F482956

General Info

Members Datasets Scaffolds Average Seq Length
837 377 1674 167

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0070241|Ga0496104_0070241_322_912
Length 196
Sequence MDITVKVNGADHSADVEPRQLLVHVIREEFGLTGTHIGCDTTSCGACTVLLDGTPVKSCTVFGVQADGREVTTVEGLITADGLDPIQEGFKEEHGLQCGFCTPGMMLVGKHLLDANPNPSEDDIRWAISGNICRCTGYMNIVKAIQWAASKQAGNGHEDSPVSPDSTADESGLGPEESVPASEIADEGVATAAPSE

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
206 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
209 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
210 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
211 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
212 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
213 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
214 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
215 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.94
Metatranscriptomes 4.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 2.87
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0070241 3300048907 Bacteria 3329
2 JGI24747J21853_1002432 3300001978 Bacteria 1519
3 JGI24033J26618_1003772 3300002155 Bacteria 1611
4 JGI24751J29686_10000457 3300002459 Bacteria 12295
5 JGI24751J29686_10028600 3300002459 Bacteria 1157
6 JGI25407J50210_10000849 3300003373 Bacteria 6579
7 JGI25407J50210_10082127 3300003373 Unclassified 800
8 JGI25407J50210_10094491 3300003373 Bacteria 740
9 JGI25405J52794_10032067 3300003911 Bacteria 1093
10 Ga0058863_11807083 3300004799 Bacteria 7922
11 Ga0058861_11793184 3300004800 Bacteria 6928
12 Ga0058862_12887376 3300004803 Bacteria 6889
13 Ga0070682_100196733 3300005337 Bacteria 1419
14 Ga0070682_100557448 3300005337 Bacteria 898
15 Ga0068868_100284494 3300005338 Bacteria 1400
16 Ga0070689_100343057 3300005340 Bacteria 1251
17 Ga0070661_100003993 3300005344 Bacteria 10144
18 Ga0070692_10248242 3300005345 Bacteria 1064
19 Ga0070668_100128237 3300005347 Bacteria 2034
20 Ga0070675_100042835 3300005354 Bacteria 3699
21 Ga0070674_100173063 3300005356 Bacteria 1648
22 Ga0070659_100243453 3300005366 Bacteria 1489
23 Ga0070703_10000022 3300005406 Bacteria 74865
24 Ga0070703_10008580 3300005406 Bacteria 2874
25 Ga0070714_100103125 3300005435 Bacteria 2516
26 Ga0070714_100140117 3300005435 Bacteria 2170
27 Ga0070714_100321392 3300005435 Bacteria 1447
28 Ga0070713_100173023 3300005436 Bacteria 1935
29 Ga0070711_100237199 3300005439 Bacteria 1424
30 Ga0070711_100262735 3300005439 Bacteria 1359
31 Ga0070705_100149652 3300005440 Bacteria 1547
32 Ga0070700_100182801 3300005441 Bacteria 1460
33 Ga0070700_100927990 3300005441 Bacteria 711
34 Ga0070694_100168279 3300005444 Bacteria 1613
35 Ga0070708_100002785 3300005445 Bacteria 13585
36 Ga0070708_100016862 3300005445 Bacteria 6073
37 Ga0070663_100785859 3300005455 Bacteria 815
38 Ga0070662_100087120 3300005457 Bacteria 2337
39 Ga0070681_10025796 3300005458 Bacteria 5909
40 Ga0070681_10035343 3300005458 Bacteria 5020
41 Ga0068867_100460891 3300005459 Bacteria 1085
42 Ga0070685_10403401 3300005466 Bacteria 947
43 Ga0070706_100000241 3300005467 Bacteria 66502
44 Ga0070706_100100976 3300005467 Bacteria 2681
45 Ga0070706_100878448 3300005467 Bacteria 828
46 Ga0070707_100000716 3300005468 Bacteria 33128
47 Ga0070707_100006806 3300005468 Bacteria 10584
48 Ga0070707_100025164 3300005468 Bacteria 5644
49 Ga0070707_100048473 3300005468 Bacteria 4069
50 Ga0070707_100603482 3300005468 Bacteria 1060
51 Ga0070707_100661830 3300005468 Bacteria 1007
52 Ga0070698_100006512 3300005471 Bacteria 12662
53 Ga0070698_100020152 3300005471 Bacteria 6992
54 Ga0070698_100025887 3300005471 Bacteria 6113
55 Ga0070698_100090234 3300005471 Bacteria 3048
56 Ga0070698_100499143 3300005471 Bacteria 1155
57 Ga0070698_100753790 3300005471 Bacteria 917
58 Ga0070699_100008694 3300005518 Bacteria 8803
59 Ga0070699_100070465 3300005518 Bacteria 3039
60 Ga0070699_100112674 3300005518 Bacteria 2389
61 Ga0070699_100220136 3300005518 Bacteria 1691
62 Ga0070699_100319316 3300005518 Bacteria 1395
63 Ga0070679_100015909 3300005530 Bacteria 7241
64 Ga0070679_100053141 3300005530 Bacteria 4033
65 Ga0070679_100145275 3300005530 Bacteria 2350
66 Ga0070684_100238361 3300005535 Bacteria 1661
67 Ga0070684_100714698 3300005535 Bacteria 934
68 Ga0070697_100006818 3300005536 Bacteria 8863
69 Ga0070697_100012515 3300005536 Bacteria 6647
70 Ga0070697_100622113 3300005536 Bacteria 950
71 Ga0070697_100864316 3300005536 Bacteria 801
72 Ga0070697_101205931 3300005536 Bacteria 674
73 Ga0068853_100630473 3300005539 Bacteria 1019
74 Ga0070695_100002478 3300005545 Bacteria 10625
75 Ga0070695_100940761 3300005545 Bacteria 700
76 Ga0070696_100085324 3300005546 Bacteria 2241
77 Ga0070696_100317216 3300005546 Bacteria 1198
78 Ga0070693_100095968 3300005547 Bacteria 1796
79 Ga0070665_100641466 3300005548 Bacteria 1075
80 Ga0070704_100009955 3300005549 Bacteria 5772
81 Ga0070704_100074814 3300005549 Bacteria 2472
82 Ga0070704_100419373 3300005549 Bacteria 1146
83 Ga0070704_100630727 3300005549 Bacteria 944
84 Ga0070704_101429876 3300005549 Bacteria 635
85 Ga0070664_100008664 3300005564 Bacteria 8232
86 Ga0068857_100256286 3300005577 Bacteria 1605
87 Ga0068857_101084055 3300005577 Bacteria 773
88 Ga0068856_100177497 3300005614 Bacteria 2142
89 Ga0068856_100275727 3300005614 Bacteria 1698
90 Ga0068852_100488780 3300005616 Bacteria 1224
91 Ga0068864_100265971 3300005618 Bacteria 1596
92 Ga0068866_10008147 3300005718 Bacteria 4404
93 Ga0068861_100040578 3300005719 Bacteria 3482
94 Ga0068861_100041374 3300005719 Bacteria 3451
95 Ga0068870_10003358 3300005840 Bacteria 6771
96 Ga0068863_100009118 3300005841 Bacteria 9689
97 Ga0068860_100179082 3300005843 Bacteria 2049
98 Ga0068862_100513914 3300005844 Bacteria 1139
99 Ga0081455_10001540 3300005937 Bacteria 28386
100 Ga0081455_10002895 3300005937 Bacteria 20154
101 Ga0081455_10006642 3300005937 Bacteria 12367
102 Ga0081455_10009966 3300005937 Bacteria 9715
103 Ga0081455_10013853 3300005937 Bacteria 7930
104 Ga0081455_10024165 3300005937 Bacteria 5636
105 Ga0081455_10033633 3300005937 Bacteria 4605
106 Ga0081455_10043463 3300005937 Bacteria 3929
107 Ga0081455_10045759 3300005937 Bacteria 3804
108 Ga0081455_10079785 3300005937 Bacteria 2686
109 Ga0081455_10154523 3300005937 Bacteria 1766
110 Ga0081538_10000029 3300005981 Bacteria 124335
111 Ga0081538_10000081 3300005981 Bacteria 92176
112 Ga0081538_10001550 3300005981 Bacteria 23554
113 Ga0081538_10010634 3300005981 Bacteria 7532
114 Ga0081538_10021468 3300005981 Bacteria 4713
115 Ga0081538_10026643 3300005981 Bacteria 4036
116 Ga0081538_10040972 3300005981 Bacteria 2946
117 Ga0081538_10104128 3300005981 Bacteria 1417
118 Ga0081538_10248137 3300005981 Bacteria 681
119 Ga0081540_1036192 3300005983 Bacteria 2636
120 Ga0081540_1085775 3300005983 Bacteria 1401
121 Ga0081539_10020154 3300005985 Bacteria 4525
122 Ga0081539_10106999 3300005985 Bacteria 1415
123 Ga0081539_10107172 3300005985 Bacteria 1413
124 Ga0075365_10302581 3300006038 Bacteria 1125
125 Ga0075432_10005230 3300006058 Bacteria 4419
126 Ga0075432_10005810 3300006058 Bacteria 4197
127 Ga0075432_10006804 3300006058 Bacteria 3893
128 Ga0075432_10050530 3300006058 Bacteria 1467
129 Ga0070715_10024725 3300006163 Bacteria 2371
130 Ga0070716_100100702 3300006173 Bacteria 1770
131 Ga0070712_100047023 3300006175 Bacteria 2985
132 Ga0070712_100098603 3300006175 Bacteria 2155
133 Ga0070712_100104226 3300006175 Bacteria 2104
134 Ga0070712_100545327 3300006175 Bacteria 977
135 Ga0075427_10001460 3300006194 Bacteria 3036
136 Ga0068871_100061592 3300006358 Bacteria 3065
137 Ga0075428_100054760 3300006844 Bacteria 4371
138 Ga0075428_100080275 3300006844 Bacteria 3560
139 Ga0075428_100152719 3300006844 Bacteria 2508
140 Ga0075428_101371073 3300006844 Bacteria 743
141 Ga0075430_100010728 3300006846 Bacteria 7766
142 Ga0075430_100024076 3300006846 Bacteria 5184
143 Ga0075431_100072293 3300006847 Bacteria 3559
144 Ga0075431_100282629 3300006847 Bacteria 1680
145 Ga0075431_100297074 3300006847 Bacteria 1632
146 Ga0075433_10006437 3300006852 Bacteria 9284
147 Ga0075433_10054894 3300006852 Bacteria 3476
148 Ga0075433_10062721 3300006852 Bacteria 3255
149 Ga0075433_10089403 3300006852 Bacteria 2722
150 Ga0075434_100002195 3300006871 Bacteria 17003
151 Ga0075434_100034163 3300006871 Bacteria 5021
152 Ga0075434_100134389 3300006871 Bacteria 2493
153 Ga0075434_100224148 3300006871 Bacteria 1900
154 Ga0075429_100017798 3300006880 Bacteria 6146
155 Ga0075429_100058147 3300006880 Bacteria 3367
156 Ga0075429_100065206 3300006880 Bacteria 3171
157 Ga0075429_100104432 3300006880 Bacteria 2475
158 Ga0075429_100452820 3300006880 Bacteria 1125
159 Ga0075436_100027135 3300006914 Bacteria 3942
160 Ga0075435_100039856 3300007076 Bacteria 3749
161 Ga0105251_10027591 3300009011 Bacteria 2877
162 Ga0105240_10401020 3300009093 Bacteria 1545
163 Ga0111539_10005444 3300009094 Bacteria 16467
164 Ga0111539_10031086 3300009094 Bacteria 6488
165 Ga0111539_10086306 3300009094 Bacteria 3688
166 Ga0111539_10136404 3300009094 Bacteria 2874
167 Ga0111539_10309917 3300009094 Bacteria 1837
168 Ga0111539_10416227 3300009094 Bacteria 1565
169 Ga0111539_10491105 3300009094 Bacteria 1430
170 Ga0111539_10496156 3300009094 Bacteria 1422
171 Ga0105245_10003018 3300009098 Bacteria 15096
172 Ga0105245_10053328 3300009098 Bacteria 3629
173 Ga0105245_10104318 3300009098 Bacteria 2628
174 Ga0105245_10740934 3300009098 Bacteria 1018
175 Ga0114129_10015822 3300009147 Bacteria 10726
176 Ga0114129_10023903 3300009147 Bacteria 8660
177 Ga0114129_10233986 3300009147 Bacteria 2473
178 Ga0114129_10363850 3300009147 Bacteria 1913
179 Ga0114129_10653817 3300009147 Bacteria 1356
180 Ga0114129_10698080 3300009147 Bacteria 1304
181 Ga0114129_11696130 3300009147 Bacteria 771
182 Ga0105243_10007194 3300009148 Bacteria 8553
183 Ga0105243_10007215 3300009148 Bacteria 8539
184 Ga0105241_10281858 3300009174 Bacteria 1420
185 Ga0105242_10004298 3300009176 Bacteria 11100
186 Ga0105242_10080853 3300009176 Bacteria 2716
187 Ga0105242_10503446 3300009176 Bacteria 1152
188 Ga0105237_10868258 3300009545 Bacteria 909
189 Ga0105237_11943491 3300009545 Bacteria 597
190 Ga0105238_10021845 3300009551 Bacteria 6519
191 Ga0105249_10004045 3300009553 Bacteria 12645
192 Ga0105249_10017153 3300009553 Bacteria 6428
193 Ga0105249_10043032 3300009553 Bacteria 4108
194 Ga0105249_10055051 3300009553 Bacteria 3638
195 Ga0105239_10104841 3300010375 Bacteria 3131
196 Ga0105239_10995508 3300010375 Bacteria 964
197 Ga0105246_10097222 3300011119 Bacteria 2136
198 Ga0105246_10308567 3300011119 Bacteria 1281
199 Ga0157369_10157590 3300013105 Bacteria 2397
200 Ga0157369_10384631 3300013105 Bacteria 1456
201 Ga0157374_11492460 3300013296 Bacteria 699
202 Ga0157378_10004846 3300013297 Bacteria 11800
203 Ga0157378_10108728 3300013297 Bacteria 2539
204 Ga0157378_10483571 3300013297 Bacteria 1234
205 Ga0163162_10024382 3300013306 Bacteria 5970
206 Ga0163162_10321598 3300013306 Bacteria 1679
207 Ga0163162_11087229 3300013306 Bacteria 906
208 Ga0157372_10660818 3300013307 Bacteria 1217
209 Ga0157375_10466697 3300013308 Bacteria 1428
210 Ga0157375_10494935 3300013308 Bacteria 1387
211 Ga0157375_10969190 3300013308 Bacteria 991
212 Ga0157380_10055804 3300014326 Bacteria 3139
213 Ga0157377_10192101 3300014745 Bacteria 1291
214 Ga0157377_10597896 3300014745 Bacteria 786
215 Ga0157376_10051157 3300014969 Bacteria 3431
216 Ga0157376_10579913 3300014969 Bacteria 1114
217 Ga0157376_12348533 3300014969 Bacteria 573
218 Ga0197907_10840627 3300020069 Bacteria 4221
219 Ga0206356_10119050 3300020070 Bacteria 7978
220 Ga0206355_1329123 3300020076 Bacteria 8157
221 Ga0206351_10542297 3300020077 Bacteria 7962
222 Ga0206352_10112103 3300020078 Bacteria 689
223 Ga0206350_11511940 3300020080 Bacteria 5114
224 Ga0206354_10468283 3300020081 Bacteria 767
225 Ga0206354_10793986 3300020081 Bacteria 677
226 Ga0206354_10873226 3300020081 Bacteria 7967
227 Ga0206353_11603916 3300020082 Bacteria 7966
228 Ga0154015_1056028 3300020610 Bacteria 6701
229 Ga0213872_10407819 3300021361 Bacteria 550
230 Ga0224712_10000485 3300022467 Bacteria 7970
231 Ga0207713_1039401 3300025735 Bacteria 1993
232 Ga0207653_10000100 3300025885 Bacteria 61375
233 Ga0207692_10042504 3300025898 Bacteria 2256
234 Ga0207642_10017387 3300025899 Bacteria 2734
235 Ga0207647_10169643 3300025904 Bacteria 1271
236 Ga0207643_10000324 3300025908 Bacteria 32791
237 Ga0207684_10000233 3300025910 Bacteria 84435
238 Ga0207684_10052564 3300025910 Bacteria 3457
239 Ga0207684_10088419 3300025910 Unclassified 2640
240 Ga0207684_10628783 3300025910 Bacteria 915
241 Ga0207684_11144264 3300025910 Bacteria 646
242 Ga0207654_10398716 3300025911 Bacteria 956
243 Ga0207707_10102836 3300025912 Bacteria 2497
244 Ga0207707_10126679 3300025912 Bacteria 2233
245 Ga0207707_10179236 3300025912 Bacteria 1850
246 Ga0207695_10585755 3300025913 Bacteria 997
247 Ga0207693_10219627 3300025915 Bacteria 1493
248 Ga0207693_10440821 3300025915 Bacteria 1018
249 Ga0207660_10249354 3300025917 Bacteria 1401
250 Ga0207660_10315439 3300025917 Bacteria 1247
251 Ga0207657_10308712 3300025919 Bacteria 1252
252 Ga0207649_10006443 3300025920 Bacteria 6375
253 Ga0207652_10019006 3300025921 Bacteria 5643
254 Ga0207652_10064827 3300025921 Bacteria 3162
255 Ga0207646_10005209 3300025922 Bacteria 13741
256 Ga0207646_10082582 3300025922 Bacteria 2873
257 Ga0207646_10101490 3300025922 Bacteria 2579
258 Ga0207694_10213442 3300025924 Bacteria 1573
259 Ga0207659_10024617 3300025926 Bacteria 4036
260 Ga0207687_10053312 3300025927 Bacteria 2825
261 Ga0207687_10569411 3300025927 Bacteria 952
262 Ga0207664_10155117 3300025929 Bacteria 1949
263 Ga0207664_10283520 3300025929 Bacteria 1454
264 Ga0207690_10858567 3300025932 Bacteria 752
265 Ga0207706_10052314 3300025933 Bacteria 3605
266 Ga0207706_10356467 3300025933 Bacteria 1271
267 Ga0207706_10400141 3300025933 Bacteria 1190
268 Ga0207686_10013008 3300025934 Bacteria 4593
269 Ga0207709_10023965 3300025935 Bacteria 3480
270 Ga0207709_10054993 3300025935 Bacteria 2457
271 Ga0207669_10090376 3300025937 Bacteria 1991
272 Ga0207665_10197506 3300025939 Bacteria 1464
273 Ga0207665_10414576 3300025939 Bacteria 1028
274 Ga0207661_10397351 3300025944 Bacteria 1250
275 Ga0207679_10854435 3300025945 Bacteria 831
276 Ga0207712_10141185 3300025961 Bacteria 1849
277 Ga0207712_10241157 3300025961 Bacteria 1456
278 Ga0207712_11343581 3300025961 Bacteria 639
279 Ga0207668_10214368 3300025972 Bacteria 1542
280 Ga0207668_10323322 3300025972 Bacteria 1281
281 Ga0207677_10425052 3300026023 Bacteria 1132
282 Ga0207677_11106454 3300026023 Bacteria 722
283 Ga0207677_11283640 3300026023 Bacteria 672
284 Ga0207708_10524684 3300026075 Bacteria 996
285 Ga0207702_10078687 3300026078 Bacteria 2855
286 Ga0207702_10407976 3300026078 Bacteria 1311
287 Ga0207641_10164982 3300026088 Bacteria 2016
288 Ga0207641_10330979 3300026088 Bacteria 1447
289 Ga0207641_11231645 3300026088 Bacteria 748
290 Ga0207676_10002670 3300026095 Bacteria 12672
291 Ga0207674_10136544 3300026116 Bacteria 2414
292 Ga0207675_100006050 3300026118 Bacteria 11513
293 Ga0207675_100009258 3300026118 Bacteria 9237
294 Ga0207675_100147726 3300026118 Bacteria 2236
295 Ga0207428_10001500 3300027907 Bacteria 24402
296 Ga0207428_10001517 3300027907 Bacteria 24233
297 Ga0207428_10005123 3300027907 Bacteria 12285
298 Ga0207428_10012696 3300027907 Bacteria 7386
299 Ga0207428_10038369 3300027907 Bacteria 3894
300 Ga0268266_10262264 3300028379 Bacteria 1602
301 Ga0268265_10145505 3300028380 Bacteria 1991
302 Ga0268264_10237489 3300028381 Bacteria 1686
303 Ga0265338_10110185 3300028800 Bacteria 2219
304 Ga0307512_10006934 3300030522 Bacteria 11325
305 Ga0265320_10011603 3300031240 Bacteria 5175
306 Ga0265340_10260490 3300031247 Bacteria 772
307 Ga0265339_10025351 3300031249 Bacteria 3403
308 Ga0307408_100037465 3300031548 Bacteria 3416
309 Ga0307408_100214879 3300031548 Bacteria 1565
310 Ga0265313_10103821 3300031595 Bacteria 1258
311 Ga0307508_10502881 3300031616 Bacteria 807
312 Ga0265314_10076053 3300031711 Bacteria 2232
313 Ga0265342_10033187 3300031712 Bacteria 3176
314 Ga0307405_10029958 3300031731 Bacteria 3186
315 Ga0307405_10036171 3300031731 Bacteria 2955
316 Ga0307405_10524780 3300031731 Bacteria 953
317 Ga0307405_11105355 3300031731 Bacteria 681
318 Ga0307413_10051992 3300031824 Bacteria 2472
319 Ga0307413_10053614 3300031824 Bacteria 2442
320 Ga0307413_10421686 3300031824 Bacteria 1051
321 Ga0307413_10564489 3300031824 Bacteria 925
322 Ga0307410_10065320 3300031852 Bacteria 2502
323 Ga0307410_10086775 3300031852 Bacteria 2211
324 Ga0307406_10077218 3300031901 Bacteria 2202
325 Ga0307406_10088933 3300031901 Bacteria 2073
326 Ga0307407_10030392 3300031903 Bacteria 2913
327 Ga0307407_10073092 3300031903 Bacteria 2047
328 Ga0307407_11143445 3300031903 Bacteria 606
329 Ga0307412_10081366 3300031911 Bacteria 2240
330 Ga0307412_10103253 3300031911 Bacteria 2020
331 Ga0307409_100045843 3300031995 Bacteria 3304
332 Ga0307409_100086368 3300031995 Bacteria 2553
333 Ga0307409_100636556 3300031995 Bacteria 1058
334 Ga0307416_100001353 3300032002 Bacteria 13220
335 Ga0307416_100013927 3300032002 Bacteria 5485
336 Ga0307416_100213375 3300032002 Bacteria 1843
337 Ga0307414_10081210 3300032004 Bacteria 2373
338 Ga0307414_10126997 3300032004 Bacteria 1972
339 Ga0307411_10048206 3300032005 Bacteria 2760
340 Ga0307411_10094931 3300032005 Bacteria 2092
341 Ga0307415_100023850 3300032126 Bacteria 3807
342 Ga0307415_100047225 3300032126 Bacteria 2897
343 Ga0307415_100237472 3300032126 Bacteria 1472
344 Ga0307415_100487348 3300032126 Bacteria 1075
345 Ga0307415_100731067 3300032126 Bacteria 896
346 Ga0307415_100816841 3300032126 Bacteria 852
347 Ga0307415_101297126 3300032126 Bacteria 689
348 Ga0373958_0110391 3300034819 Bacteria 655
349 Ga0373928_0102131 3300035084 Bacteria 749
350 Ga0373929_0079050 3300035085 Bacteria 799
351 Ga0373932_0004345 3300035112 Bacteria 3359
352 Ga0373936_0007773 3300035113 Bacteria 4027
353 Ga0373939_0003258 3300035114 Bacteria 3806
354 Ga0373945_0002205 3300035116 Bacteria 6087
355 Ga0373945_0064847 3300035116 Bacteria 1370
356 Ga0373953_0186736 3300035117 Bacteria 895
357 Ga0373956_0044317 3300035119 Bacteria 1983
358 Ga0373960_0118600 3300035121 Bacteria 876
359 Ga0373943_0000643 3300035170 Bacteria 15075
360 Ga0373946_0010131 3300035171 Bacteria 3485
361 Ga0373946_0050570 3300035171 Bacteria 1736
362 Ga0373955_0002200 3300035172 Bacteria 8459
363 Ga0373924_0101450 3300035410 Bacteria 1238
364 Ga0373924_0262390 3300035410 Unclassified 765
365 Ga0373931_0034199 3300035691 Bacteria 2637
366 Ga0373931_0296375 3300035691 Bacteria 997
367 Ga0373935_0493245 3300035692 Bacteria 888
368 Ga0373927_0042746 3300035695 Bacteria 2936
369 Ga0373933_0024950 3300035724 Bacteria 3426
370 Ga0373947_0026510 3300035725 Bacteria 3388
371 Ga0373947_0038831 3300035725 Bacteria 2831
372 Ga0373947_0056413 3300035725 Bacteria 2374
373 Ga0373947_0383218 3300035725 Bacteria 947
374 Ga0373937_0022593 3300036401 Bacteria 5658
375 Ga0373937_0403879 3300036401 Bacteria 1296
376 Ga0373925_0003808 3300037068 Bacteria 11583
377 Ga0373925_0026030 3300037068 Bacteria 4277
378 Ga0373925_0220387 3300037068 Bacteria 1514
379 Ga0395899_0231610 3300037312 Bacteria 1275
380 Ga0395899_0261623 3300037312 Bacteria 1183
381 Ga0395899_0331024 3300037312 Bacteria 1023
382 Ga0395899_0597454 3300037312 Bacteria 703
383 Ga0395900_0008417 3300037418 Bacteria 10612
384 Ga0395900_0041450 3300037418 Bacteria 4746
385 Ga0395900_0075812 3300037418 Bacteria 3457
386 Ga0395900_0088410 3300037418 Bacteria 3185
387 Ga0395900_0268293 3300037418 Bacteria 1702
388 Ga0395898_0035735 3300037466 Bacteria 4937
389 Ga0395898_0075480 3300037466 Bacteria 3256
390 Ga0395898_0296412 3300037466 Bacteria 1543
391 Ga0395898_0402349 3300037466 Bacteria 1305
392 Ga0395898_0571874 3300037466 Bacteria 1072
393 Ga0395905_0029050 3300037471 Bacteria 5211
394 Ga0395905_0068431 3300037471 Bacteria 3326
395 Ga0395905_0069420 3300037471 Bacteria 3300
396 Ga0395905_0340753 3300037471 Bacteria 1390
397 Ga0395905_0525861 3300037471 Bacteria 1083
398 Ga0436364_0073490 3300037853 Bacteria 2794
399 Ga0436364_0359023 3300037853 Bacteria 776
400 Ga0395901_0034263 3300038443 Bacteria 5243
401 Ga0395901_0043793 3300038443 Bacteria 4642
402 Ga0395901_0044881 3300038443 Bacteria 4584
403 Ga0395901_0051346 3300038443 Bacteria 4287
404 Ga0395901_0375113 3300038443 Bacteria 1465
405 Ga0395901_0451227 3300038443 Bacteria 1315
406 Ga0436360_1133702 3300039438 Bacteria 667
407 Ga0436360_1309648 3300039438 Bacteria 7849
408 Ga0436361_0127857 3300039447 Bacteria 2710
409 Ga0436361_0449584 3300039447 Unclassified 817
410 Ga0436363_0542485 3300039450 Bacteria 1118
411 Ga0436362_0763626 3300039453 Bacteria 1121
412 Ga0439439_0153248 3300041406 Bacteria 655
413 Ga0439465_0355509 3300041413 Bacteria 554
414 Ga0439443_010419 3300042003 Bacteria 1346
415 Ga0439448_0002814 3300042005 Bacteria 4764
416 Ga0439448_0077051 3300042005 Bacteria 1116
417 Ga0439450_003685 3300042008 Bacteria 2557
418 Ga0439450_016749 3300042008 Bacteria 1519
419 Ga0439454_002643 3300042011 Bacteria 1916
420 Ga0439455_0054951 3300042012 Bacteria 1046
421 Ga0439455_0057795 3300042012 Bacteria 1024
422 Ga0439455_0078654 3300042012 Bacteria 894
423 Ga0439463_002574 3300042016 Bacteria 4601
424 Ga0439463_030794 3300042016 Bacteria 1353
425 Ga0439463_156231 3300042016 Bacteria 591
426 Ga0450913_003029 3300042117 Bacteria 1077
427 Ga0450914_001143 3300042118 Bacteria 1571
428 Ga0450900_028683 3300042136 Bacteria 802
429 Ga0450902_055281 3300042137 Bacteria 683
430 Ga0450905_005746 3300042142 Bacteria 1665
431 Ga0450889_002295 3300042144 Bacteria 1913
432 Ga0450907_035672 3300042146 Bacteria 849
433 Ga0439458_0020453 3300042157 Bacteria 1528
434 Ga0439458_0111559 3300042157 Bacteria 715
435 Ga0439444_0018811 3300042437 Bacteria 1199
436 Ga0439464_0009095 3300042439 Bacteria 2610
437 Ga0439464_0020792 3300042439 Bacteria 1799
438 Ga0439464_0030414 3300042439 Bacteria 1512
439 Ga0439460_0005555 3300042461 Bacteria 3100
440 Ga0439460_0212443 3300042461 Bacteria 661
441 Ga0450916_001104 3300042530 Bacteria 2631
442 Ga0439440_0000534 3300042993 Bacteria 6416
443 Ga0466965_0078991 3300044683 Bacteria 1662
444 Ga0466966_0000887 3300044684 Bacteria 19094
445 Ga0466963_0001640 3300044694 Bacteria 12189
446 Ga0466971_0128524 3300044719 Bacteria 1175
447 Ga0466957_0004157 3300044842 Bacteria 8016
448 Ga0466959_0031559 3300045049 Bacteria 3920
449 Ga0466959_0045582 3300045049 Bacteria 3229
450 Ga0451576_0458440 3300045051 Bacteria 1339
451 Ga0451576_1148599 3300045051 Bacteria 812
452 Ga0466958_0002878 3300045836 Bacteria 8770
453 Ga0466958_0018928 3300045836 Bacteria 4003
454 Ga0466967_0189694 3300045976 Bacteria 1942
455 Ga0495617_058257 3300046452 Bacteria 1280
456 Ga0495592_0108039 3300046454 Bacteria 1972
457 Ga0495603_0001259 3300046455 Bacteria 14773
458 Ga0495603_0008959 3300046455 Bacteria 6049
459 Ga0495603_0035146 3300046455 Bacteria 3011
460 Ga0495591_029807 3300046458 Bacteria 1653
461 Ga0495629_0000580 3300046459 Bacteria 29719
462 Ga0495629_0683929 3300046459 Bacteria 682
463 Ga0495651_0011640 3300046462 Bacteria 6762
464 Ga0495651_0014139 3300046462 Bacteria 6170
465 Ga0495651_0020821 3300046462 Bacteria 5091
466 Ga0495653_0112248 3300046463 Bacteria 1956
467 Ga0495653_0127480 3300046463 Bacteria 1805
468 Ga0495580_0069647 3300046472 Bacteria 2458
469 Ga0495580_0594614 3300046472 Bacteria 732
470 Ga0495580_0675090 3300046472 Bacteria 678
471 Ga0495639_0021086 3300046475 Bacteria 2851
472 Ga0495639_0035204 3300046475 Bacteria 2240
473 Ga0495662_0029215 3300046476 Bacteria 2662
474 Ga0495664_0009359 3300046477 Bacteria 5479
475 Ga0495664_0719584 3300046477 Bacteria 589
476 Ga0495584_0039919 3300046491 Bacteria 2371
477 Ga0495585_0140132 3300046492 Bacteria 1267
478 Ga0495594_0143819 3300046499 Bacteria 1353
479 Ga0495596_0063753 3300046500 Bacteria 1434
480 Ga0495607_0042969 3300046501 Bacteria 2676
481 Ga0495607_0187540 3300046501 Bacteria 1033
482 Ga0495608_0007465 3300046511 Bacteria 7717
483 Ga0495608_0071498 3300046511 Bacteria 2263
484 Ga0495618_0035202 3300046514 Bacteria 3142
485 Ga0495618_0068801 3300046514 Bacteria 2251
486 Ga0495628_0006341 3300046516 Bacteria 10339
487 Ga0495628_0116386 3300046516 Bacteria 2053
488 Ga0495630_0023860 3300046517 Bacteria 4521
489 Ga0495630_0030667 3300046517 Bacteria 4002
490 Ga0495632_0341613 3300046519 Bacteria 659
491 Ga0495644_0183985 3300046523 Bacteria 804
492 Ga0495642_0044015 3300046528 Bacteria 1822
493 Ga0495652_0010636 3300046529 Bacteria 8336
494 Ga0495652_0162456 3300046529 Bacteria 1732
495 Ga0495665_0009317 3300046531 Bacteria 5318
496 Ga0495665_0037306 3300046531 Bacteria 2594
497 Ga0495586_0084859 3300046535 Bacteria 1744
498 Ga0495587_0007478 3300046536 Bacteria 7073
499 Ga0495598_0011137 3300046537 Bacteria 2172
500 Ga0495598_0063483 3300046537 Bacteria 1145
501 Ga0495598_0273797 3300046537 Bacteria 632
502 Ga0495621_0224260 3300046539 Bacteria 762
503 Ga0495597_0278616 3300046542 Bacteria 652
504 Ga0495645_0013507 3300046543 Bacteria 5776
505 Ga0495622_0080030 3300046557 Bacteria 1504
506 Ga0495633_0146153 3300046558 Bacteria 1092
507 Ga0495667_0008462 3300046559 Bacteria 6984
508 Ga0495656_0049735 3300046615 Bacteria 1786
509 Ga0495656_0179585 3300046615 Bacteria 1040
510 Ga0495668_0237191 3300046616 Bacteria 999
511 Ga0495634_0023976 3300046642 Bacteria 4285
512 Ga0495611_0094623 3300046648 Bacteria 1382
513 Ga0495635_0012376 3300046663 Bacteria 5979
514 Ga0495659_0104043 3300046664 Bacteria 1102
515 Ga0495661_0083231 3300046665 Bacteria 1840
516 Ga0495588_0030193 3300046674 Bacteria 2723
517 Ga0495657_0263230 3300046675 Bacteria 1035
518 Ga0495657_0356890 3300046675 Bacteria 864
519 Ga0495599_0000701 3300046678 Bacteria 18936
520 Ga0495599_0215775 3300046678 Bacteria 1175
521 Ga0495623_0124701 3300046679 Bacteria 1547
522 Ga0495646_0125975 3300046680 Bacteria 1445
523 Ga0495647_0157144 3300046681 Bacteria 978
524 Ga0495658_0002558 3300046683 Bacteria 9145
525 Ga0495658_0104906 3300046683 Unclassified 1692
526 Ga0495658_0132857 3300046683 Bacteria 1517
527 Ga0495658_0147978 3300046683 Bacteria 1441
528 Ga0495669_0026448 3300046684 Bacteria 2536
529 Ga0495669_0249083 3300046684 Bacteria 853
530 Ga0495669_0257890 3300046684 Bacteria 838
531 Ga0495613_0003552 3300046689 Bacteria 11695
532 Ga0495613_0045182 3300046689 Bacteria 3258
533 Ga0495613_0797407 3300046689 Bacteria 617
534 Ga0495613_0975691 3300046689 Bacteria 545
535 Ga0495624_0032469 3300046690 Bacteria 3385
536 Ga0495624_0154926 3300046690 Bacteria 1401
537 Ga0495624_0420610 3300046690 Bacteria 801
538 Ga0495670_0012604 3300046691 Bacteria 4158
539 Ga0495670_0260318 3300046691 Bacteria 926
540 Ga0495589_0046540 3300046794 Bacteria 2153
541 Ga0495589_0470802 3300046794 Bacteria 574
542 Ga0495600_0035151 3300046809 Bacteria 3253
543 Ga0495660_0070685 3300046810 Bacteria 1852
544 Ga0495581_0004654 3300047315 Bacteria 7922
545 Ga0495581_0006655 3300047315 Bacteria 6697
546 Ga0495636_0092017 3300047318 Bacteria 1317
547 Ga0495674_0011087 3300047319 Bacteria 8510
548 Ga0495674_0599051 3300047319 Bacteria 873
549 Ga0495676_0068338 3300047321 Bacteria 2746
550 Ga0495680_0004959 3300047322 Bacteria 12594
551 Ga0495680_0015445 3300047322 Bacteria 6588
552 Ga0495683_0342174 3300047323 Bacteria 633
553 Ga0495675_0022963 3300047444 Bacteria 3976
554 Ga0495677_0151259 3300047445 Bacteria 894
555 Ga0495679_034151 3300047446 Bacteria 1621
556 Ga0495684_0002173 3300047471 Bacteria 15710
557 Ga0495684_0022862 3300047471 Bacteria 4809
558 Ga0495593_0035302 3300047673 Bacteria 2716
559 Ga0495602_0153291 3300048088 Bacteria 1808
560 Ga0495602_0216608 3300048088 Bacteria 1448
561 Ga0495602_0273731 3300048088 Bacteria 1247
562 Ga0495614_0063362 3300048089 Bacteria 1589
563 Ga0495614_0206049 3300048089 Bacteria 891
564 Ga0496100_0012047 3300048903 Bacteria 4945
565 Ga0496100_0018163 3300048903 Bacteria 4167
566 Ga0496105_0118280 3300048908 Bacteria 2186
567 Ga0496106_0010334 3300048909 Bacteria 6897
568 Ga0496107_0014287 3300048910 Bacteria 5560
569 Ga0496108_0026709 3300048911 Bacteria 4765
570 Ga0496108_0319199 3300048911 Bacteria 1354
571 Ga0496109_0029507 3300048912 Bacteria 4913
572 Ga0496109_0203327 3300048912 Bacteria 1862
573 Ga0496110_0008928 3300048913 Bacteria 8081
574 Ga0496110_0031513 3300048913 Bacteria 4575
575 Ga0496110_0101045 3300048913 Bacteria 2585
576 Ga0496110_0338324 3300048913 Bacteria 1371
577 Ga0496110_0645430 3300048913 Bacteria 958
578 Ga0496111_0000396 3300048914 Bacteria 21854
579 Ga0496112_0101490 3300048915 Bacteria 2847
580 Ga0496112_0270757 3300048915 Bacteria 1647
581 Ga0496113_0299615 3300048916 Bacteria 1287
582 Ga0496113_0669676 3300048916 Bacteria 829
583 Ga0496114_0228935 3300048917 Bacteria 1633
584 Ga0496114_0600255 3300048917 Bacteria 971
585 Ga0496114_0732825 3300048917 Bacteria 865
586 Ga0496115_0220294 3300048918 Bacteria 1566
587 Ga0501031_0030814 3300049568 Bacteria 3499
588 Ga0501031_0385698 3300049568 Bacteria 906
589 Ga0501032_0295392 3300049569 Bacteria 1048
590 Ga0501033_0012342 3300049570 Bacteria 6520
591 Ga0501033_0035041 3300049570 Bacteria 3762
592 Ga0501033_0089341 3300049570 Bacteria 2254
593 Ga0501036_0004978 3300049572 Bacteria 10742
594 Ga0501036_0029664 3300049572 Bacteria 4620
595 Ga0501036_0064669 3300049572 Bacteria 3096
596 Ga0501036_0075164 3300049572 Bacteria 2857
597 Ga0501036_1191057 3300049572 Bacteria 621
598 Ga0501037_0029314 3300049573 Bacteria 4066
599 Ga0501037_0126498 3300049573 Bacteria 1834
600 Ga0501037_0151568 3300049573 Bacteria 1657
601 Ga0501038_0007864 3300049574 Bacteria 9826
602 Ga0501038_0009086 3300049574 Bacteria 9123
603 Ga0501038_0061396 3300049574 Bacteria 3214
604 Ga0501038_0299672 3300049574 Bacteria 1262
605 Ga0501038_0359614 3300049574 Bacteria 1132
606 Ga0501039_0004611 3300049575 Bacteria 10422
607 Ga0501039_0004615 3300049575 Bacteria 10420
608 Ga0501039_0093223 3300049575 Bacteria 2347
609 Ga0501039_0119675 3300049575 Bacteria 2063
610 Ga0501039_0152114 3300049575 Bacteria 1818
611 Ga0501039_0455240 3300049575 Bacteria 1005
612 Ga0501039_0524532 3300049575 Bacteria 930
613 Ga0501040_0002408 3300049576 Bacteria 12037
614 Ga0501040_0003475 3300049576 Bacteria 10164
615 Ga0501040_0014580 3300049576 Bacteria 5183
616 Ga0501040_0020342 3300049576 Bacteria 4420
617 Ga0501040_0128177 3300049576 Bacteria 1783
618 Ga0501040_0134761 3300049576 Bacteria 1738
619 Ga0501040_0205795 3300049576 Bacteria 1398
620 Ga0501041_0000041 3300049577 Bacteria 43676
621 Ga0501041_0002431 3300049577 Bacteria 10561
622 Ga0501041_0025935 3300049577 Bacteria 3524
623 Ga0501041_0139834 3300049577 Bacteria 1510
624 Ga0501041_0222032 3300049577 Bacteria 1186
625 Ga0501042_0002936 3300049578 Bacteria 10587
626 Ga0501042_0004188 3300049578 Bacteria 9172
627 Ga0501042_0005831 3300049578 Bacteria 7957
628 Ga0501042_0006075 3300049578 Bacteria 7823
629 Ga0501042_0009128 3300049578 Bacteria 6593
630 Ga0501042_0035806 3300049578 Bacteria 3522
631 Ga0501042_0082544 3300049578 Bacteria 2304
632 Ga0501042_0219295 3300049578 Bacteria 1372
633 Ga0501042_0289589 3300049578 Bacteria 1183
634 Ga0501043_0016315 3300049579 Bacteria 5825
635 Ga0501043_0039869 3300049579 Bacteria 3692
636 Ga0501043_0056235 3300049579 Bacteria 3090
637 Ga0501043_0318852 3300049579 Bacteria 1185
638 Ga0501043_0408536 3300049579 Bacteria 1025
639 Ga0501046_0010306 3300049580 Bacteria 8039
640 Ga0501046_0012266 3300049580 Bacteria 7303
641 Ga0501046_0245807 3300049580 Bacteria 1318
642 Ga0501046_0334092 3300049580 Bacteria 1102
643 Ga0501048_0000970 3300049582 Bacteria 21242
644 Ga0501048_0001880 3300049582 Bacteria 15940
645 Ga0501048_0031845 3300049582 Bacteria 3814
646 Ga0501048_0079870 3300049582 Bacteria 2308
647 Ga0501048_0081482 3300049582 Bacteria 2283
648 Ga0501048_0192473 3300049582 Bacteria 1445
649 Ga0501048_0919693 3300049582 Bacteria 629
650 Ga0501067_0005433 3300049583 Bacteria 7075
651 Ga0501068_0010287 3300049584 Bacteria 5253
652 Ga0501068_0016757 3300049584 Bacteria 4228
653 Ga0501068_0096740 3300049584 Bacteria 1826
654 Ga0501068_0336348 3300049584 Bacteria 969
655 Ga0501068_0410227 3300049584 Bacteria 874
656 Ga0501069_0004219 3300049585 Bacteria 7424
657 Ga0501070_0096049 3300049586 Bacteria 2452
658 Ga0501070_0181522 3300049586 Bacteria 1732
659 Ga0501070_0366222 3300049586 Bacteria 1169
660 Ga0501070_0503659 3300049586 Bacteria 973
661 Ga0501070_0511243 3300049586 Bacteria 964
662 Ga0501070_0773149 3300049586 Bacteria 755
663 Ga0501071_0004087 3300049587 Bacteria 9224
664 Ga0501071_0024748 3300049587 Bacteria 4199
665 Ga0501071_0028914 3300049587 Bacteria 3908
666 Ga0501071_0035558 3300049587 Bacteria 3548
667 Ga0501071_0073865 3300049587 Bacteria 2488
668 Ga0501071_0096950 3300049587 Bacteria 2171
669 Ga0501071_0155395 3300049587 Bacteria 1708
670 Ga0501071_0400803 3300049587 Bacteria 1047
671 Ga0501072_0005064 3300049588 Bacteria 10029
672 Ga0501072_0007049 3300049588 Bacteria 8531
673 Ga0501072_0014483 3300049588 Bacteria 6044
674 Ga0501072_0022112 3300049588 Bacteria 4933
675 Ga0501072_0033667 3300049588 Bacteria 4015
676 Ga0501072_0048230 3300049588 Bacteria 3354
677 Ga0501072_0087768 3300049588 Bacteria 2468
678 Ga0501072_0978910 3300049588 Bacteria 660
679 Ga0501072_1396079 3300049588 Bacteria 542
680 Ga0501073_0607031 3300049589 Bacteria 755
681 Ga0501074_0008216 3300049590 Bacteria 7564
682 Ga0501074_0008920 3300049590 Bacteria 7271
683 Ga0501074_0016656 3300049590 Bacteria 5333
684 Ga0501074_0026814 3300049590 Bacteria 4177
685 Ga0501074_0086611 3300049590 Bacteria 2244
686 Ga0501074_0086945 3300049590 Bacteria 2239
687 Ga0501074_0087452 3300049590 Bacteria 2232
688 Ga0501074_0158128 3300049590 Bacteria 1618
689 Ga0501074_0490876 3300049590 Bacteria 870
690 Ga0501074_0753410 3300049590 Bacteria 687
691 Ga0501074_0778041 3300049590 Bacteria 675
692 Ga0501075_0000384 3300049591 Bacteria 25536
693 Ga0501075_0027098 3300049591 Bacteria 4222
694 Ga0501075_0046131 3300049591 Bacteria 3274
695 Ga0501075_0053417 3300049591 Bacteria 3039
696 Ga0501075_0064727 3300049591 Bacteria 2757
697 Ga0501075_0103696 3300049591 Bacteria 2161
698 Ga0501075_0140374 3300049591 Bacteria 1841
699 Ga0501076_0000373 3300049592 Bacteria 27899
700 Ga0501076_0002165 3300049592 Bacteria 13473
701 Ga0501076_0002705 3300049592 Bacteria 12254
702 Ga0501076_0008115 3300049592 Bacteria 7677
703 Ga0501076_0113051 3300049592 Bacteria 2196
704 Ga0501076_0161658 3300049592 Bacteria 1824
705 Ga0501076_0415235 3300049592 Bacteria 1107
706 Ga0501076_1032087 3300049592 Bacteria 677
707 Ga0501077_0002637 3300049593 Bacteria 10741
708 Ga0501077_0017728 3300049593 Bacteria 4497
709 Ga0501077_0044547 3300049593 Bacteria 2818
710 Ga0501077_0074060 3300049593 Bacteria 2157
711 Ga0501077_0155359 3300049593 Bacteria 1452
712 Ga0501077_0309969 3300049593 Bacteria 1006
713 Ga0501217_140144 3300049661 Bacteria 716
714 Ga0501079_0003332 3300049741 Bacteria 11785
715 Ga0501079_0014627 3300049741 Bacteria 5985
716 Ga0501079_0049887 3300049741 Bacteria 3231
717 Ga0501079_0111940 3300049741 Bacteria 2121
718 Ga0501079_0166886 3300049741 Bacteria 1717
719 Ga0501079_0192609 3300049741 Bacteria 1591
720 Ga0501079_0194323 3300049741 Bacteria 1584
721 Ga0501079_0318090 3300049741 Bacteria 1218
722 Ga0501079_1008851 3300049741 Bacteria 656
723 Ga0501080_0021407 3300049742 Bacteria 5985
724 Ga0501080_0067392 3300049742 Bacteria 3329
725 Ga0501080_0591036 3300049742 Bacteria 986
726 Ga0501081_0002206 3300049743 Bacteria 12249
727 Ga0501081_0004682 3300049743 Bacteria 8794
728 Ga0501081_0040461 3300049743 Bacteria 3192
729 Ga0501081_0056000 3300049743 Bacteria 2724
730 Ga0501081_0251539 3300049743 Bacteria 1290
731 Ga0501081_1060195 3300049743 Bacteria 613
732 Ga0501268_093110 3300049765 Bacteria 637
733 Ga0501035_0031924 3300049822 Bacteria 4796
734 Ga0501035_0045881 3300049822 Bacteria 3931
735 Ga0501035_0250267 3300049822 Bacteria 1505
736 Ga0501045_0000460 3300049824 Bacteria 25215
737 Ga0501045_0002493 3300049824 Bacteria 12520
738 Ga0501045_0002574 3300049824 Bacteria 12367
739 Ga0501045_0006800 3300049824 Bacteria 7921
740 Ga0501045_0101314 3300049824 Bacteria 2132
741 Ga0501045_0200507 3300049824 Bacteria 1487
742 Ga0501045_1056320 3300049824 Bacteria 595
743 nmdc:mga05p37_24412_c1 3300050507 Bacteria 7347
744 nmdc:mga05p37_46997_c1 3300050507 Bacteria 5308
745 nmdc:mga05p37_51199_c1 3300050507 Bacteria 5079
746 nmdc:mga05p37_5452_c1 3300050507 Bacteria 14936
747 nmdc:mga05p37_6613_c1 3300050507 Bacteria 13665
748 nmdc:mga05p37_85318_c1 3300050507 Bacteria 3891
749 nmdc:mga05p37_858521_c1 3300050507 Bacteria 985
750 nmdc:mga09592_133977_c1 3300050508 Bacteria 2133
751 nmdc:mga09592_137719_c1 3300050508 Bacteria 2103
752 nmdc:mga09592_13980_c1 3300050508 Bacteria 6554
753 nmdc:mga0qj67_23075_c1 3300050509 Bacteria 4783
754 nmdc:mga0qj67_355803_c1 3300050509 Bacteria 1183
755 nmdc:mga0qj67_96750_c1 3300050509 Bacteria 2377
756 nmdc:mga06r32_12115_c1 3300050510 Bacteria 6423
757 nmdc:mga06r32_18282_c1 3300050510 Bacteria 6416
758 nmdc:mga06r32_296162_c1 3300050510 Bacteria 1604
759 nmdc:mga06r32_311631_c1 3300050510 Bacteria 1559
760 nmdc:mga08y16_11473_c1 3300050511 Bacteria 9312
761 nmdc:mga08y16_12137_c1 3300050511 Bacteria 9054
762 nmdc:mga08y16_380138_c1 3300050511 Bacteria 1448
763 nmdc:mga08y16_388109_c1 3300050511 Bacteria 1431
764 nmdc:mga08y16_712841_c1 3300050511 Bacteria 1002
765 nmdc:mga08y16_778850_c1 3300050511 Bacteria 951
766 nmdc:mga0n895_228065_c1 3300050512 Bacteria 1891
767 nmdc:mga0n895_2298_c1 3300050512 Bacteria 14858
768 nmdc:mga0n895_328891_c1 3300050512 Bacteria 1549
769 nmdc:mga0n895_8340_c1 3300050512 Bacteria 8967
770 nmdc:mga0rr50_66004_c1 3300050513 Bacteria 2743
771 nmdc:mga0rr50_68882_c1 3300050513 Bacteria 2692
772 nmdc:mga08x19_312419_c1 3300050514 Bacteria 1093
773 nmdc:mga0a205_11872_c1 3300050515 Bacteria 8041
774 nmdc:mga0a205_25198_c1 3300050515 Bacteria 5665
775 nmdc:mga0a205_670554_c1 3300050515 Bacteria 888
776 nmdc:mga0a205_80687_c1 3300050515 Bacteria 3143
777 nmdc:mga0a205_95358_c1 3300050515 Bacteria 2874
778 nmdc:mga0a205_9802_c1 3300050515 Bacteria 8785
779 Ga0495601_0001651 3300053077 Bacteria 12311
780 Ga0495601_0007552 3300053077 Bacteria 6380
781 Ga0495601_0454117 3300053077 Bacteria 829
782 Ga0495612_0363178 3300053078 Bacteria 655
783 Ga0495595_0189613 3300053084 Bacteria 1021
784 Ga0501084_0000697 3300054114 Bacteria 25775
785 Ga0501084_0000767 3300054114 Bacteria 24480
786 Ga0501084_0015598 3300054114 Bacteria 6301
787 Ga0501084_0069461 3300054114 Bacteria 2950
788 Ga0501084_0069832 3300054114 Bacteria 2941
789 Ga0501084_0086042 3300054114 Bacteria 2639
790 Ga0501084_0144316 3300054114 Bacteria 2005
791 Ga0501084_0263813 3300054114 Bacteria 1454
792 Ga0501084_1182167 3300054114 Bacteria 642
793 Ga0590071_029381 3300059421 Bacteria 1306
794 Ga0590074_003848 3300059423 Bacteria 2488
795 Ga0590075_001038 3300059424 Bacteria 7175
796 Ga0590075_017998 3300059424 Bacteria 1745
797 Ga0590077_002509 3300059426 Bacteria 3902
798 Ga0590077_081702 3300059426 Bacteria 744
799 Ga0587066_152548 3300059490 Bacteria 574
800 Ga0587073_0007531 3300059492 Bacteria 1726
801 Ga0587073_0014020 3300059492 Bacteria 1419
802 Ga0587082_129959 3300059504 Bacteria 578
803 Ga0587083_0061252 3300059505 Bacteria 849
804 Ga0587086_040303 3300059507 Bacteria 721
805 Ga0587089_005641 3300059509 Bacteria 1426
806 Ga0587094_121973 3300059513 Bacteria 523
807 Ga0587115_022488 3300059626 Bacteria 888
808 Ga0587117_000258 3300059627 Bacteria 3260
809 Ga0587072_002001 3300059643 Bacteria 2659
810 Ga0587072_033152 3300059643 Bacteria 973
811 Ga0587075_003990 3300059644 Bacteria 1688
812 Ga0587078_024720 3300059646 Bacteria 780
813 Ga0587079_021625 3300059647 Bacteria 1159
814 Ga0587079_038773 3300059647 Bacteria 953
815 Ga0587102_006889 3300059649 Bacteria 1044
816 Ga0587071_026839 3300060344 Bacteria 1088
817 Ga0587111_0004880 3300060346 Bacteria 2033
818 Ga0501082_0008656 3300060353 Bacteria 8774
819 Ga0501082_0011849 3300060353 Bacteria 7494
820 Ga0501082_0020961 3300060353 Bacteria 5637
821 Ga0501082_0025852 3300060353 Bacteria 5061
822 Ga0501082_0052080 3300060353 Bacteria 3528
823 Ga0501082_0069429 3300060353 Bacteria 3033
824 Ga0501082_0072105 3300060353 Bacteria 2975
825 Ga0501082_1020004 3300060353 Bacteria 723
826 Ga0466962_0005013 3300061719 Bacteria 6367
827 Ga0530510_0001371 3300061734 Bacteria 16303
828 Ga0530510_0006802 3300061734 Bacteria 7967
829 Ga0530510_0022544 3300061734 Bacteria 4486
830 Ga0530510_0022753 3300061734 Bacteria 4465
831 Ga0530510_0179366 3300061734 Bacteria 1570
832 Ga0530510_0187613 3300061734 Bacteria 1534
833 Ga0530510_0217904 3300061734 Bacteria 1418
834 Ga0530510_0224381 3300061734 Bacteria 1397
835 Ga0530510_0411214 3300061734 Bacteria 1021
836 Ga0530510_0589611 3300061734 Bacteria 845
837 Ga0530510_0938492 3300061734 Bacteria 662
838 Ga0496104_0070241
839 JGI24747J21853_1002432
840 JGI24033J26618_1003772
841 JGI24751J29686_10000457
842 JGI24751J29686_10028600
843 JGI25407J50210_10000849
844 JGI25407J50210_10082127
845 JGI25407J50210_10094491
846 JGI25405J52794_10032067
847 Ga0058863_11807083
848 Ga0058861_11793184
849 Ga0058862_12887376
850 Ga0070682_100196733
851 Ga0070682_100557448
852 Ga0068868_100284494
853 Ga0070689_100343057
854 Ga0070661_100003993
855 Ga0070692_10248242
856 Ga0070668_100128237
857 Ga0070675_100042835
858 Ga0070674_100173063
859 Ga0070659_100243453
860 Ga0070703_10000022
861 Ga0070703_10008580
862 Ga0070714_100103125
863 Ga0070714_100140117
864 Ga0070714_100321392
865 Ga0070713_100173023
866 Ga0070711_100237199
867 Ga0070711_100262735
868 Ga0070705_100149652
869 Ga0070700_100182801
870 Ga0070700_100927990
871 Ga0070694_100168279
872 Ga0070708_100002785
873 Ga0070708_100016862
874 Ga0070663_100785859
875 Ga0070662_100087120
876 Ga0070681_10025796
877 Ga0070681_10035343
878 Ga0068867_100460891
879 Ga0070685_10403401
880 Ga0070706_100000241
881 Ga0070706_100100976
882 Ga0070706_100878448
883 Ga0070707_100000716
884 Ga0070707_100006806
885 Ga0070707_100025164
886 Ga0070707_100048473
887 Ga0070707_100603482
888 Ga0070707_100661830
889 Ga0070698_100006512
890 Ga0070698_100020152
891 Ga0070698_100025887
892 Ga0070698_100090234
893 Ga0070698_100499143
894 Ga0070698_100753790
895 Ga0070699_100008694
896 Ga0070699_100070465
897 Ga0070699_100112674
898 Ga0070699_100220136
899 Ga0070699_100319316
900 Ga0070679_100015909
901 Ga0070679_100053141
902 Ga0070679_100145275
903 Ga0070684_100238361
904 Ga0070684_100714698
905 Ga0070697_100006818
906 Ga0070697_100012515
907 Ga0070697_100622113
908 Ga0070697_100864316
909 Ga0070697_101205931
910 Ga0068853_100630473
911 Ga0070695_100002478
912 Ga0070695_100940761
913 Ga0070696_100085324
914 Ga0070696_100317216
915 Ga0070693_100095968
916 Ga0070665_100641466
917 Ga0070704_100009955
918 Ga0070704_100074814
919 Ga0070704_100419373
920 Ga0070704_100630727
921 Ga0070704_101429876
922 Ga0070664_100008664
923 Ga0068857_100256286
924 Ga0068857_101084055
925 Ga0068856_100177497
926 Ga0068856_100275727
927 Ga0068852_100488780
928 Ga0068864_100265971
929 Ga0068866_10008147
930 Ga0068861_100040578
931 Ga0068861_100041374
932 Ga0068870_10003358
933 Ga0068863_100009118
934 Ga0068860_100179082
935 Ga0068862_100513914
936 Ga0081455_10001540
937 Ga0081455_10002895
938 Ga0081455_10006642
939 Ga0081455_10009966
940 Ga0081455_10013853
941 Ga0081455_10024165
942 Ga0081455_10033633
943 Ga0081455_10043463
944 Ga0081455_10045759
945 Ga0081455_10079785
946 Ga0081455_10154523
947 Ga0081538_10000029
948 Ga0081538_10000081
949 Ga0081538_10001550
950 Ga0081538_10010634
951 Ga0081538_10021468
952 Ga0081538_10026643
953 Ga0081538_10040972
954 Ga0081538_10104128
955 Ga0081538_10248137
956 Ga0081540_1036192
957 Ga0081540_1085775
958 Ga0081539_10020154
959 Ga0081539_10106999
960 Ga0081539_10107172
961 Ga0075365_10302581
962 Ga0075432_10005230
963 Ga0075432_10005810
964 Ga0075432_10006804
965 Ga0075432_10050530
966 Ga0070715_10024725
967 Ga0070716_100100702
968 Ga0070712_100047023
969 Ga0070712_100098603
970 Ga0070712_100104226
971 Ga0070712_100545327
972 Ga0075427_10001460
973 Ga0068871_100061592
974 Ga0075428_100054760
975 Ga0075428_100080275
976 Ga0075428_100152719
977 Ga0075428_101371073
978 Ga0075430_100010728
979 Ga0075430_100024076
980 Ga0075431_100072293
981 Ga0075431_100282629
982 Ga0075431_100297074
983 Ga0075433_10006437
984 Ga0075433_10054894
985 Ga0075433_10062721
986 Ga0075433_10089403
987 Ga0075434_100002195
988 Ga0075434_100034163
989 Ga0075434_100134389
990 Ga0075434_100224148
991 Ga0075429_100017798
992 Ga0075429_100058147
993 Ga0075429_100065206
994 Ga0075429_100104432
995 Ga0075429_100452820
996 Ga0075436_100027135
997 Ga0075435_100039856
998 Ga0105251_10027591
999 Ga0105240_10401020
1000 Ga0111539_10005444
1001 Ga0111539_10031086
1002 Ga0111539_10086306
1003 Ga0111539_10136404
1004 Ga0111539_10309917
1005 Ga0111539_10416227
1006 Ga0111539_10491105
1007 Ga0111539_10496156
1008 Ga0105245_10003018
1009 Ga0105245_10053328
1010 Ga0105245_10104318
1011 Ga0105245_10740934
1012 Ga0114129_10015822
1013 Ga0114129_10023903
1014 Ga0114129_10233986
1015 Ga0114129_10363850
1016 Ga0114129_10653817
1017 Ga0114129_10698080
1018 Ga0114129_11696130
1019 Ga0105243_10007194
1020 Ga0105243_10007215
1021 Ga0105241_10281858
1022 Ga0105242_10004298
1023 Ga0105242_10080853
1024 Ga0105242_10503446
1025 Ga0105237_10868258
1026 Ga0105237_11943491
1027 Ga0105238_10021845
1028 Ga0105249_10004045
1029 Ga0105249_10017153
1030 Ga0105249_10043032
1031 Ga0105249_10055051
1032 Ga0105239_10104841
1033 Ga0105239_10995508
1034 Ga0105246_10097222
1035 Ga0105246_10308567
1036 Ga0157369_10157590
1037 Ga0157369_10384631
1038 Ga0157374_11492460
1039 Ga0157378_10004846
1040 Ga0157378_10108728
1041 Ga0157378_10483571
1042 Ga0163162_10024382
1043 Ga0163162_10321598
1044 Ga0163162_11087229
1045 Ga0157372_10660818
1046 Ga0157375_10466697
1047 Ga0157375_10494935
1048 Ga0157375_10969190
1049 Ga0157380_10055804
1050 Ga0157377_10192101
1051 Ga0157377_10597896
1052 Ga0157376_10051157
1053 Ga0157376_10579913
1054 Ga0157376_12348533
1055 Ga0197907_10840627
1056 Ga0206356_10119050
1057 Ga0206355_1329123
1058 Ga0206351_10542297
1059 Ga0206352_10112103
1060 Ga0206350_11511940
1061 Ga0206354_10468283
1062 Ga0206354_10793986
1063 Ga0206354_10873226
1064 Ga0206353_11603916
1065 Ga0154015_1056028
1066 Ga0213872_10407819
1067 Ga0224712_10000485
1068 Ga0207713_1039401
1069 Ga0207653_10000100
1070 Ga0207692_10042504
1071 Ga0207642_10017387
1072 Ga0207647_10169643
1073 Ga0207643_10000324
1074 Ga0207684_10000233
1075 Ga0207684_10052564
1076 Ga0207684_10088419
1077 Ga0207684_10628783
1078 Ga0207684_11144264
1079 Ga0207654_10398716
1080 Ga0207707_10102836
1081 Ga0207707_10126679
1082 Ga0207707_10179236
1083 Ga0207695_10585755
1084 Ga0207693_10219627
1085 Ga0207693_10440821
1086 Ga0207660_10249354
1087 Ga0207660_10315439
1088 Ga0207657_10308712
1089 Ga0207649_10006443
1090 Ga0207652_10019006
1091 Ga0207652_10064827
1092 Ga0207646_10005209
1093 Ga0207646_10082582
1094 Ga0207646_10101490
1095 Ga0207694_10213442
1096 Ga0207659_10024617
1097 Ga0207687_10053312
1098 Ga0207687_10569411
1099 Ga0207664_10155117
1100 Ga0207664_10283520
1101 Ga0207690_10858567
1102 Ga0207706_10052314
1103 Ga0207706_10356467
1104 Ga0207706_10400141
1105 Ga0207686_10013008
1106 Ga0207709_10023965
1107 Ga0207709_10054993
1108 Ga0207669_10090376
1109 Ga0207665_10197506
1110 Ga0207665_10414576
1111 Ga0207661_10397351
1112 Ga0207679_10854435
1113 Ga0207712_10141185
1114 Ga0207712_10241157
1115 Ga0207712_11343581
1116 Ga0207668_10214368
1117 Ga0207668_10323322
1118 Ga0207677_10425052
1119 Ga0207677_11106454
1120 Ga0207677_11283640
1121 Ga0207708_10524684
1122 Ga0207702_10078687
1123 Ga0207702_10407976
1124 Ga0207641_10164982
1125 Ga0207641_10330979
1126 Ga0207641_11231645
1127 Ga0207676_10002670
1128 Ga0207674_10136544
1129 Ga0207675_100006050
1130 Ga0207675_100009258
1131 Ga0207675_100147726
1132 Ga0207428_10001500
1133 Ga0207428_10001517
1134 Ga0207428_10005123
1135 Ga0207428_10012696
1136 Ga0207428_10038369
1137 Ga0268266_10262264
1138 Ga0268265_10145505
1139 Ga0268264_10237489
1140 Ga0265338_10110185
1141 Ga0307512_10006934
1142 Ga0265320_10011603
1143 Ga0265340_10260490
1144 Ga0265339_10025351
1145 Ga0307408_100037465
1146 Ga0307408_100214879
1147 Ga0265313_10103821
1148 Ga0307508_10502881
1149 Ga0265314_10076053
1150 Ga0265342_10033187
1151 Ga0307405_10029958
1152 Ga0307405_10036171
1153 Ga0307405_10524780
1154 Ga0307405_11105355
1155 Ga0307413_10051992
1156 Ga0307413_10053614
1157 Ga0307413_10421686
1158 Ga0307413_10564489
1159 Ga0307410_10065320
1160 Ga0307410_10086775
1161 Ga0307406_10077218
1162 Ga0307406_10088933
1163 Ga0307407_10030392
1164 Ga0307407_10073092
1165 Ga0307407_11143445
1166 Ga0307412_10081366
1167 Ga0307412_10103253
1168 Ga0307409_100045843
1169 Ga0307409_100086368
1170 Ga0307409_100636556
1171 Ga0307416_100001353
1172 Ga0307416_100013927
1173 Ga0307416_100213375
1174 Ga0307414_10081210
1175 Ga0307414_10126997
1176 Ga0307411_10048206
1177 Ga0307411_10094931
1178 Ga0307415_100023850
1179 Ga0307415_100047225
1180 Ga0307415_100237472
1181 Ga0307415_100487348
1182 Ga0307415_100731067
1183 Ga0307415_100816841
1184 Ga0307415_101297126
1185 Ga0373958_0110391
1186 Ga0373928_0102131
1187 Ga0373929_0079050
1188 Ga0373932_0004345
1189 Ga0373936_0007773
1190 Ga0373939_0003258
1191 Ga0373945_0002205
1192 Ga0373945_0064847
1193 Ga0373953_0186736
1194 Ga0373956_0044317
1195 Ga0373960_0118600
1196 Ga0373943_0000643
1197 Ga0373946_0010131
1198 Ga0373946_0050570
1199 Ga0373955_0002200
1200 Ga0373924_0101450
1201 Ga0373924_0262390
1202 Ga0373931_0034199
1203 Ga0373931_0296375
1204 Ga0373935_0493245
1205 Ga0373927_0042746
1206 Ga0373933_0024950
1207 Ga0373947_0026510
1208 Ga0373947_0038831
1209 Ga0373947_0056413
1210 Ga0373947_0383218
1211 Ga0373937_0022593
1212 Ga0373937_0403879
1213 Ga0373925_0003808
1214 Ga0373925_0026030
1215 Ga0373925_0220387
1216 Ga0395899_0231610
1217 Ga0395899_0261623
1218 Ga0395899_0331024
1219 Ga0395899_0597454
1220 Ga0395900_0008417
1221 Ga0395900_0041450
1222 Ga0395900_0075812
1223 Ga0395900_0088410
1224 Ga0395900_0268293
1225 Ga0395898_0035735
1226 Ga0395898_0075480
1227 Ga0395898_0296412
1228 Ga0395898_0402349
1229 Ga0395898_0571874
1230 Ga0395905_0029050
1231 Ga0395905_0068431
1232 Ga0395905_0069420
1233 Ga0395905_0340753
1234 Ga0395905_0525861
1235 Ga0436364_0073490
1236 Ga0436364_0359023
1237 Ga0395901_0034263
1238 Ga0395901_0043793
1239 Ga0395901_0044881
1240 Ga0395901_0051346
1241 Ga0395901_0375113
1242 Ga0395901_0451227
1243 Ga0436360_1133702
1244 Ga0436360_1309648
1245 Ga0436361_0127857
1246 Ga0436361_0449584
1247 Ga0436363_0542485
1248 Ga0436362_0763626
1249 Ga0439439_0153248
1250 Ga0439465_0355509
1251 Ga0439443_010419
1252 Ga0439448_0002814
1253 Ga0439448_0077051
1254 Ga0439450_003685
1255 Ga0439450_016749
1256 Ga0439454_002643
1257 Ga0439455_0054951
1258 Ga0439455_0057795
1259 Ga0439455_0078654
1260 Ga0439463_002574
1261 Ga0439463_030794
1262 Ga0439463_156231
1263 Ga0450913_003029
1264 Ga0450914_001143
1265 Ga0450900_028683
1266 Ga0450902_055281
1267 Ga0450905_005746
1268 Ga0450889_002295
1269 Ga0450907_035672
1270 Ga0439458_0020453
1271 Ga0439458_0111559
1272 Ga0439444_0018811
1273 Ga0439464_0009095
1274 Ga0439464_0020792
1275 Ga0439464_0030414
1276 Ga0439460_0005555
1277 Ga0439460_0212443
1278 Ga0450916_001104
1279 Ga0439440_0000534
1280 Ga0466965_0078991
1281 Ga0466966_0000887
1282 Ga0466963_0001640
1283 Ga0466971_0128524
1284 Ga0466957_0004157
1285 Ga0466959_0031559
1286 Ga0466959_0045582
1287 Ga0451576_0458440
1288 Ga0451576_1148599
1289 Ga0466958_0002878
1290 Ga0466958_0018928
1291 Ga0466967_0189694
1292 Ga0495617_058257
1293 Ga0495592_0108039
1294 Ga0495603_0001259
1295 Ga0495603_0008959
1296 Ga0495603_0035146
1297 Ga0495591_029807
1298 Ga0495629_0000580
1299 Ga0495629_0683929
1300 Ga0495651_0011640
1301 Ga0495651_0014139
1302 Ga0495651_0020821
1303 Ga0495653_0112248
1304 Ga0495653_0127480
1305 Ga0495580_0069647
1306 Ga0495580_0594614
1307 Ga0495580_0675090
1308 Ga0495639_0021086
1309 Ga0495639_0035204
1310 Ga0495662_0029215
1311 Ga0495664_0009359
1312 Ga0495664_0719584
1313 Ga0495584_0039919
1314 Ga0495585_0140132
1315 Ga0495594_0143819
1316 Ga0495596_0063753
1317 Ga0495607_0042969
1318 Ga0495607_0187540
1319 Ga0495608_0007465
1320 Ga0495608_0071498
1321 Ga0495618_0035202
1322 Ga0495618_0068801
1323 Ga0495628_0006341
1324 Ga0495628_0116386
1325 Ga0495630_0023860
1326 Ga0495630_0030667
1327 Ga0495632_0341613
1328 Ga0495644_0183985
1329 Ga0495642_0044015
1330 Ga0495652_0010636
1331 Ga0495652_0162456
1332 Ga0495665_0009317
1333 Ga0495665_0037306
1334 Ga0495586_0084859
1335 Ga0495587_0007478
1336 Ga0495598_0011137
1337 Ga0495598_0063483
1338 Ga0495598_0273797
1339 Ga0495621_0224260
1340 Ga0495597_0278616
1341 Ga0495645_0013507
1342 Ga0495622_0080030
1343 Ga0495633_0146153
1344 Ga0495667_0008462
1345 Ga0495656_0049735
1346 Ga0495656_0179585
1347 Ga0495668_0237191
1348 Ga0495634_0023976
1349 Ga0495611_0094623
1350 Ga0495635_0012376
1351 Ga0495659_0104043
1352 Ga0495661_0083231
1353 Ga0495588_0030193
1354 Ga0495657_0263230
1355 Ga0495657_0356890
1356 Ga0495599_0000701
1357 Ga0495599_0215775
1358 Ga0495623_0124701
1359 Ga0495646_0125975
1360 Ga0495647_0157144
1361 Ga0495658_0002558
1362 Ga0495658_0104906
1363 Ga0495658_0132857
1364 Ga0495658_0147978
1365 Ga0495669_0026448
1366 Ga0495669_0249083
1367 Ga0495669_0257890
1368 Ga0495613_0003552
1369 Ga0495613_0045182
1370 Ga0495613_0797407
1371 Ga0495613_0975691
1372 Ga0495624_0032469
1373 Ga0495624_0154926
1374 Ga0495624_0420610
1375 Ga0495670_0012604
1376 Ga0495670_0260318
1377 Ga0495589_0046540
1378 Ga0495589_0470802
1379 Ga0495600_0035151
1380 Ga0495660_0070685
1381 Ga0495581_0004654
1382 Ga0495581_0006655
1383 Ga0495636_0092017
1384 Ga0495674_0011087
1385 Ga0495674_0599051
1386 Ga0495676_0068338
1387 Ga0495680_0004959
1388 Ga0495680_0015445
1389 Ga0495683_0342174
1390 Ga0495675_0022963
1391 Ga0495677_0151259
1392 Ga0495679_034151
1393 Ga0495684_0002173
1394 Ga0495684_0022862
1395 Ga0495593_0035302
1396 Ga0495602_0153291
1397 Ga0495602_0216608
1398 Ga0495602_0273731
1399 Ga0495614_0063362
1400 Ga0495614_0206049
1401 Ga0496100_0012047
1402 Ga0496100_0018163
1403 Ga0496105_0118280
1404 Ga0496106_0010334
1405 Ga0496107_0014287
1406 Ga0496108_0026709
1407 Ga0496108_0319199
1408 Ga0496109_0029507
1409 Ga0496109_0203327
1410 Ga0496110_0008928
1411 Ga0496110_0031513
1412 Ga0496110_0101045
1413 Ga0496110_0338324
1414 Ga0496110_0645430
1415 Ga0496111_0000396
1416 Ga0496112_0101490
1417 Ga0496112_0270757
1418 Ga0496113_0299615
1419 Ga0496113_0669676
1420 Ga0496114_0228935
1421 Ga0496114_0600255
1422 Ga0496114_0732825
1423 Ga0496115_0220294
1424 Ga0501031_0030814
1425 Ga0501031_0385698
1426 Ga0501032_0295392
1427 Ga0501033_0012342
1428 Ga0501033_0035041
1429 Ga0501033_0089341
1430 Ga0501036_0004978
1431 Ga0501036_0029664
1432 Ga0501036_0064669
1433 Ga0501036_0075164
1434 Ga0501036_1191057
1435 Ga0501037_0029314
1436 Ga0501037_0126498
1437 Ga0501037_0151568
1438 Ga0501038_0007864
1439 Ga0501038_0009086
1440 Ga0501038_0061396
1441 Ga0501038_0299672
1442 Ga0501038_0359614
1443 Ga0501039_0004611
1444 Ga0501039_0004615
1445 Ga0501039_0093223
1446 Ga0501039_0119675
1447 Ga0501039_0152114
1448 Ga0501039_0455240
1449 Ga0501039_0524532
1450 Ga0501040_0002408
1451 Ga0501040_0003475
1452 Ga0501040_0014580
1453 Ga0501040_0020342
1454 Ga0501040_0128177
1455 Ga0501040_0134761
1456 Ga0501040_0205795
1457 Ga0501041_0000041
1458 Ga0501041_0002431
1459 Ga0501041_0025935
1460 Ga0501041_0139834
1461 Ga0501041_0222032
1462 Ga0501042_0002936
1463 Ga0501042_0004188
1464 Ga0501042_0005831
1465 Ga0501042_0006075
1466 Ga0501042_0009128
1467 Ga0501042_0035806
1468 Ga0501042_0082544
1469 Ga0501042_0219295
1470 Ga0501042_0289589
1471 Ga0501043_0016315
1472 Ga0501043_0039869
1473 Ga0501043_0056235
1474 Ga0501043_0318852
1475 Ga0501043_0408536
1476 Ga0501046_0010306
1477 Ga0501046_0012266
1478 Ga0501046_0245807
1479 Ga0501046_0334092
1480 Ga0501048_0000970
1481 Ga0501048_0001880
1482 Ga0501048_0031845
1483 Ga0501048_0079870
1484 Ga0501048_0081482
1485 Ga0501048_0192473
1486 Ga0501048_0919693
1487 Ga0501067_0005433
1488 Ga0501068_0010287
1489 Ga0501068_0016757
1490 Ga0501068_0096740
1491 Ga0501068_0336348
1492 Ga0501068_0410227
1493 Ga0501069_0004219
1494 Ga0501070_0096049
1495 Ga0501070_0181522
1496 Ga0501070_0366222
1497 Ga0501070_0503659
1498 Ga0501070_0511243
1499 Ga0501070_0773149
1500 Ga0501071_0004087
1501 Ga0501071_0024748
1502 Ga0501071_0028914
1503 Ga0501071_0035558
1504 Ga0501071_0073865
1505 Ga0501071_0096950
1506 Ga0501071_0155395
1507 Ga0501071_0400803
1508 Ga0501072_0005064
1509 Ga0501072_0007049
1510 Ga0501072_0014483
1511 Ga0501072_0022112
1512 Ga0501072_0033667
1513 Ga0501072_0048230
1514 Ga0501072_0087768
1515 Ga0501072_0978910
1516 Ga0501072_1396079
1517 Ga0501073_0607031
1518 Ga0501074_0008216
1519 Ga0501074_0008920
1520 Ga0501074_0016656
1521 Ga0501074_0026814
1522 Ga0501074_0086611
1523 Ga0501074_0086945
1524 Ga0501074_0087452
1525 Ga0501074_0158128
1526 Ga0501074_0490876
1527 Ga0501074_0753410
1528 Ga0501074_0778041
1529 Ga0501075_0000384
1530 Ga0501075_0027098
1531 Ga0501075_0046131
1532 Ga0501075_0053417
1533 Ga0501075_0064727
1534 Ga0501075_0103696
1535 Ga0501075_0140374
1536 Ga0501076_0000373
1537 Ga0501076_0002165
1538 Ga0501076_0002705
1539 Ga0501076_0008115
1540 Ga0501076_0113051
1541 Ga0501076_0161658
1542 Ga0501076_0415235
1543 Ga0501076_1032087
1544 Ga0501077_0002637
1545 Ga0501077_0017728
1546 Ga0501077_0044547
1547 Ga0501077_0074060
1548 Ga0501077_0155359
1549 Ga0501077_0309969
1550 Ga0501217_140144
1551 Ga0501079_0003332
1552 Ga0501079_0014627
1553 Ga0501079_0049887
1554 Ga0501079_0111940
1555 Ga0501079_0166886
1556 Ga0501079_0192609
1557 Ga0501079_0194323
1558 Ga0501079_0318090
1559 Ga0501079_1008851
1560 Ga0501080_0021407
1561 Ga0501080_0067392
1562 Ga0501080_0591036
1563 Ga0501081_0002206
1564 Ga0501081_0004682
1565 Ga0501081_0040461
1566 Ga0501081_0056000
1567 Ga0501081_0251539
1568 Ga0501081_1060195
1569 Ga0501268_093110
1570 Ga0501035_0031924
1571 Ga0501035_0045881
1572 Ga0501035_0250267
1573 Ga0501045_0000460
1574 Ga0501045_0002493
1575 Ga0501045_0002574
1576 Ga0501045_0006800
1577 Ga0501045_0101314
1578 Ga0501045_0200507
1579 Ga0501045_1056320
1580 nmdc:mga05p37_24412_c1
1581 nmdc:mga05p37_46997_c1
1582 nmdc:mga05p37_51199_c1
1583 nmdc:mga05p37_5452_c1
1584 nmdc:mga05p37_6613_c1
1585 nmdc:mga05p37_85318_c1
1586 nmdc:mga05p37_858521_c1
1587 nmdc:mga09592_133977_c1
1588 nmdc:mga09592_137719_c1
1589 nmdc:mga09592_13980_c1
1590 nmdc:mga0qj67_23075_c1
1591 nmdc:mga0qj67_355803_c1
1592 nmdc:mga0qj67_96750_c1
1593 nmdc:mga06r32_12115_c1
1594 nmdc:mga06r32_18282_c1
1595 nmdc:mga06r32_296162_c1
1596 nmdc:mga06r32_311631_c1
1597 nmdc:mga08y16_11473_c1
1598 nmdc:mga08y16_12137_c1
1599 nmdc:mga08y16_380138_c1
1600 nmdc:mga08y16_388109_c1
1601 nmdc:mga08y16_712841_c1
1602 nmdc:mga08y16_778850_c1
1603 nmdc:mga0n895_228065_c1
1604 nmdc:mga0n895_2298_c1
1605 nmdc:mga0n895_328891_c1
1606 nmdc:mga0n895_8340_c1
1607 nmdc:mga0rr50_66004_c1
1608 nmdc:mga0rr50_68882_c1
1609 nmdc:mga08x19_312419_c1
1610 nmdc:mga0a205_11872_c1
1611 nmdc:mga0a205_25198_c1
1612 nmdc:mga0a205_670554_c1
1613 nmdc:mga0a205_80687_c1
1614 nmdc:mga0a205_95358_c1
1615 nmdc:mga0a205_9802_c1
1616 Ga0495601_0001651
1617 Ga0495601_0007552
1618 Ga0495601_0454117
1619 Ga0495612_0363178
1620 Ga0495595_0189613
1621 Ga0501084_0000697
1622 Ga0501084_0000767
1623 Ga0501084_0015598
1624 Ga0501084_0069461
1625 Ga0501084_0069832
1626 Ga0501084_0086042
1627 Ga0501084_0144316
1628 Ga0501084_0263813
1629 Ga0501084_1182167
1630 Ga0590071_029381
1631 Ga0590074_003848
1632 Ga0590075_001038
1633 Ga0590075_017998
1634 Ga0590077_002509
1635 Ga0590077_081702
1636 Ga0587066_152548
1637 Ga0587073_0007531
1638 Ga0587073_0014020
1639 Ga0587082_129959
1640 Ga0587083_0061252
1641 Ga0587086_040303
1642 Ga0587089_005641
1643 Ga0587094_121973
1644 Ga0587115_022488
1645 Ga0587117_000258
1646 Ga0587072_002001
1647 Ga0587072_033152
1648 Ga0587075_003990
1649 Ga0587078_024720
1650 Ga0587079_021625
1651 Ga0587079_038773
1652 Ga0587102_006889
1653 Ga0587071_026839
1654 Ga0587111_0004880
1655 Ga0501082_0008656
1656 Ga0501082_0011849
1657 Ga0501082_0020961
1658 Ga0501082_0025852
1659 Ga0501082_0052080
1660 Ga0501082_0069429
1661 Ga0501082_0072105
1662 Ga0501082_1020004
1663 Ga0466962_0005013
1664 Ga0530510_0001371
1665 Ga0530510_0006802
1666 Ga0530510_0022544
1667 Ga0530510_0022753
1668 Ga0530510_0179366
1669 Ga0530510_0187613
1670 Ga0530510_0217904
1671 Ga0530510_0224381
1672 Ga0530510_0411214
1673 Ga0530510_0589611
1674 Ga0530510_0938492

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

146

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

5

75

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9598 1 153
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9586 1 154
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9562 2 152
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9562 1 153
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9449 1 153
ID Description Score Start End Superfamily
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9641 1 75 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.958 1 75 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9538 1 73 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9477 1 75 3.10.20.30
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9471 1 75 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2W5ZLB2-F1-model_v4 Carbon monoxide dehydrogenase 0.9741 1 158 GO:0016491
GO:0046872
GO:0051537
AF-A0A1E3RY14-F1-model_v4 Carbon monoxide dehydrogenase 0.9736 1 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A1T5A9Z4-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9736 1 151 GO:0016491
GO:0046872
GO:0051537
AF-G7CHX0-F1-model_v4 Carbon monoxide dehydrogenase (Small chain), CoxS 0.9733 1 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A3D3YT62-F1-model_v4 Carbon monoxide dehydrogenase 0.9732 1 151 GO:0016491
GO:0046872
GO:0051537

Map