F482956
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 837 | 377 | 1674 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0070241|Ga0496104_0070241_322_912 |
| Length | 196 |
| Sequence | MDITVKVNGADHSADVEPRQLLVHVIREEFGLTGTHIGCDTTSCGACTVLLDGTPVKSCTVFGVQADGREVTTVEGLITADGLDPIQEGFKEEHGLQCGFCTPGMMLVGKHLLDANPNPSEDDIRWAISGNICRCTGYMNIVKAIQWAASKQAGNGHEDSPVSPDSTADESGLGPEESVPASEIADEGVATAAPSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 100 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 202 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 203 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 204 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 205 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 206 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 207 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 208 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 209 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 210 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 211 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 212 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 213 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 214 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 215 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 221 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 356 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 357 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 359 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.94 |
| Metatranscriptomes | 4.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 2.87 |
| Rhizosphere | 96.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496104_0070241 | 3300048907 | Bacteria | 3329 |
| 2 | JGI24747J21853_1002432 | 3300001978 | Bacteria | 1519 |
| 3 | JGI24033J26618_1003772 | 3300002155 | Bacteria | 1611 |
| 4 | JGI24751J29686_10000457 | 3300002459 | Bacteria | 12295 |
| 5 | JGI24751J29686_10028600 | 3300002459 | Bacteria | 1157 |
| 6 | JGI25407J50210_10000849 | 3300003373 | Bacteria | 6579 |
| 7 | JGI25407J50210_10082127 | 3300003373 | Unclassified | 800 |
| 8 | JGI25407J50210_10094491 | 3300003373 | Bacteria | 740 |
| 9 | JGI25405J52794_10032067 | 3300003911 | Bacteria | 1093 |
| 10 | Ga0058863_11807083 | 3300004799 | Bacteria | 7922 |
| 11 | Ga0058861_11793184 | 3300004800 | Bacteria | 6928 |
| 12 | Ga0058862_12887376 | 3300004803 | Bacteria | 6889 |
| 13 | Ga0070682_100196733 | 3300005337 | Bacteria | 1419 |
| 14 | Ga0070682_100557448 | 3300005337 | Bacteria | 898 |
| 15 | Ga0068868_100284494 | 3300005338 | Bacteria | 1400 |
| 16 | Ga0070689_100343057 | 3300005340 | Bacteria | 1251 |
| 17 | Ga0070661_100003993 | 3300005344 | Bacteria | 10144 |
| 18 | Ga0070692_10248242 | 3300005345 | Bacteria | 1064 |
| 19 | Ga0070668_100128237 | 3300005347 | Bacteria | 2034 |
| 20 | Ga0070675_100042835 | 3300005354 | Bacteria | 3699 |
| 21 | Ga0070674_100173063 | 3300005356 | Bacteria | 1648 |
| 22 | Ga0070659_100243453 | 3300005366 | Bacteria | 1489 |
| 23 | Ga0070703_10000022 | 3300005406 | Bacteria | 74865 |
| 24 | Ga0070703_10008580 | 3300005406 | Bacteria | 2874 |
| 25 | Ga0070714_100103125 | 3300005435 | Bacteria | 2516 |
| 26 | Ga0070714_100140117 | 3300005435 | Bacteria | 2170 |
| 27 | Ga0070714_100321392 | 3300005435 | Bacteria | 1447 |
| 28 | Ga0070713_100173023 | 3300005436 | Bacteria | 1935 |
| 29 | Ga0070711_100237199 | 3300005439 | Bacteria | 1424 |
| 30 | Ga0070711_100262735 | 3300005439 | Bacteria | 1359 |
| 31 | Ga0070705_100149652 | 3300005440 | Bacteria | 1547 |
| 32 | Ga0070700_100182801 | 3300005441 | Bacteria | 1460 |
| 33 | Ga0070700_100927990 | 3300005441 | Bacteria | 711 |
| 34 | Ga0070694_100168279 | 3300005444 | Bacteria | 1613 |
| 35 | Ga0070708_100002785 | 3300005445 | Bacteria | 13585 |
| 36 | Ga0070708_100016862 | 3300005445 | Bacteria | 6073 |
| 37 | Ga0070663_100785859 | 3300005455 | Bacteria | 815 |
| 38 | Ga0070662_100087120 | 3300005457 | Bacteria | 2337 |
| 39 | Ga0070681_10025796 | 3300005458 | Bacteria | 5909 |
| 40 | Ga0070681_10035343 | 3300005458 | Bacteria | 5020 |
| 41 | Ga0068867_100460891 | 3300005459 | Bacteria | 1085 |
| 42 | Ga0070685_10403401 | 3300005466 | Bacteria | 947 |
| 43 | Ga0070706_100000241 | 3300005467 | Bacteria | 66502 |
| 44 | Ga0070706_100100976 | 3300005467 | Bacteria | 2681 |
| 45 | Ga0070706_100878448 | 3300005467 | Bacteria | 828 |
| 46 | Ga0070707_100000716 | 3300005468 | Bacteria | 33128 |
| 47 | Ga0070707_100006806 | 3300005468 | Bacteria | 10584 |
| 48 | Ga0070707_100025164 | 3300005468 | Bacteria | 5644 |
| 49 | Ga0070707_100048473 | 3300005468 | Bacteria | 4069 |
| 50 | Ga0070707_100603482 | 3300005468 | Bacteria | 1060 |
| 51 | Ga0070707_100661830 | 3300005468 | Bacteria | 1007 |
| 52 | Ga0070698_100006512 | 3300005471 | Bacteria | 12662 |
| 53 | Ga0070698_100020152 | 3300005471 | Bacteria | 6992 |
| 54 | Ga0070698_100025887 | 3300005471 | Bacteria | 6113 |
| 55 | Ga0070698_100090234 | 3300005471 | Bacteria | 3048 |
| 56 | Ga0070698_100499143 | 3300005471 | Bacteria | 1155 |
| 57 | Ga0070698_100753790 | 3300005471 | Bacteria | 917 |
| 58 | Ga0070699_100008694 | 3300005518 | Bacteria | 8803 |
| 59 | Ga0070699_100070465 | 3300005518 | Bacteria | 3039 |
| 60 | Ga0070699_100112674 | 3300005518 | Bacteria | 2389 |
| 61 | Ga0070699_100220136 | 3300005518 | Bacteria | 1691 |
| 62 | Ga0070699_100319316 | 3300005518 | Bacteria | 1395 |
| 63 | Ga0070679_100015909 | 3300005530 | Bacteria | 7241 |
| 64 | Ga0070679_100053141 | 3300005530 | Bacteria | 4033 |
| 65 | Ga0070679_100145275 | 3300005530 | Bacteria | 2350 |
| 66 | Ga0070684_100238361 | 3300005535 | Bacteria | 1661 |
| 67 | Ga0070684_100714698 | 3300005535 | Bacteria | 934 |
| 68 | Ga0070697_100006818 | 3300005536 | Bacteria | 8863 |
| 69 | Ga0070697_100012515 | 3300005536 | Bacteria | 6647 |
| 70 | Ga0070697_100622113 | 3300005536 | Bacteria | 950 |
| 71 | Ga0070697_100864316 | 3300005536 | Bacteria | 801 |
| 72 | Ga0070697_101205931 | 3300005536 | Bacteria | 674 |
| 73 | Ga0068853_100630473 | 3300005539 | Bacteria | 1019 |
| 74 | Ga0070695_100002478 | 3300005545 | Bacteria | 10625 |
| 75 | Ga0070695_100940761 | 3300005545 | Bacteria | 700 |
| 76 | Ga0070696_100085324 | 3300005546 | Bacteria | 2241 |
| 77 | Ga0070696_100317216 | 3300005546 | Bacteria | 1198 |
| 78 | Ga0070693_100095968 | 3300005547 | Bacteria | 1796 |
| 79 | Ga0070665_100641466 | 3300005548 | Bacteria | 1075 |
| 80 | Ga0070704_100009955 | 3300005549 | Bacteria | 5772 |
| 81 | Ga0070704_100074814 | 3300005549 | Bacteria | 2472 |
| 82 | Ga0070704_100419373 | 3300005549 | Bacteria | 1146 |
| 83 | Ga0070704_100630727 | 3300005549 | Bacteria | 944 |
| 84 | Ga0070704_101429876 | 3300005549 | Bacteria | 635 |
| 85 | Ga0070664_100008664 | 3300005564 | Bacteria | 8232 |
| 86 | Ga0068857_100256286 | 3300005577 | Bacteria | 1605 |
| 87 | Ga0068857_101084055 | 3300005577 | Bacteria | 773 |
| 88 | Ga0068856_100177497 | 3300005614 | Bacteria | 2142 |
| 89 | Ga0068856_100275727 | 3300005614 | Bacteria | 1698 |
| 90 | Ga0068852_100488780 | 3300005616 | Bacteria | 1224 |
| 91 | Ga0068864_100265971 | 3300005618 | Bacteria | 1596 |
| 92 | Ga0068866_10008147 | 3300005718 | Bacteria | 4404 |
| 93 | Ga0068861_100040578 | 3300005719 | Bacteria | 3482 |
| 94 | Ga0068861_100041374 | 3300005719 | Bacteria | 3451 |
| 95 | Ga0068870_10003358 | 3300005840 | Bacteria | 6771 |
| 96 | Ga0068863_100009118 | 3300005841 | Bacteria | 9689 |
| 97 | Ga0068860_100179082 | 3300005843 | Bacteria | 2049 |
| 98 | Ga0068862_100513914 | 3300005844 | Bacteria | 1139 |
| 99 | Ga0081455_10001540 | 3300005937 | Bacteria | 28386 |
| 100 | Ga0081455_10002895 | 3300005937 | Bacteria | 20154 |
| 101 | Ga0081455_10006642 | 3300005937 | Bacteria | 12367 |
| 102 | Ga0081455_10009966 | 3300005937 | Bacteria | 9715 |
| 103 | Ga0081455_10013853 | 3300005937 | Bacteria | 7930 |
| 104 | Ga0081455_10024165 | 3300005937 | Bacteria | 5636 |
| 105 | Ga0081455_10033633 | 3300005937 | Bacteria | 4605 |
| 106 | Ga0081455_10043463 | 3300005937 | Bacteria | 3929 |
| 107 | Ga0081455_10045759 | 3300005937 | Bacteria | 3804 |
| 108 | Ga0081455_10079785 | 3300005937 | Bacteria | 2686 |
| 109 | Ga0081455_10154523 | 3300005937 | Bacteria | 1766 |
| 110 | Ga0081538_10000029 | 3300005981 | Bacteria | 124335 |
| 111 | Ga0081538_10000081 | 3300005981 | Bacteria | 92176 |
| 112 | Ga0081538_10001550 | 3300005981 | Bacteria | 23554 |
| 113 | Ga0081538_10010634 | 3300005981 | Bacteria | 7532 |
| 114 | Ga0081538_10021468 | 3300005981 | Bacteria | 4713 |
| 115 | Ga0081538_10026643 | 3300005981 | Bacteria | 4036 |
| 116 | Ga0081538_10040972 | 3300005981 | Bacteria | 2946 |
| 117 | Ga0081538_10104128 | 3300005981 | Bacteria | 1417 |
| 118 | Ga0081538_10248137 | 3300005981 | Bacteria | 681 |
| 119 | Ga0081540_1036192 | 3300005983 | Bacteria | 2636 |
| 120 | Ga0081540_1085775 | 3300005983 | Bacteria | 1401 |
| 121 | Ga0081539_10020154 | 3300005985 | Bacteria | 4525 |
| 122 | Ga0081539_10106999 | 3300005985 | Bacteria | 1415 |
| 123 | Ga0081539_10107172 | 3300005985 | Bacteria | 1413 |
| 124 | Ga0075365_10302581 | 3300006038 | Bacteria | 1125 |
| 125 | Ga0075432_10005230 | 3300006058 | Bacteria | 4419 |
| 126 | Ga0075432_10005810 | 3300006058 | Bacteria | 4197 |
| 127 | Ga0075432_10006804 | 3300006058 | Bacteria | 3893 |
| 128 | Ga0075432_10050530 | 3300006058 | Bacteria | 1467 |
| 129 | Ga0070715_10024725 | 3300006163 | Bacteria | 2371 |
| 130 | Ga0070716_100100702 | 3300006173 | Bacteria | 1770 |
| 131 | Ga0070712_100047023 | 3300006175 | Bacteria | 2985 |
| 132 | Ga0070712_100098603 | 3300006175 | Bacteria | 2155 |
| 133 | Ga0070712_100104226 | 3300006175 | Bacteria | 2104 |
| 134 | Ga0070712_100545327 | 3300006175 | Bacteria | 977 |
| 135 | Ga0075427_10001460 | 3300006194 | Bacteria | 3036 |
| 136 | Ga0068871_100061592 | 3300006358 | Bacteria | 3065 |
| 137 | Ga0075428_100054760 | 3300006844 | Bacteria | 4371 |
| 138 | Ga0075428_100080275 | 3300006844 | Bacteria | 3560 |
| 139 | Ga0075428_100152719 | 3300006844 | Bacteria | 2508 |
| 140 | Ga0075428_101371073 | 3300006844 | Bacteria | 743 |
| 141 | Ga0075430_100010728 | 3300006846 | Bacteria | 7766 |
| 142 | Ga0075430_100024076 | 3300006846 | Bacteria | 5184 |
| 143 | Ga0075431_100072293 | 3300006847 | Bacteria | 3559 |
| 144 | Ga0075431_100282629 | 3300006847 | Bacteria | 1680 |
| 145 | Ga0075431_100297074 | 3300006847 | Bacteria | 1632 |
| 146 | Ga0075433_10006437 | 3300006852 | Bacteria | 9284 |
| 147 | Ga0075433_10054894 | 3300006852 | Bacteria | 3476 |
| 148 | Ga0075433_10062721 | 3300006852 | Bacteria | 3255 |
| 149 | Ga0075433_10089403 | 3300006852 | Bacteria | 2722 |
| 150 | Ga0075434_100002195 | 3300006871 | Bacteria | 17003 |
| 151 | Ga0075434_100034163 | 3300006871 | Bacteria | 5021 |
| 152 | Ga0075434_100134389 | 3300006871 | Bacteria | 2493 |
| 153 | Ga0075434_100224148 | 3300006871 | Bacteria | 1900 |
| 154 | Ga0075429_100017798 | 3300006880 | Bacteria | 6146 |
| 155 | Ga0075429_100058147 | 3300006880 | Bacteria | 3367 |
| 156 | Ga0075429_100065206 | 3300006880 | Bacteria | 3171 |
| 157 | Ga0075429_100104432 | 3300006880 | Bacteria | 2475 |
| 158 | Ga0075429_100452820 | 3300006880 | Bacteria | 1125 |
| 159 | Ga0075436_100027135 | 3300006914 | Bacteria | 3942 |
| 160 | Ga0075435_100039856 | 3300007076 | Bacteria | 3749 |
| 161 | Ga0105251_10027591 | 3300009011 | Bacteria | 2877 |
| 162 | Ga0105240_10401020 | 3300009093 | Bacteria | 1545 |
| 163 | Ga0111539_10005444 | 3300009094 | Bacteria | 16467 |
| 164 | Ga0111539_10031086 | 3300009094 | Bacteria | 6488 |
| 165 | Ga0111539_10086306 | 3300009094 | Bacteria | 3688 |
| 166 | Ga0111539_10136404 | 3300009094 | Bacteria | 2874 |
| 167 | Ga0111539_10309917 | 3300009094 | Bacteria | 1837 |
| 168 | Ga0111539_10416227 | 3300009094 | Bacteria | 1565 |
| 169 | Ga0111539_10491105 | 3300009094 | Bacteria | 1430 |
| 170 | Ga0111539_10496156 | 3300009094 | Bacteria | 1422 |
| 171 | Ga0105245_10003018 | 3300009098 | Bacteria | 15096 |
| 172 | Ga0105245_10053328 | 3300009098 | Bacteria | 3629 |
| 173 | Ga0105245_10104318 | 3300009098 | Bacteria | 2628 |
| 174 | Ga0105245_10740934 | 3300009098 | Bacteria | 1018 |
| 175 | Ga0114129_10015822 | 3300009147 | Bacteria | 10726 |
| 176 | Ga0114129_10023903 | 3300009147 | Bacteria | 8660 |
| 177 | Ga0114129_10233986 | 3300009147 | Bacteria | 2473 |
| 178 | Ga0114129_10363850 | 3300009147 | Bacteria | 1913 |
| 179 | Ga0114129_10653817 | 3300009147 | Bacteria | 1356 |
| 180 | Ga0114129_10698080 | 3300009147 | Bacteria | 1304 |
| 181 | Ga0114129_11696130 | 3300009147 | Bacteria | 771 |
| 182 | Ga0105243_10007194 | 3300009148 | Bacteria | 8553 |
| 183 | Ga0105243_10007215 | 3300009148 | Bacteria | 8539 |
| 184 | Ga0105241_10281858 | 3300009174 | Bacteria | 1420 |
| 185 | Ga0105242_10004298 | 3300009176 | Bacteria | 11100 |
| 186 | Ga0105242_10080853 | 3300009176 | Bacteria | 2716 |
| 187 | Ga0105242_10503446 | 3300009176 | Bacteria | 1152 |
| 188 | Ga0105237_10868258 | 3300009545 | Bacteria | 909 |
| 189 | Ga0105237_11943491 | 3300009545 | Bacteria | 597 |
| 190 | Ga0105238_10021845 | 3300009551 | Bacteria | 6519 |
| 191 | Ga0105249_10004045 | 3300009553 | Bacteria | 12645 |
| 192 | Ga0105249_10017153 | 3300009553 | Bacteria | 6428 |
| 193 | Ga0105249_10043032 | 3300009553 | Bacteria | 4108 |
| 194 | Ga0105249_10055051 | 3300009553 | Bacteria | 3638 |
| 195 | Ga0105239_10104841 | 3300010375 | Bacteria | 3131 |
| 196 | Ga0105239_10995508 | 3300010375 | Bacteria | 964 |
| 197 | Ga0105246_10097222 | 3300011119 | Bacteria | 2136 |
| 198 | Ga0105246_10308567 | 3300011119 | Bacteria | 1281 |
| 199 | Ga0157369_10157590 | 3300013105 | Bacteria | 2397 |
| 200 | Ga0157369_10384631 | 3300013105 | Bacteria | 1456 |
| 201 | Ga0157374_11492460 | 3300013296 | Bacteria | 699 |
| 202 | Ga0157378_10004846 | 3300013297 | Bacteria | 11800 |
| 203 | Ga0157378_10108728 | 3300013297 | Bacteria | 2539 |
| 204 | Ga0157378_10483571 | 3300013297 | Bacteria | 1234 |
| 205 | Ga0163162_10024382 | 3300013306 | Bacteria | 5970 |
| 206 | Ga0163162_10321598 | 3300013306 | Bacteria | 1679 |
| 207 | Ga0163162_11087229 | 3300013306 | Bacteria | 906 |
| 208 | Ga0157372_10660818 | 3300013307 | Bacteria | 1217 |
| 209 | Ga0157375_10466697 | 3300013308 | Bacteria | 1428 |
| 210 | Ga0157375_10494935 | 3300013308 | Bacteria | 1387 |
| 211 | Ga0157375_10969190 | 3300013308 | Bacteria | 991 |
| 212 | Ga0157380_10055804 | 3300014326 | Bacteria | 3139 |
| 213 | Ga0157377_10192101 | 3300014745 | Bacteria | 1291 |
| 214 | Ga0157377_10597896 | 3300014745 | Bacteria | 786 |
| 215 | Ga0157376_10051157 | 3300014969 | Bacteria | 3431 |
| 216 | Ga0157376_10579913 | 3300014969 | Bacteria | 1114 |
| 217 | Ga0157376_12348533 | 3300014969 | Bacteria | 573 |
| 218 | Ga0197907_10840627 | 3300020069 | Bacteria | 4221 |
| 219 | Ga0206356_10119050 | 3300020070 | Bacteria | 7978 |
| 220 | Ga0206355_1329123 | 3300020076 | Bacteria | 8157 |
| 221 | Ga0206351_10542297 | 3300020077 | Bacteria | 7962 |
| 222 | Ga0206352_10112103 | 3300020078 | Bacteria | 689 |
| 223 | Ga0206350_11511940 | 3300020080 | Bacteria | 5114 |
| 224 | Ga0206354_10468283 | 3300020081 | Bacteria | 767 |
| 225 | Ga0206354_10793986 | 3300020081 | Bacteria | 677 |
| 226 | Ga0206354_10873226 | 3300020081 | Bacteria | 7967 |
| 227 | Ga0206353_11603916 | 3300020082 | Bacteria | 7966 |
| 228 | Ga0154015_1056028 | 3300020610 | Bacteria | 6701 |
| 229 | Ga0213872_10407819 | 3300021361 | Bacteria | 550 |
| 230 | Ga0224712_10000485 | 3300022467 | Bacteria | 7970 |
| 231 | Ga0207713_1039401 | 3300025735 | Bacteria | 1993 |
| 232 | Ga0207653_10000100 | 3300025885 | Bacteria | 61375 |
| 233 | Ga0207692_10042504 | 3300025898 | Bacteria | 2256 |
| 234 | Ga0207642_10017387 | 3300025899 | Bacteria | 2734 |
| 235 | Ga0207647_10169643 | 3300025904 | Bacteria | 1271 |
| 236 | Ga0207643_10000324 | 3300025908 | Bacteria | 32791 |
| 237 | Ga0207684_10000233 | 3300025910 | Bacteria | 84435 |
| 238 | Ga0207684_10052564 | 3300025910 | Bacteria | 3457 |
| 239 | Ga0207684_10088419 | 3300025910 | Unclassified | 2640 |
| 240 | Ga0207684_10628783 | 3300025910 | Bacteria | 915 |
| 241 | Ga0207684_11144264 | 3300025910 | Bacteria | 646 |
| 242 | Ga0207654_10398716 | 3300025911 | Bacteria | 956 |
| 243 | Ga0207707_10102836 | 3300025912 | Bacteria | 2497 |
| 244 | Ga0207707_10126679 | 3300025912 | Bacteria | 2233 |
| 245 | Ga0207707_10179236 | 3300025912 | Bacteria | 1850 |
| 246 | Ga0207695_10585755 | 3300025913 | Bacteria | 997 |
| 247 | Ga0207693_10219627 | 3300025915 | Bacteria | 1493 |
| 248 | Ga0207693_10440821 | 3300025915 | Bacteria | 1018 |
| 249 | Ga0207660_10249354 | 3300025917 | Bacteria | 1401 |
| 250 | Ga0207660_10315439 | 3300025917 | Bacteria | 1247 |
| 251 | Ga0207657_10308712 | 3300025919 | Bacteria | 1252 |
| 252 | Ga0207649_10006443 | 3300025920 | Bacteria | 6375 |
| 253 | Ga0207652_10019006 | 3300025921 | Bacteria | 5643 |
| 254 | Ga0207652_10064827 | 3300025921 | Bacteria | 3162 |
| 255 | Ga0207646_10005209 | 3300025922 | Bacteria | 13741 |
| 256 | Ga0207646_10082582 | 3300025922 | Bacteria | 2873 |
| 257 | Ga0207646_10101490 | 3300025922 | Bacteria | 2579 |
| 258 | Ga0207694_10213442 | 3300025924 | Bacteria | 1573 |
| 259 | Ga0207659_10024617 | 3300025926 | Bacteria | 4036 |
| 260 | Ga0207687_10053312 | 3300025927 | Bacteria | 2825 |
| 261 | Ga0207687_10569411 | 3300025927 | Bacteria | 952 |
| 262 | Ga0207664_10155117 | 3300025929 | Bacteria | 1949 |
| 263 | Ga0207664_10283520 | 3300025929 | Bacteria | 1454 |
| 264 | Ga0207690_10858567 | 3300025932 | Bacteria | 752 |
| 265 | Ga0207706_10052314 | 3300025933 | Bacteria | 3605 |
| 266 | Ga0207706_10356467 | 3300025933 | Bacteria | 1271 |
| 267 | Ga0207706_10400141 | 3300025933 | Bacteria | 1190 |
| 268 | Ga0207686_10013008 | 3300025934 | Bacteria | 4593 |
| 269 | Ga0207709_10023965 | 3300025935 | Bacteria | 3480 |
| 270 | Ga0207709_10054993 | 3300025935 | Bacteria | 2457 |
| 271 | Ga0207669_10090376 | 3300025937 | Bacteria | 1991 |
| 272 | Ga0207665_10197506 | 3300025939 | Bacteria | 1464 |
| 273 | Ga0207665_10414576 | 3300025939 | Bacteria | 1028 |
| 274 | Ga0207661_10397351 | 3300025944 | Bacteria | 1250 |
| 275 | Ga0207679_10854435 | 3300025945 | Bacteria | 831 |
| 276 | Ga0207712_10141185 | 3300025961 | Bacteria | 1849 |
| 277 | Ga0207712_10241157 | 3300025961 | Bacteria | 1456 |
| 278 | Ga0207712_11343581 | 3300025961 | Bacteria | 639 |
| 279 | Ga0207668_10214368 | 3300025972 | Bacteria | 1542 |
| 280 | Ga0207668_10323322 | 3300025972 | Bacteria | 1281 |
| 281 | Ga0207677_10425052 | 3300026023 | Bacteria | 1132 |
| 282 | Ga0207677_11106454 | 3300026023 | Bacteria | 722 |
| 283 | Ga0207677_11283640 | 3300026023 | Bacteria | 672 |
| 284 | Ga0207708_10524684 | 3300026075 | Bacteria | 996 |
| 285 | Ga0207702_10078687 | 3300026078 | Bacteria | 2855 |
| 286 | Ga0207702_10407976 | 3300026078 | Bacteria | 1311 |
| 287 | Ga0207641_10164982 | 3300026088 | Bacteria | 2016 |
| 288 | Ga0207641_10330979 | 3300026088 | Bacteria | 1447 |
| 289 | Ga0207641_11231645 | 3300026088 | Bacteria | 748 |
| 290 | Ga0207676_10002670 | 3300026095 | Bacteria | 12672 |
| 291 | Ga0207674_10136544 | 3300026116 | Bacteria | 2414 |
| 292 | Ga0207675_100006050 | 3300026118 | Bacteria | 11513 |
| 293 | Ga0207675_100009258 | 3300026118 | Bacteria | 9237 |
| 294 | Ga0207675_100147726 | 3300026118 | Bacteria | 2236 |
| 295 | Ga0207428_10001500 | 3300027907 | Bacteria | 24402 |
| 296 | Ga0207428_10001517 | 3300027907 | Bacteria | 24233 |
| 297 | Ga0207428_10005123 | 3300027907 | Bacteria | 12285 |
| 298 | Ga0207428_10012696 | 3300027907 | Bacteria | 7386 |
| 299 | Ga0207428_10038369 | 3300027907 | Bacteria | 3894 |
| 300 | Ga0268266_10262264 | 3300028379 | Bacteria | 1602 |
| 301 | Ga0268265_10145505 | 3300028380 | Bacteria | 1991 |
| 302 | Ga0268264_10237489 | 3300028381 | Bacteria | 1686 |
| 303 | Ga0265338_10110185 | 3300028800 | Bacteria | 2219 |
| 304 | Ga0307512_10006934 | 3300030522 | Bacteria | 11325 |
| 305 | Ga0265320_10011603 | 3300031240 | Bacteria | 5175 |
| 306 | Ga0265340_10260490 | 3300031247 | Bacteria | 772 |
| 307 | Ga0265339_10025351 | 3300031249 | Bacteria | 3403 |
| 308 | Ga0307408_100037465 | 3300031548 | Bacteria | 3416 |
| 309 | Ga0307408_100214879 | 3300031548 | Bacteria | 1565 |
| 310 | Ga0265313_10103821 | 3300031595 | Bacteria | 1258 |
| 311 | Ga0307508_10502881 | 3300031616 | Bacteria | 807 |
| 312 | Ga0265314_10076053 | 3300031711 | Bacteria | 2232 |
| 313 | Ga0265342_10033187 | 3300031712 | Bacteria | 3176 |
| 314 | Ga0307405_10029958 | 3300031731 | Bacteria | 3186 |
| 315 | Ga0307405_10036171 | 3300031731 | Bacteria | 2955 |
| 316 | Ga0307405_10524780 | 3300031731 | Bacteria | 953 |
| 317 | Ga0307405_11105355 | 3300031731 | Bacteria | 681 |
| 318 | Ga0307413_10051992 | 3300031824 | Bacteria | 2472 |
| 319 | Ga0307413_10053614 | 3300031824 | Bacteria | 2442 |
| 320 | Ga0307413_10421686 | 3300031824 | Bacteria | 1051 |
| 321 | Ga0307413_10564489 | 3300031824 | Bacteria | 925 |
| 322 | Ga0307410_10065320 | 3300031852 | Bacteria | 2502 |
| 323 | Ga0307410_10086775 | 3300031852 | Bacteria | 2211 |
| 324 | Ga0307406_10077218 | 3300031901 | Bacteria | 2202 |
| 325 | Ga0307406_10088933 | 3300031901 | Bacteria | 2073 |
| 326 | Ga0307407_10030392 | 3300031903 | Bacteria | 2913 |
| 327 | Ga0307407_10073092 | 3300031903 | Bacteria | 2047 |
| 328 | Ga0307407_11143445 | 3300031903 | Bacteria | 606 |
| 329 | Ga0307412_10081366 | 3300031911 | Bacteria | 2240 |
| 330 | Ga0307412_10103253 | 3300031911 | Bacteria | 2020 |
| 331 | Ga0307409_100045843 | 3300031995 | Bacteria | 3304 |
| 332 | Ga0307409_100086368 | 3300031995 | Bacteria | 2553 |
| 333 | Ga0307409_100636556 | 3300031995 | Bacteria | 1058 |
| 334 | Ga0307416_100001353 | 3300032002 | Bacteria | 13220 |
| 335 | Ga0307416_100013927 | 3300032002 | Bacteria | 5485 |
| 336 | Ga0307416_100213375 | 3300032002 | Bacteria | 1843 |
| 337 | Ga0307414_10081210 | 3300032004 | Bacteria | 2373 |
| 338 | Ga0307414_10126997 | 3300032004 | Bacteria | 1972 |
| 339 | Ga0307411_10048206 | 3300032005 | Bacteria | 2760 |
| 340 | Ga0307411_10094931 | 3300032005 | Bacteria | 2092 |
| 341 | Ga0307415_100023850 | 3300032126 | Bacteria | 3807 |
| 342 | Ga0307415_100047225 | 3300032126 | Bacteria | 2897 |
| 343 | Ga0307415_100237472 | 3300032126 | Bacteria | 1472 |
| 344 | Ga0307415_100487348 | 3300032126 | Bacteria | 1075 |
| 345 | Ga0307415_100731067 | 3300032126 | Bacteria | 896 |
| 346 | Ga0307415_100816841 | 3300032126 | Bacteria | 852 |
| 347 | Ga0307415_101297126 | 3300032126 | Bacteria | 689 |
| 348 | Ga0373958_0110391 | 3300034819 | Bacteria | 655 |
| 349 | Ga0373928_0102131 | 3300035084 | Bacteria | 749 |
| 350 | Ga0373929_0079050 | 3300035085 | Bacteria | 799 |
| 351 | Ga0373932_0004345 | 3300035112 | Bacteria | 3359 |
| 352 | Ga0373936_0007773 | 3300035113 | Bacteria | 4027 |
| 353 | Ga0373939_0003258 | 3300035114 | Bacteria | 3806 |
| 354 | Ga0373945_0002205 | 3300035116 | Bacteria | 6087 |
| 355 | Ga0373945_0064847 | 3300035116 | Bacteria | 1370 |
| 356 | Ga0373953_0186736 | 3300035117 | Bacteria | 895 |
| 357 | Ga0373956_0044317 | 3300035119 | Bacteria | 1983 |
| 358 | Ga0373960_0118600 | 3300035121 | Bacteria | 876 |
| 359 | Ga0373943_0000643 | 3300035170 | Bacteria | 15075 |
| 360 | Ga0373946_0010131 | 3300035171 | Bacteria | 3485 |
| 361 | Ga0373946_0050570 | 3300035171 | Bacteria | 1736 |
| 362 | Ga0373955_0002200 | 3300035172 | Bacteria | 8459 |
| 363 | Ga0373924_0101450 | 3300035410 | Bacteria | 1238 |
| 364 | Ga0373924_0262390 | 3300035410 | Unclassified | 765 |
| 365 | Ga0373931_0034199 | 3300035691 | Bacteria | 2637 |
| 366 | Ga0373931_0296375 | 3300035691 | Bacteria | 997 |
| 367 | Ga0373935_0493245 | 3300035692 | Bacteria | 888 |
| 368 | Ga0373927_0042746 | 3300035695 | Bacteria | 2936 |
| 369 | Ga0373933_0024950 | 3300035724 | Bacteria | 3426 |
| 370 | Ga0373947_0026510 | 3300035725 | Bacteria | 3388 |
| 371 | Ga0373947_0038831 | 3300035725 | Bacteria | 2831 |
| 372 | Ga0373947_0056413 | 3300035725 | Bacteria | 2374 |
| 373 | Ga0373947_0383218 | 3300035725 | Bacteria | 947 |
| 374 | Ga0373937_0022593 | 3300036401 | Bacteria | 5658 |
| 375 | Ga0373937_0403879 | 3300036401 | Bacteria | 1296 |
| 376 | Ga0373925_0003808 | 3300037068 | Bacteria | 11583 |
| 377 | Ga0373925_0026030 | 3300037068 | Bacteria | 4277 |
| 378 | Ga0373925_0220387 | 3300037068 | Bacteria | 1514 |
| 379 | Ga0395899_0231610 | 3300037312 | Bacteria | 1275 |
| 380 | Ga0395899_0261623 | 3300037312 | Bacteria | 1183 |
| 381 | Ga0395899_0331024 | 3300037312 | Bacteria | 1023 |
| 382 | Ga0395899_0597454 | 3300037312 | Bacteria | 703 |
| 383 | Ga0395900_0008417 | 3300037418 | Bacteria | 10612 |
| 384 | Ga0395900_0041450 | 3300037418 | Bacteria | 4746 |
| 385 | Ga0395900_0075812 | 3300037418 | Bacteria | 3457 |
| 386 | Ga0395900_0088410 | 3300037418 | Bacteria | 3185 |
| 387 | Ga0395900_0268293 | 3300037418 | Bacteria | 1702 |
| 388 | Ga0395898_0035735 | 3300037466 | Bacteria | 4937 |
| 389 | Ga0395898_0075480 | 3300037466 | Bacteria | 3256 |
| 390 | Ga0395898_0296412 | 3300037466 | Bacteria | 1543 |
| 391 | Ga0395898_0402349 | 3300037466 | Bacteria | 1305 |
| 392 | Ga0395898_0571874 | 3300037466 | Bacteria | 1072 |
| 393 | Ga0395905_0029050 | 3300037471 | Bacteria | 5211 |
| 394 | Ga0395905_0068431 | 3300037471 | Bacteria | 3326 |
| 395 | Ga0395905_0069420 | 3300037471 | Bacteria | 3300 |
| 396 | Ga0395905_0340753 | 3300037471 | Bacteria | 1390 |
| 397 | Ga0395905_0525861 | 3300037471 | Bacteria | 1083 |
| 398 | Ga0436364_0073490 | 3300037853 | Bacteria | 2794 |
| 399 | Ga0436364_0359023 | 3300037853 | Bacteria | 776 |
| 400 | Ga0395901_0034263 | 3300038443 | Bacteria | 5243 |
| 401 | Ga0395901_0043793 | 3300038443 | Bacteria | 4642 |
| 402 | Ga0395901_0044881 | 3300038443 | Bacteria | 4584 |
| 403 | Ga0395901_0051346 | 3300038443 | Bacteria | 4287 |
| 404 | Ga0395901_0375113 | 3300038443 | Bacteria | 1465 |
| 405 | Ga0395901_0451227 | 3300038443 | Bacteria | 1315 |
| 406 | Ga0436360_1133702 | 3300039438 | Bacteria | 667 |
| 407 | Ga0436360_1309648 | 3300039438 | Bacteria | 7849 |
| 408 | Ga0436361_0127857 | 3300039447 | Bacteria | 2710 |
| 409 | Ga0436361_0449584 | 3300039447 | Unclassified | 817 |
| 410 | Ga0436363_0542485 | 3300039450 | Bacteria | 1118 |
| 411 | Ga0436362_0763626 | 3300039453 | Bacteria | 1121 |
| 412 | Ga0439439_0153248 | 3300041406 | Bacteria | 655 |
| 413 | Ga0439465_0355509 | 3300041413 | Bacteria | 554 |
| 414 | Ga0439443_010419 | 3300042003 | Bacteria | 1346 |
| 415 | Ga0439448_0002814 | 3300042005 | Bacteria | 4764 |
| 416 | Ga0439448_0077051 | 3300042005 | Bacteria | 1116 |
| 417 | Ga0439450_003685 | 3300042008 | Bacteria | 2557 |
| 418 | Ga0439450_016749 | 3300042008 | Bacteria | 1519 |
| 419 | Ga0439454_002643 | 3300042011 | Bacteria | 1916 |
| 420 | Ga0439455_0054951 | 3300042012 | Bacteria | 1046 |
| 421 | Ga0439455_0057795 | 3300042012 | Bacteria | 1024 |
| 422 | Ga0439455_0078654 | 3300042012 | Bacteria | 894 |
| 423 | Ga0439463_002574 | 3300042016 | Bacteria | 4601 |
| 424 | Ga0439463_030794 | 3300042016 | Bacteria | 1353 |
| 425 | Ga0439463_156231 | 3300042016 | Bacteria | 591 |
| 426 | Ga0450913_003029 | 3300042117 | Bacteria | 1077 |
| 427 | Ga0450914_001143 | 3300042118 | Bacteria | 1571 |
| 428 | Ga0450900_028683 | 3300042136 | Bacteria | 802 |
| 429 | Ga0450902_055281 | 3300042137 | Bacteria | 683 |
| 430 | Ga0450905_005746 | 3300042142 | Bacteria | 1665 |
| 431 | Ga0450889_002295 | 3300042144 | Bacteria | 1913 |
| 432 | Ga0450907_035672 | 3300042146 | Bacteria | 849 |
| 433 | Ga0439458_0020453 | 3300042157 | Bacteria | 1528 |
| 434 | Ga0439458_0111559 | 3300042157 | Bacteria | 715 |
| 435 | Ga0439444_0018811 | 3300042437 | Bacteria | 1199 |
| 436 | Ga0439464_0009095 | 3300042439 | Bacteria | 2610 |
| 437 | Ga0439464_0020792 | 3300042439 | Bacteria | 1799 |
| 438 | Ga0439464_0030414 | 3300042439 | Bacteria | 1512 |
| 439 | Ga0439460_0005555 | 3300042461 | Bacteria | 3100 |
| 440 | Ga0439460_0212443 | 3300042461 | Bacteria | 661 |
| 441 | Ga0450916_001104 | 3300042530 | Bacteria | 2631 |
| 442 | Ga0439440_0000534 | 3300042993 | Bacteria | 6416 |
| 443 | Ga0466965_0078991 | 3300044683 | Bacteria | 1662 |
| 444 | Ga0466966_0000887 | 3300044684 | Bacteria | 19094 |
| 445 | Ga0466963_0001640 | 3300044694 | Bacteria | 12189 |
| 446 | Ga0466971_0128524 | 3300044719 | Bacteria | 1175 |
| 447 | Ga0466957_0004157 | 3300044842 | Bacteria | 8016 |
| 448 | Ga0466959_0031559 | 3300045049 | Bacteria | 3920 |
| 449 | Ga0466959_0045582 | 3300045049 | Bacteria | 3229 |
| 450 | Ga0451576_0458440 | 3300045051 | Bacteria | 1339 |
| 451 | Ga0451576_1148599 | 3300045051 | Bacteria | 812 |
| 452 | Ga0466958_0002878 | 3300045836 | Bacteria | 8770 |
| 453 | Ga0466958_0018928 | 3300045836 | Bacteria | 4003 |
| 454 | Ga0466967_0189694 | 3300045976 | Bacteria | 1942 |
| 455 | Ga0495617_058257 | 3300046452 | Bacteria | 1280 |
| 456 | Ga0495592_0108039 | 3300046454 | Bacteria | 1972 |
| 457 | Ga0495603_0001259 | 3300046455 | Bacteria | 14773 |
| 458 | Ga0495603_0008959 | 3300046455 | Bacteria | 6049 |
| 459 | Ga0495603_0035146 | 3300046455 | Bacteria | 3011 |
| 460 | Ga0495591_029807 | 3300046458 | Bacteria | 1653 |
| 461 | Ga0495629_0000580 | 3300046459 | Bacteria | 29719 |
| 462 | Ga0495629_0683929 | 3300046459 | Bacteria | 682 |
| 463 | Ga0495651_0011640 | 3300046462 | Bacteria | 6762 |
| 464 | Ga0495651_0014139 | 3300046462 | Bacteria | 6170 |
| 465 | Ga0495651_0020821 | 3300046462 | Bacteria | 5091 |
| 466 | Ga0495653_0112248 | 3300046463 | Bacteria | 1956 |
| 467 | Ga0495653_0127480 | 3300046463 | Bacteria | 1805 |
| 468 | Ga0495580_0069647 | 3300046472 | Bacteria | 2458 |
| 469 | Ga0495580_0594614 | 3300046472 | Bacteria | 732 |
| 470 | Ga0495580_0675090 | 3300046472 | Bacteria | 678 |
| 471 | Ga0495639_0021086 | 3300046475 | Bacteria | 2851 |
| 472 | Ga0495639_0035204 | 3300046475 | Bacteria | 2240 |
| 473 | Ga0495662_0029215 | 3300046476 | Bacteria | 2662 |
| 474 | Ga0495664_0009359 | 3300046477 | Bacteria | 5479 |
| 475 | Ga0495664_0719584 | 3300046477 | Bacteria | 589 |
| 476 | Ga0495584_0039919 | 3300046491 | Bacteria | 2371 |
| 477 | Ga0495585_0140132 | 3300046492 | Bacteria | 1267 |
| 478 | Ga0495594_0143819 | 3300046499 | Bacteria | 1353 |
| 479 | Ga0495596_0063753 | 3300046500 | Bacteria | 1434 |
| 480 | Ga0495607_0042969 | 3300046501 | Bacteria | 2676 |
| 481 | Ga0495607_0187540 | 3300046501 | Bacteria | 1033 |
| 482 | Ga0495608_0007465 | 3300046511 | Bacteria | 7717 |
| 483 | Ga0495608_0071498 | 3300046511 | Bacteria | 2263 |
| 484 | Ga0495618_0035202 | 3300046514 | Bacteria | 3142 |
| 485 | Ga0495618_0068801 | 3300046514 | Bacteria | 2251 |
| 486 | Ga0495628_0006341 | 3300046516 | Bacteria | 10339 |
| 487 | Ga0495628_0116386 | 3300046516 | Bacteria | 2053 |
| 488 | Ga0495630_0023860 | 3300046517 | Bacteria | 4521 |
| 489 | Ga0495630_0030667 | 3300046517 | Bacteria | 4002 |
| 490 | Ga0495632_0341613 | 3300046519 | Bacteria | 659 |
| 491 | Ga0495644_0183985 | 3300046523 | Bacteria | 804 |
| 492 | Ga0495642_0044015 | 3300046528 | Bacteria | 1822 |
| 493 | Ga0495652_0010636 | 3300046529 | Bacteria | 8336 |
| 494 | Ga0495652_0162456 | 3300046529 | Bacteria | 1732 |
| 495 | Ga0495665_0009317 | 3300046531 | Bacteria | 5318 |
| 496 | Ga0495665_0037306 | 3300046531 | Bacteria | 2594 |
| 497 | Ga0495586_0084859 | 3300046535 | Bacteria | 1744 |
| 498 | Ga0495587_0007478 | 3300046536 | Bacteria | 7073 |
| 499 | Ga0495598_0011137 | 3300046537 | Bacteria | 2172 |
| 500 | Ga0495598_0063483 | 3300046537 | Bacteria | 1145 |
| 501 | Ga0495598_0273797 | 3300046537 | Bacteria | 632 |
| 502 | Ga0495621_0224260 | 3300046539 | Bacteria | 762 |
| 503 | Ga0495597_0278616 | 3300046542 | Bacteria | 652 |
| 504 | Ga0495645_0013507 | 3300046543 | Bacteria | 5776 |
| 505 | Ga0495622_0080030 | 3300046557 | Bacteria | 1504 |
| 506 | Ga0495633_0146153 | 3300046558 | Bacteria | 1092 |
| 507 | Ga0495667_0008462 | 3300046559 | Bacteria | 6984 |
| 508 | Ga0495656_0049735 | 3300046615 | Bacteria | 1786 |
| 509 | Ga0495656_0179585 | 3300046615 | Bacteria | 1040 |
| 510 | Ga0495668_0237191 | 3300046616 | Bacteria | 999 |
| 511 | Ga0495634_0023976 | 3300046642 | Bacteria | 4285 |
| 512 | Ga0495611_0094623 | 3300046648 | Bacteria | 1382 |
| 513 | Ga0495635_0012376 | 3300046663 | Bacteria | 5979 |
| 514 | Ga0495659_0104043 | 3300046664 | Bacteria | 1102 |
| 515 | Ga0495661_0083231 | 3300046665 | Bacteria | 1840 |
| 516 | Ga0495588_0030193 | 3300046674 | Bacteria | 2723 |
| 517 | Ga0495657_0263230 | 3300046675 | Bacteria | 1035 |
| 518 | Ga0495657_0356890 | 3300046675 | Bacteria | 864 |
| 519 | Ga0495599_0000701 | 3300046678 | Bacteria | 18936 |
| 520 | Ga0495599_0215775 | 3300046678 | Bacteria | 1175 |
| 521 | Ga0495623_0124701 | 3300046679 | Bacteria | 1547 |
| 522 | Ga0495646_0125975 | 3300046680 | Bacteria | 1445 |
| 523 | Ga0495647_0157144 | 3300046681 | Bacteria | 978 |
| 524 | Ga0495658_0002558 | 3300046683 | Bacteria | 9145 |
| 525 | Ga0495658_0104906 | 3300046683 | Unclassified | 1692 |
| 526 | Ga0495658_0132857 | 3300046683 | Bacteria | 1517 |
| 527 | Ga0495658_0147978 | 3300046683 | Bacteria | 1441 |
| 528 | Ga0495669_0026448 | 3300046684 | Bacteria | 2536 |
| 529 | Ga0495669_0249083 | 3300046684 | Bacteria | 853 |
| 530 | Ga0495669_0257890 | 3300046684 | Bacteria | 838 |
| 531 | Ga0495613_0003552 | 3300046689 | Bacteria | 11695 |
| 532 | Ga0495613_0045182 | 3300046689 | Bacteria | 3258 |
| 533 | Ga0495613_0797407 | 3300046689 | Bacteria | 617 |
| 534 | Ga0495613_0975691 | 3300046689 | Bacteria | 545 |
| 535 | Ga0495624_0032469 | 3300046690 | Bacteria | 3385 |
| 536 | Ga0495624_0154926 | 3300046690 | Bacteria | 1401 |
| 537 | Ga0495624_0420610 | 3300046690 | Bacteria | 801 |
| 538 | Ga0495670_0012604 | 3300046691 | Bacteria | 4158 |
| 539 | Ga0495670_0260318 | 3300046691 | Bacteria | 926 |
| 540 | Ga0495589_0046540 | 3300046794 | Bacteria | 2153 |
| 541 | Ga0495589_0470802 | 3300046794 | Bacteria | 574 |
| 542 | Ga0495600_0035151 | 3300046809 | Bacteria | 3253 |
| 543 | Ga0495660_0070685 | 3300046810 | Bacteria | 1852 |
| 544 | Ga0495581_0004654 | 3300047315 | Bacteria | 7922 |
| 545 | Ga0495581_0006655 | 3300047315 | Bacteria | 6697 |
| 546 | Ga0495636_0092017 | 3300047318 | Bacteria | 1317 |
| 547 | Ga0495674_0011087 | 3300047319 | Bacteria | 8510 |
| 548 | Ga0495674_0599051 | 3300047319 | Bacteria | 873 |
| 549 | Ga0495676_0068338 | 3300047321 | Bacteria | 2746 |
| 550 | Ga0495680_0004959 | 3300047322 | Bacteria | 12594 |
| 551 | Ga0495680_0015445 | 3300047322 | Bacteria | 6588 |
| 552 | Ga0495683_0342174 | 3300047323 | Bacteria | 633 |
| 553 | Ga0495675_0022963 | 3300047444 | Bacteria | 3976 |
| 554 | Ga0495677_0151259 | 3300047445 | Bacteria | 894 |
| 555 | Ga0495679_034151 | 3300047446 | Bacteria | 1621 |
| 556 | Ga0495684_0002173 | 3300047471 | Bacteria | 15710 |
| 557 | Ga0495684_0022862 | 3300047471 | Bacteria | 4809 |
| 558 | Ga0495593_0035302 | 3300047673 | Bacteria | 2716 |
| 559 | Ga0495602_0153291 | 3300048088 | Bacteria | 1808 |
| 560 | Ga0495602_0216608 | 3300048088 | Bacteria | 1448 |
| 561 | Ga0495602_0273731 | 3300048088 | Bacteria | 1247 |
| 562 | Ga0495614_0063362 | 3300048089 | Bacteria | 1589 |
| 563 | Ga0495614_0206049 | 3300048089 | Bacteria | 891 |
| 564 | Ga0496100_0012047 | 3300048903 | Bacteria | 4945 |
| 565 | Ga0496100_0018163 | 3300048903 | Bacteria | 4167 |
| 566 | Ga0496105_0118280 | 3300048908 | Bacteria | 2186 |
| 567 | Ga0496106_0010334 | 3300048909 | Bacteria | 6897 |
| 568 | Ga0496107_0014287 | 3300048910 | Bacteria | 5560 |
| 569 | Ga0496108_0026709 | 3300048911 | Bacteria | 4765 |
| 570 | Ga0496108_0319199 | 3300048911 | Bacteria | 1354 |
| 571 | Ga0496109_0029507 | 3300048912 | Bacteria | 4913 |
| 572 | Ga0496109_0203327 | 3300048912 | Bacteria | 1862 |
| 573 | Ga0496110_0008928 | 3300048913 | Bacteria | 8081 |
| 574 | Ga0496110_0031513 | 3300048913 | Bacteria | 4575 |
| 575 | Ga0496110_0101045 | 3300048913 | Bacteria | 2585 |
| 576 | Ga0496110_0338324 | 3300048913 | Bacteria | 1371 |
| 577 | Ga0496110_0645430 | 3300048913 | Bacteria | 958 |
| 578 | Ga0496111_0000396 | 3300048914 | Bacteria | 21854 |
| 579 | Ga0496112_0101490 | 3300048915 | Bacteria | 2847 |
| 580 | Ga0496112_0270757 | 3300048915 | Bacteria | 1647 |
| 581 | Ga0496113_0299615 | 3300048916 | Bacteria | 1287 |
| 582 | Ga0496113_0669676 | 3300048916 | Bacteria | 829 |
| 583 | Ga0496114_0228935 | 3300048917 | Bacteria | 1633 |
| 584 | Ga0496114_0600255 | 3300048917 | Bacteria | 971 |
| 585 | Ga0496114_0732825 | 3300048917 | Bacteria | 865 |
| 586 | Ga0496115_0220294 | 3300048918 | Bacteria | 1566 |
| 587 | Ga0501031_0030814 | 3300049568 | Bacteria | 3499 |
| 588 | Ga0501031_0385698 | 3300049568 | Bacteria | 906 |
| 589 | Ga0501032_0295392 | 3300049569 | Bacteria | 1048 |
| 590 | Ga0501033_0012342 | 3300049570 | Bacteria | 6520 |
| 591 | Ga0501033_0035041 | 3300049570 | Bacteria | 3762 |
| 592 | Ga0501033_0089341 | 3300049570 | Bacteria | 2254 |
| 593 | Ga0501036_0004978 | 3300049572 | Bacteria | 10742 |
| 594 | Ga0501036_0029664 | 3300049572 | Bacteria | 4620 |
| 595 | Ga0501036_0064669 | 3300049572 | Bacteria | 3096 |
| 596 | Ga0501036_0075164 | 3300049572 | Bacteria | 2857 |
| 597 | Ga0501036_1191057 | 3300049572 | Bacteria | 621 |
| 598 | Ga0501037_0029314 | 3300049573 | Bacteria | 4066 |
| 599 | Ga0501037_0126498 | 3300049573 | Bacteria | 1834 |
| 600 | Ga0501037_0151568 | 3300049573 | Bacteria | 1657 |
| 601 | Ga0501038_0007864 | 3300049574 | Bacteria | 9826 |
| 602 | Ga0501038_0009086 | 3300049574 | Bacteria | 9123 |
| 603 | Ga0501038_0061396 | 3300049574 | Bacteria | 3214 |
| 604 | Ga0501038_0299672 | 3300049574 | Bacteria | 1262 |
| 605 | Ga0501038_0359614 | 3300049574 | Bacteria | 1132 |
| 606 | Ga0501039_0004611 | 3300049575 | Bacteria | 10422 |
| 607 | Ga0501039_0004615 | 3300049575 | Bacteria | 10420 |
| 608 | Ga0501039_0093223 | 3300049575 | Bacteria | 2347 |
| 609 | Ga0501039_0119675 | 3300049575 | Bacteria | 2063 |
| 610 | Ga0501039_0152114 | 3300049575 | Bacteria | 1818 |
| 611 | Ga0501039_0455240 | 3300049575 | Bacteria | 1005 |
| 612 | Ga0501039_0524532 | 3300049575 | Bacteria | 930 |
| 613 | Ga0501040_0002408 | 3300049576 | Bacteria | 12037 |
| 614 | Ga0501040_0003475 | 3300049576 | Bacteria | 10164 |
| 615 | Ga0501040_0014580 | 3300049576 | Bacteria | 5183 |
| 616 | Ga0501040_0020342 | 3300049576 | Bacteria | 4420 |
| 617 | Ga0501040_0128177 | 3300049576 | Bacteria | 1783 |
| 618 | Ga0501040_0134761 | 3300049576 | Bacteria | 1738 |
| 619 | Ga0501040_0205795 | 3300049576 | Bacteria | 1398 |
| 620 | Ga0501041_0000041 | 3300049577 | Bacteria | 43676 |
| 621 | Ga0501041_0002431 | 3300049577 | Bacteria | 10561 |
| 622 | Ga0501041_0025935 | 3300049577 | Bacteria | 3524 |
| 623 | Ga0501041_0139834 | 3300049577 | Bacteria | 1510 |
| 624 | Ga0501041_0222032 | 3300049577 | Bacteria | 1186 |
| 625 | Ga0501042_0002936 | 3300049578 | Bacteria | 10587 |
| 626 | Ga0501042_0004188 | 3300049578 | Bacteria | 9172 |
| 627 | Ga0501042_0005831 | 3300049578 | Bacteria | 7957 |
| 628 | Ga0501042_0006075 | 3300049578 | Bacteria | 7823 |
| 629 | Ga0501042_0009128 | 3300049578 | Bacteria | 6593 |
| 630 | Ga0501042_0035806 | 3300049578 | Bacteria | 3522 |
| 631 | Ga0501042_0082544 | 3300049578 | Bacteria | 2304 |
| 632 | Ga0501042_0219295 | 3300049578 | Bacteria | 1372 |
| 633 | Ga0501042_0289589 | 3300049578 | Bacteria | 1183 |
| 634 | Ga0501043_0016315 | 3300049579 | Bacteria | 5825 |
| 635 | Ga0501043_0039869 | 3300049579 | Bacteria | 3692 |
| 636 | Ga0501043_0056235 | 3300049579 | Bacteria | 3090 |
| 637 | Ga0501043_0318852 | 3300049579 | Bacteria | 1185 |
| 638 | Ga0501043_0408536 | 3300049579 | Bacteria | 1025 |
| 639 | Ga0501046_0010306 | 3300049580 | Bacteria | 8039 |
| 640 | Ga0501046_0012266 | 3300049580 | Bacteria | 7303 |
| 641 | Ga0501046_0245807 | 3300049580 | Bacteria | 1318 |
| 642 | Ga0501046_0334092 | 3300049580 | Bacteria | 1102 |
| 643 | Ga0501048_0000970 | 3300049582 | Bacteria | 21242 |
| 644 | Ga0501048_0001880 | 3300049582 | Bacteria | 15940 |
| 645 | Ga0501048_0031845 | 3300049582 | Bacteria | 3814 |
| 646 | Ga0501048_0079870 | 3300049582 | Bacteria | 2308 |
| 647 | Ga0501048_0081482 | 3300049582 | Bacteria | 2283 |
| 648 | Ga0501048_0192473 | 3300049582 | Bacteria | 1445 |
| 649 | Ga0501048_0919693 | 3300049582 | Bacteria | 629 |
| 650 | Ga0501067_0005433 | 3300049583 | Bacteria | 7075 |
| 651 | Ga0501068_0010287 | 3300049584 | Bacteria | 5253 |
| 652 | Ga0501068_0016757 | 3300049584 | Bacteria | 4228 |
| 653 | Ga0501068_0096740 | 3300049584 | Bacteria | 1826 |
| 654 | Ga0501068_0336348 | 3300049584 | Bacteria | 969 |
| 655 | Ga0501068_0410227 | 3300049584 | Bacteria | 874 |
| 656 | Ga0501069_0004219 | 3300049585 | Bacteria | 7424 |
| 657 | Ga0501070_0096049 | 3300049586 | Bacteria | 2452 |
| 658 | Ga0501070_0181522 | 3300049586 | Bacteria | 1732 |
| 659 | Ga0501070_0366222 | 3300049586 | Bacteria | 1169 |
| 660 | Ga0501070_0503659 | 3300049586 | Bacteria | 973 |
| 661 | Ga0501070_0511243 | 3300049586 | Bacteria | 964 |
| 662 | Ga0501070_0773149 | 3300049586 | Bacteria | 755 |
| 663 | Ga0501071_0004087 | 3300049587 | Bacteria | 9224 |
| 664 | Ga0501071_0024748 | 3300049587 | Bacteria | 4199 |
| 665 | Ga0501071_0028914 | 3300049587 | Bacteria | 3908 |
| 666 | Ga0501071_0035558 | 3300049587 | Bacteria | 3548 |
| 667 | Ga0501071_0073865 | 3300049587 | Bacteria | 2488 |
| 668 | Ga0501071_0096950 | 3300049587 | Bacteria | 2171 |
| 669 | Ga0501071_0155395 | 3300049587 | Bacteria | 1708 |
| 670 | Ga0501071_0400803 | 3300049587 | Bacteria | 1047 |
| 671 | Ga0501072_0005064 | 3300049588 | Bacteria | 10029 |
| 672 | Ga0501072_0007049 | 3300049588 | Bacteria | 8531 |
| 673 | Ga0501072_0014483 | 3300049588 | Bacteria | 6044 |
| 674 | Ga0501072_0022112 | 3300049588 | Bacteria | 4933 |
| 675 | Ga0501072_0033667 | 3300049588 | Bacteria | 4015 |
| 676 | Ga0501072_0048230 | 3300049588 | Bacteria | 3354 |
| 677 | Ga0501072_0087768 | 3300049588 | Bacteria | 2468 |
| 678 | Ga0501072_0978910 | 3300049588 | Bacteria | 660 |
| 679 | Ga0501072_1396079 | 3300049588 | Bacteria | 542 |
| 680 | Ga0501073_0607031 | 3300049589 | Bacteria | 755 |
| 681 | Ga0501074_0008216 | 3300049590 | Bacteria | 7564 |
| 682 | Ga0501074_0008920 | 3300049590 | Bacteria | 7271 |
| 683 | Ga0501074_0016656 | 3300049590 | Bacteria | 5333 |
| 684 | Ga0501074_0026814 | 3300049590 | Bacteria | 4177 |
| 685 | Ga0501074_0086611 | 3300049590 | Bacteria | 2244 |
| 686 | Ga0501074_0086945 | 3300049590 | Bacteria | 2239 |
| 687 | Ga0501074_0087452 | 3300049590 | Bacteria | 2232 |
| 688 | Ga0501074_0158128 | 3300049590 | Bacteria | 1618 |
| 689 | Ga0501074_0490876 | 3300049590 | Bacteria | 870 |
| 690 | Ga0501074_0753410 | 3300049590 | Bacteria | 687 |
| 691 | Ga0501074_0778041 | 3300049590 | Bacteria | 675 |
| 692 | Ga0501075_0000384 | 3300049591 | Bacteria | 25536 |
| 693 | Ga0501075_0027098 | 3300049591 | Bacteria | 4222 |
| 694 | Ga0501075_0046131 | 3300049591 | Bacteria | 3274 |
| 695 | Ga0501075_0053417 | 3300049591 | Bacteria | 3039 |
| 696 | Ga0501075_0064727 | 3300049591 | Bacteria | 2757 |
| 697 | Ga0501075_0103696 | 3300049591 | Bacteria | 2161 |
| 698 | Ga0501075_0140374 | 3300049591 | Bacteria | 1841 |
| 699 | Ga0501076_0000373 | 3300049592 | Bacteria | 27899 |
| 700 | Ga0501076_0002165 | 3300049592 | Bacteria | 13473 |
| 701 | Ga0501076_0002705 | 3300049592 | Bacteria | 12254 |
| 702 | Ga0501076_0008115 | 3300049592 | Bacteria | 7677 |
| 703 | Ga0501076_0113051 | 3300049592 | Bacteria | 2196 |
| 704 | Ga0501076_0161658 | 3300049592 | Bacteria | 1824 |
| 705 | Ga0501076_0415235 | 3300049592 | Bacteria | 1107 |
| 706 | Ga0501076_1032087 | 3300049592 | Bacteria | 677 |
| 707 | Ga0501077_0002637 | 3300049593 | Bacteria | 10741 |
| 708 | Ga0501077_0017728 | 3300049593 | Bacteria | 4497 |
| 709 | Ga0501077_0044547 | 3300049593 | Bacteria | 2818 |
| 710 | Ga0501077_0074060 | 3300049593 | Bacteria | 2157 |
| 711 | Ga0501077_0155359 | 3300049593 | Bacteria | 1452 |
| 712 | Ga0501077_0309969 | 3300049593 | Bacteria | 1006 |
| 713 | Ga0501217_140144 | 3300049661 | Bacteria | 716 |
| 714 | Ga0501079_0003332 | 3300049741 | Bacteria | 11785 |
| 715 | Ga0501079_0014627 | 3300049741 | Bacteria | 5985 |
| 716 | Ga0501079_0049887 | 3300049741 | Bacteria | 3231 |
| 717 | Ga0501079_0111940 | 3300049741 | Bacteria | 2121 |
| 718 | Ga0501079_0166886 | 3300049741 | Bacteria | 1717 |
| 719 | Ga0501079_0192609 | 3300049741 | Bacteria | 1591 |
| 720 | Ga0501079_0194323 | 3300049741 | Bacteria | 1584 |
| 721 | Ga0501079_0318090 | 3300049741 | Bacteria | 1218 |
| 722 | Ga0501079_1008851 | 3300049741 | Bacteria | 656 |
| 723 | Ga0501080_0021407 | 3300049742 | Bacteria | 5985 |
| 724 | Ga0501080_0067392 | 3300049742 | Bacteria | 3329 |
| 725 | Ga0501080_0591036 | 3300049742 | Bacteria | 986 |
| 726 | Ga0501081_0002206 | 3300049743 | Bacteria | 12249 |
| 727 | Ga0501081_0004682 | 3300049743 | Bacteria | 8794 |
| 728 | Ga0501081_0040461 | 3300049743 | Bacteria | 3192 |
| 729 | Ga0501081_0056000 | 3300049743 | Bacteria | 2724 |
| 730 | Ga0501081_0251539 | 3300049743 | Bacteria | 1290 |
| 731 | Ga0501081_1060195 | 3300049743 | Bacteria | 613 |
| 732 | Ga0501268_093110 | 3300049765 | Bacteria | 637 |
| 733 | Ga0501035_0031924 | 3300049822 | Bacteria | 4796 |
| 734 | Ga0501035_0045881 | 3300049822 | Bacteria | 3931 |
| 735 | Ga0501035_0250267 | 3300049822 | Bacteria | 1505 |
| 736 | Ga0501045_0000460 | 3300049824 | Bacteria | 25215 |
| 737 | Ga0501045_0002493 | 3300049824 | Bacteria | 12520 |
| 738 | Ga0501045_0002574 | 3300049824 | Bacteria | 12367 |
| 739 | Ga0501045_0006800 | 3300049824 | Bacteria | 7921 |
| 740 | Ga0501045_0101314 | 3300049824 | Bacteria | 2132 |
| 741 | Ga0501045_0200507 | 3300049824 | Bacteria | 1487 |
| 742 | Ga0501045_1056320 | 3300049824 | Bacteria | 595 |
| 743 | nmdc:mga05p37_24412_c1 | 3300050507 | Bacteria | 7347 |
| 744 | nmdc:mga05p37_46997_c1 | 3300050507 | Bacteria | 5308 |
| 745 | nmdc:mga05p37_51199_c1 | 3300050507 | Bacteria | 5079 |
| 746 | nmdc:mga05p37_5452_c1 | 3300050507 | Bacteria | 14936 |
| 747 | nmdc:mga05p37_6613_c1 | 3300050507 | Bacteria | 13665 |
| 748 | nmdc:mga05p37_85318_c1 | 3300050507 | Bacteria | 3891 |
| 749 | nmdc:mga05p37_858521_c1 | 3300050507 | Bacteria | 985 |
| 750 | nmdc:mga09592_133977_c1 | 3300050508 | Bacteria | 2133 |
| 751 | nmdc:mga09592_137719_c1 | 3300050508 | Bacteria | 2103 |
| 752 | nmdc:mga09592_13980_c1 | 3300050508 | Bacteria | 6554 |
| 753 | nmdc:mga0qj67_23075_c1 | 3300050509 | Bacteria | 4783 |
| 754 | nmdc:mga0qj67_355803_c1 | 3300050509 | Bacteria | 1183 |
| 755 | nmdc:mga0qj67_96750_c1 | 3300050509 | Bacteria | 2377 |
| 756 | nmdc:mga06r32_12115_c1 | 3300050510 | Bacteria | 6423 |
| 757 | nmdc:mga06r32_18282_c1 | 3300050510 | Bacteria | 6416 |
| 758 | nmdc:mga06r32_296162_c1 | 3300050510 | Bacteria | 1604 |
| 759 | nmdc:mga06r32_311631_c1 | 3300050510 | Bacteria | 1559 |
| 760 | nmdc:mga08y16_11473_c1 | 3300050511 | Bacteria | 9312 |
| 761 | nmdc:mga08y16_12137_c1 | 3300050511 | Bacteria | 9054 |
| 762 | nmdc:mga08y16_380138_c1 | 3300050511 | Bacteria | 1448 |
| 763 | nmdc:mga08y16_388109_c1 | 3300050511 | Bacteria | 1431 |
| 764 | nmdc:mga08y16_712841_c1 | 3300050511 | Bacteria | 1002 |
| 765 | nmdc:mga08y16_778850_c1 | 3300050511 | Bacteria | 951 |
| 766 | nmdc:mga0n895_228065_c1 | 3300050512 | Bacteria | 1891 |
| 767 | nmdc:mga0n895_2298_c1 | 3300050512 | Bacteria | 14858 |
| 768 | nmdc:mga0n895_328891_c1 | 3300050512 | Bacteria | 1549 |
| 769 | nmdc:mga0n895_8340_c1 | 3300050512 | Bacteria | 8967 |
| 770 | nmdc:mga0rr50_66004_c1 | 3300050513 | Bacteria | 2743 |
| 771 | nmdc:mga0rr50_68882_c1 | 3300050513 | Bacteria | 2692 |
| 772 | nmdc:mga08x19_312419_c1 | 3300050514 | Bacteria | 1093 |
| 773 | nmdc:mga0a205_11872_c1 | 3300050515 | Bacteria | 8041 |
| 774 | nmdc:mga0a205_25198_c1 | 3300050515 | Bacteria | 5665 |
| 775 | nmdc:mga0a205_670554_c1 | 3300050515 | Bacteria | 888 |
| 776 | nmdc:mga0a205_80687_c1 | 3300050515 | Bacteria | 3143 |
| 777 | nmdc:mga0a205_95358_c1 | 3300050515 | Bacteria | 2874 |
| 778 | nmdc:mga0a205_9802_c1 | 3300050515 | Bacteria | 8785 |
| 779 | Ga0495601_0001651 | 3300053077 | Bacteria | 12311 |
| 780 | Ga0495601_0007552 | 3300053077 | Bacteria | 6380 |
| 781 | Ga0495601_0454117 | 3300053077 | Bacteria | 829 |
| 782 | Ga0495612_0363178 | 3300053078 | Bacteria | 655 |
| 783 | Ga0495595_0189613 | 3300053084 | Bacteria | 1021 |
| 784 | Ga0501084_0000697 | 3300054114 | Bacteria | 25775 |
| 785 | Ga0501084_0000767 | 3300054114 | Bacteria | 24480 |
| 786 | Ga0501084_0015598 | 3300054114 | Bacteria | 6301 |
| 787 | Ga0501084_0069461 | 3300054114 | Bacteria | 2950 |
| 788 | Ga0501084_0069832 | 3300054114 | Bacteria | 2941 |
| 789 | Ga0501084_0086042 | 3300054114 | Bacteria | 2639 |
| 790 | Ga0501084_0144316 | 3300054114 | Bacteria | 2005 |
| 791 | Ga0501084_0263813 | 3300054114 | Bacteria | 1454 |
| 792 | Ga0501084_1182167 | 3300054114 | Bacteria | 642 |
| 793 | Ga0590071_029381 | 3300059421 | Bacteria | 1306 |
| 794 | Ga0590074_003848 | 3300059423 | Bacteria | 2488 |
| 795 | Ga0590075_001038 | 3300059424 | Bacteria | 7175 |
| 796 | Ga0590075_017998 | 3300059424 | Bacteria | 1745 |
| 797 | Ga0590077_002509 | 3300059426 | Bacteria | 3902 |
| 798 | Ga0590077_081702 | 3300059426 | Bacteria | 744 |
| 799 | Ga0587066_152548 | 3300059490 | Bacteria | 574 |
| 800 | Ga0587073_0007531 | 3300059492 | Bacteria | 1726 |
| 801 | Ga0587073_0014020 | 3300059492 | Bacteria | 1419 |
| 802 | Ga0587082_129959 | 3300059504 | Bacteria | 578 |
| 803 | Ga0587083_0061252 | 3300059505 | Bacteria | 849 |
| 804 | Ga0587086_040303 | 3300059507 | Bacteria | 721 |
| 805 | Ga0587089_005641 | 3300059509 | Bacteria | 1426 |
| 806 | Ga0587094_121973 | 3300059513 | Bacteria | 523 |
| 807 | Ga0587115_022488 | 3300059626 | Bacteria | 888 |
| 808 | Ga0587117_000258 | 3300059627 | Bacteria | 3260 |
| 809 | Ga0587072_002001 | 3300059643 | Bacteria | 2659 |
| 810 | Ga0587072_033152 | 3300059643 | Bacteria | 973 |
| 811 | Ga0587075_003990 | 3300059644 | Bacteria | 1688 |
| 812 | Ga0587078_024720 | 3300059646 | Bacteria | 780 |
| 813 | Ga0587079_021625 | 3300059647 | Bacteria | 1159 |
| 814 | Ga0587079_038773 | 3300059647 | Bacteria | 953 |
| 815 | Ga0587102_006889 | 3300059649 | Bacteria | 1044 |
| 816 | Ga0587071_026839 | 3300060344 | Bacteria | 1088 |
| 817 | Ga0587111_0004880 | 3300060346 | Bacteria | 2033 |
| 818 | Ga0501082_0008656 | 3300060353 | Bacteria | 8774 |
| 819 | Ga0501082_0011849 | 3300060353 | Bacteria | 7494 |
| 820 | Ga0501082_0020961 | 3300060353 | Bacteria | 5637 |
| 821 | Ga0501082_0025852 | 3300060353 | Bacteria | 5061 |
| 822 | Ga0501082_0052080 | 3300060353 | Bacteria | 3528 |
| 823 | Ga0501082_0069429 | 3300060353 | Bacteria | 3033 |
| 824 | Ga0501082_0072105 | 3300060353 | Bacteria | 2975 |
| 825 | Ga0501082_1020004 | 3300060353 | Bacteria | 723 |
| 826 | Ga0466962_0005013 | 3300061719 | Bacteria | 6367 |
| 827 | Ga0530510_0001371 | 3300061734 | Bacteria | 16303 |
| 828 | Ga0530510_0006802 | 3300061734 | Bacteria | 7967 |
| 829 | Ga0530510_0022544 | 3300061734 | Bacteria | 4486 |
| 830 | Ga0530510_0022753 | 3300061734 | Bacteria | 4465 |
| 831 | Ga0530510_0179366 | 3300061734 | Bacteria | 1570 |
| 832 | Ga0530510_0187613 | 3300061734 | Bacteria | 1534 |
| 833 | Ga0530510_0217904 | 3300061734 | Bacteria | 1418 |
| 834 | Ga0530510_0224381 | 3300061734 | Bacteria | 1397 |
| 835 | Ga0530510_0411214 | 3300061734 | Bacteria | 1021 |
| 836 | Ga0530510_0589611 | 3300061734 | Bacteria | 845 |
| 837 | Ga0530510_0938492 | 3300061734 | Bacteria | 662 |
| 838 | Ga0496104_0070241 | |||
| 839 | JGI24747J21853_1002432 | |||
| 840 | JGI24033J26618_1003772 | |||
| 841 | JGI24751J29686_10000457 | |||
| 842 | JGI24751J29686_10028600 | |||
| 843 | JGI25407J50210_10000849 | |||
| 844 | JGI25407J50210_10082127 | |||
| 845 | JGI25407J50210_10094491 | |||
| 846 | JGI25405J52794_10032067 | |||
| 847 | Ga0058863_11807083 | |||
| 848 | Ga0058861_11793184 | |||
| 849 | Ga0058862_12887376 | |||
| 850 | Ga0070682_100196733 | |||
| 851 | Ga0070682_100557448 | |||
| 852 | Ga0068868_100284494 | |||
| 853 | Ga0070689_100343057 | |||
| 854 | Ga0070661_100003993 | |||
| 855 | Ga0070692_10248242 | |||
| 856 | Ga0070668_100128237 | |||
| 857 | Ga0070675_100042835 | |||
| 858 | Ga0070674_100173063 | |||
| 859 | Ga0070659_100243453 | |||
| 860 | Ga0070703_10000022 | |||
| 861 | Ga0070703_10008580 | |||
| 862 | Ga0070714_100103125 | |||
| 863 | Ga0070714_100140117 | |||
| 864 | Ga0070714_100321392 | |||
| 865 | Ga0070713_100173023 | |||
| 866 | Ga0070711_100237199 | |||
| 867 | Ga0070711_100262735 | |||
| 868 | Ga0070705_100149652 | |||
| 869 | Ga0070700_100182801 | |||
| 870 | Ga0070700_100927990 | |||
| 871 | Ga0070694_100168279 | |||
| 872 | Ga0070708_100002785 | |||
| 873 | Ga0070708_100016862 | |||
| 874 | Ga0070663_100785859 | |||
| 875 | Ga0070662_100087120 | |||
| 876 | Ga0070681_10025796 | |||
| 877 | Ga0070681_10035343 | |||
| 878 | Ga0068867_100460891 | |||
| 879 | Ga0070685_10403401 | |||
| 880 | Ga0070706_100000241 | |||
| 881 | Ga0070706_100100976 | |||
| 882 | Ga0070706_100878448 | |||
| 883 | Ga0070707_100000716 | |||
| 884 | Ga0070707_100006806 | |||
| 885 | Ga0070707_100025164 | |||
| 886 | Ga0070707_100048473 | |||
| 887 | Ga0070707_100603482 | |||
| 888 | Ga0070707_100661830 | |||
| 889 | Ga0070698_100006512 | |||
| 890 | Ga0070698_100020152 | |||
| 891 | Ga0070698_100025887 | |||
| 892 | Ga0070698_100090234 | |||
| 893 | Ga0070698_100499143 | |||
| 894 | Ga0070698_100753790 | |||
| 895 | Ga0070699_100008694 | |||
| 896 | Ga0070699_100070465 | |||
| 897 | Ga0070699_100112674 | |||
| 898 | Ga0070699_100220136 | |||
| 899 | Ga0070699_100319316 | |||
| 900 | Ga0070679_100015909 | |||
| 901 | Ga0070679_100053141 | |||
| 902 | Ga0070679_100145275 | |||
| 903 | Ga0070684_100238361 | |||
| 904 | Ga0070684_100714698 | |||
| 905 | Ga0070697_100006818 | |||
| 906 | Ga0070697_100012515 | |||
| 907 | Ga0070697_100622113 | |||
| 908 | Ga0070697_100864316 | |||
| 909 | Ga0070697_101205931 | |||
| 910 | Ga0068853_100630473 | |||
| 911 | Ga0070695_100002478 | |||
| 912 | Ga0070695_100940761 | |||
| 913 | Ga0070696_100085324 | |||
| 914 | Ga0070696_100317216 | |||
| 915 | Ga0070693_100095968 | |||
| 916 | Ga0070665_100641466 | |||
| 917 | Ga0070704_100009955 | |||
| 918 | Ga0070704_100074814 | |||
| 919 | Ga0070704_100419373 | |||
| 920 | Ga0070704_100630727 | |||
| 921 | Ga0070704_101429876 | |||
| 922 | Ga0070664_100008664 | |||
| 923 | Ga0068857_100256286 | |||
| 924 | Ga0068857_101084055 | |||
| 925 | Ga0068856_100177497 | |||
| 926 | Ga0068856_100275727 | |||
| 927 | Ga0068852_100488780 | |||
| 928 | Ga0068864_100265971 | |||
| 929 | Ga0068866_10008147 | |||
| 930 | Ga0068861_100040578 | |||
| 931 | Ga0068861_100041374 | |||
| 932 | Ga0068870_10003358 | |||
| 933 | Ga0068863_100009118 | |||
| 934 | Ga0068860_100179082 | |||
| 935 | Ga0068862_100513914 | |||
| 936 | Ga0081455_10001540 | |||
| 937 | Ga0081455_10002895 | |||
| 938 | Ga0081455_10006642 | |||
| 939 | Ga0081455_10009966 | |||
| 940 | Ga0081455_10013853 | |||
| 941 | Ga0081455_10024165 | |||
| 942 | Ga0081455_10033633 | |||
| 943 | Ga0081455_10043463 | |||
| 944 | Ga0081455_10045759 | |||
| 945 | Ga0081455_10079785 | |||
| 946 | Ga0081455_10154523 | |||
| 947 | Ga0081538_10000029 | |||
| 948 | Ga0081538_10000081 | |||
| 949 | Ga0081538_10001550 | |||
| 950 | Ga0081538_10010634 | |||
| 951 | Ga0081538_10021468 | |||
| 952 | Ga0081538_10026643 | |||
| 953 | Ga0081538_10040972 | |||
| 954 | Ga0081538_10104128 | |||
| 955 | Ga0081538_10248137 | |||
| 956 | Ga0081540_1036192 | |||
| 957 | Ga0081540_1085775 | |||
| 958 | Ga0081539_10020154 | |||
| 959 | Ga0081539_10106999 | |||
| 960 | Ga0081539_10107172 | |||
| 961 | Ga0075365_10302581 | |||
| 962 | Ga0075432_10005230 | |||
| 963 | Ga0075432_10005810 | |||
| 964 | Ga0075432_10006804 | |||
| 965 | Ga0075432_10050530 | |||
| 966 | Ga0070715_10024725 | |||
| 967 | Ga0070716_100100702 | |||
| 968 | Ga0070712_100047023 | |||
| 969 | Ga0070712_100098603 | |||
| 970 | Ga0070712_100104226 | |||
| 971 | Ga0070712_100545327 | |||
| 972 | Ga0075427_10001460 | |||
| 973 | Ga0068871_100061592 | |||
| 974 | Ga0075428_100054760 | |||
| 975 | Ga0075428_100080275 | |||
| 976 | Ga0075428_100152719 | |||
| 977 | Ga0075428_101371073 | |||
| 978 | Ga0075430_100010728 | |||
| 979 | Ga0075430_100024076 | |||
| 980 | Ga0075431_100072293 | |||
| 981 | Ga0075431_100282629 | |||
| 982 | Ga0075431_100297074 | |||
| 983 | Ga0075433_10006437 | |||
| 984 | Ga0075433_10054894 | |||
| 985 | Ga0075433_10062721 | |||
| 986 | Ga0075433_10089403 | |||
| 987 | Ga0075434_100002195 | |||
| 988 | Ga0075434_100034163 | |||
| 989 | Ga0075434_100134389 | |||
| 990 | Ga0075434_100224148 | |||
| 991 | Ga0075429_100017798 | |||
| 992 | Ga0075429_100058147 | |||
| 993 | Ga0075429_100065206 | |||
| 994 | Ga0075429_100104432 | |||
| 995 | Ga0075429_100452820 | |||
| 996 | Ga0075436_100027135 | |||
| 997 | Ga0075435_100039856 | |||
| 998 | Ga0105251_10027591 | |||
| 999 | Ga0105240_10401020 | |||
| 1000 | Ga0111539_10005444 | |||
| 1001 | Ga0111539_10031086 | |||
| 1002 | Ga0111539_10086306 | |||
| 1003 | Ga0111539_10136404 | |||
| 1004 | Ga0111539_10309917 | |||
| 1005 | Ga0111539_10416227 | |||
| 1006 | Ga0111539_10491105 | |||
| 1007 | Ga0111539_10496156 | |||
| 1008 | Ga0105245_10003018 | |||
| 1009 | Ga0105245_10053328 | |||
| 1010 | Ga0105245_10104318 | |||
| 1011 | Ga0105245_10740934 | |||
| 1012 | Ga0114129_10015822 | |||
| 1013 | Ga0114129_10023903 | |||
| 1014 | Ga0114129_10233986 | |||
| 1015 | Ga0114129_10363850 | |||
| 1016 | Ga0114129_10653817 | |||
| 1017 | Ga0114129_10698080 | |||
| 1018 | Ga0114129_11696130 | |||
| 1019 | Ga0105243_10007194 | |||
| 1020 | Ga0105243_10007215 | |||
| 1021 | Ga0105241_10281858 | |||
| 1022 | Ga0105242_10004298 | |||
| 1023 | Ga0105242_10080853 | |||
| 1024 | Ga0105242_10503446 | |||
| 1025 | Ga0105237_10868258 | |||
| 1026 | Ga0105237_11943491 | |||
| 1027 | Ga0105238_10021845 | |||
| 1028 | Ga0105249_10004045 | |||
| 1029 | Ga0105249_10017153 | |||
| 1030 | Ga0105249_10043032 | |||
| 1031 | Ga0105249_10055051 | |||
| 1032 | Ga0105239_10104841 | |||
| 1033 | Ga0105239_10995508 | |||
| 1034 | Ga0105246_10097222 | |||
| 1035 | Ga0105246_10308567 | |||
| 1036 | Ga0157369_10157590 | |||
| 1037 | Ga0157369_10384631 | |||
| 1038 | Ga0157374_11492460 | |||
| 1039 | Ga0157378_10004846 | |||
| 1040 | Ga0157378_10108728 | |||
| 1041 | Ga0157378_10483571 | |||
| 1042 | Ga0163162_10024382 | |||
| 1043 | Ga0163162_10321598 | |||
| 1044 | Ga0163162_11087229 | |||
| 1045 | Ga0157372_10660818 | |||
| 1046 | Ga0157375_10466697 | |||
| 1047 | Ga0157375_10494935 | |||
| 1048 | Ga0157375_10969190 | |||
| 1049 | Ga0157380_10055804 | |||
| 1050 | Ga0157377_10192101 | |||
| 1051 | Ga0157377_10597896 | |||
| 1052 | Ga0157376_10051157 | |||
| 1053 | Ga0157376_10579913 | |||
| 1054 | Ga0157376_12348533 | |||
| 1055 | Ga0197907_10840627 | |||
| 1056 | Ga0206356_10119050 | |||
| 1057 | Ga0206355_1329123 | |||
| 1058 | Ga0206351_10542297 | |||
| 1059 | Ga0206352_10112103 | |||
| 1060 | Ga0206350_11511940 | |||
| 1061 | Ga0206354_10468283 | |||
| 1062 | Ga0206354_10793986 | |||
| 1063 | Ga0206354_10873226 | |||
| 1064 | Ga0206353_11603916 | |||
| 1065 | Ga0154015_1056028 | |||
| 1066 | Ga0213872_10407819 | |||
| 1067 | Ga0224712_10000485 | |||
| 1068 | Ga0207713_1039401 | |||
| 1069 | Ga0207653_10000100 | |||
| 1070 | Ga0207692_10042504 | |||
| 1071 | Ga0207642_10017387 | |||
| 1072 | Ga0207647_10169643 | |||
| 1073 | Ga0207643_10000324 | |||
| 1074 | Ga0207684_10000233 | |||
| 1075 | Ga0207684_10052564 | |||
| 1076 | Ga0207684_10088419 | |||
| 1077 | Ga0207684_10628783 | |||
| 1078 | Ga0207684_11144264 | |||
| 1079 | Ga0207654_10398716 | |||
| 1080 | Ga0207707_10102836 | |||
| 1081 | Ga0207707_10126679 | |||
| 1082 | Ga0207707_10179236 | |||
| 1083 | Ga0207695_10585755 | |||
| 1084 | Ga0207693_10219627 | |||
| 1085 | Ga0207693_10440821 | |||
| 1086 | Ga0207660_10249354 | |||
| 1087 | Ga0207660_10315439 | |||
| 1088 | Ga0207657_10308712 | |||
| 1089 | Ga0207649_10006443 | |||
| 1090 | Ga0207652_10019006 | |||
| 1091 | Ga0207652_10064827 | |||
| 1092 | Ga0207646_10005209 | |||
| 1093 | Ga0207646_10082582 | |||
| 1094 | Ga0207646_10101490 | |||
| 1095 | Ga0207694_10213442 | |||
| 1096 | Ga0207659_10024617 | |||
| 1097 | Ga0207687_10053312 | |||
| 1098 | Ga0207687_10569411 | |||
| 1099 | Ga0207664_10155117 | |||
| 1100 | Ga0207664_10283520 | |||
| 1101 | Ga0207690_10858567 | |||
| 1102 | Ga0207706_10052314 | |||
| 1103 | Ga0207706_10356467 | |||
| 1104 | Ga0207706_10400141 | |||
| 1105 | Ga0207686_10013008 | |||
| 1106 | Ga0207709_10023965 | |||
| 1107 | Ga0207709_10054993 | |||
| 1108 | Ga0207669_10090376 | |||
| 1109 | Ga0207665_10197506 | |||
| 1110 | Ga0207665_10414576 | |||
| 1111 | Ga0207661_10397351 | |||
| 1112 | Ga0207679_10854435 | |||
| 1113 | Ga0207712_10141185 | |||
| 1114 | Ga0207712_10241157 | |||
| 1115 | Ga0207712_11343581 | |||
| 1116 | Ga0207668_10214368 | |||
| 1117 | Ga0207668_10323322 | |||
| 1118 | Ga0207677_10425052 | |||
| 1119 | Ga0207677_11106454 | |||
| 1120 | Ga0207677_11283640 | |||
| 1121 | Ga0207708_10524684 | |||
| 1122 | Ga0207702_10078687 | |||
| 1123 | Ga0207702_10407976 | |||
| 1124 | Ga0207641_10164982 | |||
| 1125 | Ga0207641_10330979 | |||
| 1126 | Ga0207641_11231645 | |||
| 1127 | Ga0207676_10002670 | |||
| 1128 | Ga0207674_10136544 | |||
| 1129 | Ga0207675_100006050 | |||
| 1130 | Ga0207675_100009258 | |||
| 1131 | Ga0207675_100147726 | |||
| 1132 | Ga0207428_10001500 | |||
| 1133 | Ga0207428_10001517 | |||
| 1134 | Ga0207428_10005123 | |||
| 1135 | Ga0207428_10012696 | |||
| 1136 | Ga0207428_10038369 | |||
| 1137 | Ga0268266_10262264 | |||
| 1138 | Ga0268265_10145505 | |||
| 1139 | Ga0268264_10237489 | |||
| 1140 | Ga0265338_10110185 | |||
| 1141 | Ga0307512_10006934 | |||
| 1142 | Ga0265320_10011603 | |||
| 1143 | Ga0265340_10260490 | |||
| 1144 | Ga0265339_10025351 | |||
| 1145 | Ga0307408_100037465 | |||
| 1146 | Ga0307408_100214879 | |||
| 1147 | Ga0265313_10103821 | |||
| 1148 | Ga0307508_10502881 | |||
| 1149 | Ga0265314_10076053 | |||
| 1150 | Ga0265342_10033187 | |||
| 1151 | Ga0307405_10029958 | |||
| 1152 | Ga0307405_10036171 | |||
| 1153 | Ga0307405_10524780 | |||
| 1154 | Ga0307405_11105355 | |||
| 1155 | Ga0307413_10051992 | |||
| 1156 | Ga0307413_10053614 | |||
| 1157 | Ga0307413_10421686 | |||
| 1158 | Ga0307413_10564489 | |||
| 1159 | Ga0307410_10065320 | |||
| 1160 | Ga0307410_10086775 | |||
| 1161 | Ga0307406_10077218 | |||
| 1162 | Ga0307406_10088933 | |||
| 1163 | Ga0307407_10030392 | |||
| 1164 | Ga0307407_10073092 | |||
| 1165 | Ga0307407_11143445 | |||
| 1166 | Ga0307412_10081366 | |||
| 1167 | Ga0307412_10103253 | |||
| 1168 | Ga0307409_100045843 | |||
| 1169 | Ga0307409_100086368 | |||
| 1170 | Ga0307409_100636556 | |||
| 1171 | Ga0307416_100001353 | |||
| 1172 | Ga0307416_100013927 | |||
| 1173 | Ga0307416_100213375 | |||
| 1174 | Ga0307414_10081210 | |||
| 1175 | Ga0307414_10126997 | |||
| 1176 | Ga0307411_10048206 | |||
| 1177 | Ga0307411_10094931 | |||
| 1178 | Ga0307415_100023850 | |||
| 1179 | Ga0307415_100047225 | |||
| 1180 | Ga0307415_100237472 | |||
| 1181 | Ga0307415_100487348 | |||
| 1182 | Ga0307415_100731067 | |||
| 1183 | Ga0307415_100816841 | |||
| 1184 | Ga0307415_101297126 | |||
| 1185 | Ga0373958_0110391 | |||
| 1186 | Ga0373928_0102131 | |||
| 1187 | Ga0373929_0079050 | |||
| 1188 | Ga0373932_0004345 | |||
| 1189 | Ga0373936_0007773 | |||
| 1190 | Ga0373939_0003258 | |||
| 1191 | Ga0373945_0002205 | |||
| 1192 | Ga0373945_0064847 | |||
| 1193 | Ga0373953_0186736 | |||
| 1194 | Ga0373956_0044317 | |||
| 1195 | Ga0373960_0118600 | |||
| 1196 | Ga0373943_0000643 | |||
| 1197 | Ga0373946_0010131 | |||
| 1198 | Ga0373946_0050570 | |||
| 1199 | Ga0373955_0002200 | |||
| 1200 | Ga0373924_0101450 | |||
| 1201 | Ga0373924_0262390 | |||
| 1202 | Ga0373931_0034199 | |||
| 1203 | Ga0373931_0296375 | |||
| 1204 | Ga0373935_0493245 | |||
| 1205 | Ga0373927_0042746 | |||
| 1206 | Ga0373933_0024950 | |||
| 1207 | Ga0373947_0026510 | |||
| 1208 | Ga0373947_0038831 | |||
| 1209 | Ga0373947_0056413 | |||
| 1210 | Ga0373947_0383218 | |||
| 1211 | Ga0373937_0022593 | |||
| 1212 | Ga0373937_0403879 | |||
| 1213 | Ga0373925_0003808 | |||
| 1214 | Ga0373925_0026030 | |||
| 1215 | Ga0373925_0220387 | |||
| 1216 | Ga0395899_0231610 | |||
| 1217 | Ga0395899_0261623 | |||
| 1218 | Ga0395899_0331024 | |||
| 1219 | Ga0395899_0597454 | |||
| 1220 | Ga0395900_0008417 | |||
| 1221 | Ga0395900_0041450 | |||
| 1222 | Ga0395900_0075812 | |||
| 1223 | Ga0395900_0088410 | |||
| 1224 | Ga0395900_0268293 | |||
| 1225 | Ga0395898_0035735 | |||
| 1226 | Ga0395898_0075480 | |||
| 1227 | Ga0395898_0296412 | |||
| 1228 | Ga0395898_0402349 | |||
| 1229 | Ga0395898_0571874 | |||
| 1230 | Ga0395905_0029050 | |||
| 1231 | Ga0395905_0068431 | |||
| 1232 | Ga0395905_0069420 | |||
| 1233 | Ga0395905_0340753 | |||
| 1234 | Ga0395905_0525861 | |||
| 1235 | Ga0436364_0073490 | |||
| 1236 | Ga0436364_0359023 | |||
| 1237 | Ga0395901_0034263 | |||
| 1238 | Ga0395901_0043793 | |||
| 1239 | Ga0395901_0044881 | |||
| 1240 | Ga0395901_0051346 | |||
| 1241 | Ga0395901_0375113 | |||
| 1242 | Ga0395901_0451227 | |||
| 1243 | Ga0436360_1133702 | |||
| 1244 | Ga0436360_1309648 | |||
| 1245 | Ga0436361_0127857 | |||
| 1246 | Ga0436361_0449584 | |||
| 1247 | Ga0436363_0542485 | |||
| 1248 | Ga0436362_0763626 | |||
| 1249 | Ga0439439_0153248 | |||
| 1250 | Ga0439465_0355509 | |||
| 1251 | Ga0439443_010419 | |||
| 1252 | Ga0439448_0002814 | |||
| 1253 | Ga0439448_0077051 | |||
| 1254 | Ga0439450_003685 | |||
| 1255 | Ga0439450_016749 | |||
| 1256 | Ga0439454_002643 | |||
| 1257 | Ga0439455_0054951 | |||
| 1258 | Ga0439455_0057795 | |||
| 1259 | Ga0439455_0078654 | |||
| 1260 | Ga0439463_002574 | |||
| 1261 | Ga0439463_030794 | |||
| 1262 | Ga0439463_156231 | |||
| 1263 | Ga0450913_003029 | |||
| 1264 | Ga0450914_001143 | |||
| 1265 | Ga0450900_028683 | |||
| 1266 | Ga0450902_055281 | |||
| 1267 | Ga0450905_005746 | |||
| 1268 | Ga0450889_002295 | |||
| 1269 | Ga0450907_035672 | |||
| 1270 | Ga0439458_0020453 | |||
| 1271 | Ga0439458_0111559 | |||
| 1272 | Ga0439444_0018811 | |||
| 1273 | Ga0439464_0009095 | |||
| 1274 | Ga0439464_0020792 | |||
| 1275 | Ga0439464_0030414 | |||
| 1276 | Ga0439460_0005555 | |||
| 1277 | Ga0439460_0212443 | |||
| 1278 | Ga0450916_001104 | |||
| 1279 | Ga0439440_0000534 | |||
| 1280 | Ga0466965_0078991 | |||
| 1281 | Ga0466966_0000887 | |||
| 1282 | Ga0466963_0001640 | |||
| 1283 | Ga0466971_0128524 | |||
| 1284 | Ga0466957_0004157 | |||
| 1285 | Ga0466959_0031559 | |||
| 1286 | Ga0466959_0045582 | |||
| 1287 | Ga0451576_0458440 | |||
| 1288 | Ga0451576_1148599 | |||
| 1289 | Ga0466958_0002878 | |||
| 1290 | Ga0466958_0018928 | |||
| 1291 | Ga0466967_0189694 | |||
| 1292 | Ga0495617_058257 | |||
| 1293 | Ga0495592_0108039 | |||
| 1294 | Ga0495603_0001259 | |||
| 1295 | Ga0495603_0008959 | |||
| 1296 | Ga0495603_0035146 | |||
| 1297 | Ga0495591_029807 | |||
| 1298 | Ga0495629_0000580 | |||
| 1299 | Ga0495629_0683929 | |||
| 1300 | Ga0495651_0011640 | |||
| 1301 | Ga0495651_0014139 | |||
| 1302 | Ga0495651_0020821 | |||
| 1303 | Ga0495653_0112248 | |||
| 1304 | Ga0495653_0127480 | |||
| 1305 | Ga0495580_0069647 | |||
| 1306 | Ga0495580_0594614 | |||
| 1307 | Ga0495580_0675090 | |||
| 1308 | Ga0495639_0021086 | |||
| 1309 | Ga0495639_0035204 | |||
| 1310 | Ga0495662_0029215 | |||
| 1311 | Ga0495664_0009359 | |||
| 1312 | Ga0495664_0719584 | |||
| 1313 | Ga0495584_0039919 | |||
| 1314 | Ga0495585_0140132 | |||
| 1315 | Ga0495594_0143819 | |||
| 1316 | Ga0495596_0063753 | |||
| 1317 | Ga0495607_0042969 | |||
| 1318 | Ga0495607_0187540 | |||
| 1319 | Ga0495608_0007465 | |||
| 1320 | Ga0495608_0071498 | |||
| 1321 | Ga0495618_0035202 | |||
| 1322 | Ga0495618_0068801 | |||
| 1323 | Ga0495628_0006341 | |||
| 1324 | Ga0495628_0116386 | |||
| 1325 | Ga0495630_0023860 | |||
| 1326 | Ga0495630_0030667 | |||
| 1327 | Ga0495632_0341613 | |||
| 1328 | Ga0495644_0183985 | |||
| 1329 | Ga0495642_0044015 | |||
| 1330 | Ga0495652_0010636 | |||
| 1331 | Ga0495652_0162456 | |||
| 1332 | Ga0495665_0009317 | |||
| 1333 | Ga0495665_0037306 | |||
| 1334 | Ga0495586_0084859 | |||
| 1335 | Ga0495587_0007478 | |||
| 1336 | Ga0495598_0011137 | |||
| 1337 | Ga0495598_0063483 | |||
| 1338 | Ga0495598_0273797 | |||
| 1339 | Ga0495621_0224260 | |||
| 1340 | Ga0495597_0278616 | |||
| 1341 | Ga0495645_0013507 | |||
| 1342 | Ga0495622_0080030 | |||
| 1343 | Ga0495633_0146153 | |||
| 1344 | Ga0495667_0008462 | |||
| 1345 | Ga0495656_0049735 | |||
| 1346 | Ga0495656_0179585 | |||
| 1347 | Ga0495668_0237191 | |||
| 1348 | Ga0495634_0023976 | |||
| 1349 | Ga0495611_0094623 | |||
| 1350 | Ga0495635_0012376 | |||
| 1351 | Ga0495659_0104043 | |||
| 1352 | Ga0495661_0083231 | |||
| 1353 | Ga0495588_0030193 | |||
| 1354 | Ga0495657_0263230 | |||
| 1355 | Ga0495657_0356890 | |||
| 1356 | Ga0495599_0000701 | |||
| 1357 | Ga0495599_0215775 | |||
| 1358 | Ga0495623_0124701 | |||
| 1359 | Ga0495646_0125975 | |||
| 1360 | Ga0495647_0157144 | |||
| 1361 | Ga0495658_0002558 | |||
| 1362 | Ga0495658_0104906 | |||
| 1363 | Ga0495658_0132857 | |||
| 1364 | Ga0495658_0147978 | |||
| 1365 | Ga0495669_0026448 | |||
| 1366 | Ga0495669_0249083 | |||
| 1367 | Ga0495669_0257890 | |||
| 1368 | Ga0495613_0003552 | |||
| 1369 | Ga0495613_0045182 | |||
| 1370 | Ga0495613_0797407 | |||
| 1371 | Ga0495613_0975691 | |||
| 1372 | Ga0495624_0032469 | |||
| 1373 | Ga0495624_0154926 | |||
| 1374 | Ga0495624_0420610 | |||
| 1375 | Ga0495670_0012604 | |||
| 1376 | Ga0495670_0260318 | |||
| 1377 | Ga0495589_0046540 | |||
| 1378 | Ga0495589_0470802 | |||
| 1379 | Ga0495600_0035151 | |||
| 1380 | Ga0495660_0070685 | |||
| 1381 | Ga0495581_0004654 | |||
| 1382 | Ga0495581_0006655 | |||
| 1383 | Ga0495636_0092017 | |||
| 1384 | Ga0495674_0011087 | |||
| 1385 | Ga0495674_0599051 | |||
| 1386 | Ga0495676_0068338 | |||
| 1387 | Ga0495680_0004959 | |||
| 1388 | Ga0495680_0015445 | |||
| 1389 | Ga0495683_0342174 | |||
| 1390 | Ga0495675_0022963 | |||
| 1391 | Ga0495677_0151259 | |||
| 1392 | Ga0495679_034151 | |||
| 1393 | Ga0495684_0002173 | |||
| 1394 | Ga0495684_0022862 | |||
| 1395 | Ga0495593_0035302 | |||
| 1396 | Ga0495602_0153291 | |||
| 1397 | Ga0495602_0216608 | |||
| 1398 | Ga0495602_0273731 | |||
| 1399 | Ga0495614_0063362 | |||
| 1400 | Ga0495614_0206049 | |||
| 1401 | Ga0496100_0012047 | |||
| 1402 | Ga0496100_0018163 | |||
| 1403 | Ga0496105_0118280 | |||
| 1404 | Ga0496106_0010334 | |||
| 1405 | Ga0496107_0014287 | |||
| 1406 | Ga0496108_0026709 | |||
| 1407 | Ga0496108_0319199 | |||
| 1408 | Ga0496109_0029507 | |||
| 1409 | Ga0496109_0203327 | |||
| 1410 | Ga0496110_0008928 | |||
| 1411 | Ga0496110_0031513 | |||
| 1412 | Ga0496110_0101045 | |||
| 1413 | Ga0496110_0338324 | |||
| 1414 | Ga0496110_0645430 | |||
| 1415 | Ga0496111_0000396 | |||
| 1416 | Ga0496112_0101490 | |||
| 1417 | Ga0496112_0270757 | |||
| 1418 | Ga0496113_0299615 | |||
| 1419 | Ga0496113_0669676 | |||
| 1420 | Ga0496114_0228935 | |||
| 1421 | Ga0496114_0600255 | |||
| 1422 | Ga0496114_0732825 | |||
| 1423 | Ga0496115_0220294 | |||
| 1424 | Ga0501031_0030814 | |||
| 1425 | Ga0501031_0385698 | |||
| 1426 | Ga0501032_0295392 | |||
| 1427 | Ga0501033_0012342 | |||
| 1428 | Ga0501033_0035041 | |||
| 1429 | Ga0501033_0089341 | |||
| 1430 | Ga0501036_0004978 | |||
| 1431 | Ga0501036_0029664 | |||
| 1432 | Ga0501036_0064669 | |||
| 1433 | Ga0501036_0075164 | |||
| 1434 | Ga0501036_1191057 | |||
| 1435 | Ga0501037_0029314 | |||
| 1436 | Ga0501037_0126498 | |||
| 1437 | Ga0501037_0151568 | |||
| 1438 | Ga0501038_0007864 | |||
| 1439 | Ga0501038_0009086 | |||
| 1440 | Ga0501038_0061396 | |||
| 1441 | Ga0501038_0299672 | |||
| 1442 | Ga0501038_0359614 | |||
| 1443 | Ga0501039_0004611 | |||
| 1444 | Ga0501039_0004615 | |||
| 1445 | Ga0501039_0093223 | |||
| 1446 | Ga0501039_0119675 | |||
| 1447 | Ga0501039_0152114 | |||
| 1448 | Ga0501039_0455240 | |||
| 1449 | Ga0501039_0524532 | |||
| 1450 | Ga0501040_0002408 | |||
| 1451 | Ga0501040_0003475 | |||
| 1452 | Ga0501040_0014580 | |||
| 1453 | Ga0501040_0020342 | |||
| 1454 | Ga0501040_0128177 | |||
| 1455 | Ga0501040_0134761 | |||
| 1456 | Ga0501040_0205795 | |||
| 1457 | Ga0501041_0000041 | |||
| 1458 | Ga0501041_0002431 | |||
| 1459 | Ga0501041_0025935 | |||
| 1460 | Ga0501041_0139834 | |||
| 1461 | Ga0501041_0222032 | |||
| 1462 | Ga0501042_0002936 | |||
| 1463 | Ga0501042_0004188 | |||
| 1464 | Ga0501042_0005831 | |||
| 1465 | Ga0501042_0006075 | |||
| 1466 | Ga0501042_0009128 | |||
| 1467 | Ga0501042_0035806 | |||
| 1468 | Ga0501042_0082544 | |||
| 1469 | Ga0501042_0219295 | |||
| 1470 | Ga0501042_0289589 | |||
| 1471 | Ga0501043_0016315 | |||
| 1472 | Ga0501043_0039869 | |||
| 1473 | Ga0501043_0056235 | |||
| 1474 | Ga0501043_0318852 | |||
| 1475 | Ga0501043_0408536 | |||
| 1476 | Ga0501046_0010306 | |||
| 1477 | Ga0501046_0012266 | |||
| 1478 | Ga0501046_0245807 | |||
| 1479 | Ga0501046_0334092 | |||
| 1480 | Ga0501048_0000970 | |||
| 1481 | Ga0501048_0001880 | |||
| 1482 | Ga0501048_0031845 | |||
| 1483 | Ga0501048_0079870 | |||
| 1484 | Ga0501048_0081482 | |||
| 1485 | Ga0501048_0192473 | |||
| 1486 | Ga0501048_0919693 | |||
| 1487 | Ga0501067_0005433 | |||
| 1488 | Ga0501068_0010287 | |||
| 1489 | Ga0501068_0016757 | |||
| 1490 | Ga0501068_0096740 | |||
| 1491 | Ga0501068_0336348 | |||
| 1492 | Ga0501068_0410227 | |||
| 1493 | Ga0501069_0004219 | |||
| 1494 | Ga0501070_0096049 | |||
| 1495 | Ga0501070_0181522 | |||
| 1496 | Ga0501070_0366222 | |||
| 1497 | Ga0501070_0503659 | |||
| 1498 | Ga0501070_0511243 | |||
| 1499 | Ga0501070_0773149 | |||
| 1500 | Ga0501071_0004087 | |||
| 1501 | Ga0501071_0024748 | |||
| 1502 | Ga0501071_0028914 | |||
| 1503 | Ga0501071_0035558 | |||
| 1504 | Ga0501071_0073865 | |||
| 1505 | Ga0501071_0096950 | |||
| 1506 | Ga0501071_0155395 | |||
| 1507 | Ga0501071_0400803 | |||
| 1508 | Ga0501072_0005064 | |||
| 1509 | Ga0501072_0007049 | |||
| 1510 | Ga0501072_0014483 | |||
| 1511 | Ga0501072_0022112 | |||
| 1512 | Ga0501072_0033667 | |||
| 1513 | Ga0501072_0048230 | |||
| 1514 | Ga0501072_0087768 | |||
| 1515 | Ga0501072_0978910 | |||
| 1516 | Ga0501072_1396079 | |||
| 1517 | Ga0501073_0607031 | |||
| 1518 | Ga0501074_0008216 | |||
| 1519 | Ga0501074_0008920 | |||
| 1520 | Ga0501074_0016656 | |||
| 1521 | Ga0501074_0026814 | |||
| 1522 | Ga0501074_0086611 | |||
| 1523 | Ga0501074_0086945 | |||
| 1524 | Ga0501074_0087452 | |||
| 1525 | Ga0501074_0158128 | |||
| 1526 | Ga0501074_0490876 | |||
| 1527 | Ga0501074_0753410 | |||
| 1528 | Ga0501074_0778041 | |||
| 1529 | Ga0501075_0000384 | |||
| 1530 | Ga0501075_0027098 | |||
| 1531 | Ga0501075_0046131 | |||
| 1532 | Ga0501075_0053417 | |||
| 1533 | Ga0501075_0064727 | |||
| 1534 | Ga0501075_0103696 | |||
| 1535 | Ga0501075_0140374 | |||
| 1536 | Ga0501076_0000373 | |||
| 1537 | Ga0501076_0002165 | |||
| 1538 | Ga0501076_0002705 | |||
| 1539 | Ga0501076_0008115 | |||
| 1540 | Ga0501076_0113051 | |||
| 1541 | Ga0501076_0161658 | |||
| 1542 | Ga0501076_0415235 | |||
| 1543 | Ga0501076_1032087 | |||
| 1544 | Ga0501077_0002637 | |||
| 1545 | Ga0501077_0017728 | |||
| 1546 | Ga0501077_0044547 | |||
| 1547 | Ga0501077_0074060 | |||
| 1548 | Ga0501077_0155359 | |||
| 1549 | Ga0501077_0309969 | |||
| 1550 | Ga0501217_140144 | |||
| 1551 | Ga0501079_0003332 | |||
| 1552 | Ga0501079_0014627 | |||
| 1553 | Ga0501079_0049887 | |||
| 1554 | Ga0501079_0111940 | |||
| 1555 | Ga0501079_0166886 | |||
| 1556 | Ga0501079_0192609 | |||
| 1557 | Ga0501079_0194323 | |||
| 1558 | Ga0501079_0318090 | |||
| 1559 | Ga0501079_1008851 | |||
| 1560 | Ga0501080_0021407 | |||
| 1561 | Ga0501080_0067392 | |||
| 1562 | Ga0501080_0591036 | |||
| 1563 | Ga0501081_0002206 | |||
| 1564 | Ga0501081_0004682 | |||
| 1565 | Ga0501081_0040461 | |||
| 1566 | Ga0501081_0056000 | |||
| 1567 | Ga0501081_0251539 | |||
| 1568 | Ga0501081_1060195 | |||
| 1569 | Ga0501268_093110 | |||
| 1570 | Ga0501035_0031924 | |||
| 1571 | Ga0501035_0045881 | |||
| 1572 | Ga0501035_0250267 | |||
| 1573 | Ga0501045_0000460 | |||
| 1574 | Ga0501045_0002493 | |||
| 1575 | Ga0501045_0002574 | |||
| 1576 | Ga0501045_0006800 | |||
| 1577 | Ga0501045_0101314 | |||
| 1578 | Ga0501045_0200507 | |||
| 1579 | Ga0501045_1056320 | |||
| 1580 | nmdc:mga05p37_24412_c1 | |||
| 1581 | nmdc:mga05p37_46997_c1 | |||
| 1582 | nmdc:mga05p37_51199_c1 | |||
| 1583 | nmdc:mga05p37_5452_c1 | |||
| 1584 | nmdc:mga05p37_6613_c1 | |||
| 1585 | nmdc:mga05p37_85318_c1 | |||
| 1586 | nmdc:mga05p37_858521_c1 | |||
| 1587 | nmdc:mga09592_133977_c1 | |||
| 1588 | nmdc:mga09592_137719_c1 | |||
| 1589 | nmdc:mga09592_13980_c1 | |||
| 1590 | nmdc:mga0qj67_23075_c1 | |||
| 1591 | nmdc:mga0qj67_355803_c1 | |||
| 1592 | nmdc:mga0qj67_96750_c1 | |||
| 1593 | nmdc:mga06r32_12115_c1 | |||
| 1594 | nmdc:mga06r32_18282_c1 | |||
| 1595 | nmdc:mga06r32_296162_c1 | |||
| 1596 | nmdc:mga06r32_311631_c1 | |||
| 1597 | nmdc:mga08y16_11473_c1 | |||
| 1598 | nmdc:mga08y16_12137_c1 | |||
| 1599 | nmdc:mga08y16_380138_c1 | |||
| 1600 | nmdc:mga08y16_388109_c1 | |||
| 1601 | nmdc:mga08y16_712841_c1 | |||
| 1602 | nmdc:mga08y16_778850_c1 | |||
| 1603 | nmdc:mga0n895_228065_c1 | |||
| 1604 | nmdc:mga0n895_2298_c1 | |||
| 1605 | nmdc:mga0n895_328891_c1 | |||
| 1606 | nmdc:mga0n895_8340_c1 | |||
| 1607 | nmdc:mga0rr50_66004_c1 | |||
| 1608 | nmdc:mga0rr50_68882_c1 | |||
| 1609 | nmdc:mga08x19_312419_c1 | |||
| 1610 | nmdc:mga0a205_11872_c1 | |||
| 1611 | nmdc:mga0a205_25198_c1 | |||
| 1612 | nmdc:mga0a205_670554_c1 | |||
| 1613 | nmdc:mga0a205_80687_c1 | |||
| 1614 | nmdc:mga0a205_95358_c1 | |||
| 1615 | nmdc:mga0a205_9802_c1 | |||
| 1616 | Ga0495601_0001651 | |||
| 1617 | Ga0495601_0007552 | |||
| 1618 | Ga0495601_0454117 | |||
| 1619 | Ga0495612_0363178 | |||
| 1620 | Ga0495595_0189613 | |||
| 1621 | Ga0501084_0000697 | |||
| 1622 | Ga0501084_0000767 | |||
| 1623 | Ga0501084_0015598 | |||
| 1624 | Ga0501084_0069461 | |||
| 1625 | Ga0501084_0069832 | |||
| 1626 | Ga0501084_0086042 | |||
| 1627 | Ga0501084_0144316 | |||
| 1628 | Ga0501084_0263813 | |||
| 1629 | Ga0501084_1182167 | |||
| 1630 | Ga0590071_029381 | |||
| 1631 | Ga0590074_003848 | |||
| 1632 | Ga0590075_001038 | |||
| 1633 | Ga0590075_017998 | |||
| 1634 | Ga0590077_002509 | |||
| 1635 | Ga0590077_081702 | |||
| 1636 | Ga0587066_152548 | |||
| 1637 | Ga0587073_0007531 | |||
| 1638 | Ga0587073_0014020 | |||
| 1639 | Ga0587082_129959 | |||
| 1640 | Ga0587083_0061252 | |||
| 1641 | Ga0587086_040303 | |||
| 1642 | Ga0587089_005641 | |||
| 1643 | Ga0587094_121973 | |||
| 1644 | Ga0587115_022488 | |||
| 1645 | Ga0587117_000258 | |||
| 1646 | Ga0587072_002001 | |||
| 1647 | Ga0587072_033152 | |||
| 1648 | Ga0587075_003990 | |||
| 1649 | Ga0587078_024720 | |||
| 1650 | Ga0587079_021625 | |||
| 1651 | Ga0587079_038773 | |||
| 1652 | Ga0587102_006889 | |||
| 1653 | Ga0587071_026839 | |||
| 1654 | Ga0587111_0004880 | |||
| 1655 | Ga0501082_0008656 | |||
| 1656 | Ga0501082_0011849 | |||
| 1657 | Ga0501082_0020961 | |||
| 1658 | Ga0501082_0025852 | |||
| 1659 | Ga0501082_0052080 | |||
| 1660 | Ga0501082_0069429 | |||
| 1661 | Ga0501082_0072105 | |||
| 1662 | Ga0501082_1020004 | |||
| 1663 | Ga0466962_0005013 | |||
| 1664 | Ga0530510_0001371 | |||
| 1665 | Ga0530510_0006802 | |||
| 1666 | Ga0530510_0022544 | |||
| 1667 | Ga0530510_0022753 | |||
| 1668 | Ga0530510_0179366 | |||
| 1669 | Ga0530510_0187613 | |||
| 1670 | Ga0530510_0217904 | |||
| 1671 | Ga0530510_0224381 | |||
| 1672 | Ga0530510_0411214 | |||
| 1673 | Ga0530510_0589611 | |||
| 1674 | Ga0530510_0938492 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9598 | 1 | 153 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9586 | 1 | 154 |
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9562 | 2 | 152 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9562 | 1 | 153 |
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.9449 | 1 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9641 | 1 | 75 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.958 | 1 | 75 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9538 | 1 | 73 | 3.10.20.30 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9477 | 1 | 75 | 3.10.20.30 |
| 3hrdH01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9471 | 1 | 75 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5ZLB2-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9741 | 1 | 158 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1E3RY14-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9736 | 1 | 156 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1T5A9Z4-F1-model_v4 | Carbon-monoxide dehydrogenase small subunit | 0.9736 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-G7CHX0-F1-model_v4 | Carbon monoxide dehydrogenase (Small chain), CoxS | 0.9733 | 1 | 154 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A3D3YT62-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9732 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |