002741 | Bacteria | 1294 |
| 9 | JGI25164J39214_1001884 | 3300002772 | Bacteria | 3919 |
| 10 | JGI25152J39213_1000054 | 3300002773 | Bacteria | 76796 |
| 11 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 12 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 13 | JGI25165J46597_1001213 | 3300003214 | Bacteria | 15503 |
| 14 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 15 | rootH1_10045344 | 3300003316 | Bacteria | 1121 |
| 16 | rootH1_10048329 | 3300003316 | Bacteria | 6986 |
| 17 | rootH1_10057924 | 3300003316 | Bacteria | 15146 |
| 18 | rootH1_10061801 | 3300003316 | Bacteria | 3597 |
| 19 | rootH1_10061802 | 3300003316 | Bacteria | 3080 |
| 20 | rootH1_10061802 | 3300003323 | Bacteria | 2799 |
| 21 | rootH2_10001274 | 3300003320 | Bacteria | 94480 |
| 22 | rootH2_10006602 | 3300003320 | Bacteria | 39003 |
| 23 | rootH2_10035936 | 3300003320 | Bacteria | 8028 |
| 24 | rootH2_10057451 | 3300003320 | Bacteria | 8559 |
| 25 | rootL2_10030820 | 3300003322 | Bacteria | 3992 |
| 26 | rootL2_10063246 | 3300003322 | Bacteria | 7963 |
| 27 | rootL2_10178833 | 3300003322 | Unclassified | 2553 |
| 28 | rootL2_10224865 | 3300003322 | Bacteria | 3358 |
| 29 | rootL2_10306079 | 3300003322 | Bacteria | 1618 |
| 30 | rootL2_10314446 | 3300003322 | Unclassified | 1255 |
| 31 | rootH1_10003362 | 3300003323 | Bacteria | 34489 |
| 32 | rootH1_10036959 | 3300003323 | Bacteria | 3914 |
| 33 | rootH1_10168090 | 3300003323 | Bacteria | 4886 |
| 34 | rootH1_10233864 | 3300003323 | Bacteria | 3550 |
| 35 | rootH1_10326186 | 3300003323 | Bacteria | 2400 |
| 36 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 37 | Ga0055530_10002643 | 3300003791 | Bacteria | 11212 |
| 38 | Ga0065714_10002307 | 3300005288 | Bacteria | 26043 |
| 39 | Ga0065714_10021495 | 3300005288 | Bacteria | 1078 |
| 40 | Ga0065714_10073449 | 3300005288 | Bacteria | 3182 |
| 41 | Ga0065714_10074001 | 3300005288 | Bacteria | 3097 |
| 42 | Ga0065714_10083206 | 3300005288 | Bacteria | 2263 |
| 43 | Ga0065714_10090585 | 3300005288 | Unclassified | 1939 |
| 44 | Ga0065714_10124708 | 3300005288 | Bacteria | 1301 |
| 45 | Ga0065714_10137475 | 3300005288 | Bacteria | 1197 |
| 46 | Ga0065714_10220103 | 3300005288 | Bacteria | 838 |
| 47 | Ga0065704_10139651 | 3300005289 | Unclassified | 1531 |
| 48 | Ga0065712_10000430 | 3300005290 | Bacteria | 12470 |
| 49 | Ga0065712_10083690 | 3300005290 | Unclassified | 2817 |
| 50 | Ga0065712_10258451 | 3300005290 | Bacteria | 943 |
| 51 | Ga0065715_10001577 | 3300005293 | Bacteria | 6228 |
| 52 | Ga0065715_10119205 | 3300005293 | Bacteria | 2293 |
| 53 | Ga0070658_10000056 | 3300005327 | Bacteria | 114761 |
| 54 | Ga0070658_10149113 | 3300005327 | Bacteria | 1957 |
| 55 | Ga0070676_10000483 | 3300005328 | Bacteria | 18990 |
| 56 | Ga0070676_10286193 | 3300005328 | Bacteria | 1112 |
| 57 | Ga0070683_100012300 | 3300005329 | Bacteria | 7434 |
| 58 | Ga0070670_100000206 | 3300005331 | Bacteria | 54782 |
| 59 | Ga0070670_100067827 | 3300005331 | Bacteria | 3060 |
| 60 | Ga0070670_100149166 | 3300005331 | Bacteria | 2024 |
| 61 | Ga0070670_100167608 | 3300005331 | Bacteria | 1905 |
| 62 | Ga0068869_100035489 | 3300005334 | Bacteria | 3533 |
| 63 | Ga0068869_100245099 | 3300005334 | Bacteria | 1429 |
| 64 | Ga0068869_100482176 | 3300005334 | Unclassified | 1033 |
| 65 | Ga0070666_10026629 | 3300005335 | Unclassified | 3781 |
| 66 | Ga0070682_100000128 | 3300005337 | Bacteria | 65176 |
| 67 | Ga0070682_100009239 | 3300005337 | Bacteria | 5576 |
| 68 | Ga0070682_100608284 | 3300005337 | Bacteria | 864 |
| 69 | Ga0070682_100753470 | 3300005337 | Bacteria | 786 |
| 70 | Ga0068868_100083750 | 3300005338 | Bacteria | 2561 |
| 71 | Ga0068868_100934516 | 3300005338 | Unclassified | 790 |
| 72 | Ga0070660_100270344 | 3300005339 | Bacteria | 1389 |
| 73 | Ga0070660_101018209 | 3300005339 | Unclassified | 700 |
| 74 | Ga0070689_100000319 | 3300005340 | Bacteria | 28095 |
| 75 | Ga0070689_100051404 | 3300005340 | Bacteria | 3186 |
| 76 | Ga0070689_100436969 | 3300005340 | Bacteria | 1111 |
| 77 | Ga0070691_10022586 | 3300005341 | Bacteria | 2919 |
| 78 | Ga0070692_10006967 | 3300005345 | Bacteria | 4948 |
| 79 | Ga0070692_10218559 | 3300005345 | Unclassified | 1125 |
| 80 | Ga0070668_100013323 | 3300005347 | Bacteria | 6137 |
| 81 | Ga0070668_100184533 | 3300005347 | Unclassified | 1706 |
| 82 | Ga0070669_100000934 | 3300005353 | Bacteria | 21298 |
| 83 | Ga0070669_100102259 | 3300005353 | Bacteria | 2163 |
| 84 | Ga0070675_100021516 | 3300005354 | Bacteria | 5155 |
| 85 | Ga0070674_100038925 | 3300005356 | Unclassified | 3208 |
| 86 | Ga0070673_100006813 | 3300005364 | Bacteria | 7463 |
| 87 | Ga0070673_100014069 | 3300005364 | Bacteria | 5558 |
| 88 | Ga0070688_100000510 | 3300005365 | Bacteria | 19613 |
| 89 | Ga0070659_100018458 | 3300005366 | Bacteria | 5265 |
| 90 | Ga0070667_100138613 | 3300005367 | Bacteria | 2128 |
| 91 | Ga0070667_100143851 | 3300005367 | Unclassified | 2090 |
| 92 | Ga0070703_10009040 | 3300005406 | Bacteria | 2809 |
| 93 | Ga0070701_10077074 | 3300005438 | Unclassified | 1796 |
| 94 | Ga0070701_10170658 | 3300005438 | Bacteria | 1266 |
| 95 | Ga0070701_10397679 | 3300005438 | Bacteria | 872 |
| 96 | Ga0070705_100127967 | 3300005440 | Bacteria | 1652 |
| 97 | Ga0070700_100002107 | 3300005441 | Bacteria | 10105 |
| 98 | Ga0070700_100018150 | 3300005441 | Bacteria | 4040 |
| 99 | Ga0070700_100037482 | 3300005441 | Bacteria | 2949 |
| 100 | Ga0070700_100421096 | 3300005441 | Bacteria | 1009 |
| 101 | Ga0070694_100003543 | 3300005444 | Bacteria | 9334 |
| 102 | Ga0070694_100011567 | 3300005444 | Bacteria | 5465 |
| 103 | Ga0070694_100094247 | 3300005444 | Bacteria | 2106 |
| 104 | Ga0070694_100213837 | 3300005444 | Bacteria | 1443 |
| 105 | Ga0070678_100010530 | 3300005456 | Bacteria | 5657 |
| 106 | Ga0070678_100330095 | 3300005456 | Bacteria | 1305 |
| 107 | Ga0070678_100489903 | 3300005456 | Unclassified | 1083 |
| 108 | Ga0070662_100008951 | 3300005457 | Bacteria | 6525 |
| 109 | Ga0068867_100007419 | 3300005459 | Bacteria | 7755 |
| 110 | Ga0068867_100019363 | 3300005459 | Bacteria | 4851 |
| 111 | Ga0068867_100036014 | 3300005459 | Bacteria | 3590 |
| 112 | Ga0068867_100167260 | 3300005459 | Bacteria | 1739 |
| 113 | Ga0068867_100250559 | 3300005459 | Unclassified | 1440 |
| 114 | Ga0070706_100008371 | 3300005467 | Bacteria | 9639 |
| 115 | Ga0070707_100232970 | 3300005468 | Bacteria | 1792 |
| 116 | Ga0070698_100013520 | 3300005471 | Bacteria | 8640 |
| 117 | Ga0070698_100345486 | 3300005471 | Bacteria | 1419 |
| 118 | Ga0070699_100505253 | 3300005518 | Bacteria | 1098 |
| 119 | Ga0070699_101005853 | 3300005518 | Bacteria | 764 |
| 120 | Ga0070684_100011435 | 3300005535 | Bacteria | 7073 |
| 121 | Ga0070697_100262071 | 3300005536 | Bacteria | 1480 |
| 122 | Ga0068853_100001211 | 3300005539 | Bacteria | 18396 |
| 123 | Ga0068853_100046310 | 3300005539 | Bacteria | 3729 |
| 124 | Ga0068853_100057054 | 3300005539 | Bacteria | 3369 |
| 125 | Ga0068853_100087140 | 3300005539 | Bacteria | 2739 |
| 126 | Ga0068853_100139477 | 3300005539 | Bacteria | 2176 |
| 127 | Ga0068853_100142365 | 3300005539 | Bacteria | 2153 |
| 128 | Ga0068853_100202548 | 3300005539 | Unclassified | 1806 |
| 129 | Ga0068853_100225771 | 3300005539 | Bacteria | 1712 |
| 130 | Ga0068853_100251343 | 3300005539 | Bacteria | 1622 |
| 131 | Ga0068853_100531961 | 3300005539 | Bacteria | 1112 |
| 132 | Ga0070672_100033374 | 3300005543 | Bacteria | 3898 |
| 133 | Ga0070672_100229535 | 3300005543 | Bacteria | 1559 |
| 134 | Ga0070672_100392553 | 3300005543 | Bacteria | 1188 |
| 135 | Ga0070686_100149774 | 3300005544 | Bacteria | 1633 |
| 136 | Ga0070695_100023844 | 3300005545 | Bacteria | 3767 |
| 137 | Ga0070695_100158146 | 3300005545 | Bacteria | 1588 |
| 138 | Ga0070693_100003801 | 3300005547 | Bacteria | 7069 |
| 139 | Ga0070693_100018920 | 3300005547 | Bacteria | 3603 |
| 140 | Ga0070693_100089584 | 3300005547 | Unclassified | 1852 |
| 141 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 142 | Ga0070665_100000034 | 3300005548 | Bacteria | 324289 |
| 143 | Ga0070704_100398569 | 3300005549 | Bacteria | 1174 |
| 144 | Ga0070704_100416530 | 3300005549 | Bacteria | 1150 |
| 145 | Ga0068855_100000302 | 3300005563 | Bacteria | 61501 |
| 146 | Ga0068855_100000303 | 3300005563 | Bacteria | 61260 |
| 147 | Ga0068855_100000611 | 3300005563 | Bacteria | 43912 |
| 148 | Ga0068855_100004987 | 3300005563 | Bacteria | 16203 |
| 149 | Ga0068855_100012990 | 3300005563 | Bacteria | 10049 |
| 150 | Ga0068855_100013791 | 3300005563 | Bacteria | 9743 |
| 151 | Ga0068855_100015293 | 3300005563 | Bacteria | 9238 |
| 152 | Ga0068855_100025300 | 3300005563 | Bacteria | 7104 |
| 153 | Ga0068855_100043825 | 3300005563 | Bacteria | 5297 |
| 154 | Ga0068855_100857549 | 3300005563 | Bacteria | 962 |
| 155 | Ga0070664_100166444 | 3300005564 | Unclassified | 1953 |
| 156 | Ga0068857_100014797 | 3300005577 | Bacteria | 6806 |
| 157 | Ga0068857_100061189 | 3300005577 | Bacteria | 3345 |
| 158 | Ga0068857_100143380 | 3300005577 | Unclassified | 2160 |
| 159 | Ga0068857_100365774 | 3300005577 | Unclassified | 1337 |
| 160 | Ga0068857_100440878 | 3300005577 | Bacteria | 1216 |
| 161 | Ga0068857_100822224 | 3300005577 | Unclassified | 888 |
| 162 | Ga0068854_100057157 | 3300005578 | Bacteria | 2814 |
| 163 | Ga0068854_100178575 | 3300005578 | Bacteria | 1657 |
| 164 | Ga0068856_100000031 | 3300005614 | Bacteria | 126668 |
| 165 | Ga0068856_100007747 | 3300005614 | Bacteria | 10489 |
| 166 | Ga0068856_100072206 | 3300005614 | Bacteria | 3417 |
| 167 | Ga0068856_100086138 | 3300005614 | Bacteria | 3121 |
| 168 | Ga0070702_100086190 | 3300005615 | Bacteria | 1894 |
| 169 | Ga0068852_100002788 | 3300005616 | Bacteria | 12103 |
| 170 | Ga0068852_100006666 | 3300005616 | Bacteria | 8369 |
| 171 | Ga0068852_100601218 | 3300005616 | Unclassified | 1104 |
| 172 | Ga0068859_100013226 | 3300005617 | Bacteria | 8280 |
| 173 | Ga0068859_100015073 | 3300005617 | Bacteria | 7760 |
| 174 | Ga0068859_100111574 | 3300005617 | Bacteria | 2797 |
| 175 | Ga0068859_100138046 | 3300005617 | Bacteria | 2511 |
| 176 | Ga0068859_100168938 | 3300005617 | Unclassified | 2268 |
| 177 | Ga0068864_100005575 | 3300005618 | Bacteria | 10321 |
| 178 | Ga0068864_100011191 | 3300005618 | Bacteria | 7415 |
| 179 | Ga0068864_100031988 | 3300005618 | Bacteria | 4466 |
| 180 | Ga0068864_100378890 | 3300005618 | Bacteria | 1340 |
| 181 | Ga0068866_10022755 | 3300005718 | Bacteria | 2905 |
| 182 | Ga0068866_10087895 | 3300005718 | Bacteria | 1685 |
| 183 | Ga0068866_10239976 | 3300005718 | Bacteria | 1103 |
| 184 | Ga0068861_100004638 | 3300005719 | Bacteria | 9225 |
| 185 | Ga0068861_100005935 | 3300005719 | Bacteria | 8297 |
| 186 | Ga0068861_100083919 | 3300005719 | Unclassified | 2500 |
| 187 | Ga0068851_10002933 | 3300005834 | Bacteria | 7538 |
| 188 | Ga0068851_10342556 | 3300005834 | Bacteria | 868 |
| 189 | Ga0068870_10015867 | 3300005840 | Unclassified | 3585 |
| 190 | Ga0068870_10023032 | 3300005840 | Bacteria | 3066 |
| 191 | Ga0068863_100343107 | 3300005841 | Bacteria | 1453 |
| 192 | Ga0068858_100037895 | 3300005842 | Bacteria | 4471 |
| 193 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 194 | Ga0068860_100000991 | 3300005843 | Bacteria | 31410 |
| 195 | Ga0068860_100014093 | 3300005843 | Bacteria | 7843 |
| 196 | Ga0068860_100040178 | 3300005843 | Bacteria | 4473 |
| 197 | Ga0068860_100130922 | 3300005843 | Bacteria | 2407 |
| 198 | Ga0068860_100219588 | 3300005843 | Unclassified | 1846 |
| 199 | Ga0068860_100308835 | 3300005843 | Unclassified | 1550 |
| 200 | Ga0068860_100484107 | 3300005843 | Unclassified | 1234 |
| 201 | Ga0068860_100899216 | 3300005843 | Bacteria | 901 |
| 202 | Ga0068862_100072224 | 3300005844 | Bacteria | 2980 |
| 203 | Ga0068862_100913420 | 3300005844 | Unclassified | 864 |
| 204 | Ga0081540_1006723 | 3300005983 | Bacteria | 8316 |
| 205 | Ga0075366_10011521 | 3300006195 | Bacteria | 4993 |
| 206 | Ga0075366_10012650 | 3300006195 | Bacteria | 4792 |
| 207 | Ga0075366_10014933 | 3300006195 | Bacteria | 4441 |
| 208 | Ga0075366_10101845 | 3300006195 | Bacteria | 1724 |
| 209 | Ga0075366_10174290 | 3300006195 | Bacteria | 1305 |
| 210 | Ga0097621_100002837 | 3300006237 | Bacteria | 11885 |
| 211 | Ga0097621_100445918 | 3300006237 | Bacteria | 1165 |
| 212 | Ga0068871_100000482 | 3300006358 | Bacteria | 27275 |
| 213 | Ga0068871_100218305 | 3300006358 | Unclassified | 1651 |
| 214 | Ga0068871_100246069 | 3300006358 | Bacteria | 1556 |
| 215 | Ga0068871_100349861 | 3300006358 | Bacteria | 1307 |
| 216 | Ga0068871_100812944 | 3300006358 | Unclassified | 862 |
| 217 | Ga0075428_100030804 | 3300006844 | Bacteria | 5932 |
| 218 | Ga0075431_100541691 | 3300006847 | Bacteria | 1152 |
| 219 | Ga0075433_10022890 | 3300006852 | Bacteria | 5251 |
| 220 | Ga0075433_10047752 | 3300006852 | Bacteria | 3723 |
| 221 | Ga0075434_100036829 | 3300006871 | Bacteria | 4839 |
| 222 | Ga0075434_100048996 | 3300006871 | Unclassified | 4192 |
| 223 | Ga0075429_100468412 | 3300006880 | Bacteria | 1104 |
| 224 | Ga0068865_100000055 | 3300006881 | Bacteria | 62584 |
| 225 | Ga0097620_100013226 | 3300006931 | Bacteria | 8280 |
| 226 | Ga0097620_100015073 | 3300006931 | Bacteria | 7760 |
| 227 | Ga0097620_100111571 | 3300006931 | Bacteria | 2797 |
| 228 | Ga0097620_100138049 | 3300006931 | Bacteria | 2511 |
| 229 | Ga0097620_100168944 | 3300006931 | Unclassified | 2268 |
| 230 | Ga0105244_10041432 | 3300009036 | Bacteria | 2386 |
| 231 | Ga0105240_10002527 | 3300009093 | Bacteria | 29369 |
| 232 | Ga0105240_10004693 | 3300009093 | Bacteria | 20655 |
| 233 | Ga0105240_10004802 | 3300009093 | Bacteria | 20368 |
| 234 | Ga0105240_10006961 | 3300009093 | Bacteria | 16518 |
| 235 | Ga0105240_10009628 | 3300009093 | Bacteria | 13666 |
| 236 | Ga0105240_10021720 | 3300009093 | Bacteria | 8531 |
| 237 | Ga0105240_10046065 | 3300009093 | Bacteria | 5528 |
| 238 | Ga0105240_10046113 | 3300009093 | Bacteria | 5524 |
| 239 | Ga0105240_10098107 | 3300009093 | Bacteria | 3569 |
| 240 | Ga0105240_10202882 | 3300009093 | Bacteria | 2323 |
| 241 | Ga0105240_10237008 | 3300009093 | Unclassified | 2117 |
| 242 | Ga0105240_10293724 | 3300009093 | Bacteria | 1862 |
| 243 | Ga0105240_10771533 | 3300009093 | Bacteria | 1044 |
| 244 | Ga0111539_10000962 | 3300009094 | Bacteria | 37802 |
| 245 | Ga0111539_10029922 | 3300009094 | Bacteria | 6624 |
| 246 | Ga0105245_10218194 | 3300009098 | Bacteria | 1839 |
| 247 | Ga0105245_10855581 | 3300009098 | Bacteria | 949 |
| 248 | Ga0105247_10000681 | 3300009101 | Bacteria | 26876 |
| 249 | Ga0105247_10386156 | 3300009101 | Bacteria | 994 |
| 250 | Ga0105247_10406290 | 3300009101 | Unclassified | 972 |
| 251 | Ga0114129_10004031 | 3300009147 | Bacteria | 20733 |
| 252 | Ga0114129_10004843 | 3300009147 | Bacteria | 19010 |
| 253 | Ga0114129_10081799 | 3300009147 | Bacteria | 4489 |
| 254 | Ga0105243_10221755 | 3300009148 | Bacteria | 1672 |
| 255 | Ga0105241_10000864 | 3300009174 | Bacteria | 22996 |
| 256 | Ga0105241_10007631 | 3300009174 | Bacteria | 7952 |
| 257 | Ga0105241_10019765 | 3300009174 | Bacteria | 4971 |
| 258 | Ga0105241_10054759 | 3300009174 | Bacteria | 3055 |
| 259 | Ga0105241_10182222 | 3300009174 | Bacteria | 1743 |
| 260 | Ga0105241_10240211 | 3300009174 | Bacteria | 1531 |
| 261 | Ga0105241_10265602 | 3300009174 | Bacteria | 1460 |
| 262 | Ga0105241_10454451 | 3300009174 | Bacteria | 1134 |
| 263 | Ga0105241_10704681 | 3300009174 | Bacteria | 922 |
| 264 | Ga0105241_10892784 | 3300009174 | Bacteria | 825 |
| 265 | Ga0105242_10152181 | 3300009176 | Bacteria | 2018 |
| 266 | Ga0105242_10250210 | 3300009176 | Bacteria | 1597 |
| 267 | Ga0105248_10068671 | 3300009177 | Unclassified | 3979 |
| 268 | Ga0105248_10152124 | 3300009177 | Bacteria | 2611 |
| 269 | Ga0105248_10170357 | 3300009177 | Unclassified | 2454 |
| 270 | Ga0105248_10229317 | 3300009177 | Bacteria | 2091 |
| 271 | Ga0105248_10516612 | 3300009177 | Bacteria | 1347 |
| 272 | Ga0105237_10001160 | 3300009545 | Bacteria | 35249 |
| 273 | Ga0105237_10001943 | 3300009545 | Bacteria | 26329 |
| 274 | Ga0105237_10004982 | 3300009545 | Bacteria | 15141 |
| 275 | Ga0105237_10007200 | 3300009545 | Bacteria | 12215 |
| 276 | Ga0105237_10007849 | 3300009545 | Bacteria | 11633 |
| 277 | Ga0105237_10011368 | 3300009545 | Bacteria | 9417 |
| 278 | Ga0105237_10011870 | 3300009545 | Bacteria | 9211 |
| 279 | Ga0105237_10015433 | 3300009545 | Bacteria | 7950 |
| 280 | Ga0105237_10021202 | 3300009545 | Bacteria | 6683 |
| 281 | Ga0105237_10022335 | 3300009545 | Bacteria | 6493 |
| 282 | Ga0105237_10048443 | 3300009545 | Unclassified | 4271 |
| 283 | Ga0105237_10136120 | 3300009545 | Bacteria | 2451 |
| 284 | Ga0105237_10155572 | 3300009545 | Bacteria | 2283 |
| 285 | Ga0105238_10000868 | 3300009551 | Bacteria | 31217 |
| 286 | Ga0105238_10005073 | 3300009551 | Bacteria | 13016 |
| 287 | Ga0105238_10010457 | 3300009551 | Bacteria | 9313 |
| 288 | Ga0105238_10180359 | 3300009551 | Unclassified | 2089 |
| 289 | Ga0105238_10303971 | 3300009551 | Bacteria | 1579 |
| 290 | Ga0105249_10001842 | 3300009553 | Bacteria | 18441 |
| 291 | Ga0105249_10040578 | 3300009553 | Bacteria | 4228 |
| 292 | Ga0105249_10050948 | 3300009553 | Bacteria | 3775 |
| 293 | Ga0105249_10710136 | 3300009553 | Unclassified | 1066 |
| 294 | Ga0105239_10000252 | 3300010375 | Bacteria | 80006 |
| 295 | Ga0105239_10004611 | 3300010375 | Bacteria | 16401 |
| 296 | Ga0105239_10004643 | 3300010375 | Bacteria | 16327 |
| 297 | Ga0105239_10008566 | 3300010375 | Bacteria | 11606 |
| 298 | Ga0105239_10008890 | 3300010375 | Bacteria | 11370 |
| 299 | Ga0105239_10011451 | 3300010375 | Bacteria | 9892 |
| 300 | Ga0105239_10024239 | 3300010375 | Bacteria | 6683 |
| 301 | Ga0105239_10034520 | 3300010375 | Bacteria | 5555 |
| 302 | Ga0105239_10041186 | 3300010375 | Bacteria | 5062 |
| 303 | Ga0105239_10042832 | 3300010375 | Bacteria | 4961 |
| 304 | Ga0105239_10059111 | 3300010375 | Unclassified | 4207 |
| 305 | Ga0105239_10341504 | 3300010375 | Unclassified | 1690 |
| 306 | Ga0105239_10360348 | 3300010375 | Bacteria | 1642 |
| 307 | Ga0105239_10576041 | 3300010375 | Bacteria | 1283 |
| 308 | Ga0105239_10971625 | 3300010375 | Bacteria | 976 |
| 309 | Ga0105246_10370339 | 3300011119 | Bacteria | 1180 |
| 310 | Ga0157373_10008702 | 3300013100 | Bacteria | 7529 |
| 311 | Ga0157373_10058910 | 3300013100 | Bacteria | 2722 |
| 312 | Ga0157373_10138219 | 3300013100 | Bacteria | 1713 |
| 313 | Ga0157371_10000117 | 3300013102 | Bacteria | 121069 |
| 314 | Ga0157371_10083390 | 3300013102 | Bacteria | 2263 |
| 315 | Ga0157371_10978574 | 3300013102 | Unclassified | 644 |
| 316 | Ga0157370_10017786 | 3300013104 | Bacteria | 7165 |
| 317 | Ga0157370_10025160 | 3300013104 | Bacteria | 5893 |
| 318 | Ga0157370_10025999 | 3300013104 | Bacteria | 5784 |
| 319 | Ga0157370_10034709 | 3300013104 | Bacteria | 4907 |
| 320 | Ga0157370_10054701 | 3300013104 | Bacteria | 3804 |
| 321 | Ga0157370_10071814 | 3300013104 | Bacteria | 3266 |
| 322 | Ga0157370_10093547 | 3300013104 | Bacteria | 2821 |
| 323 | Ga0157370_10234957 | 3300013104 | Bacteria | 1696 |
| 324 | Ga0157370_10279282 | 3300013104 | Bacteria | 1543 |
| 325 | Ga0157369_10000047 | 3300013105 | Bacteria | 172682 |
| 326 | Ga0157369_10047681 | 3300013105 | Bacteria | 4650 |
| 327 | Ga0157369_10396198 | 3300013105 | Bacteria | 1432 |
| 328 | Ga0157369_10560879 | 3300013105 | Bacteria | 1180 |
| 329 | Ga0157369_10686923 | 3300013105 | Bacteria | 1054 |
| 330 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 331 | Ga0157374_10047255 | 3300013296 | Unclassified | 3990 |
| 332 | Ga0157374_10061346 | 3300013296 | Bacteria | 3521 |
| 333 | Ga0157374_10188317 | 3300013296 | Bacteria | 2018 |
| 334 | Ga0157374_10327344 | 3300013296 | Bacteria | 1519 |
| 335 | Ga0157374_10428429 | 3300013296 | Bacteria | 1322 |
| 336 | Ga0157374_11090840 | 3300013296 | Bacteria | 819 |
| 337 | Ga0157378_10028393 | 3300013297 | Bacteria | 4936 |
| 338 | Ga0157378_10031595 | 3300013297 | Bacteria | 4676 |
| 339 | Ga0157378_10107670 | 3300013297 | Unclassified | 2551 |
| 340 | Ga0157378_10150583 | 3300013297 | Bacteria | 2167 |
| 341 | Ga0157378_10264970 | 3300013297 | Unclassified | 1650 |
| 342 | Ga0157378_10477589 | 3300013297 | Bacteria | 1241 |
| 343 | Ga0163162_10000018 | 3300013306 | Bacteria | 226257 |
| 344 | Ga0163162_10000895 | 3300013306 | Bacteria | 27750 |
| 345 | Ga0163162_10001007 | 3300013306 | Bacteria | 26190 |
| 346 | Ga0163162_10007780 | 3300013306 | Bacteria | 10447 |
| 347 | Ga0163162_10019918 | 3300013306 | Bacteria | 6589 |
| 348 | Ga0163162_10147740 | 3300013306 | Unclassified | 2467 |
| 349 | Ga0163162_10383957 | 3300013306 | Bacteria | 1538 |
| 350 | Ga0163162_10739063 | 3300013306 | Bacteria | 1104 |
| 351 | Ga0157372_10001233 | 3300013307 | Bacteria | 27695 |
| 352 | Ga0157372_10005354 | 3300013307 | Bacteria | 13628 |
| 353 | Ga0157372_10056004 | 3300013307 | Unclassified | 4405 |
| 354 | Ga0157372_10076406 | 3300013307 | Bacteria | 3781 |
| 355 | Ga0157372_10095920 | 3300013307 | Bacteria | 3379 |
| 356 | Ga0157375_10008365 | 3300013308 | Bacteria | 9063 |
| 357 | Ga0157375_10141294 | 3300013308 | Bacteria | 2535 |
| 358 | Ga0157375_10172190 | 3300013308 | Bacteria | 2313 |
| 359 | Ga0157375_10286114 | 3300013308 | Bacteria | 1811 |
| 360 | Ga0163163_10000142 | 3300014325 | Bacteria | 74753 |
| 361 | Ga0163163_10200401 | 3300014325 | Bacteria | 2044 |
| 362 | Ga0163163_10205216 | 3300014325 | Unclassified | 2019 |
| 363 | Ga0163163_10357950 | 3300014325 | Bacteria | 1516 |
| 364 | Ga0163163_10506953 | 3300014325 | Bacteria | 1269 |
| 365 | Ga0157380_10015109 | 3300014326 | Bacteria | 5666 |
| 366 | Ga0157380_10045508 | 3300014326 | Bacteria | 3444 |
| 367 | Ga0182008_10000914 | 3300014497 | Bacteria | 20553 |
| 368 | Ga0157377_10029113 | 3300014745 | Bacteria | 2979 |
| 369 | Ga0157377_10095423 | 3300014745 | Bacteria | 1763 |
| 370 | Ga0157377_10374487 | 3300014745 | Bacteria | 962 |
| 371 | Ga0157379_10079921 | 3300014968 | Bacteria | 2929 |
| 372 | Ga0157379_10711937 | 3300014968 | Unclassified | 943 |
| 373 | Ga0157376_10005733 | 3300014969 | Bacteria | 8696 |
| 374 | Ga0182006_1000153 | 3300015261 | Bacteria | 73985 |
| 375 | Ga0182006_1000287 | 3300015261 | Bacteria | 44409 |
| 376 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 377 | Ga0182005_1004167 | 3300015265 | Unclassified | 4726 |
| 378 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 379 | Ga0163161_10001043 | 3300017792 | Bacteria | 21096 |
| 380 | Ga0163161_10002412 | 3300017792 | Bacteria | 13408 |
| 381 | Ga0163161_10002768 | 3300017792 | Bacteria | 12458 |
| 382 | Ga0163161_10006203 | 3300017792 | Bacteria | 8284 |
| 383 | Ga0163161_10166941 | 3300017792 | Bacteria | 1681 |
| 384 | Ga0163161_10592064 | 3300017792 | Bacteria | 913 |
| 385 | Ga0206352_11032327 | 3300020078 | Unclassified | 983 |
| 386 | Ga0213872_10090057 | 3300021361 | Bacteria | 1373 |
| 387 | Ga0213876_10002467 | 3300021384 | Bacteria | 10860 |
| 388 | Ga0209436_102408 | 3300025208 | Bacteria | 5661 |
| 389 | Ga0209563_104170 | 3300025230 | Bacteria | 2812 |
| 390 | Ga0207427_101183 | 3300025231 | Bacteria | 10197 |
| 391 | Ga0209437_100112 | 3300025233 | Bacteria | 214292 |
| 392 | Ga0209258_105671 | 3300025242 | Bacteria | 2074 |
| 393 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 394 | Ga0209646_1000615 | 3300025246 | Bacteria | 13711 |
| 395 | Ga0209646_1001930 | 3300025246 | Bacteria | 5022 |
| 396 | Ga0209026_1000549 | 3300025250 | Bacteria | 25871 |
| 397 | Ga0209026_1009331 | 3300025250 | Bacteria | 1938 |
| 398 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 399 | Ga0209233_1000126 | 3300025261 | Bacteria | 214298 |
| 400 | Ga0209233_1022574 | 3300025261 | Bacteria | 1608 |
| 401 | Ga0209455_1003551 | 3300025272 | Bacteria | 5457 |
| 402 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 403 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 404 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 405 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 406 | Ga0207426_1002573 | 3300025302 | Bacteria | 11311 |
| 407 | Ga0207697_10126376 | 3300025315 | Unclassified | 1103 |
| 408 | Ga0207656_10005303 | 3300025321 | Bacteria | 4548 |
| 409 | Ga0207653_10004534 | 3300025885 | Bacteria | 4353 |
| 410 | Ga0207642_10050167 | 3300025899 | Bacteria | 1881 |
| 411 | Ga0207710_10000858 | 3300025900 | Bacteria | 16391 |
| 412 | Ga0207688_10137064 | 3300025901 | Bacteria | 1438 |
| 413 | Ga0207680_10032116 | 3300025903 | Unclassified | 2981 |
| 414 | Ga0207647_10031630 | 3300025904 | Bacteria | 3404 |
| 415 | Ga0207647_10177606 | 3300025904 | Unclassified | 1238 |
| 416 | Ga0207647_10317244 | 3300025904 | Unclassified | 885 |
| 417 | Ga0207647_10344552 | 3300025904 | Bacteria | 844 |
| 418 | Ga0207647_10426471 | 3300025904 | Unclassified | 745 |
| 419 | Ga0207699_10328991 | 3300025906 | Bacteria | 1074 |
| 420 | Ga0207645_10000056 | 3300025907 | Bacteria | 80880 |
| 421 | Ga0207645_10420145 | 3300025907 | Unclassified | 901 |
| 422 | Ga0207643_10014568 | 3300025908 | Bacteria | 4274 |
| 423 | Ga0207643_10020936 | 3300025908 | Bacteria | 3590 |
| 424 | Ga0207705_10000028 | 3300025909 | Bacteria | 240636 |
| 425 | Ga0207705_10052660 | 3300025909 | Bacteria | 2931 |
| 426 | Ga0207684_10100971 | 3300025910 | Bacteria | 2466 |
| 427 | Ga0207654_10015752 | 3300025911 | Bacteria | 3929 |
| 428 | Ga0207654_10037185 | 3300025911 | Unclassified | 2723 |
| 429 | Ga0207654_10046925 | 3300025911 | Bacteria | 2466 |
| 430 | Ga0207654_10054537 | 3300025911 | Bacteria | 2310 |
| 431 | Ga0207654_10276514 | 3300025911 | Bacteria | 1134 |
| 432 | Ga0207654_10386451 | 3300025911 | Bacteria | 970 |
| 433 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 434 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 435 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 436 | Ga0207695_10000081 | 3300025913 | Bacteria | 284797 |
| 437 | Ga0207695_10000156 | 3300025913 | Bacteria | 204576 |
| 438 | Ga0207695_10002773 | 3300025913 | Bacteria | 25522 |
| 439 | Ga0207695_10015983 | 3300025913 | Bacteria | 8809 |
| 440 | Ga0207695_10017121 | 3300025913 | Bacteria | 8449 |
| 441 | Ga0207695_10019732 | 3300025913 | Bacteria | 7750 |
| 442 | Ga0207695_10155221 | 3300025913 | Bacteria | 2224 |
| 443 | Ga0207695_10159941 | 3300025913 | Unclassified | 2184 |
| 444 | Ga0207695_10167303 | 3300025913 | Bacteria | 2126 |
| 445 | Ga0207695_10187302 | 3300025913 | Bacteria | 1988 |
| 446 | Ga0207671_10001813 | 3300025914 | Bacteria | 23849 |
| 447 | Ga0207671_10001925 | 3300025914 | Bacteria | 23035 |
| 448 | Ga0207671_10002777 | 3300025914 | Bacteria | 18271 |
| 449 | Ga0207671_10003734 | 3300025914 | Bacteria | 15006 |
| 450 | Ga0207671_10007568 | 3300025914 | Bacteria | 9405 |
| 451 | Ga0207671_10009812 | 3300025914 | Bacteria | 7966 |
| 452 | Ga0207671_10011422 | 3300025914 | Bacteria | 7233 |
| 453 | Ga0207671_10012550 | 3300025914 | Bacteria | 6804 |
| 454 | Ga0207671_10014922 | 3300025914 | Bacteria | 6109 |
| 455 | Ga0207671_10019257 | 3300025914 | Bacteria | 5222 |
| 456 | Ga0207671_10177474 | 3300025914 | Bacteria | 1656 |
| 457 | Ga0207671_10571631 | 3300025914 | Unclassified | 901 |
| 458 | Ga0207662_10516042 | 3300025918 | Bacteria | 824 |
| 459 | Ga0207657_10122884 | 3300025919 | Bacteria | 2135 |
| 460 | Ga0207657_10264322 | 3300025919 | Bacteria | 1369 |
| 461 | Ga0207646_10227045 | 3300025922 | Bacteria | 1687 |
| 462 | Ga0207681_10012023 | 3300025923 | Bacteria | 5332 |
| 463 | Ga0207681_10016048 | 3300025923 | Bacteria | 4677 |
| 464 | Ga0207694_10002363 | 3300025924 | Bacteria | 15426 |
| 465 | Ga0207694_10104418 | 3300025924 | Unclassified | 2248 |
| 466 | Ga0207694_10124867 | 3300025924 | Unclassified | 2058 |
| 467 | Ga0207650_10000017 | 3300025925 | Bacteria | 354674 |
| 468 | Ga0207650_10115834 | 3300025925 | Bacteria | 2080 |
| 469 | Ga0207650_10245444 | 3300025925 | Bacteria | 1448 |
| 470 | Ga0207659_10377078 | 3300025926 | Bacteria | 1182 |
| 471 | Ga0207687_10218090 | 3300025927 | Bacteria | 1500 |
| 472 | Ga0207690_10000123 | 3300025932 | Bacteria | 64409 |
| 473 | Ga0207706_10018091 | 3300025933 | Bacteria | 6341 |
| 474 | Ga0207686_10050235 | 3300025934 | Bacteria | 2592 |
| 475 | Ga0207709_10145319 | 3300025935 | Bacteria | 1636 |
| 476 | Ga0207670_10002115 | 3300025936 | Bacteria | 10383 |
| 477 | Ga0207670_10072836 | 3300025936 | Unclassified | 2380 |
| 478 | Ga0207670_10187541 | 3300025936 | Unclassified | 1562 |
| 479 | Ga0207669_10185910 | 3300025937 | Bacteria | 1494 |
| 480 | Ga0207669_10250083 | 3300025937 | Bacteria | 1319 |
| 481 | Ga0207704_10000229 | 3300025938 | Bacteria | 27868 |
| 482 | Ga0207704_10611016 | 3300025938 | Unclassified | 894 |
| 483 | Ga0207691_10200507 | 3300025940 | Unclassified | 1737 |
| 484 | Ga0207691_10406044 | 3300025940 | Bacteria | 1162 |
| 485 | Ga0207711_10020898 | 3300025941 | Bacteria | 5464 |
| 486 | Ga0207711_10065685 | 3300025941 | Bacteria | 3136 |
| 487 | Ga0207689_10041358 | 3300025942 | Bacteria | 3814 |
| 488 | Ga0207689_10590122 | 3300025942 | Unclassified | 934 |
| 489 | Ga0207689_10921964 | 3300025942 | Bacteria | 737 |
| 490 | Ga0207661_10008165 | 3300025944 | Bacteria | 7472 |
| 491 | Ga0207667_10000477 | 3300025949 | Bacteria | 53347 |
| 492 | Ga0207667_10000713 | 3300025949 | Bacteria | 43129 |
| 493 | Ga0207667_10001082 | 3300025949 | Bacteria | 34557 |
| 494 | Ga0207667_10005555 | 3300025949 | Bacteria | 15386 |
| 495 | Ga0207667_10012719 | 3300025949 | Bacteria | 9667 |
| 496 | Ga0207667_10014605 | 3300025949 | Bacteria | 8943 |
| 497 | Ga0207667_10058197 | 3300025949 | Bacteria | 4055 |
| 498 | Ga0207667_10065263 | 3300025949 | Bacteria | 3798 |
| 499 | Ga0207651_10058557 | 3300025960 | Unclassified | 2663 |
| 500 | Ga0207651_10128212 | 3300025960 | Bacteria | 1937 |
| 501 | Ga0207712_10001192 | 3300025961 | Bacteria | 17973 |
| 502 | Ga0207712_10065778 | 3300025961 | Bacteria | 2589 |
| 503 | Ga0207712_10132384 | 3300025961 | Bacteria | 1902 |
| 504 | Ga0207712_10427477 | 3300025961 | Bacteria | 1119 |
| 505 | Ga0207640_10101047 | 3300025981 | Bacteria | 2022 |
| 506 | Ga0207658_10034061 | 3300025986 | Bacteria | 3637 |
| 507 | Ga0207677_10046290 | 3300026023 | Bacteria | 2912 |
| 508 | Ga0207677_10615541 | 3300026023 | Unclassified | 954 |
| 509 | Ga0207703_10059644 | 3300026035 | Bacteria | 3117 |
| 510 | Ga0207703_10064094 | 3300026035 | Bacteria | 3015 |
| 511 | Ga0207703_10429930 | 3300026035 | Bacteria | 1230 |
| 512 | Ga0207639_10002473 | 3300026041 | Bacteria | 12387 |
| 513 | Ga0207639_10028495 | 3300026041 | Bacteria | 4078 |
| 514 | Ga0207639_10054131 | 3300026041 | Unclassified | 3066 |
| 515 | Ga0207639_10099176 | 3300026041 | Bacteria | 2350 |
| 516 | Ga0207639_10118262 | 3300026041 | Bacteria | 2173 |
| 517 | Ga0207639_10132143 | 3300026041 | Bacteria | 2068 |
| 518 | Ga0207639_10135240 | 3300026041 | Bacteria | 2046 |
| 519 | Ga0207639_10575402 | 3300026041 | Bacteria | 1036 |
| 520 | Ga0207639_10647771 | 3300026041 | Bacteria | 977 |
| 521 | Ga0207708_10013257 | 3300026075 | Bacteria | 6155 |
| 522 | Ga0207708_10013431 | 3300026075 | Bacteria | 6122 |
| 523 | Ga0207708_10391037 | 3300026075 | Bacteria | 1148 |
| 524 | Ga0207708_10993140 | 3300026075 | Unclassified | 729 |
| 525 | Ga0207702_10000071 | 3300026078 | Bacteria | 114394 |
| 526 | Ga0207702_10038000 | 3300026078 | Bacteria | 4032 |
| 527 | Ga0207702_10262543 | 3300026078 | Bacteria | 1627 |
| 528 | Ga0207702_10386946 | 3300026078 | Bacteria | 1346 |
| 529 | Ga0207702_11057425 | 3300026078 | Bacteria | 805 |
| 530 | Ga0207648_10004742 | 3300026089 | Bacteria | 13897 |
| 531 | Ga0207648_10022019 | 3300026089 | Bacteria | 5725 |
| 532 | Ga0207648_10033398 | 3300026089 | Unclassified | 4538 |
| 533 | Ga0207648_10073185 | 3300026089 | Bacteria | 2987 |
| 534 | Ga0207648_10297207 | 3300026089 | Unclassified | 1447 |
| 535 | Ga0207676_10009550 | 3300026095 | Bacteria | 6906 |
| 536 | Ga0207676_10401166 | 3300026095 | Unclassified | 1281 |
| 537 | Ga0207674_10003327 | 3300026116 | Bacteria | 19761 |
| 538 | Ga0207674_10009705 | 3300026116 | Bacteria | 10971 |
| 539 | Ga0207674_10041071 | 3300026116 | Bacteria | 4786 |
| 540 | Ga0207674_10082730 | 3300026116 | Bacteria | 3210 |
| 541 | Ga0207674_10436689 | 3300026116 | Bacteria | 1265 |
| 542 | Ga0207675_100000260 | 3300026118 | Bacteria | 50253 |
| 543 | Ga0207675_100012852 | 3300026118 | Bacteria | 7819 |
| 544 | Ga0207675_100049719 | 3300026118 | Bacteria | 3912 |
| 545 | Ga0207675_100144993 | 3300026118 | Bacteria | 2257 |
| 546 | Ga0207675_100461562 | 3300026118 | Bacteria | 1260 |
| 547 | Ga0207683_10005938 | 3300026121 | Bacteria | 10467 |
| 548 | Ga0207683_10365918 | 3300026121 | Bacteria | 1324 |
| 549 | Ga0207698_10015082 | 3300026142 | Bacteria | 5164 |
| 550 | Ga0207428_10241999 | 3300027907 | Bacteria | 1348 |
| 551 | Ga0268266_10000073 | 3300028379 | Bacteria | 232074 |
| 552 | Ga0268266_10000119 | 3300028379 | Bacteria | 162424 |
| 553 | Ga0268265_10013170 | 3300028380 | Bacteria | 5619 |
| 554 | Ga0268265_11207261 | 3300028380 | Bacteria | 754 |
| 555 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 556 | Ga0268264_10006772 | 3300028381 | Bacteria | 9624 |
| 557 | Ga0268264_10015719 | 3300028381 | Bacteria | 6199 |
| 558 | Ga0268264_10025073 | 3300028381 | Bacteria | 4873 |
| 559 | Ga0268264_10032633 | 3300028381 | Bacteria | 4273 |
| 560 | Ga0268264_10085953 | 3300028381 | Bacteria | 2701 |
| 561 | Ga0307517_10002971 | 3300028786 | Bacteria | 26793 |
| 562 | Ga0307515_10001098 | 3300028794 | Bacteria | 62024 |
| 563 | Ga0307515_10004758 | 3300028794 | Bacteria | 27824 |
| 564 | Ga0307515_10006567 | 3300028794 | Bacteria | 23231 |
| 565 | Ga0307515_10011347 | 3300028794 | Bacteria | 16910 |
| 566 | Ga0265324_10106507 | 3300029957 | Unclassified | 952 |
| 567 | Ga0307511_10000232 | 3300030521 | Bacteria | 56875 |
| 568 | Ga0307512_10156020 | 3300030522 | Bacteria | 1351 |
| 569 | Ga0316181_1166948 | 3300030744 | Bacteria | 1694 |
| 570 | Ga0265327_10164210 | 3300031251 | Bacteria | 1024 |
| 571 | Ga0307513_10103824 | 3300031456 | Bacteria | 2858 |
| 572 | Ga0307513_10155986 | 3300031456 | Bacteria | 2183 |
| 573 | Ga0307513_10207758 | 3300031456 | Bacteria | 1792 |
| 574 | Ga0307513_10283975 | 3300031456 | Bacteria | 1431 |
| 575 | Ga0307513_10448906 | 3300031456 | Bacteria | 1014 |
| 576 | Ga0307509_10103378 | 3300031507 | Bacteria | 2877 |
| 577 | Ga0307509_10137330 | 3300031507 | Bacteria | 2388 |
| 578 | Ga0307509_10183593 | 3300031507 | Bacteria | 1953 |
| 579 | Ga0307408_100049523 | 3300031548 | Bacteria | 3018 |
| 580 | Ga0307516_10000768 | 3300031730 | Bacteria | 43795 |
| 581 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 582 | Ga0307410_10079764 | 3300031852 | Bacteria | 2295 |
| 583 | Ga0307406_10195874 | 3300031901 | Bacteria | 1483 |
| 584 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 585 | Ga0307407_10085975 | 3300031903 | Bacteria | 1915 |
| 586 | Ga0307409_100012342 | 3300031995 | Bacteria | 5441 |
| 587 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 588 | Ga0307414_10010770 | 3300032004 | Bacteria | 5330 |
| 589 | Ga0307414_10390173 | 3300032004 | Bacteria | 1206 |
| 590 | Ga0307507_10000071 | 3300033179 | Bacteria | 158391 |
| 591 | Ga0307507_10001977 | 3300033179 | Bacteria | 44460 |
| 592 | Ga0307510_10000637 | 3300033180 | Bacteria | 35581 |
| 593 | Ga0307510_10075388 | 3300033180 | Bacteria | 3326 |
| 594 | Ga0373951_0001316 | 3300035091 | Bacteria | 6546 |
| 595 | Ga0373941_0179980 | 3300035115 | Bacteria | 793 |
| 596 | Ga0373955_0237595 | 3300035172 | Bacteria | 1091 |
| 597 | Ga0373931_0278100 | 3300035691 | Unclassified | 1027 |
| 598 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 599 | Ga0395899_0000462 | 3300037312 | Bacteria | 46052 |
| 600 | Ga0395900_0000141 | 3300037418 | Bacteria | 121159 |
| 601 | Ga0395898_0017800 | 3300037466 | Bacteria | 7250 |
| 602 | Ga0395905_0000124 | 3300037471 | Bacteria | 126707 |
| 603 | Ga0395901_0000138 | 3300038443 | Bacteria | 94944 |
| 604 | Ga0436365_1179973 | 3300039437 | Bacteria | 33661 |
| 605 | Ga0436361_0979080 | 3300039447 | Bacteria | 2219 |
| 606 | Ga0439436_0023300 | 3300041404 | Bacteria | 1832 |
| 607 | Ga0439439_0006062 | 3300041406 | Bacteria | 2785 |
| 608 | Ga0439466_0123634 | 3300041411 | Bacteria | 798 |
| 609 | Ga0451849_1018633 | 3300041505 | Bacteria | 1618 |
| 610 | Ga0451843_0419312 | 3300041509 | Bacteria | 923 |
| 611 | Ga0451843_1695759 | 3300041509 | Bacteria | 1478 |
| 612 | Ga0451853_3921089 | 3300041512 | Bacteria | 1079 |
| 613 | Ga0439448_0072759 | 3300042005 | Bacteria | 1146 |
| 614 | Ga0439432_073451 | 3300042006 | Bacteria | 1041 |
| 615 | Ga0439449_0014731 | 3300042007 | Bacteria | 2938 |
| 616 | Ga0439449_0021859 | 3300042007 | Bacteria | 2394 |
| 617 | Ga0439449_0032968 | 3300042007 | Bacteria | 1931 |
| 618 | Ga0439449_0045301 | 3300042007 | Bacteria | 1630 |
| 619 | Ga0439457_000072 | 3300042014 | Bacteria | 22114 |
| 620 | Ga0439457_003482 | 3300042014 | Bacteria | 4280 |
| 621 | Ga0439457_037178 | 3300042014 | Bacteria | 1084 |
| 622 | Ga0439462_0000326 | 3300042015 | Bacteria | 8900 |
| 623 | Ga0450894_010694 | 3300042131 | Bacteria | 1192 |
| 624 | Ga0450895_012677 | 3300042132 | Bacteria | 736 |
| 625 | Ga0450899_005855 | 3300042135 | Bacteria | 1324 |
| 626 | Ga0439446_0132497 | 3300042156 | Bacteria | 809 |
| 627 | Ga0466972_0000571 | 3300044658 | Bacteria | 17952 |
| 628 | Ga0466972_0019102 | 3300044658 | Bacteria | 3427 |
| 629 | Ga0466972_0075328 | 3300044658 | Unclassified | 1608 |
| 630 | Ga0466965_0050017 | 3300044683 | Bacteria | 2072 |
| 631 | Ga0466966_0000022 | 3300044684 | Bacteria | 112729 |
| 632 | Ga0466961_0421287 | 3300044693 | Bacteria | 809 |
| 633 | Ga0466964_0215057 | 3300044706 | Unclassified | 930 |
| 634 | Ga0453684_0102814 | 3300044712 | Bacteria | 3493 |
| 635 | Ga0466968_0161226 | 3300044735 | Bacteria | 1035 |
| 636 | Ga0466970_0047829 | 3300044765 | Unclassified | 2280 |
| 637 | Ga0466957_0000411 | 3300044842 | Bacteria | 20992 |
| 638 | Ga0466957_0006428 | 3300044842 | Bacteria | 6636 |
| 639 | Ga0466957_0030049 | 3300044842 | Bacteria | 3243 |
| 640 | Ga0466957_0581647 | 3300044842 | Bacteria | 783 |
| 641 | Ga0466959_0000055 | 3300045049 | Bacteria | 78801 |
| 642 | Ga0466959_0005141 | 3300045049 | Bacteria | 8913 |
| 643 | Ga0495638_0042658 | 3300046460 | Bacteria | 2865 |
| 644 | Ga0495638_0165846 | 3300046460 | Bacteria | 1271 |
| 645 | Ga0495638_0167071 | 3300046460 | Bacteria | 1265 |
| 646 | Ga0495651_0121740 | 3300046462 | Bacteria | 1916 |
| 647 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 648 | Ga0495650_0043031 | 3300046471 | Bacteria | 1920 |
| 649 | Ga0495585_0000723 | 3300046492 | Bacteria | 29538 |
| 650 | Ga0495585_0000917 | 3300046492 | Bacteria | 24965 |
| 651 | Ga0495585_0001092 | 3300046492 | Bacteria | 22350 |
| 652 | Ga0495585_0003748 | 3300046492 | Bacteria | 10145 |
| 653 | Ga0495606_0000003 | 3300046507 | Bacteria | 449402 |
| 654 | Ga0495606_0000096 | 3300046507 | Bacteria | 151500 |
| 655 | Ga0495606_0005679 | 3300046507 | Bacteria | 11808 |
| 656 | Ga0495606_0034004 | 3300046507 | Bacteria | 3506 |
| 657 | Ga0495606_0059081 | 3300046507 | Bacteria | 2461 |
| 658 | Ga0495606_0063050 | 3300046507 | Bacteria | 2363 |
| 659 | Ga0495610_0000076 | 3300046512 | Bacteria | 118246 |
| 660 | Ga0495610_0000273 | 3300046512 | Bacteria | 53916 |
| 661 | Ga0495610_0000427 | 3300046512 | Bacteria | 43336 |
| 662 | Ga0495610_0003649 | 3300046512 | Bacteria | 11848 |
| 663 | Ga0495616_0027571 | 3300046513 | Bacteria | 3013 |
| 664 | Ga0495631_0018599 | 3300046518 | Bacteria | 3269 |
| 665 | Ga0495632_0106654 | 3300046519 | Bacteria | 1318 |
| 666 | Ga0495637_0030977 | 3300046520 | Bacteria | 2369 |
| 667 | Ga0495643_0096259 | 3300046522 | Unclassified | 1522 |
| 668 | Ga0495648_0011656 | 3300046524 | Bacteria | 6605 |
| 669 | Ga0495648_0013028 | 3300046524 | Bacteria | 6171 |
| 670 | Ga0495648_0037682 | 3300046524 | Bacteria | 3103 |
| 671 | Ga0495652_0120370 | 3300046529 | Bacteria | 2095 |
| 672 | Ga0495652_0261294 | 3300046529 | Bacteria | 1278 |
| 673 | Ga0495609_0010151 | 3300046538 | Bacteria | 4528 |
| 674 | Ga0495609_0035849 | 3300046538 | Bacteria | 2243 |
| 675 | Ga0495621_0005520 | 3300046539 | Bacteria | 3638 |
| 676 | Ga0495622_0046331 | 3300046557 | Bacteria | 2020 |
| 677 | Ga0495622_0109395 | 3300046557 | Bacteria | 1265 |
| 678 | Ga0495633_0000269 | 3300046558 | Bacteria | 61152 |
| 679 | Ga0495633_0016633 | 3300046558 | Bacteria | 3786 |
| 680 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 681 | Ga0495668_0001067 | 3300046616 | Bacteria | 28949 |
| 682 | Ga0495611_0004900 | 3300046648 | Bacteria | 5745 |
| 683 | Ga0495625_0000003 | 3300046660 | Bacteria | 686847 |
| 684 | Ga0495625_0000304 | 3300046660 | Bacteria | 75543 |
| 685 | Ga0495625_0000647 | 3300046660 | Bacteria | 50043 |
| 686 | Ga0495625_0000993 | 3300046660 | Bacteria | 37558 |
| 687 | Ga0495625_0001005 | 3300046660 | Bacteria | 37265 |
| 688 | Ga0495625_0086610 | 3300046660 | Bacteria | 2173 |
| 689 | Ga0495625_0099570 | 3300046660 | Unclassified | 1998 |
| 690 | Ga0495625_0229107 | 3300046660 | Bacteria | 1214 |
| 691 | Ga0495625_0263913 | 3300046660 | Unclassified | 1113 |
| 692 | Ga0495661_0001756 | 3300046665 | Bacteria | 17434 |
| 693 | Ga0495661_0028328 | 3300046665 | Bacteria | 3587 |
| 694 | Ga0495661_0061413 | 3300046665 | Bacteria | 2231 |
| 695 | Ga0495661_0270470 | 3300046665 | Bacteria | 860 |
| 696 | Ga0495658_0012865 | 3300046683 | Bacteria | 4251 |
| 697 | Ga0495658_0141113 | 3300046683 | Bacteria | 1473 |
| 698 | Ga0495671_0212222 | 3300046692 | Bacteria | 938 |
| 699 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 700 | Ga0495649_0032101 | 3300046694 | Bacteria | 2895 |
| 701 | Ga0495649_0376623 | 3300046694 | Unclassified | 715 |
| 702 | Ga0495600_0229575 | 3300046809 | Bacteria | 1185 |
| 703 | Ga0495660_0013907 | 3300046810 | Bacteria | 4664 |
| 704 | Ga0495660_0045669 | 3300046810 | Bacteria | 2404 |
| 705 | Ga0495660_0075393 | 3300046810 | Bacteria | 1780 |
| 706 | Ga0495674_0462146 | 3300047319 | Unclassified | 1019 |
| 707 | Ga0495683_0034477 | 3300047323 | Bacteria | 2574 |
| 708 | Ga0495687_000040 | 3300047443 | Bacteria | 230786 |
| 709 | Ga0495687_001602 | 3300047443 | Bacteria | 20428 |
| 710 | Ga0495673_0047765 | 3300047469 | Bacteria | 1890 |
| 711 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 712 | Ga0495686_0060268 | 3300047472 | Bacteria | 2359 |
| 713 | Ga0495686_0066871 | 3300047472 | Bacteria | 2220 |
| 714 | Ga0495614_0010900 | 3300048089 | Bacteria | 4001 |
| 715 | Ga0496112_0258335 | 3300048915 | Bacteria | 1692 |
| 716 | Ga0495678_005512 | 3300049459 | Bacteria | 6968 |
| 717 | Ga0501291_008663 | 3300049514 | Unclassified | 1409 |
| 718 | Ga0501292_007492 | 3300049515 | Bacteria | 1578 |
| 719 | Ga0501293_005939 | 3300049516 | Unclassified | 987 |
| 720 | Ga0501293_013252 | 3300049516 | Unclassified | 739 |
| 721 | Ga0501296_001357 | 3300049519 | Unclassified | 2473 |
| 722 | Ga0501298_028333 | 3300049521 | Bacteria | 1086 |
| 723 | Ga0501298_078843 | 3300049521 | Unclassified | 722 |
| 724 | Ga0501299_001015 | 3300049522 | Bacteria | 3492 |
| 725 | Ga0501299_004193 | 3300049522 | Bacteria | 2139 |
| 726 | Ga0501303_005616 | 3300049526 | Bacteria | 1074 |
| 727 | Ga0501037_0503059 | 3300049573 | Bacteria | 822 |
| 728 | Ga0501047_0065903 | 3300049581 | Bacteria | 3491 |
| 729 | Ga0501198_038527 | 3300049649 | Unclassified | 821 |
| 730 | Ga0501202_005457 | 3300049652 | Bacteria | 2253 |
| 731 | Ga0501206_003896 | 3300049653 | Unclassified | 1895 |
| 732 | Ga0501207_043283 | 3300049654 | Unclassified | 787 |
| 733 | Ga0501216_000648 | 3300049660 | Bacteria | 4262 |
| 734 | Ga0501216_006035 | 3300049660 | Unclassified | 1845 |
| 735 | Ga0501217_001584 | 3300049661 | Unclassified | 4303 |
| 736 | Ga0501223_004821 | 3300049663 | Bacteria | 2866 |
| 737 | Ga0501235_000446 | 3300049669 | Bacteria | 8040 |
| 738 | Ga0501235_001982 | 3300049669 | Bacteria | 4388 |
| 739 | Ga0501250_001004 | 3300049680 | Bacteria | 2166 |
| 740 | Ga0501253_001218 | 3300049683 | Bacteria | 2552 |
| 741 | Ga0501253_003832 | 3300049683 | Bacteria | 1845 |
| 742 | Ga0501255_006525 | 3300049684 | Unclassified | 1207 |
| 743 | Ga0501255_037644 | 3300049684 | Unclassified | 698 |
| 744 | Ga0501256_000923 | 3300049685 | Unclassified | 2037 |
| 745 | Ga0501257_089268 | 3300049686 | Unclassified | 801 |
| 746 | Ga0501261_000342 | 3300049690 | Bacteria | 6294 |
| 747 | Ga0501219_000156 | 3300049703 | Bacteria | 12392 |
| 748 | Ga0501221_019499 | 3300049704 | Unclassified | 1316 |
| 749 | Ga0501221_080821 | 3300049704 | Unclassified | 782 |
| 750 | Ga0501225_0000860 | 3300049705 | Bacteria | 9430 |
| 751 | Ga0501225_0003107 | 3300049705 | Bacteria | 5075 |
| 752 | Ga0501225_0013777 | 3300049705 | Bacteria | 2260 |
| 753 | Ga0501234_009803 | 3300049707 | Unclassified | 1494 |
| 754 | Ga0501245_001963 | 3300049708 | Bacteria | 2715 |
| 755 | Ga0501241_014210 | 3300049758 | Unclassified | 1447 |
| 756 | Ga0501262_004892 | 3300049759 | Unclassified | 1568 |
| 757 | Ga0501270_001709 | 3300049767 | Bacteria | 2151 |
| 758 | Ga0501278_006290 | 3300049774 | Unclassified | 887 |
| 759 | Ga0501035_0082398 | 3300049822 | Bacteria | 2839 |
| 760 | Ga0501044_0003835 | 3300049823 | Bacteria | 16872 |
| 761 | Ga0501204_005235 | 3300049850 | Unclassified | 1416 |
| 762 | nmdc:mga0k408_21815_c1 | 3300050493 | Bacteria | 3601 |
| 763 | nmdc:mga0k408_288582_c1 | 3300050493 | Unclassified | 979 |
| 764 | nmdc:mga0k408_42372_c1 | 3300050493 | Bacteria | 2622 |
| 765 | nmdc:mga0k408_713_c1 | 3300050493 | Bacteria | 4816 |
| 766 | nmdc:mga07m45_425316_c1 | 3300050496 | Bacteria | 770 |
| 767 | nmdc:mga05p37_114902_c1 | 3300050507 | Bacteria | 3309 |
| 768 | nmdc:mga05p37_23907_c1 | 3300050507 | Bacteria | 7419 |
| 769 | nmdc:mga05p37_3277_c1 | 3300050507 | Bacteria | 18866 |
| 770 | nmdc:mga06r32_749482_c1 | 3300050510 | Bacteria | 940 |
| 771 | nmdc:mga08y16_248297_c1 | 3300050511 | Bacteria | 1839 |
| 772 | nmdc:mga08y16_444052_c1 | 3300050511 | Bacteria | 1324 |
| 773 | nmdc:mga0n895_121843_c1 | 3300050512 | Bacteria | 2629 |
| 774 | nmdc:mga0n895_64239_c1 | 3300050512 | Unclassified | 3631 |
| 775 | nmdc:mga0a205_44537_c1 | 3300050515 | Bacteria | 4278 |
| 776 | Ga0500635_0001446 | 3300053080 | Bacteria | 5711 |
| 777 | Ga0500578_0000010 | 3300053086 | Bacteria | 217642 |
| 778 | Ga0500578_0078696 | 3300053086 | Bacteria | 2098 |
| 779 | Ga0500578_0265995 | 3300053086 | Bacteria | 1028 |
| 780 | Ga0500644_0033077 | 3300053088 | Bacteria | 1657 |
| 781 | Ga0500646_0007943 | 3300053090 | Bacteria | 2712 |
| 782 | Ga0500646_0092397 | 3300053090 | Bacteria | 938 |
| 783 | Ga0500647_0125587 | 3300053091 | Bacteria | 1212 |
| 784 | Ga0500583_0000039 | 3300053092 | Bacteria | 87189 |
| 785 | Ga0500583_0000648 | 3300053092 | Bacteria | 10329 |
| 786 | Ga0500583_0000663 | 3300053092 | Bacteria | 10165 |
| 787 | Ga0500583_0098232 | 3300053092 | Bacteria | 1432 |
| 788 | Ga0500583_0099898 | 3300053092 | Unclassified | 1420 |
| 789 | Ga0500583_0122585 | 3300053092 | Bacteria | 1287 |
| 790 | Ga0500651_0168522 | 3300053093 | Unclassified | 1307 |
| 791 | Ga0500650_0196838 | 3300053098 | Bacteria | 919 |
| 792 | Ga0500555_022008 | 3300053103 | Bacteria | 1834 |
| 793 | Ga0500608_031671 | 3300053122 | Bacteria | 2510 |
| 794 | Ga0500608_076100 | 3300053122 | Bacteria | 1590 |
| 795 | Ga0500614_029038 | 3300053123 | Bacteria | 1340 |
| 796 | Ga0500618_000142 | 3300053125 | Bacteria | 59775 |
| 797 | Ga0500618_000150 | 3300053125 | Bacteria | 57266 |
| 798 | Ga0500642_0006554 | 3300053130 | Unclassified | 3844 |
| 799 | Ga0500642_0154709 | 3300053130 | Unclassified | 1076 |
| 800 | Ga0500652_030756 | 3300053131 | Bacteria | 2101 |
| 801 | Ga0500652_124333 | 3300053131 | Bacteria | 1078 |
| 802 | Ga0500568_0027829 | 3300053139 | Unclassified | 2361 |
| 803 | Ga0500588_0038722 | 3300053146 | Bacteria | 1424 |
| 804 | Ga0500589_044855 | 3300053147 | Bacteria | 2060 |
| 805 | Ga0500589_111600 | 3300053147 | Bacteria | 1172 |
| 806 | Ga0500622_0004994 | 3300053156 | Bacteria | 8081 |
| 807 | Ga0500622_0023303 | 3300053156 | Bacteria | 3279 |
| 808 | Ga0500639_167792 | 3300053163 | Unclassified | 989 |
| 809 | Ga0500636_0069537 | 3300053177 | Bacteria | 2043 |
| 810 | Ga0500637_0269298 | 3300053178 | Bacteria | 943 |
| 811 | Ga0500611_019062 | 3300053727 | Bacteria | 1275 |
| 812 | Ga0590075_000806 | 3300059424 | Bacteria | 8262 |
| 813 | Ga0466962_0170410 | 3300061719 | Bacteria | 1060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049649 | Ga0501198_038527 | Ga0501198_038527_248_778 | 175 |
| 2 | 3300049684 | Ga0501255_006525 | Ga0501255_006525_658_1188 | 175 |
| 3 | 3300046665 | Ga0495661_0061413 | Ga0495661_0061413_1622_2215 | 178 |
| 4 | 3300005539 | Ga0068853_100057054 | Ga0068853_1000570545 | 180 |
| 5 | 3300046492 | Ga0495585_0001092 | Ga0495585_0001092_14041_14706 | 181 |
| 6 | 3300047443 | Ga0495687_001602 | Ga0495687_001602_19573_20238 | 181 |
| 7 | 3300005563 | Ga0068855_100004987 | Ga0068855_1000049876 | 183 |
| 8 | 3300006195 | Ga0075366_10011521 | Ga0075366_100115212 | 183 |
| 9 | 3300025949 | Ga0207667_10058197 | Ga0207667_100581976 | 183 |
| 10 | 3300050493 | nmdc:mga0k408_42372_c1 | nmdc:mga0k408_42372_c1_1582_2247 | 183 |
| 11 | 3300050496 | nmdc:mga07m45_425316_c1 | nmdc:mga07m45_425316_c1_94_759 | 183 |
| 12 | 3300005844 | Ga0068862_100913420 | Ga0068862_1009134201 | 184 |
| 13 | 3300049685 | Ga0501256_000923 | Ga0501256_000923_1464_2024 | 185 |
| 14 | 3300042005 | Ga0439448_0072759 | Ga0439448_0072759_544_1113 | 189 |
| 15 | 3300046460 | Ga0495638_0167071 | Ga0495638_0167071_19_594 | 190 |
| 16 | 3300046660 | Ga0495625_0001005 | Ga0495625_0001005_17102_17734 | 191 |
| 17 | 3300005290 | Ga0065712_10258451 | Ga0065712_102584511 | 193 |
| 18 | 3300005340 | Ga0070689_100436969 | Ga0070689_1004369692 | 193 |
| 19 | 3300005444 | Ga0070694_100213837 | Ga0070694_1002138372 | 193 |
| 20 | 3300005468 | Ga0070707_100232970 | Ga0070707_1002329701 | 193 |
| 21 | 3300005471 | Ga0070698_100013520 | Ga0070698_1000135208 | 193 |
| 22 | 3300005536 | Ga0070697_100262071 | Ga0070697_1002620712 | 193 |
| 23 | 3300005545 | Ga0070695_100158146 | Ga0070695_1001581462 | 193 |
| 24 | 3300005577 | Ga0068857_100365774 | Ga0068857_1003657741 | 193 |
| 25 | 3300005578 | Ga0068854_100178575 | Ga0068854_1001785753 | 193 |
| 26 | 3300005618 | Ga0068864_100011191 | Ga0068864_1000111912 | 193 |
| 27 | 3300005618 | Ga0068864_100378890 | Ga0068864_1003788902 | 193 |
| 28 | 3300006844 | Ga0075428_100030804 | Ga0075428_1000308044 | 193 |
| 29 | 3300006847 | Ga0075431_100541691 | Ga0075431_1005416911 | 193 |
| 30 | 3300006852 | Ga0075433_10022890 | Ga0075433_100228903 | 193 |
| 31 | 3300006871 | Ga0075434_100048996 | Ga0075434_1000489963 | 193 |
| 32 | 3300006880 | Ga0075429_100468412 | Ga0075429_1004684121 | 193 |
| 33 | 3300009093 | Ga0105240_10771533 | Ga0105240_107715332 | 193 |
| 34 | 3300009101 | Ga0105247_10000681 | Ga0105247_1000068114 | 193 |
| 35 | 3300009147 | Ga0114129_10081799 | Ga0114129_100817992 | 193 |
| 36 | 3300009177 | Ga0105248_10068671 | Ga0105248_100686712 | 193 |
| 37 | 3300009177 | Ga0105248_10152124 | Ga0105248_101521242 | 193 |
| 38 | 3300010375 | Ga0105239_10042832 | Ga0105239_100428322 | 193 |
| 39 | 3300013102 | Ga0157371_10978574 | Ga0157371_109785741 | 193 |
| 40 | 3300014325 | Ga0163163_10200401 | Ga0163163_102004012 | 193 |
| 41 | 3300025904 | Ga0207647_10426471 | Ga0207647_104264711 | 193 |
| 42 | 3300025941 | Ga0207711_10065685 | Ga0207711_100656853 | 193 |
| 43 | 3300025961 | Ga0207712_10001192 | Ga0207712_100011927 | 193 |
| 44 | 3300026116 | Ga0207674_10436689 | Ga0207674_104366892 | 193 |
| 45 | 3300028380 | Ga0268265_11207261 | Ga0268265_112072611 | 193 |
| 46 | 3300049516 | Ga0501293_013252 | Ga0501293_013252_20_604 | 193 |
| 47 | 3300050507 | nmdc:mga05p37_114902_c1 | nmdc:mga05p37_114902_c1_1990_2574 | 193 |
| 48 | 3300050512 | nmdc:mga0n895_121843_c1 | nmdc:mga0n895_121843_c1_546_1130 | 193 |
| 49 | 3300050512 | nmdc:mga0n895_64239_c1 | nmdc:mga0n895_64239_c1_2214_2798 | 193 |
| 50 | 3300050515 | nmdc:mga0a205_44537_c1 | nmdc:mga0a205_44537_c1_2340_2924 | 193 |
| 51 | 3300003322 | rootL2_10063246 | rootL2_100632468 | 194 |
| 52 | 3300005335 | Ga0070666_10026629 | Ga0070666_100266292 | 194 |
| 53 | 3300005341 | Ga0070691_10022586 | Ga0070691_100225862 | 194 |
| 54 | 3300005539 | Ga0068853_100046310 | Ga0068853_1000463103 | 194 |
| 55 | 3300005616 | Ga0068852_100601218 | Ga0068852_1006012182 | 194 |
| 56 | 3300025914 | Ga0207671_10002777 | Ga0207671_1000277710 | 194 |
| 57 | 3300025924 | Ga0207694_10104418 | Ga0207694_101044182 | 194 |
| 58 | 3300003322 | rootL2_10178833 | rootL2_101788332 | 197 |
| 59 | 3300046471 | Ga0495650_0000014 | Ga0495650_0000014_125382_126047 | 198 |
| 60 | 3300046512 | Ga0495610_0000427 | Ga0495610_0000427_22240_22905 | 198 |
| 61 | 3300046660 | Ga0495625_0000003 | Ga0495625_0000003_110040_110705 | 198 |
| 62 | 3300046665 | Ga0495661_0001756 | Ga0495661_0001756_2925_3590 | 198 |
| 63 | 3300046692 | Ga0495671_0212222 | Ga0495671_0212222_156_821 | 198 |
| 64 | 3300046694 | Ga0495649_0000002 | Ga0495649_0000002_896259_896924 | 198 |
| 65 | 3300013306 | Ga0163162_10019918 | Ga0163162_100199187 | 199 |
| 66 | 3300046507 | Ga0495606_0000096 | Ga0495606_0000096_105171_105836 | 199 |
| 67 | 3300047469 | Ga0495673_0047765 | Ga0495673_0047765_933_1598 | 199 |
| 68 | 3300003316 | rootH1_10057924 | rootH1_1005792413 | 200 |
| 69 | 3300026041 | Ga0207639_10099176 | Ga0207639_100991763 | 200 |
| 70 | 3300014745 | Ga0157377_10374487 | Ga0157377_103744871 | 203 |
| 71 | 3300005366 | Ga0070659_100018458 | Ga0070659_1000184583 | 204 |
| 72 | 3300009101 | Ga0105247_10406290 | Ga0105247_104062902 | 204 |
| 73 | 3300005337 | Ga0070682_100000128 | Ga0070682_1000001286 | 205 |
| 74 | 3300005338 | Ga0068868_100934516 | Ga0068868_1009345162 | 205 |
| 75 | 3300005539 | Ga0068853_100251343 | Ga0068853_1002513432 | 205 |
| 76 | 3300005547 | Ga0070693_100018920 | Ga0070693_1000189202 | 205 |
| 77 | 3300005843 | Ga0068860_100899216 | Ga0068860_1008992162 | 205 |
| 78 | 3300013306 | Ga0163162_10007780 | Ga0163162_100077801 | 205 |
| 79 | 3300044712 | Ga0453684_0102814 | Ga0453684_0102814_1644_2294 | 205 |
| 80 | 3300002459 | JGI24751J29686_10000015 | JGI24751J29686_1000001569 | 206 |
| 81 | 3300003322 | rootL2_10314446 | rootL2_103144461 | 206 |
| 82 | 3300005331 | Ga0070670_100000206 | Ga0070670_10000020634 | 206 |
| 83 | 3300005331 | Ga0070670_100067827 | Ga0070670_1000678273 | 206 |
| 84 | 3300005331 | Ga0070670_100167608 | Ga0070670_1001676082 | 206 |
| 85 | 3300005334 | Ga0068869_100482176 | Ga0068869_1004821761 | 206 |
| 86 | 3300005337 | Ga0070682_100009239 | Ga0070682_1000092394 | 206 |
| 87 | 3300005340 | Ga0070689_100000319 | Ga0070689_1000003196 | 206 |
| 88 | 3300005345 | Ga0070692_10006967 | Ga0070692_100069674 | 206 |
| 89 | 3300005345 | Ga0070692_10218559 | Ga0070692_102185592 | 206 |
| 90 | 3300005353 | Ga0070669_100102259 | Ga0070669_1001022592 | 206 |
| 91 | 3300005406 | Ga0070703_10009040 | Ga0070703_100090403 | 206 |
| 92 | 3300005438 | Ga0070701_10077074 | Ga0070701_100770742 | 206 |
| 93 | 3300005438 | Ga0070701_10397679 | Ga0070701_103976791 | 206 |
| 94 | 3300005440 | Ga0070705_100127967 | Ga0070705_1001279672 | 206 |
| 95 | 3300005441 | Ga0070700_100002107 | Ga0070700_1000021078 | 206 |
| 96 | 3300005441 | Ga0070700_100018150 | Ga0070700_1000181503 | 206 |
| 97 | 3300005441 | Ga0070700_100421096 | Ga0070700_1004210961 | 206 |
| 98 | 3300005444 | Ga0070694_100003543 | Ga0070694_1000035438 | 206 |
| 99 | 3300005444 | Ga0070694_100011567 | Ga0070694_1000115672 | 206 |
| 100 | 3300005444 | Ga0070694_100094247 | Ga0070694_1000942472 | 206 |
| 101 | 3300005456 | Ga0070678_100330095 | Ga0070678_1003300952 | 206 |
| 102 | 3300005459 | Ga0068867_100167260 | Ga0068867_1001672602 | 206 |
| 103 | 3300005459 | Ga0068867_100250559 | Ga0068867_1002505591 | 206 |
| 104 | 3300005467 | Ga0070706_100008371 | Ga0070706_1000083716 | 206 |
| 105 | 3300005518 | Ga0070699_100505253 | Ga0070699_1005052532 | 206 |
| 106 | 3300005545 | Ga0070695_100023844 | Ga0070695_1000238443 | 206 |
| 107 | 3300005547 | Ga0070693_100003801 | Ga0070693_1000038013 | 206 |
| 108 | 3300005547 | Ga0070693_100089584 | Ga0070693_1000895841 | 206 |
| 109 | 3300005549 | Ga0070704_100398569 | Ga0070704_1003985692 | 206 |
| 110 | 3300005577 | Ga0068857_100143380 | Ga0068857_1001433802 | 206 |
| 111 | 3300005577 | Ga0068857_100440878 | Ga0068857_1004408782 | 206 |
| 112 | 3300005615 | Ga0070702_100086190 | Ga0070702_1000861902 | 206 |
| 113 | 3300005617 | Ga0068859_100015073 | Ga0068859_1000150738 | 206 |
| 114 | 3300005617 | Ga0068859_100138046 | Ga0068859_1001380462 | 206 |
| 115 | 3300005617 | Ga0068859_100168938 | Ga0068859_1001689382 | 206 |
| 116 | 3300005618 | Ga0068864_100005575 | Ga0068864_1000055756 | 206 |
| 117 | 3300005618 | Ga0068864_100031988 | Ga0068864_1000319884 | 206 |
| 118 | 3300005719 | Ga0068861_100005935 | Ga0068861_1000059355 | 206 |
| 119 | 3300005719 | Ga0068861_100083919 | Ga0068861_1000839192 | 206 |
| 120 | 3300005834 | Ga0068851_10002933 | Ga0068851_100029332 | 206 |
| 121 | 3300005834 | Ga0068851_10342556 | Ga0068851_103425562 | 206 |
| 122 | 3300005840 | Ga0068870_10015867 | Ga0068870_100158672 | 206 |
| 123 | 3300005842 | Ga0068858_100037895 | Ga0068858_1000378952 | 206 |
| 124 | 3300005843 | Ga0068860_100219588 | Ga0068860_1002195882 | 206 |
| 125 | 3300005843 | Ga0068860_100308835 | Ga0068860_1003088352 | 206 |
| 126 | 3300005843 | Ga0068860_100484107 | Ga0068860_1004841071 | 206 |
| 127 | 3300006852 | Ga0075433_10047752 | Ga0075433_100477524 | 206 |
| 128 | 3300006871 | Ga0075434_100036829 | Ga0075434_1000368292 | 206 |
| 129 | 3300006931 | Ga0097620_100015073 | Ga0097620_1000150732 | 206 |
| 130 | 3300006931 | Ga0097620_100138049 | Ga0097620_1001380493 | 206 |
| 131 | 3300006931 | Ga0097620_100168944 | Ga0097620_1001689442 | 206 |
| 132 | 3300009094 | Ga0111539_10029922 | Ga0111539_100299225 | 206 |
| 133 | 3300009101 | Ga0105247_10386156 | Ga0105247_103861562 | 206 |
| 134 | 3300009148 | Ga0105243_10221755 | Ga0105243_102217552 | 206 |
| 135 | 3300009174 | Ga0105241_10240211 | Ga0105241_102402112 | 206 |
| 136 | 3300009174 | Ga0105241_10265602 | Ga0105241_102656021 | 206 |
| 137 | 3300009176 | Ga0105242_10250210 | Ga0105242_102502102 | 206 |
| 138 | 3300009177 | Ga0105248_10170357 | Ga0105248_101703572 | 206 |
| 139 | 3300009177 | Ga0105248_10229317 | Ga0105248_102293172 | 206 |
| 140 | 3300009177 | Ga0105248_10516612 | Ga0105248_105166122 | 206 |
| 141 | 3300009545 | Ga0105237_10001943 | Ga0105237_1000194317 | 206 |
| 142 | 3300009551 | Ga0105238_10000868 | Ga0105238_1000086826 | 206 |
| 143 | 3300009553 | Ga0105249_10001842 | Ga0105249_100018427 | 206 |
| 144 | 3300009553 | Ga0105249_10710136 | Ga0105249_107101361 | 206 |
| 145 | 3300013296 | Ga0157374_10188317 | Ga0157374_101883172 | 206 |
| 146 | 3300013296 | Ga0157374_11090840 | Ga0157374_110908402 | 206 |
| 147 | 3300013308 | Ga0157375_10141294 | Ga0157375_101412941 | 206 |
| 148 | 3300013308 | Ga0157375_10286114 | Ga0157375_102861142 | 206 |
| 149 | 3300014325 | Ga0163163_10000142 | Ga0163163_1000014242 | 206 |
| 150 | 3300014325 | Ga0163163_10205216 | Ga0163163_102052162 | 206 |
| 151 | 3300014325 | Ga0163163_10506953 | Ga0163163_105069532 | 206 |
| 152 | 3300014326 | Ga0157380_10045508 | Ga0157380_100455083 | 206 |
| 153 | 3300014745 | Ga0157377_10095423 | Ga0157377_100954232 | 206 |
| 154 | 3300014968 | Ga0157379_10079921 | Ga0157379_100799212 | 206 |
| 155 | 3300014968 | Ga0157379_10711937 | Ga0157379_107119371 | 206 |
| 156 | 3300025321 | Ga0207656_10005303 | Ga0207656_100053036 | 206 |
| 157 | 3300025885 | Ga0207653_10004534 | Ga0207653_100045344 | 206 |
| 158 | 3300025901 | Ga0207688_10137064 | Ga0207688_101370642 | 206 |
| 159 | 3300025908 | Ga0207643_10014568 | Ga0207643_100145681 | 206 |
| 160 | 3300025910 | Ga0207684_10100971 | Ga0207684_101009712 | 206 |
| 161 | 3300025914 | Ga0207671_10003734 | Ga0207671_1000373410 | 206 |
| 162 | 3300025918 | Ga0207662_10516042 | Ga0207662_105160421 | 206 |
| 163 | 3300025922 | Ga0207646_10227045 | Ga0207646_102270452 | 206 |
| 164 | 3300025923 | Ga0207681_10016048 | Ga0207681_100160483 | 206 |
| 165 | 3300025924 | Ga0207694_10002363 | Ga0207694_1000236319 | 206 |
| 166 | 3300025925 | Ga0207650_10000017 | Ga0207650_1000001740 | 206 |
| 167 | 3300025925 | Ga0207650_10245444 | Ga0207650_102454442 | 206 |
| 168 | 3300025934 | Ga0207686_10050235 | Ga0207686_100502352 | 206 |
| 169 | 3300025935 | Ga0207709_10145319 | Ga0207709_101453191 | 206 |
| 170 | 3300025936 | Ga0207670_10002115 | Ga0207670_100021156 | 206 |
| 171 | 3300025936 | Ga0207670_10187541 | Ga0207670_101875412 | 206 |
| 172 | 3300025940 | Ga0207691_10200507 | Ga0207691_102005071 | 206 |
| 173 | 3300025941 | Ga0207711_10020898 | Ga0207711_100208986 | 206 |
| 174 | 3300025942 | Ga0207689_10590122 | Ga0207689_105901222 | 206 |
| 175 | 3300025961 | Ga0207712_10427477 | Ga0207712_104274772 | 206 |
| 176 | 3300026023 | Ga0207677_10615541 | Ga0207677_106155412 | 206 |
| 177 | 3300026035 | Ga0207703_10059644 | Ga0207703_100596442 | 206 |
| 178 | 3300026035 | Ga0207703_10429930 | Ga0207703_104299302 | 206 |
| 179 | 3300026075 | Ga0207708_10013257 | Ga0207708_100132575 | 206 |
| 180 | 3300026075 | Ga0207708_10013431 | Ga0207708_100134316 | 206 |
| 181 | 3300026075 | Ga0207708_10391037 | Ga0207708_103910372 | 206 |
| 182 | 3300026089 | Ga0207648_10033398 | Ga0207648_100333983 | 206 |
| 183 | 3300026089 | Ga0207648_10073185 | Ga0207648_100731854 | 206 |
| 184 | 3300026089 | Ga0207648_10297207 | Ga0207648_102972072 | 206 |
| 185 | 3300026095 | Ga0207676_10009550 | Ga0207676_100095507 | 206 |
| 186 | 3300026095 | Ga0207676_10401166 | Ga0207676_104011661 | 206 |
| 187 | 3300026116 | Ga0207674_10041071 | Ga0207674_100410714 | 206 |
| 188 | 3300026118 | Ga0207675_100012852 | Ga0207675_1000128525 | 206 |
| 189 | 3300026118 | Ga0207675_100049719 | Ga0207675_1000497193 | 206 |
| 190 | 3300026118 | Ga0207675_100461562 | Ga0207675_1004615622 | 206 |
| 191 | 3300026121 | Ga0207683_10365918 | Ga0207683_103659182 | 206 |
| 192 | 3300028381 | Ga0268264_10015719 | Ga0268264_100157192 | 206 |
| 193 | 3300031548 | Ga0307408_100049523 | Ga0307408_1000495232 | 206 |
| 194 | 3300031903 | Ga0307407_10085975 | Ga0307407_100859752 | 206 |
| 195 | 3300035091 | Ga0373951_0001316 | Ga0373951_0001316_2893_3516 | 206 |
| 196 | 3300035691 | Ga0373931_0278100 | Ga0373931_0278100_173_796 | 206 |
| 197 | 3300046539 | Ga0495621_0005520 | Ga0495621_0005520_899_1525 | 206 |
| 198 | 3300048915 | Ga0496112_0258335 | Ga0496112_0258335_344_967 | 206 |
| 199 | 3300049514 | Ga0501291_008663 | Ga0501291_008663_288_911 | 206 |
| 200 | 3300049515 | Ga0501292_007492 | Ga0501292_007492_172_795 | 206 |
| 201 | 3300049516 | Ga0501293_005939 | Ga0501293_005939_87_710 | 206 |
| 202 | 3300049519 | Ga0501296_001357 | Ga0501296_001357_1793_2416 | 206 |
| 203 | 3300049521 | Ga0501298_028333 | Ga0501298_028333_41_664 | 206 |
| 204 | 3300049521 | Ga0501298_078843 | Ga0501298_078843_46_669 | 206 |
| 205 | 3300049522 | Ga0501299_001015 | Ga0501299_001015_941_1564 | 206 |
| 206 | 3300049522 | Ga0501299_004193 | Ga0501299_004193_115_738 | 206 |
| 207 | 3300049526 | Ga0501303_005616 | Ga0501303_005616_31_654 | 206 |
| 208 | 3300049652 | Ga0501202_005457 | Ga0501202_005457_1065_1688 | 206 |
| 209 | 3300049653 | Ga0501206_003896 | Ga0501206_003896_301_924 | 206 |
| 210 | 3300049654 | Ga0501207_043283 | Ga0501207_043283_78_701 | 206 |
| 211 | 3300049660 | Ga0501216_000648 | Ga0501216_000648_2584_3207 | 206 |
| 212 | 3300049660 | Ga0501216_006035 | Ga0501216_006035_1001_1624 | 206 |
| 213 | 3300049661 | Ga0501217_001584 | Ga0501217_001584_86_709 | 206 |
| 214 | 3300049663 | Ga0501223_004821 | Ga0501223_004821_318_941 | 206 |
| 215 | 3300049669 | Ga0501235_000446 | Ga0501235_000446_7383_8006 | 206 |
| 216 | 3300049669 | Ga0501235_001982 | Ga0501235_001982_1803_2426 | 206 |
| 217 | 3300049680 | Ga0501250_001004 | Ga0501250_001004_182_805 | 206 |
| 218 | 3300049683 | Ga0501253_001218 | Ga0501253_001218_149_772 | 206 |
| 219 | 3300049683 | Ga0501253_003832 | Ga0501253_003832_777_1400 | 206 |
| 220 | 3300049684 | Ga0501255_037644 | Ga0501255_037644_35_658 | 206 |
| 221 | 3300049690 | Ga0501261_000342 | Ga0501261_000342_4990_5613 | 206 |
| 222 | 3300049704 | Ga0501221_019499 | Ga0501221_019499_673_1296 | 206 |
| 223 | 3300049704 | Ga0501221_080821 | Ga0501221_080821_10_633 | 206 |
| 224 | 3300049705 | Ga0501225_0003107 | Ga0501225_0003107_3801_4424 | 206 |
| 225 | 3300049705 | Ga0501225_0013777 | Ga0501225_0013777_1534_2157 | 206 |
| 226 | 3300049707 | Ga0501234_009803 | Ga0501234_009803_786_1409 | 206 |
| 227 | 3300049708 | Ga0501245_001963 | Ga0501245_001963_690_1313 | 206 |
| 228 | 3300049758 | Ga0501241_014210 | Ga0501241_014210_698_1321 | 206 |
| 229 | 3300049759 | Ga0501262_004892 | Ga0501262_004892_423_1046 | 206 |
| 230 | 3300049767 | Ga0501270_001709 | Ga0501270_001709_569_1192 | 206 |
| 231 | 3300049774 | Ga0501278_006290 | Ga0501278_006290_144_767 | 206 |
| 232 | 3300049850 | Ga0501204_005235 | Ga0501204_005235_10_633 | 206 |
| 233 | 3300050510 | nmdc:mga06r32_749482_c1 | nmdc:mga06r32_749482_c1_142_765 | 206 |
| 234 | 3300050511 | nmdc:mga08y16_248297_c1 | nmdc:mga08y16_248297_c1_109_732 | 206 |
| 235 | 3300053146 | Ga0500588_0038722 | Ga0500588_0038722_637_1260 | 207 |
| 236 | iso_pu_bacteria | 2902048731 | 2902051317 | 207 |
| 237 | 3300005290 | Ga0065712_10000430 | Ga0065712_100004308 | 208 |
| 238 | 3300005293 | Ga0065715_10001577 | Ga0065715_100015773 | 208 |
| 239 | 3300005544 | Ga0070686_100149774 | Ga0070686_1001497741 | 208 |
| 240 | 3300005577 | Ga0068857_100822224 | Ga0068857_1008222241 | 208 |
| 241 | 3300005617 | Ga0068859_100111574 | Ga0068859_1001115742 | 208 |
| 242 | 3300005843 | Ga0068860_100014093 | Ga0068860_1000140936 | 208 |
| 243 | 3300006931 | Ga0097620_100111571 | Ga0097620_1001115712 | 208 |
| 244 | 3300025900 | Ga0207710_10000858 | Ga0207710_1000085812 | 208 |
| 245 | 3300025904 | Ga0207647_10177606 | Ga0207647_101776062 | 208 |
| 246 | 3300025914 | Ga0207671_10571631 | Ga0207671_105716311 | 208 |
| 247 | 3300025927 | Ga0207687_10218090 | Ga0207687_102180902 | 208 |
| 248 | 3300025960 | Ga0207651_10128212 | Ga0207651_101282121 | 208 |
| 249 | 3300026035 | Ga0207703_10064094 | Ga0207703_100640942 | 208 |
| 250 | 3300028381 | Ga0268264_10025073 | Ga0268264_100250732 | 208 |
| 251 | iso_pu_bacteria | 2945997725 | 2946003203 | 208 |
| 252 | 3300050493 | nmdc:mga0k408_288582_c1 | nmdc:mga0k408_288582_c1_82_735 | 209 |
| 253 | iso_pu_bacteria | 2585427687 | 2586208787 | 209 |
| 254 | iso_pu_bacteria | 2738541302 | 2738854865 | 209 |
| 255 | iso_pu_bacteria | 2739367651 | 2739587021 | 209 |
| 256 | iso_pu_bacteria | 2739367656 | 2739618211 | 209 |
| 257 | iso_pu_bacteria | 2739367663 | 2739646316 | 209 |
| 258 | iso_pu_bacteria | 2818991437 | 2819547474 | 209 |
| 259 | iso_pu_bacteria | 2842722452 | 2842727535 | 209 |
| 260 | iso_pu_bacteria | 2842909656 | 2842911257 | 209 |
| 261 | iso_pu_bacteria | 2849281842 | 2849283212 | 209 |
| 262 | iso_pu_bacteria | 2857627736 | 2857631500 | 209 |
| 263 | iso_pu_bacteria | 2904445276 | 2904449708 | 209 |
| 264 | iso_pu_bacteria | 2932082852 | 2932085895 | 209 |
| 265 | iso_pu_bacteria | 2954016120 | 2954020060 | 209 |
| 266 | 3300003322 | rootL2_10030820 | rootL2_100308207 | 210 |
| 267 | 3300005288 | Ga0065714_10137475 | Ga0065714_101374752 | 210 |
| 268 | 3300005289 | Ga0065704_10139651 | Ga0065704_101396512 | 210 |
| 269 | 3300005328 | Ga0070676_10286193 | Ga0070676_102861932 | 210 |
| 270 | 3300005438 | Ga0070701_10170658 | Ga0070701_101706582 | 210 |
| 271 | 3300005549 | Ga0070704_100416530 | Ga0070704_1004165302 | 210 |
| 272 | 3300005840 | Ga0068870_10023032 | Ga0068870_100230323 | 210 |
| 273 | 3300025904 | Ga0207647_10317244 | Ga0207647_103172442 | 210 |
| 274 | 3300025907 | Ga0207645_10420145 | Ga0207645_104201451 | 210 |
| 275 | 3300025938 | Ga0207704_10611016 | Ga0207704_106110162 | 210 |
| 276 | 3300026075 | Ga0207708_10993140 | Ga0207708_109931401 | 210 |
| 277 | 3300027907 | Ga0207428_10241999 | Ga0207428_102419992 | 210 |
| 278 | 3300030744 | Ga0316181_1166948 | Ga0316181_11669482 | 210 |
| 279 | 3300046507 | Ga0495606_0063050 | Ga0495606_0063050_535_1167 | 210 |
| 280 | 3300003322 | rootL2_10306079 | rootL2_103060792 | 211 |
| 281 | 3300005288 | Ga0065714_10220103 | Ga0065714_102201031 | 211 |
| 282 | 3300002737 | JGI25162J39368_1000435 | JGI25162J39368_100043518 | 212 |
| 283 | 3300002772 | JGI25164J39214_1001884 | JGI25164J39214_10018844 | 212 |
| 284 | 3300003214 | JGI25165J46597_1001213 | JGI25165J46597_10012133 | 212 |
| 285 | 3300003323 | rootH1_10003362 | rootH1_1000336224 | 212 |
| 286 | 3300003323 | rootH1_10036959 | rootH1_100369594 | 212 |
| 287 | 3300005327 | Ga0070658_10000056 | Ga0070658_10000056117 | 212 |
| 288 | 3300005339 | Ga0070660_101018209 | Ga0070660_1010182091 | 212 |
| 289 | 3300005356 | Ga0070674_100038925 | Ga0070674_1000389252 | 212 |
| 290 | 3300005539 | Ga0068853_100531961 | Ga0068853_1005319611 | 212 |
| 291 | 3300005563 | Ga0068855_100043825 | Ga0068855_1000438255 | 212 |
| 292 | 3300005614 | Ga0068856_100007747 | Ga0068856_1000077472 | 212 |
| 293 | 3300005718 | Ga0068866_10239976 | Ga0068866_102399762 | 212 |
| 294 | 3300009093 | Ga0105240_10046113 | Ga0105240_100461135 | 212 |
| 295 | 3300009098 | Ga0105245_10218194 | Ga0105245_102181942 | 212 |
| 296 | 3300009174 | Ga0105241_10019765 | Ga0105241_100197653 | 212 |
| 297 | 3300009174 | Ga0105241_10704681 | Ga0105241_107046811 | 212 |
| 298 | 3300010375 | Ga0105239_10576041 | Ga0105239_105760412 | 212 |
| 299 | 3300013296 | Ga0157374_10428429 | Ga0157374_104284292 | 212 |
| 300 | 3300013297 | Ga0157378_10477589 | Ga0157378_104775892 | 212 |
| 301 | 3300025230 | Ga0209563_104170 | Ga0209563_1041702 | 212 |
| 302 | 3300025231 | Ga0207427_101183 | Ga0207427_1011833 | 212 |
| 303 | 3300025233 | Ga0209437_100112 | Ga0209437_10011216 | 212 |
| 304 | 3300025250 | Ga0209026_1009331 | Ga0209026_10093312 | 212 |
| 305 | 3300025261 | Ga0209233_1000126 | Ga0209233_1000126165 | 212 |
| 306 | 3300025261 | Ga0209233_1022574 | Ga0209233_10225742 | 212 |
| 307 | 3300025272 | Ga0209455_1003551 | Ga0209455_10035512 | 212 |
| 308 | 3300025909 | Ga0207705_10000028 | Ga0207705_1000002812 | 212 |
| 309 | 3300025911 | Ga0207654_10054537 | Ga0207654_100545373 | 212 |
| 310 | 3300025911 | Ga0207654_10386451 | Ga0207654_103864511 | 212 |
| 311 | 3300025913 | Ga0207695_10155221 | Ga0207695_101552212 | 212 |
| 312 | 3300025919 | Ga0207657_10122884 | Ga0207657_101228843 | 212 |
| 313 | 3300025937 | Ga0207669_10185910 | Ga0207669_101859102 | 212 |
| 314 | 3300025949 | Ga0207667_10065263 | Ga0207667_100652634 | 212 |
| 315 | 3300026041 | Ga0207639_10575402 | Ga0207639_105754022 | 212 |
| 316 | 3300026078 | Ga0207702_10386946 | Ga0207702_103869461 | 212 |
| 317 | 3300028786 | Ga0307517_10002971 | Ga0307517_1000297118 | 212 |
| 318 | 3300031251 | Ga0265327_10164210 | Ga0265327_101642102 | 212 |
| 319 | 3300031507 | Ga0307509_10103378 | Ga0307509_101033784 | 212 |
| 320 | 3300032004 | Ga0307414_10390173 | Ga0307414_103901732 | 212 |
| 321 | 3300033180 | Ga0307510_10075388 | Ga0307510_100753883 | 212 |
| 322 | 3300046518 | Ga0495631_0018599 | Ga0495631_0018599_770_1408 | 212 |
| 323 | 3300046529 | Ga0495652_0261294 | Ga0495652_0261294_454_1092 | 212 |
| 324 | 3300046660 | Ga0495625_0086610 | Ga0495625_0086610_707_1345 | 212 |
| 325 | 3300047323 | Ga0495683_0034477 | Ga0495683_0034477_285_923 | 212 |
| 326 | 3300002077 | JGI24744J21845_10020228 | JGI24744J21845_100202282 | 213 |
| 327 | 3300002741 | JGI25157J39369_1009630 | JGI25157J39369_10096302 | 213 |
| 328 | 3300002773 | JGI25152J39213_1000054 | JGI25152J39213_100005431 | 213 |
| 329 | 3300002774 | JGI25150J39212_1000003 | JGI25150J39212_1000003243 | 213 |
| 330 | 3300003187 | JGI25151J46595_10000002 | JGI25151J46595_10000002243 | 213 |
| 331 | 3300003215 | JGI25153J46596_10000015 | JGI25153J46596_1000001554 | 213 |
| 332 | 3300003316 | rootH1_10048329 | rootH1_100483296 | 213 |
| 333 | 3300003320 | rootH2_10001274 | rootH2_1000127451 | 213 |
| 334 | 3300003322 | rootL2_10224865 | rootL2_102248655 | 213 |
| 335 | 3300003781 | Ga0055536_1000006 | Ga0055536_1000006167 | 213 |
| 336 | 3300003791 | Ga0055530_10002643 | Ga0055530_100026436 | 213 |
| 337 | 3300005288 | Ga0065714_10002307 | Ga0065714_1000230711 | 213 |
| 338 | 3300005288 | Ga0065714_10021495 | Ga0065714_100214951 | 213 |
| 339 | 3300005288 | Ga0065714_10074001 | Ga0065714_100740012 | 213 |
| 340 | 3300005288 | Ga0065714_10083206 | Ga0065714_100832062 | 213 |
| 341 | 3300005327 | Ga0070658_10149113 | Ga0070658_101491132 | 213 |
| 342 | 3300005328 | Ga0070676_10000483 | Ga0070676_1000048317 | 213 |
| 343 | 3300005334 | Ga0068869_100245099 | Ga0068869_1002450991 | 213 |
| 344 | 3300005338 | Ga0068868_100083750 | Ga0068868_1000837502 | 213 |
| 345 | 3300005339 | Ga0070660_100270344 | Ga0070660_1002703442 | 213 |
| 346 | 3300005364 | Ga0070673_100006813 | Ga0070673_1000068133 | 213 |
| 347 | 3300005456 | Ga0070678_100010530 | Ga0070678_1000105307 | 213 |
| 348 | 3300005459 | Ga0068867_100036014 | Ga0068867_1000360142 | 213 |
| 349 | 3300005539 | Ga0068853_100087140 | Ga0068853_1000871403 | 213 |
| 350 | 3300005539 | Ga0068853_100139477 | Ga0068853_1001394772 | 213 |
| 351 | 3300005543 | Ga0070672_100392553 | Ga0070672_1003925532 | 213 |
| 352 | 3300005548 | Ga0070665_100000034 | Ga0070665_100000034166 | 213 |
| 353 | 3300005563 | Ga0068855_100000302 | Ga0068855_10000030245 | 213 |
| 354 | 3300005563 | Ga0068855_100000611 | Ga0068855_10000061110 | 213 |
| 355 | 3300005563 | Ga0068855_100013791 | Ga0068855_1000137914 | 213 |
| 356 | 3300005614 | Ga0068856_100000031 | Ga0068856_10000003187 | 213 |
| 357 | 3300005614 | Ga0068856_100072206 | Ga0068856_1000722061 | 213 |
| 358 | 3300005616 | Ga0068852_100006666 | Ga0068852_1000066667 | 213 |
| 359 | 3300005718 | Ga0068866_10022755 | Ga0068866_100227552 | 213 |
| 360 | 3300006237 | Ga0097621_100002837 | Ga0097621_1000028379 | 213 |
| 361 | 3300006358 | Ga0068871_100000482 | Ga0068871_10000048229 | 213 |
| 362 | 3300006881 | Ga0068865_100000055 | Ga0068865_10000005564 | 213 |
| 363 | 3300009036 | Ga0105244_10041432 | Ga0105244_100414321 | 213 |
| 364 | 3300009093 | Ga0105240_10006961 | Ga0105240_100069619 | 213 |
| 365 | 3300009093 | Ga0105240_10202882 | Ga0105240_102028823 | 213 |
| 366 | 3300009098 | Ga0105245_10855581 | Ga0105245_108555811 | 213 |
| 367 | 3300009174 | Ga0105241_10007631 | Ga0105241_100076318 | 213 |
| 368 | 3300009174 | Ga0105241_10182222 | Ga0105241_101822221 | 213 |
| 369 | 3300009174 | Ga0105241_10454451 | Ga0105241_104544512 | 213 |
| 370 | 3300009545 | Ga0105237_10001160 | Ga0105237_1000116021 | 213 |
| 371 | 3300009545 | Ga0105237_10021202 | Ga0105237_100212028 | 213 |
| 372 | 3300009545 | Ga0105237_10022335 | Ga0105237_100223352 | 213 |
| 373 | 3300009545 | Ga0105237_10136120 | Ga0105237_101361204 | 213 |
| 374 | 3300009551 | Ga0105238_10010457 | Ga0105238_100104574 | 213 |
| 375 | 3300010375 | Ga0105239_10004643 | Ga0105239_1000464310 | 213 |
| 376 | 3300011119 | Ga0105246_10370339 | Ga0105246_103703392 | 213 |
| 377 | 3300013100 | Ga0157373_10008702 | Ga0157373_100087029 | 213 |
| 378 | 3300013102 | Ga0157371_10000117 | Ga0157371_1000011739 | 213 |
| 379 | 3300013104 | Ga0157370_10017786 | Ga0157370_100177863 | 213 |
| 380 | 3300013104 | Ga0157370_10025999 | Ga0157370_100259993 | 213 |
| 381 | 3300013104 | Ga0157370_10054701 | Ga0157370_100547016 | 213 |
| 382 | 3300013104 | Ga0157370_10071814 | Ga0157370_100718143 | 213 |
| 383 | 3300013104 | Ga0157370_10093547 | Ga0157370_100935473 | 213 |
| 384 | 3300013104 | Ga0157370_10279282 | Ga0157370_102792822 | 213 |
| 385 | 3300013105 | Ga0157369_10000047 | Ga0157369_1000004782 | 213 |
| 386 | 3300013105 | Ga0157369_10560879 | Ga0157369_105608792 | 213 |
| 387 | 3300013296 | Ga0157374_10047255 | Ga0157374_100472553 | 213 |
| 388 | 3300013297 | Ga0157378_10028393 | Ga0157378_100283935 | 213 |
| 389 | 3300013297 | Ga0157378_10031595 | Ga0157378_100315955 | 213 |
| 390 | 3300013297 | Ga0157378_10150583 | Ga0157378_101505832 | 213 |
| 391 | 3300013306 | Ga0163162_10000018 | Ga0163162_10000018137 | 213 |
| 392 | 3300013306 | Ga0163162_10000895 | Ga0163162_1000089511 | 213 |
| 393 | 3300013308 | Ga0157375_10172190 | Ga0157375_101721902 | 213 |
| 394 | 3300014497 | Ga0182008_10000914 | Ga0182008_1000091410 | 213 |
| 395 | 3300015261 | Ga0182006_1000153 | Ga0182006_10001539 | 213 |
| 396 | 3300015261 | Ga0182006_1000287 | Ga0182006_100028736 | 213 |
| 397 | 3300015262 | Ga0182007_10000005 | Ga0182007_10000005168 | 213 |
| 398 | 3300015682 | Ga0183373_1002 | Ga0183373_1002756 | 213 |
| 399 | 3300017792 | Ga0163161_10002412 | Ga0163161_100024126 | 213 |
| 400 | 3300017792 | Ga0163161_10002768 | Ga0163161_1000276811 | 213 |
| 401 | 3300017792 | Ga0163161_10006203 | Ga0163161_100062036 | 213 |
| 402 | 3300017792 | Ga0163161_10166941 | Ga0163161_101669412 | 213 |
| 403 | 3300021361 | Ga0213872_10090057 | Ga0213872_100900573 | 213 |
| 404 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003599 | 213 |
| 405 | 3300025250 | Ga0209026_1000549 | Ga0209026_100054914 | 213 |
| 406 | 3300025258 | Ga0209129_1000014 | Ga0209129_1000014234 | 213 |
| 407 | 3300025292 | Ga0209676_1000039 | Ga0209676_1000039259 | 213 |
| 408 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007598 | 213 |
| 409 | 3300025297 | Ga0209758_1000012 | Ga0209758_1000012599 | 213 |
| 410 | 3300025298 | Ga0209050_1000033 | Ga0209050_1000033189 | 213 |
| 411 | 3300025907 | Ga0207645_10000056 | Ga0207645_100000568 | 213 |
| 412 | 3300025909 | Ga0207705_10052660 | Ga0207705_100526602 | 213 |
| 413 | 3300025911 | Ga0207654_10046925 | Ga0207654_100469252 | 213 |
| 414 | 3300025911 | Ga0207654_10276514 | Ga0207654_102765142 | 213 |
| 415 | 3300025913 | Ga0207695_10015983 | Ga0207695_1001598310 | 213 |
| 416 | 3300025913 | Ga0207695_10167303 | Ga0207695_101673032 | 213 |
| 417 | 3300025914 | Ga0207671_10001813 | Ga0207671_1000181321 | 213 |
| 418 | 3300025914 | Ga0207671_10012550 | Ga0207671_100125502 | 213 |
| 419 | 3300025914 | Ga0207671_10019257 | Ga0207671_100192573 | 213 |
| 420 | 3300025919 | Ga0207657_10264322 | Ga0207657_102643222 | 213 |
| 421 | 3300025932 | Ga0207690_10000123 | Ga0207690_1000012340 | 213 |
| 422 | 3300025938 | Ga0207704_10000229 | Ga0207704_1000022911 | 213 |
| 423 | 3300025942 | Ga0207689_10921964 | Ga0207689_109219641 | 213 |
| 424 | 3300025949 | Ga0207667_10000477 | Ga0207667_1000047741 | 213 |
| 425 | 3300025949 | Ga0207667_10005555 | Ga0207667_1000555514 | 213 |
| 426 | 3300025949 | Ga0207667_10012719 | Ga0207667_1001271910 | 213 |
| 427 | 3300026023 | Ga0207677_10046290 | Ga0207677_100462903 | 213 |
| 428 | 3300026041 | Ga0207639_10028495 | Ga0207639_100284953 | 213 |
| 429 | 3300026041 | Ga0207639_10118262 | Ga0207639_101182623 | 213 |
| 430 | 3300026078 | Ga0207702_10000071 | Ga0207702_1000007188 | 213 |
| 431 | 3300026078 | Ga0207702_11057425 | Ga0207702_110574251 | 213 |
| 432 | 3300026089 | Ga0207648_10004742 | Ga0207648_100047429 | 213 |
| 433 | 3300026121 | Ga0207683_10005938 | Ga0207683_100059387 | 213 |
| 434 | 3300028379 | Ga0268266_10000119 | Ga0268266_1000011910 | 213 |
| 435 | 3300028794 | Ga0307515_10001098 | Ga0307515_1000109822 | 213 |
| 436 | 3300028794 | Ga0307515_10006567 | Ga0307515_1000656713 | 213 |
| 437 | 3300031731 | Ga0307405_10000009 | Ga0307405_10000009105 | 213 |
| 438 | 3300031903 | Ga0307407_10000001 | Ga0307407_10000001281 | 213 |
| 439 | 3300031995 | Ga0307409_100012342 | Ga0307409_1000123425 | 213 |
| 440 | 3300032002 | Ga0307416_100000008 | Ga0307416_100000008108 | 213 |
| 441 | 3300032004 | Ga0307414_10010770 | Ga0307414_100107702 | 213 |
| 442 | 3300033179 | Ga0307507_10000071 | Ga0307507_1000007113 | 213 |
| 443 | 3300037312 | Ga0395899_0000462 | Ga0395899_0000462_22782_23423 | 213 |
| 444 | 3300037418 | Ga0395900_0000141 | Ga0395900_0000141_40780_41421 | 213 |
| 445 | 3300037466 | Ga0395898_0017800 | Ga0395898_0017800_5513_6154 | 213 |
| 446 | 3300037471 | Ga0395905_0000124 | Ga0395905_0000124_94234_94875 | 213 |
| 447 | 3300038443 | Ga0395901_0000138 | Ga0395901_0000138_44345_44986 | 213 |
| 448 | 3300039447 | Ga0436361_0979080 | Ga0436361_0979080_711_1352 | 213 |
| 449 | 3300046492 | Ga0495585_0000917 | Ga0495585_0000917_8474_9115 | 213 |
| 450 | 3300046507 | Ga0495606_0034004 | Ga0495606_0034004_2180_2821 | 213 |
| 451 | 3300046512 | Ga0495610_0000076 | Ga0495610_0000076_32477_33118 | 213 |
| 452 | 3300046512 | Ga0495610_0003649 | Ga0495610_0003649_2160_2801 | 213 |
| 453 | 3300046520 | Ga0495637_0030977 | Ga0495637_0030977_1422_2063 | 213 |
| 454 | 3300046524 | Ga0495648_0013028 | Ga0495648_0013028_897_1538 | 213 |
| 455 | 3300046557 | Ga0495622_0109395 | Ga0495622_0109395_57_698 | 213 |
| 456 | 3300046660 | Ga0495625_0000647 | Ga0495625_0000647_36762_37403 | 213 |
| 457 | 3300046660 | Ga0495625_0099570 | Ga0495625_0099570_1135_1776 | 213 |
| 458 | 3300046665 | Ga0495661_0270470 | Ga0495661_0270470_160_807 | 213 |
| 459 | 3300046683 | Ga0495658_0012865 | Ga0495658_0012865_420_1061 | 213 |
| 460 | 3300046810 | Ga0495660_0075393 | Ga0495660_0075393_388_1032 | 213 |
| 461 | 3300053080 | Ga0500635_0001446 | Ga0500635_0001446_2250_2894 | 213 |
| 462 | 3300053122 | Ga0500608_031671 | Ga0500608_031671_408_1052 | 213 |
| 463 | 3300053125 | Ga0500618_000142 | Ga0500618_000142_30976_31620 | 213 |
| 464 | 3300059424 | Ga0590075_000806 | Ga0590075_000806_669_1316 | 213 |
| 465 | iso_pu_bacteria | 2818991442 | 2819577641 | 213 |
| 466 | iso_pu_bacteria | 2821136567 | 2821142184 | 213 |
| 467 | iso_pu_bacteria | 2852623160 | 2852624962 | 213 |
| 468 | iso_pu_bacteria | 2884933994 | 2884936012 | 213 |
| 469 | iso_pu_bacteria | 2904467357 | 2904470647 | 213 |
| 470 | 3300005288 | Ga0065714_10090585 | Ga0065714_100905853 | 214 |
| 471 | iso_pu_bacteria | 2738541278 | 2738724770 | 214 |
| 472 | iso_pu_bacteria | 2919437846 | 2919438807 | 214 |
| 473 | 3300021384 | Ga0213876_10002467 | Ga0213876_100024679 | 216 |
| 474 | 3300039437 | Ga0436365_1179973 | Ga0436365_1179973_14407_15060 | 216 |
| 475 | 3300046810 | Ga0495660_0013907 | Ga0495660_0013907_471_1121 | 216 |
| 476 | 3300001990 | JGI24737J22298_10000227 | JGI24737J22298_1000022716 | 217 |
| 477 | 3300002067 | JGI24735J21928_10000002 | JGI24735J21928_10000002448 | 217 |
| 478 | 3300003316 | rootH1_10045344 | rootH1_100453442 | 217 |
| 479 | 3300003323 | rootH1_10168090 | rootH1_101680902 | 217 |
| 480 | 3300003323 | rootH1_10233864 | rootH1_102338642 | 217 |
| 481 | 3300005288 | Ga0065714_10073449 | Ga0065714_100734492 | 217 |
| 482 | 3300005288 | Ga0065714_10124708 | Ga0065714_101247081 | 217 |
| 483 | 3300005539 | Ga0068853_100142365 | Ga0068853_1001423653 | 217 |
| 484 | 3300005539 | Ga0068853_100202548 | Ga0068853_1002025481 | 217 |
| 485 | 3300006195 | Ga0075366_10012650 | Ga0075366_100126501 | 217 |
| 486 | 3300009093 | Ga0105240_10293724 | Ga0105240_102937241 | 217 |
| 487 | 3300009147 | Ga0114129_10004031 | Ga0114129_100040312 | 217 |
| 488 | 3300009174 | Ga0105241_10892784 | Ga0105241_108927842 | 217 |
| 489 | 3300009545 | Ga0105237_10155572 | Ga0105237_101555722 | 217 |
| 490 | 3300010375 | Ga0105239_10004611 | Ga0105239_100046112 | 217 |
| 491 | 3300010375 | Ga0105239_10008566 | Ga0105239_1000856610 | 217 |
| 492 | 3300010375 | Ga0105239_10341504 | Ga0105239_103415042 | 217 |
| 493 | 3300010375 | Ga0105239_10971625 | Ga0105239_109716252 | 217 |
| 494 | 3300013102 | Ga0157371_10083390 | Ga0157371_100833904 | 217 |
| 495 | 3300013104 | Ga0157370_10234957 | Ga0157370_102349571 | 217 |
| 496 | 3300013105 | Ga0157369_10047681 | Ga0157369_100476811 | 217 |
| 497 | 3300013296 | Ga0157374_10327344 | Ga0157374_103273442 | 217 |
| 498 | 3300013306 | Ga0163162_10383957 | Ga0163162_103839573 | 217 |
| 499 | 3300013307 | Ga0157372_10001233 | Ga0157372_100012331 | 217 |
| 500 | 3300015265 | Ga0182005_1004167 | Ga0182005_10041674 | 217 |
| 501 | 3300017792 | Ga0163161_10001043 | Ga0163161_1000104312 | 217 |
| 502 | 3300017792 | Ga0163161_10592064 | Ga0163161_105920642 | 217 |
| 503 | 3300025208 | Ga0209436_102408 | Ga0209436_1024089 | 217 |
| 504 | 3300025246 | Ga0209646_1001930 | Ga0209646_10019306 | 217 |
| 505 | 3300025302 | Ga0207426_1002573 | Ga0207426_10025732 | 217 |
| 506 | 3300025913 | Ga0207695_10187302 | Ga0207695_101873021 | 217 |
| 507 | 3300025914 | Ga0207671_10011422 | Ga0207671_100114225 | 217 |
| 508 | 3300026041 | Ga0207639_10132143 | Ga0207639_101321433 | 217 |
| 509 | 3300026041 | Ga0207639_10135240 | Ga0207639_101352403 | 217 |
| 510 | 3300028794 | Ga0307515_10004758 | Ga0307515_1000475813 | 217 |
| 511 | 3300028794 | Ga0307515_10011347 | Ga0307515_100113478 | 217 |
| 512 | 3300031456 | Ga0307513_10207758 | Ga0307513_102077583 | 217 |
| 513 | 3300031456 | Ga0307513_10283975 | Ga0307513_102839751 | 217 |
| 514 | 3300031507 | Ga0307509_10183593 | Ga0307509_101835931 | 217 |
| 515 | 3300033179 | Ga0307507_10001977 | Ga0307507_1000197740 | 217 |
| 516 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_117924_118577 | 217 |
| 517 | 3300041509 | Ga0451843_1695759 | Ga0451843_1695759_13_666 | 217 |
| 518 | 3300044842 | Ga0466957_0006428 | Ga0466957_0006428_4909_5562 | 217 |
| 519 | 3300046462 | Ga0495651_0121740 | Ga0495651_0121740_514_1167 | 217 |
| 520 | 3300046492 | Ga0495585_0000723 | Ga0495585_0000723_2937_3590 | 217 |
| 521 | 3300046492 | Ga0495585_0003748 | Ga0495585_0003748_8710_9363 | 217 |
| 522 | 3300046507 | Ga0495606_0000003 | Ga0495606_0000003_313747_314400 | 217 |
| 523 | 3300046507 | Ga0495606_0059081 | Ga0495606_0059081_660_1313 | 217 |
| 524 | 3300046512 | Ga0495610_0000273 | Ga0495610_0000273_31230_31883 | 217 |
| 525 | 3300046513 | Ga0495616_0027571 | Ga0495616_0027571_499_1158 | 217 |
| 526 | 3300046524 | Ga0495648_0037682 | Ga0495648_0037682_889_1542 | 217 |
| 527 | 3300046529 | Ga0495652_0120370 | Ga0495652_0120370_340_999 | 217 |
| 528 | 3300046538 | Ga0495609_0010151 | Ga0495609_0010151_1325_1978 | 217 |
| 529 | 3300046538 | Ga0495609_0035849 | Ga0495609_0035849_758_1411 | 217 |
| 530 | 3300046557 | Ga0495622_0046331 | Ga0495622_0046331_1325_1978 | 217 |
| 531 | 3300046558 | Ga0495633_0000269 | Ga0495633_0000269_50218_50871 | 217 |
| 532 | 3300046558 | Ga0495633_0016633 | Ga0495633_0016633_2436_3089 | 217 |
| 533 | 3300046616 | Ga0495668_0000032 | Ga0495668_0000032_244160_244813 | 217 |
| 534 | 3300046660 | Ga0495625_0000304 | Ga0495625_0000304_47542_48195 | 217 |
| 535 | 3300046660 | Ga0495625_0000993 | Ga0495625_0000993_32094_32747 | 217 |
| 536 | 3300046660 | Ga0495625_0229107 | Ga0495625_0229107_201_854 | 217 |
| 537 | 3300046660 | Ga0495625_0263913 | Ga0495625_0263913_70_729 | 217 |
| 538 | 3300046665 | Ga0495661_0028328 | Ga0495661_0028328_2037_2690 | 217 |
| 539 | 3300046683 | Ga0495658_0141113 | Ga0495658_0141113_168_821 | 217 |
| 540 | 3300046809 | Ga0495600_0229575 | Ga0495600_0229575_315_968 | 217 |
| 541 | 3300046810 | Ga0495660_0045669 | Ga0495660_0045669_154_807 | 217 |
| 542 | 3300047472 | Ga0495686_0060268 | Ga0495686_0060268_1315_1974 | 217 |
| 543 | 3300048089 | Ga0495614_0010900 | Ga0495614_0010900_2800_3453 | 217 |
| 544 | 3300049459 | Ga0495678_005512 | Ga0495678_005512_6252_6911 | 217 |
| 545 | 3300050493 | nmdc:mga0k408_713_c1 | nmdc:mga0k408_713_c1_64_717 | 217 |
| 546 | 3300050507 | nmdc:mga05p37_23907_c1 | nmdc:mga05p37_23907_c1_148_801 | 217 |
| 547 | 3300053090 | Ga0500646_0007943 | Ga0500646_0007943_179_832 | 217 |
| 548 | 3300053091 | Ga0500647_0125587 | Ga0500647_0125587_99_752 | 217 |
| 549 | 3300053092 | Ga0500583_0000648 | Ga0500583_0000648_2809_3462 | 217 |
| 550 | 3300053122 | Ga0500608_076100 | Ga0500608_076100_436_1089 | 217 |
| 551 | 3300053123 | Ga0500614_029038 | Ga0500614_029038_145_798 | 217 |
| 552 | 3300053125 | Ga0500618_000150 | Ga0500618_000150_45141_45794 | 217 |
| 553 | 3300053131 | Ga0500652_124333 | Ga0500652_124333_68_721 | 217 |
| 554 | 3300053147 | Ga0500589_044855 | Ga0500589_044855_173_826 | 217 |
| 555 | 3300053163 | Ga0500639_167792 | Ga0500639_167792_44_697 | 217 |
| 556 | 3300053727 | Ga0500611_019062 | Ga0500611_019062_585_1238 | 217 |
| 557 | iso_pu_bacteria | 2599185184 | 2599478506 | 217 |
| 558 | iso_pu_bacteria | 2928078545 | 2928080442 | 217 |
| 559 | iso_pu_bacteria | 2928147474 | 2928149386 | 217 |
| 560 | iso_pu_bacteria | 2932082852 | 2932083217 | 217 |
| 561 | 3300003316 | rootH1_10061801 | rootH1_100618011 | 218 |
| 562 | 3300003323 | rootH1_10326186 | rootH1_103261863 | 218 |
| 563 | 3300005539 | Ga0068853_100225771 | Ga0068853_1002257713 | 218 |
| 564 | 3300005563 | Ga0068855_100012990 | Ga0068855_1000129906 | 218 |
| 565 | 3300005563 | Ga0068855_100857549 | Ga0068855_1008575492 | 218 |
| 566 | 3300005577 | Ga0068857_100061189 | Ga0068857_1000611893 | 218 |
| 567 | 3300005843 | Ga0068860_100130922 | Ga0068860_1001309222 | 218 |
| 568 | 3300006195 | Ga0075366_10014933 | Ga0075366_100149332 | 218 |
| 569 | 3300006195 | Ga0075366_10101845 | Ga0075366_101018453 | 218 |
| 570 | 3300006195 | Ga0075366_10174290 | Ga0075366_101742903 | 218 |
| 571 | 3300009147 | Ga0114129_10004843 | Ga0114129_100048436 | 218 |
| 572 | 3300009174 | Ga0105241_10054759 | Ga0105241_100547592 | 218 |
| 573 | 3300009545 | Ga0105237_10011368 | Ga0105237_100113686 | 218 |
| 574 | 3300010375 | Ga0105239_10011451 | Ga0105239_100114515 | 218 |
| 575 | 3300013296 | Ga0157374_10061346 | Ga0157374_100613462 | 218 |
| 576 | 3300025242 | Ga0209258_105671 | Ga0209258_1056712 | 218 |
| 577 | 3300025246 | Ga0209646_1000615 | Ga0209646_10006155 | 218 |
| 578 | 3300025911 | Ga0207654_10015752 | Ga0207654_100157523 | 218 |
| 579 | 3300025949 | Ga0207667_10014605 | Ga0207667_100146052 | 218 |
| 580 | 3300026041 | Ga0207639_10647771 | Ga0207639_106477712 | 218 |
| 581 | 3300026078 | Ga0207702_10038000 | Ga0207702_100380003 | 218 |
| 582 | 3300026116 | Ga0207674_10082730 | Ga0207674_100827303 | 218 |
| 583 | 3300028381 | Ga0268264_10085953 | Ga0268264_100859532 | 218 |
| 584 | 3300030522 | Ga0307512_10156020 | Ga0307512_101560201 | 218 |
| 585 | 3300031456 | Ga0307513_10103824 | Ga0307513_101038243 | 218 |
| 586 | 3300031456 | Ga0307513_10155986 | Ga0307513_101559862 | 218 |
| 587 | 3300031456 | Ga0307513_10448906 | Ga0307513_104489061 | 218 |
| 588 | 3300041404 | Ga0439436_0023300 | Ga0439436_0023300_553_1209 | 218 |
| 589 | 3300041505 | Ga0451849_1018633 | Ga0451849_1018633_491_1147 | 218 |
| 590 | 3300041512 | Ga0451853_3921089 | Ga0451853_3921089_280_936 | 218 |
| 591 | 3300042007 | Ga0439449_0014731 | Ga0439449_0014731_755_1411 | 218 |
| 592 | 3300042007 | Ga0439449_0021859 | Ga0439449_0021859_1508_2164 | 218 |
| 593 | 3300042007 | Ga0439449_0045301 | Ga0439449_0045301_416_1072 | 218 |
| 594 | 3300042014 | Ga0439457_000072 | Ga0439457_000072_12709_13365 | 218 |
| 595 | 3300042014 | Ga0439457_037178 | Ga0439457_037178_296_952 | 218 |
| 596 | 3300042015 | Ga0439462_0000326 | Ga0439462_0000326_6642_7298 | 218 |
| 597 | 3300044658 | Ga0466972_0000571 | Ga0466972_0000571_14384_15040 | 218 |
| 598 | 3300044658 | Ga0466972_0019102 | Ga0466972_0019102_135_791 | 218 |
| 599 | 3300044684 | Ga0466966_0000022 | Ga0466966_0000022_73361_74017 | 218 |
| 600 | 3300044693 | Ga0466961_0421287 | Ga0466961_0421287_14_670 | 218 |
| 601 | 3300044706 | Ga0466964_0215057 | Ga0466964_0215057_86_742 | 218 |
| 602 | 3300044735 | Ga0466968_0161226 | Ga0466968_0161226_201_857 | 218 |
| 603 | 3300044842 | Ga0466957_0000411 | Ga0466957_0000411_6320_6976 | 218 |
| 604 | 3300044842 | Ga0466957_0030049 | Ga0466957_0030049_223_882 | 218 |
| 605 | 3300045049 | Ga0466959_0000055 | Ga0466959_0000055_73040_73696 | 218 |
| 606 | 3300046519 | Ga0495632_0106654 | Ga0495632_0106654_363_1019 | 218 |
| 607 | 3300046616 | Ga0495668_0001067 | Ga0495668_0001067_16596_17252 | 218 |
| 608 | 3300049573 | Ga0501037_0503059 | Ga0501037_0503059_14_670 | 218 |
| 609 | 3300049581 | Ga0501047_0065903 | Ga0501047_0065903_2775_3431 | 218 |
| 610 | 3300049686 | Ga0501257_089268 | Ga0501257_089268_50_706 | 218 |
| 611 | 3300049703 | Ga0501219_000156 | Ga0501219_000156_9400_10056 | 218 |
| 612 | 3300049705 | Ga0501225_0000860 | Ga0501225_0000860_8479_9135 | 218 |
| 613 | 3300049822 | Ga0501035_0082398 | Ga0501035_0082398_1992_2648 | 218 |
| 614 | 3300049823 | Ga0501044_0003835 | Ga0501044_0003835_3188_3844 | 218 |
| 615 | 3300050493 | nmdc:mga0k408_21815_c1 | nmdc:mga0k408_21815_c1_1308_1964 | 218 |
| 616 | 3300050507 | nmdc:mga05p37_3277_c1 | nmdc:mga05p37_3277_c1_7447_8103 | 218 |
| 617 | 3300053086 | Ga0500578_0000010 | Ga0500578_0000010_36556_37212 | 218 |
| 618 | 3300053086 | Ga0500578_0078696 | Ga0500578_0078696_1414_2070 | 218 |
| 619 | 3300053088 | Ga0500644_0033077 | Ga0500644_0033077_925_1581 | 218 |
| 620 | 3300053090 | Ga0500646_0092397 | Ga0500646_0092397_120_776 | 218 |
| 621 | 3300053092 | Ga0500583_0000039 | Ga0500583_0000039_74252_74908 | 218 |
| 622 | 3300053092 | Ga0500583_0000663 | Ga0500583_0000663_3948_4604 | 218 |
| 623 | 3300053092 | Ga0500583_0098232 | Ga0500583_0098232_158_814 | 218 |
| 624 | 3300053092 | Ga0500583_0122585 | Ga0500583_0122585_142_798 | 218 |
| 625 | 3300053103 | Ga0500555_022008 | Ga0500555_022008_279_935 | 218 |
| 626 | 3300053130 | Ga0500642_0154709 | Ga0500642_0154709_317_973 | 218 |
| 627 | 3300053131 | Ga0500652_030756 | Ga0500652_030756_538_1194 | 218 |
| 628 | 3300053147 | Ga0500589_111600 | Ga0500589_111600_399_1055 | 218 |
| 629 | 3300053156 | Ga0500622_0023303 | Ga0500622_0023303_1317_1973 | 218 |
| 630 | 3300053177 | Ga0500636_0069537 | Ga0500636_0069537_1355_2011 | 218 |
| 631 | 3300053178 | Ga0500637_0269298 | Ga0500637_0269298_110_766 | 218 |
| 632 | 3300061719 | Ga0466962_0170410 | Ga0466962_0170410_388_1044 | 218 |
| 633 | 2162886012 | MBSR1b_contig_8140190 | MBSR1b_0158.00001050 | 219 |
| 634 | 2162886012 | MBSR1b_contig_8930577 | MBSR1b_0106.00000740 | 219 |
| 635 | 3300003316 | rootH1_10061802 | rootH1_100618024 | 219 |
| 636 | 3300003320 | rootH2_10006602 | rootH2_1000660226 | 219 |
| 637 | 3300003320 | rootH2_10035936 | rootH2_100359365 | 219 |
| 638 | 3300003320 | rootH2_10057451 | rootH2_100574515 | 219 |
| 639 | 3300005290 | Ga0065712_10083690 | Ga0065712_100836904 | 219 |
| 640 | 3300005293 | Ga0065715_10119205 | Ga0065715_101192052 | 219 |
| 641 | 3300005329 | Ga0070683_100012300 | Ga0070683_1000123003 | 219 |
| 642 | 3300005331 | Ga0070670_100149166 | Ga0070670_1001491663 | 219 |
| 643 | 3300005334 | Ga0068869_100035489 | Ga0068869_1000354892 | 219 |
| 644 | 3300005337 | Ga0070682_100608284 | Ga0070682_1006082842 | 219 |
| 645 | 3300005337 | Ga0070682_100753470 | Ga0070682_1007534702 | 219 |
| 646 | 3300005340 | Ga0070689_100051404 | Ga0070689_1000514043 | 219 |
| 647 | 3300005347 | Ga0070668_100013323 | Ga0070668_1000133233 | 219 |
| 648 | 3300005347 | Ga0070668_100184533 | Ga0070668_1001845332 | 219 |
| 649 | 3300005353 | Ga0070669_100000934 | Ga0070669_10000093418 | 219 |
| 650 | 3300005354 | Ga0070675_100021516 | Ga0070675_1000215165 | 219 |
| 651 | 3300005364 | Ga0070673_100014069 | Ga0070673_1000140693 | 219 |
| 652 | 3300005365 | Ga0070688_100000510 | Ga0070688_1000005105 | 219 |
| 653 | 3300005367 | Ga0070667_100138613 | Ga0070667_1001386132 | 219 |
| 654 | 3300005367 | Ga0070667_100143851 | Ga0070667_1001438512 | 219 |
| 655 | 3300005441 | Ga0070700_100037482 | Ga0070700_1000374825 | 219 |
| 656 | 3300005456 | Ga0070678_100489903 | Ga0070678_1004899031 | 219 |
| 657 | 3300005457 | Ga0070662_100008951 | Ga0070662_1000089516 | 219 |
| 658 | 3300005459 | Ga0068867_100007419 | Ga0068867_1000074193 | 219 |
| 659 | 3300005459 | Ga0068867_100019363 | Ga0068867_1000193633 | 219 |
| 660 | 3300005471 | Ga0070698_100345486 | Ga0070698_1003454862 | 219 |
| 661 | 3300005518 | Ga0070699_101005853 | Ga0070699_1010058531 | 219 |
| 662 | 3300005535 | Ga0070684_100011435 | Ga0070684_1000114356 | 219 |
| 663 | 3300005539 | Ga0068853_100001211 | Ga0068853_1000012112 | 219 |
| 664 | 3300005543 | Ga0070672_100033374 | Ga0070672_1000333746 | 219 |
| 665 | 3300005543 | Ga0070672_100229535 | Ga0070672_1002295352 | 219 |
| 666 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002469 | 219 |
| 667 | 3300005563 | Ga0068855_100000303 | Ga0068855_10000030332 | 219 |
| 668 | 3300005563 | Ga0068855_100015293 | Ga0068855_1000152936 | 219 |
| 669 | 3300005563 | Ga0068855_100025300 | Ga0068855_1000253004 | 219 |
| 670 | 3300005564 | Ga0070664_100166444 | Ga0070664_1001664443 | 219 |
| 671 | 3300005577 | Ga0068857_100014797 | Ga0068857_1000147973 | 219 |
| 672 | 3300005578 | Ga0068854_100057157 | Ga0068854_1000571573 | 219 |
| 673 | 3300005614 | Ga0068856_100086138 | Ga0068856_1000861384 | 219 |
| 674 | 3300005616 | Ga0068852_100002788 | Ga0068852_1000027886 | 219 |
| 675 | 3300005617 | Ga0068859_100013226 | Ga0068859_1000132268 | 219 |
| 676 | 3300005718 | Ga0068866_10087895 | Ga0068866_100878952 | 219 |
| 677 | 3300005719 | Ga0068861_100004638 | Ga0068861_1000046382 | 219 |
| 678 | 3300005841 | Ga0068863_100343107 | Ga0068863_1003431072 | 219 |
| 679 | 3300005843 | Ga0068860_100000003 | Ga0068860_10000000385 | 219 |
| 680 | 3300005843 | Ga0068860_100000991 | Ga0068860_10000099122 | 219 |
| 681 | 3300005843 | Ga0068860_100040178 | Ga0068860_1000401782 | 219 |
| 682 | 3300005844 | Ga0068862_100072224 | Ga0068862_1000722243 | 219 |
| 683 | 3300005983 | Ga0081540_1006723 | Ga0081540_10067234 | 219 |
| 684 | 3300006237 | Ga0097621_100445918 | Ga0097621_1004459182 | 219 |
| 685 | 3300006358 | Ga0068871_100218305 | Ga0068871_1002183052 | 219 |
| 686 | 3300006358 | Ga0068871_100246069 | Ga0068871_1002460691 | 219 |
| 687 | 3300006358 | Ga0068871_100349861 | Ga0068871_1003498612 | 219 |
| 688 | 3300006358 | Ga0068871_100812944 | Ga0068871_1008129441 | 219 |
| 689 | 3300006931 | Ga0097620_100013226 | Ga0097620_1000132268 | 219 |
| 690 | 3300009093 | Ga0105240_10002527 | Ga0105240_1000252718 | 219 |
| 691 | 3300009093 | Ga0105240_10004693 | Ga0105240_100046938 | 219 |
| 692 | 3300009093 | Ga0105240_10004802 | Ga0105240_100048027 | 219 |
| 693 | 3300009093 | Ga0105240_10009628 | Ga0105240_100096287 | 219 |
| 694 | 3300009093 | Ga0105240_10021720 | Ga0105240_100217205 | 219 |
| 695 | 3300009093 | Ga0105240_10046065 | Ga0105240_100460653 | 219 |
| 696 | 3300009093 | Ga0105240_10098107 | Ga0105240_100981071 | 219 |
| 697 | 3300009093 | Ga0105240_10237008 | Ga0105240_102370082 | 219 |
| 698 | 3300009094 | Ga0111539_10000962 | Ga0111539_1000096217 | 219 |
| 699 | 3300009174 | Ga0105241_10000864 | Ga0105241_100008645 | 219 |
| 700 | 3300009176 | Ga0105242_10152181 | Ga0105242_101521812 | 219 |
| 701 | 3300009545 | Ga0105237_10004982 | Ga0105237_1000498211 | 219 |
| 702 | 3300009545 | Ga0105237_10007200 | Ga0105237_100072007 | 219 |
| 703 | 3300009545 | Ga0105237_10007849 | Ga0105237_100078493 | 219 |
| 704 | 3300009545 | Ga0105237_10011870 | Ga0105237_100118708 | 219 |
| 705 | 3300009545 | Ga0105237_10015433 | Ga0105237_100154337 | 219 |
| 706 | 3300009545 | Ga0105237_10048443 | Ga0105237_100484433 | 219 |
| 707 | 3300009551 | Ga0105238_10005073 | Ga0105238_100050732 | 219 |
| 708 | 3300009551 | Ga0105238_10180359 | Ga0105238_101803592 | 219 |
| 709 | 3300009551 | Ga0105238_10303971 | Ga0105238_103039712 | 219 |
| 710 | 3300009553 | Ga0105249_10040578 | Ga0105249_100405784 | 219 |
| 711 | 3300009553 | Ga0105249_10050948 | Ga0105249_100509482 | 219 |
| 712 | 3300010375 | Ga0105239_10000252 | Ga0105239_1000025247 | 219 |
| 713 | 3300010375 | Ga0105239_10008890 | Ga0105239_100088909 | 219 |
| 714 | 3300010375 | Ga0105239_10024239 | Ga0105239_100242392 | 219 |
| 715 | 3300010375 | Ga0105239_10034520 | Ga0105239_100345202 | 219 |
| 716 | 3300010375 | Ga0105239_10041186 | Ga0105239_100411863 | 219 |
| 717 | 3300010375 | Ga0105239_10059111 | Ga0105239_100591112 | 219 |
| 718 | 3300010375 | Ga0105239_10360348 | Ga0105239_103603482 | 219 |
| 719 | 3300013100 | Ga0157373_10058910 | Ga0157373_100589103 | 219 |
| 720 | 3300013100 | Ga0157373_10138219 | Ga0157373_101382192 | 219 |
| 721 | 3300013104 | Ga0157370_10025160 | Ga0157370_100251604 | 219 |
| 722 | 3300013104 | Ga0157370_10034709 | Ga0157370_100347095 | 219 |
| 723 | 3300013105 | Ga0157369_10396198 | Ga0157369_103961982 | 219 |
| 724 | 3300013105 | Ga0157369_10686923 | Ga0157369_106869231 | 219 |
| 725 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013201 | 219 |
| 726 | 3300013297 | Ga0157378_10107670 | Ga0157378_101076702 | 219 |
| 727 | 3300013297 | Ga0157378_10264970 | Ga0157378_102649702 | 219 |
| 728 | 3300013306 | Ga0163162_10001007 | Ga0163162_1000100718 | 219 |
| 729 | 3300013306 | Ga0163162_10147740 | Ga0163162_101477403 | 219 |
| 730 | 3300013306 | Ga0163162_10739063 | Ga0163162_107390632 | 219 |
| 731 | 3300013307 | Ga0157372_10005354 | Ga0157372_1000535410 | 219 |
| 732 | 3300013307 | Ga0157372_10056004 | Ga0157372_100560042 | 219 |
| 733 | 3300013307 | Ga0157372_10076406 | Ga0157372_100764062 | 219 |
| 734 | 3300013307 | Ga0157372_10095920 | Ga0157372_100959202 | 219 |
| 735 | 3300013308 | Ga0157375_10008365 | Ga0157375_100083653 | 219 |
| 736 | 3300014325 | Ga0163163_10357950 | Ga0163163_103579502 | 219 |
| 737 | 3300014326 | Ga0157380_10015109 | Ga0157380_100151096 | 219 |
| 738 | 3300014745 | Ga0157377_10029113 | Ga0157377_100291132 | 219 |
| 739 | 3300014969 | Ga0157376_10005733 | Ga0157376_100057336 | 219 |
| 740 | 3300020078 | Ga0206352_11032327 | Ga0206352_110323272 | 219 |
| 741 | 3300025315 | Ga0207697_10126376 | Ga0207697_101263763 | 219 |
| 742 | 3300025899 | Ga0207642_10050167 | Ga0207642_100501672 | 219 |
| 743 | 3300025903 | Ga0207680_10032116 | Ga0207680_100321162 | 219 |
| 744 | 3300025904 | Ga0207647_10031630 | Ga0207647_100316303 | 219 |
| 745 | 3300025904 | Ga0207647_10344552 | Ga0207647_103445522 | 219 |
| 746 | 3300025906 | Ga0207699_10328991 | Ga0207699_103289912 | 219 |
| 747 | 3300025908 | Ga0207643_10020936 | Ga0207643_100209363 | 219 |
| 748 | 3300025911 | Ga0207654_10037185 | Ga0207654_100371852 | 219 |
| 749 | 3300025913 | Ga0207695_10000051 | Ga0207695_1000005138 | 219 |
| 750 | 3300025913 | Ga0207695_10000056 | Ga0207695_10000056204 | 219 |
| 751 | 3300025913 | Ga0207695_10000066 | Ga0207695_1000006696 | 219 |
| 752 | 3300025913 | Ga0207695_10000081 | Ga0207695_1000008138 | 219 |
| 753 | 3300025913 | Ga0207695_10000156 | Ga0207695_1000015614 | 219 |
| 754 | 3300025913 | Ga0207695_10002773 | Ga0207695_1000277314 | 219 |
| 755 | 3300025913 | Ga0207695_10017121 | Ga0207695_100171214 | 219 |
| 756 | 3300025913 | Ga0207695_10019732 | Ga0207695_100197322 | 219 |
| 757 | 3300025913 | Ga0207695_10159941 | Ga0207695_101599412 | 219 |
| 758 | 3300025914 | Ga0207671_10001925 | Ga0207671_100019255 | 219 |
| 759 | 3300025914 | Ga0207671_10007568 | Ga0207671_100075682 | 219 |
| 760 | 3300025914 | Ga0207671_10009812 | Ga0207671_100098124 | 219 |
| 761 | 3300025914 | Ga0207671_10014922 | Ga0207671_100149223 | 219 |
| 762 | 3300025914 | Ga0207671_10177474 | Ga0207671_101774741 | 219 |
| 763 | 3300025923 | Ga0207681_10012023 | Ga0207681_100120236 | 219 |
| 764 | 3300025924 | Ga0207694_10124867 | Ga0207694_101248672 | 219 |
| 765 | 3300025925 | Ga0207650_10115834 | Ga0207650_101158342 | 219 |
| 766 | 3300025926 | Ga0207659_10377078 | Ga0207659_103770782 | 219 |
| 767 | 3300025933 | Ga0207706_10018091 | Ga0207706_100180917 | 219 |
| 768 | 3300025936 | Ga0207670_10072836 | Ga0207670_100728362 | 219 |
| 769 | 3300025937 | Ga0207669_10250083 | Ga0207669_102500832 | 219 |
| 770 | 3300025940 | Ga0207691_10406044 | Ga0207691_104060442 | 219 |
| 771 | 3300025942 | Ga0207689_10041358 | Ga0207689_100413582 | 219 |
| 772 | 3300025944 | Ga0207661_10008165 | Ga0207661_100081653 | 219 |
| 773 | 3300025949 | Ga0207667_10000713 | Ga0207667_1000071325 | 219 |
| 774 | 3300025949 | Ga0207667_10001082 | Ga0207667_100010823 | 219 |
| 775 | 3300025960 | Ga0207651_10058557 | Ga0207651_100585572 | 219 |
| 776 | 3300025961 | Ga0207712_10065778 | Ga0207712_100657782 | 219 |
| 777 | 3300025961 | Ga0207712_10132384 | Ga0207712_101323842 | 219 |
| 778 | 3300025981 | Ga0207640_10101047 | Ga0207640_101010471 | 219 |
| 779 | 3300025986 | Ga0207658_10034061 | Ga0207658_100340612 | 219 |
| 780 | 3300026041 | Ga0207639_10002473 | Ga0207639_100024734 | 219 |
| 781 | 3300026041 | Ga0207639_10054131 | Ga0207639_100541312 | 219 |
| 782 | 3300026078 | Ga0207702_10262543 | Ga0207702_102625431 | 219 |
| 783 | 3300026089 | Ga0207648_10022019 | Ga0207648_100220194 | 219 |
| 784 | 3300026116 | Ga0207674_10003327 | Ga0207674_100033273 | 219 |
| 785 | 3300026116 | Ga0207674_10009705 | Ga0207674_100097058 | 219 |
| 786 | 3300026118 | Ga0207675_100000260 | Ga0207675_10000026027 | 219 |
| 787 | 3300026118 | Ga0207675_100144993 | Ga0207675_1001449932 | 219 |
| 788 | 3300026142 | Ga0207698_10015082 | Ga0207698_100150822 | 219 |
| 789 | 3300028379 | Ga0268266_10000073 | Ga0268266_1000007334 | 219 |
| 790 | 3300028380 | Ga0268265_10013170 | Ga0268265_100131707 | 219 |
| 791 | 3300028381 | Ga0268264_10000063 | Ga0268264_100000633 | 219 |
| 792 | 3300028381 | Ga0268264_10006772 | Ga0268264_100067723 | 219 |
| 793 | 3300028381 | Ga0268264_10032633 | Ga0268264_100326332 | 219 |
| 794 | 3300029957 | Ga0265324_10106507 | Ga0265324_101065072 | 219 |
| 795 | 3300030521 | Ga0307511_10000232 | Ga0307511_1000023213 | 219 |
| 796 | 3300031507 | Ga0307509_10137330 | Ga0307509_101373303 | 219 |
| 797 | 3300031730 | Ga0307516_10000768 | Ga0307516_1000076837 | 219 |
| 798 | 3300031852 | Ga0307410_10079764 | Ga0307410_100797642 | 219 |
| 799 | 3300031901 | Ga0307406_10195874 | Ga0307406_101958742 | 219 |
| 800 | 3300033180 | Ga0307510_10000637 | Ga0307510_1000063717 | 219 |
| 801 | 3300035115 | Ga0373941_0179980 | Ga0373941_0179980_61_720 | 219 |
| 802 | 3300035172 | Ga0373955_0237595 | Ga0373955_0237595_275_934 | 219 |
| 803 | 3300041406 | Ga0439439_0006062 | Ga0439439_0006062_490_1149 | 219 |
| 804 | 3300041411 | Ga0439466_0123634 | Ga0439466_0123634_22_681 | 219 |
| 805 | 3300041509 | Ga0451843_0419312 | Ga0451843_0419312_115_774 | 219 |
| 806 | 3300042006 | Ga0439432_073451 | Ga0439432_073451_32_691 | 219 |
| 807 | 3300042007 | Ga0439449_0032968 | Ga0439449_0032968_1183_1842 | 219 |
| 808 | 3300042014 | Ga0439457_003482 | Ga0439457_003482_1479_2138 | 219 |
| 809 | 3300042131 | Ga0450894_010694 | Ga0450894_010694_260_919 | 219 |
| 810 | 3300042132 | Ga0450895_012677 | Ga0450895_012677_34_693 | 219 |
| 811 | 3300042135 | Ga0450899_005855 | Ga0450899_005855_615_1274 | 219 |
| 812 | 3300042156 | Ga0439446_0132497 | Ga0439446_0132497_14_673 | 219 |
| 813 | 3300044658 | Ga0466972_0075328 | Ga0466972_0075328_530_1189 | 219 |
| 814 | 3300044683 | Ga0466965_0050017 | Ga0466965_0050017_865_1524 | 219 |
| 815 | 3300044765 | Ga0466970_0047829 | Ga0466970_0047829_66_728 | 219 |
| 816 | 3300044842 | Ga0466957_0581647 | Ga0466957_0581647_62_721 | 219 |
| 817 | 3300045049 | Ga0466959_0005141 | Ga0466959_0005141_8092_8754 | 219 |
| 818 | 3300046460 | Ga0495638_0042658 | Ga0495638_0042658_668_1327 | 219 |
| 819 | 3300046460 | Ga0495638_0165846 | Ga0495638_0165846_142_801 | 219 |
| 820 | 3300046471 | Ga0495650_0043031 | Ga0495650_0043031_1010_1669 | 219 |
| 821 | 3300046507 | Ga0495606_0005679 | Ga0495606_0005679_3006_3665 | 219 |
| 822 | 3300046522 | Ga0495643_0096259 | Ga0495643_0096259_632_1291 | 219 |
| 823 | 3300046524 | Ga0495648_0011656 | Ga0495648_0011656_4532_5191 | 219 |
| 824 | 3300046648 | Ga0495611_0004900 | Ga0495611_0004900_4714_5373 | 219 |
| 825 | 3300046694 | Ga0495649_0032101 | Ga0495649_0032101_1479_2138 | 219 |
| 826 | 3300046694 | Ga0495649_0376623 | Ga0495649_0376623_13_672 | 219 |
| 827 | 3300047319 | Ga0495674_0462146 | Ga0495674_0462146_20_682 | 219 |
| 828 | 3300047443 | Ga0495687_000040 | Ga0495687_000040_8329_8988 | 219 |
| 829 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_345915_346574 | 219 |
| 830 | 3300047472 | Ga0495686_0066871 | Ga0495686_0066871_931_1590 | 219 |
| 831 | 3300050511 | nmdc:mga08y16_444052_c1 | nmdc:mga08y16_444052_c1_397_1056 | 219 |
| 832 | 3300053086 | Ga0500578_0265995 | Ga0500578_0265995_76_735 | 219 |
| 833 | 3300053092 | Ga0500583_0099898 | Ga0500583_0099898_438_1097 | 219 |
| 834 | 3300053093 | Ga0500651_0168522 | Ga0500651_0168522_232_891 | 219 |
| 835 | 3300053098 | Ga0500650_0196838 | Ga0500650_0196838_206_865 | 219 |
| 836 | 3300053130 | Ga0500642_0006554 | Ga0500642_0006554_340_999 | 219 |
| 837 | 3300053139 | Ga0500568_0027829 | Ga0500568_0027829_171_830 | 219 |
| 838 | 3300053156 | Ga0500622_0004994 | Ga0500622_0004994_2840_3499 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ulq-assembly1.cif.gz_B | crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain | 0.9547 | 156 | 211 |
| 1qmp-assembly2.cif.gz_B | phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a | 0.9464 | 8 | 125 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9461 | 157 | 217 |
| 7x1k-assembly1.cif.gz_B | crystal structure of the flagellar expression regulator degu from listeria monocytogenes | 0.9458 | 156 | 219 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9446 | 157 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9547 | 156 | 211 | 1.10.10.10 |
| 3cloA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9487 | 157 | 211 | 1.10.10.10 |
| 3cloC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9465 | 157 | 211 | 1.10.10.10 |
| 1qmpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9464 | 8 | 125 | 3.40.50.2300 |
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9443 | 151 | 214 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3WAF0-F1-model_v4 | Response regulator transcription factor | 0.9864 | 5 | 143 |
GO:0000160
|
| AF-A0A7G6YP66-F1-model_v4 | Response regulator transcription factor | 0.9731 | 1 | 127 |
GO:0000160
GO:0016020 |
| AF-A0A4Q3WAF0-F1-model_v4 | Response regulator transcription factor | 0.9726 | 5 | 143 |
GO:0000160
|
| AF-A0A1M7AU28-F1-model_v4 | Response regulator receiver domain-containing protein | 0.9716 | 1 | 127 |
GO:0000160
|
| AF-A0A519S1Y2-F1-model_v4 | Response regulator transcription factor | 0.9699 | 8 | 136 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar