F482913
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 397 | 835 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0410636|Ga0501034_0410636_183_959 |
| Length | 258 |
| Sequence | MARKPKHQSQTPAPPSAPPPRGTSDRDKAIDALIALLAERPFDEIGLAEIAGRAGIKLSQLRAEFGSPLAIFAAHVKDIDRRVLDGGDTDMSDEAPRDRLFEVLMRRLDAMKPYREAVRSMLRSARRHPSLALALNAMAVRSQQWMLEAAGIHASGPKGLMRAQGSALMFARVLSVWIDDEDEGLDRTMAALDRGLASAERWAGFLNDLCAVPKCLVRGHRGSQRGLASIHHPEEPRSGPRRMTGTAPRPSILPLWVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 262 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 388 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 389 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 390 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.56 |
| Metatranscriptomes | 1.32 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.63 |
| Nodule | 0 |
| Rhizoplane | 6.46 |
| Rhizosphere | 90.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214772988 | 2209111006 | Bacteria | 11988 |
| 2 | ARcpr5oldR_c000150 | 3300000041 | Bacteria | 12077 |
| 3 | ARSoilYngRDRAFT_c00394 | 3300000042 | Bacteria | 5757 |
| 4 | ARcpr5yngRDRAFT_c000123 | 3300000043 | Bacteria | 12049 |
| 5 | ARSoilOldRDRAFT_c000007 | 3300000044 | Bacteria | 55959 |
| 6 | ARCol0oldRDRAFT_c00020 | 3300000045 | Bacteria | 12065 |
| 7 | ARCol0yngRDRAFT_1000290 | 3300000652 | Bacteria | 7781 |
| 8 | JGI24746J21847_1001263 | 3300001977 | Bacteria | 4039 |
| 9 | JGI24747J21853_1005813 | 3300001978 | Bacteria | 1149 |
| 10 | JGI24737J22298_10014250 | 3300001990 | Bacteria | 2582 |
| 11 | JGI24750J21931_1000532 | 3300002070 | Bacteria | 5867 |
| 12 | JGI24745J21846_1001764 | 3300002073 | Bacteria | 2134 |
| 13 | JGI24748J21848_1001717 | 3300002074 | Bacteria | 2430 |
| 14 | JGI24738J21930_10001430 | 3300002075 | Bacteria | 6625 |
| 15 | JGI24744J21845_10003290 | 3300002077 | Bacteria | 3319 |
| 16 | JGI24035J26624_1000877 | 3300002126 | Bacteria | 2842 |
| 17 | JGI24034J26672_10000969 | 3300002239 | Bacteria | 3750 |
| 18 | JGI24742J22300_10000325 | 3300002244 | Bacteria | 7086 |
| 19 | Ga0065716_1001614 | 3300005277 | Bacteria | 5215 |
| 20 | Ga0065704_10072439 | 3300005289 | Bacteria | 8525 |
| 21 | Ga0065712_10071797 | 3300005290 | Bacteria | 5059 |
| 22 | Ga0065715_10003150 | 3300005293 | Bacteria | 9200 |
| 23 | Ga0065715_10089667 | 3300005293 | Bacteria | 9013 |
| 24 | Ga0070658_10008781 | 3300005327 | Bacteria | 8120 |
| 25 | Ga0070676_10033910 | 3300005328 | Bacteria | 2929 |
| 26 | Ga0070683_100036987 | 3300005329 | Bacteria | 4467 |
| 27 | Ga0070690_100012762 | 3300005330 | Bacteria | 4948 |
| 28 | Ga0070690_100122896 | 3300005330 | Bacteria | 1744 |
| 29 | Ga0070670_100006862 | 3300005331 | Bacteria | 9649 |
| 30 | Ga0070677_10000988 | 3300005333 | Bacteria | 9191 |
| 31 | Ga0068869_100006414 | 3300005334 | Bacteria | 7460 |
| 32 | Ga0070666_10029109 | 3300005335 | Bacteria | 3629 |
| 33 | Ga0070680_100002248 | 3300005336 | Bacteria | 14256 |
| 34 | Ga0070680_100024074 | 3300005336 | Bacteria | 4860 |
| 35 | Ga0070680_100044425 | 3300005336 | Bacteria | 3610 |
| 36 | Ga0070680_100074935 | 3300005336 | Bacteria | 2785 |
| 37 | Ga0070680_100080355 | 3300005336 | Bacteria | 2688 |
| 38 | Ga0070680_100158004 | 3300005336 | Bacteria | 1905 |
| 39 | Ga0070680_100268648 | 3300005336 | Bacteria | 1444 |
| 40 | Ga0070682_100011702 | 3300005337 | Bacteria | 5017 |
| 41 | Ga0070682_100213593 | 3300005337 | Bacteria | 1369 |
| 42 | Ga0070682_100456343 | 3300005337 | Bacteria | 980 |
| 43 | Ga0068868_100002461 | 3300005338 | Bacteria | 12859 |
| 44 | Ga0070660_100024777 | 3300005339 | Bacteria | 4455 |
| 45 | Ga0070660_100034337 | 3300005339 | Bacteria | 3831 |
| 46 | Ga0070660_100158724 | 3300005339 | Bacteria | 1821 |
| 47 | Ga0070689_100074333 | 3300005340 | Bacteria | 2659 |
| 48 | Ga0070689_100287691 | 3300005340 | Bacteria | 1365 |
| 49 | Ga0070689_100298063 | 3300005340 | Bacteria | 1341 |
| 50 | Ga0070691_10001048 | 3300005341 | Bacteria | 11394 |
| 51 | Ga0070691_10127262 | 3300005341 | Bacteria | 1288 |
| 52 | Ga0070687_100001539 | 3300005343 | Bacteria | 8169 |
| 53 | Ga0070687_100002921 | 3300005343 | Bacteria | 6556 |
| 54 | Ga0070661_100142399 | 3300005344 | Bacteria | 1808 |
| 55 | Ga0070692_10001006 | 3300005345 | Bacteria | 9699 |
| 56 | Ga0070692_10073538 | 3300005345 | Bacteria | 1826 |
| 57 | Ga0070668_100034942 | 3300005347 | Bacteria | 3831 |
| 58 | Ga0070668_100095260 | 3300005347 | Bacteria | 2351 |
| 59 | Ga0070668_100281096 | 3300005347 | Unclassified | 1390 |
| 60 | Ga0070669_100002469 | 3300005353 | Bacteria | 13390 |
| 61 | Ga0070669_100112134 | 3300005353 | Bacteria | 2071 |
| 62 | Ga0070669_100527797 | 3300005353 | Bacteria | 982 |
| 63 | Ga0070675_100007875 | 3300005354 | Bacteria | 8257 |
| 64 | Ga0070675_100192967 | 3300005354 | Bacteria | 1765 |
| 65 | Ga0070671_100027809 | 3300005355 | Bacteria | 4655 |
| 66 | Ga0070674_100026094 | 3300005356 | Bacteria | 3812 |
| 67 | Ga0070674_100230633 | 3300005356 | Bacteria | 1445 |
| 68 | Ga0070673_100000950 | 3300005364 | Bacteria | 16418 |
| 69 | Ga0070673_100484704 | 3300005364 | Bacteria | 1117 |
| 70 | Ga0070688_100003204 | 3300005365 | Bacteria | 8386 |
| 71 | Ga0070659_100006909 | 3300005366 | Bacteria | 8218 |
| 72 | Ga0070659_100086149 | 3300005366 | Bacteria | 2513 |
| 73 | Ga0070659_100286565 | 3300005366 | Unclassified | 1371 |
| 74 | Ga0070659_100661369 | 3300005366 | Bacteria | 901 |
| 75 | Ga0070667_100182185 | 3300005367 | Bacteria | 1858 |
| 76 | Ga0070667_100227279 | 3300005367 | Bacteria | 1663 |
| 77 | Ga0070709_10014181 | 3300005434 | Bacteria | 4502 |
| 78 | Ga0070714_100049845 | 3300005435 | Bacteria | 3564 |
| 79 | Ga0070714_100167523 | 3300005435 | Bacteria | 1992 |
| 80 | Ga0070714_100168615 | 3300005435 | Bacteria | 1985 |
| 81 | Ga0070714_100337229 | 3300005435 | Bacteria | 1413 |
| 82 | Ga0070713_100207921 | 3300005436 | Bacteria | 1770 |
| 83 | Ga0070710_10019546 | 3300005437 | Bacteria | 3502 |
| 84 | Ga0070710_10028747 | 3300005437 | Bacteria | 2976 |
| 85 | Ga0070701_10001420 | 3300005438 | Bacteria | 8867 |
| 86 | Ga0070701_10016393 | 3300005438 | Bacteria | 3444 |
| 87 | Ga0070711_100063686 | 3300005439 | Bacteria | 2574 |
| 88 | Ga0070711_100151412 | 3300005439 | Bacteria | 1749 |
| 89 | Ga0070711_100190525 | 3300005439 | Bacteria | 1576 |
| 90 | Ga0070700_100014469 | 3300005441 | Bacteria | 4455 |
| 91 | Ga0070694_100027621 | 3300005444 | Bacteria | 3687 |
| 92 | Ga0070694_100058571 | 3300005444 | Bacteria | 2621 |
| 93 | Ga0070694_100136162 | 3300005444 | Bacteria | 1780 |
| 94 | Ga0070708_100487167 | 3300005445 | Bacteria | 1163 |
| 95 | Ga0070663_100175121 | 3300005455 | Bacteria | 1661 |
| 96 | Ga0070662_100059002 | 3300005457 | Bacteria | 2794 |
| 97 | Ga0070662_100095940 | 3300005457 | Bacteria | 2236 |
| 98 | Ga0070662_100162522 | 3300005457 | Bacteria | 1748 |
| 99 | Ga0070681_10028339 | 3300005458 | Bacteria | 5629 |
| 100 | Ga0070681_10039416 | 3300005458 | Bacteria | 4736 |
| 101 | Ga0070681_10054250 | 3300005458 | Bacteria | 3994 |
| 102 | Ga0070681_10200162 | 3300005458 | Bacteria | 1916 |
| 103 | Ga0068867_100001504 | 3300005459 | Bacteria | 16138 |
| 104 | Ga0068867_100444073 | 3300005459 | Bacteria | 1104 |
| 105 | Ga0070685_10023092 | 3300005466 | Bacteria | 3401 |
| 106 | Ga0070685_10064625 | 3300005466 | Bacteria | 2152 |
| 107 | Ga0070707_100980370 | 3300005468 | Unclassified | 810 |
| 108 | Ga0070699_100332377 | 3300005518 | Bacteria | 1367 |
| 109 | Ga0070679_100058641 | 3300005530 | Bacteria | 3836 |
| 110 | Ga0070679_100124721 | 3300005530 | Bacteria | 2558 |
| 111 | Ga0070679_100142953 | 3300005530 | Bacteria | 2371 |
| 112 | Ga0070679_100259971 | 3300005530 | Bacteria | 1691 |
| 113 | Ga0070684_100003143 | 3300005535 | Bacteria | 12332 |
| 114 | Ga0070684_100129503 | 3300005535 | Bacteria | 2276 |
| 115 | Ga0068853_100006565 | 3300005539 | Bacteria | 9267 |
| 116 | Ga0068853_100199077 | 3300005539 | Bacteria | 1822 |
| 117 | Ga0070672_100153037 | 3300005543 | Bacteria | 1909 |
| 118 | Ga0070672_100168917 | 3300005543 | Bacteria | 1818 |
| 119 | Ga0070686_100003197 | 3300005544 | Bacteria | 8978 |
| 120 | Ga0070686_100393737 | 3300005544 | Unclassified | 1052 |
| 121 | Ga0070695_100014595 | 3300005545 | Bacteria | 4736 |
| 122 | Ga0070696_100006401 | 3300005546 | Bacteria | 7881 |
| 123 | Ga0070696_100024235 | 3300005546 | Bacteria | 4123 |
| 124 | Ga0070696_100105465 | 3300005546 | Bacteria | 2025 |
| 125 | Ga0070693_100023336 | 3300005547 | Bacteria | 3306 |
| 126 | Ga0070693_100126925 | 3300005547 | Bacteria | 1589 |
| 127 | Ga0070704_100018521 | 3300005549 | Bacteria | 4455 |
| 128 | Ga0068855_100034704 | 3300005563 | Bacteria | 6012 |
| 129 | Ga0068855_100050850 | 3300005563 | Bacteria | 4882 |
| 130 | Ga0068855_100055497 | 3300005563 | Bacteria | 4653 |
| 131 | Ga0068855_100063448 | 3300005563 | Bacteria | 4312 |
| 132 | Ga0068855_100092066 | 3300005563 | Bacteria | 3496 |
| 133 | Ga0068855_100421556 | 3300005563 | Bacteria | 1460 |
| 134 | Ga0070664_100065346 | 3300005564 | Bacteria | 3103 |
| 135 | Ga0070664_101111406 | 3300005564 | Bacteria | 745 |
| 136 | Ga0068857_100000616 | 3300005577 | Bacteria | 26168 |
| 137 | Ga0068857_100450248 | 3300005577 | Bacteria | 1203 |
| 138 | Ga0068854_100003096 | 3300005578 | Bacteria | 10357 |
| 139 | Ga0068854_100039018 | 3300005578 | Bacteria | 3343 |
| 140 | Ga0068854_100086516 | 3300005578 | Bacteria | 2324 |
| 141 | Ga0068856_100003598 | 3300005614 | Bacteria | 15595 |
| 142 | Ga0068856_100302258 | 3300005614 | Bacteria | 1618 |
| 143 | Ga0068852_100006718 | 3300005616 | Bacteria | 8344 |
| 144 | Ga0068852_100333399 | 3300005616 | Bacteria | 1477 |
| 145 | Ga0068859_100012599 | 3300005617 | Bacteria | 8504 |
| 146 | Ga0068859_100202356 | 3300005617 | Bacteria | 2071 |
| 147 | Ga0068864_100001534 | 3300005618 | Bacteria | 19014 |
| 148 | Ga0068866_10003980 | 3300005718 | Bacteria | 6062 |
| 149 | Ga0068861_100728868 | 3300005719 | Bacteria | 924 |
| 150 | Ga0068870_10000289 | 3300005840 | Bacteria | 18688 |
| 151 | Ga0068858_100009901 | 3300005842 | Bacteria | 9055 |
| 152 | Ga0068858_100051708 | 3300005842 | Bacteria | 3801 |
| 153 | Ga0068860_100017484 | 3300005843 | Bacteria | 6987 |
| 154 | Ga0068860_100029565 | 3300005843 | Bacteria | 5272 |
| 155 | Ga0068862_100005504 | 3300005844 | Bacteria | 10580 |
| 156 | Ga0068862_100239992 | 3300005844 | Bacteria | 1647 |
| 157 | Ga0081455_10000540 | 3300005937 | Bacteria | 49195 |
| 158 | Ga0081455_10008929 | 3300005937 | Bacteria | 10360 |
| 159 | Ga0081455_10014732 | 3300005937 | Bacteria | 7633 |
| 160 | Ga0070717_10294740 | 3300006028 | Bacteria | 1441 |
| 161 | Ga0075368_10058580 | 3300006042 | Bacteria | 1539 |
| 162 | Ga0075363_100018969 | 3300006048 | Bacteria | 3433 |
| 163 | Ga0075363_100090855 | 3300006048 | Bacteria | 1680 |
| 164 | Ga0075363_100119038 | 3300006048 | Bacteria | 1473 |
| 165 | Ga0070716_100034968 | 3300006173 | Bacteria | 2759 |
| 166 | Ga0070712_100171085 | 3300006175 | Bacteria | 1685 |
| 167 | Ga0070712_100706908 | 3300006175 | Bacteria | 860 |
| 168 | Ga0075362_10044204 | 3300006177 | Bacteria | 1974 |
| 169 | Ga0075367_10057035 | 3300006178 | Bacteria | 2322 |
| 170 | Ga0075427_10000344 | 3300006194 | Bacteria | 5117 |
| 171 | Ga0097621_100001930 | 3300006237 | Bacteria | 14142 |
| 172 | Ga0097621_100094037 | 3300006237 | Bacteria | 2513 |
| 173 | Ga0075370_10254295 | 3300006353 | Bacteria | 1041 |
| 174 | Ga0068871_100001884 | 3300006358 | Bacteria | 14190 |
| 175 | Ga0075428_100005389 | 3300006844 | Bacteria | 14223 |
| 176 | Ga0075428_100313407 | 3300006844 | Bacteria | 1686 |
| 177 | Ga0075430_100000426 | 3300006846 | Bacteria | 31396 |
| 178 | Ga0075431_100005525 | 3300006847 | Bacteria | 12476 |
| 179 | Ga0075433_10000029 | 3300006852 | Bacteria | 55893 |
| 180 | Ga0075433_10005937 | 3300006852 | Bacteria | 9616 |
| 181 | Ga0075433_10010527 | 3300006852 | Bacteria | 7429 |
| 182 | Ga0075434_100000208 | 3300006871 | Bacteria | 39868 |
| 183 | Ga0075434_100003871 | 3300006871 | Bacteria | 13392 |
| 184 | Ga0075434_100058176 | 3300006871 | Bacteria | 3842 |
| 185 | Ga0075434_100059772 | 3300006871 | Bacteria | 3790 |
| 186 | Ga0075434_100097978 | 3300006871 | Bacteria | 2937 |
| 187 | Ga0075434_100244633 | 3300006871 | Bacteria | 1814 |
| 188 | Ga0075429_100000734 | 3300006880 | Bacteria | 25672 |
| 189 | Ga0075436_100259605 | 3300006914 | Bacteria | 1239 |
| 190 | Ga0075436_100284281 | 3300006914 | Unclassified | 1183 |
| 191 | Ga0075436_100302194 | 3300006914 | Bacteria | 1147 |
| 192 | Ga0097620_100012598 | 3300006931 | Bacteria | 8504 |
| 193 | Ga0097620_100202349 | 3300006931 | Bacteria | 2071 |
| 194 | Ga0075435_100001396 | 3300007076 | Bacteria | 15545 |
| 195 | Ga0075435_100035116 | 3300007076 | Bacteria | 3977 |
| 196 | Ga0075435_100056535 | 3300007076 | Bacteria | 3172 |
| 197 | Ga0075435_100081695 | 3300007076 | Bacteria | 2655 |
| 198 | Ga0075435_100253011 | 3300007076 | Bacteria | 1500 |
| 199 | Ga0105240_10045619 | 3300009093 | Bacteria | 5559 |
| 200 | Ga0105240_11075781 | 3300009093 | Bacteria | 857 |
| 201 | Ga0111539_10001931 | 3300009094 | Bacteria | 27629 |
| 202 | Ga0105245_10002784 | 3300009098 | Bacteria | 15726 |
| 203 | Ga0105245_10011288 | 3300009098 | Bacteria | 7780 |
| 204 | Ga0105245_10909693 | 3300009098 | Unclassified | 922 |
| 205 | Ga0105247_10003272 | 3300009101 | Bacteria | 10625 |
| 206 | Ga0105247_10510540 | 3300009101 | Bacteria | 877 |
| 207 | Ga0105243_10131082 | 3300009148 | Bacteria | 2126 |
| 208 | Ga0105243_10151695 | 3300009148 | Bacteria | 1989 |
| 209 | Ga0105241_10000940 | 3300009174 | Bacteria | 21996 |
| 210 | Ga0105241_10034680 | 3300009174 | Bacteria | 3792 |
| 211 | Ga0105242_10259660 | 3300009176 | Bacteria | 1569 |
| 212 | Ga0105248_10012521 | 3300009177 | Bacteria | 9355 |
| 213 | Ga0105248_10013721 | 3300009177 | Bacteria | 8920 |
| 214 | Ga0105248_10096829 | 3300009177 | Bacteria | 3324 |
| 215 | Ga0105237_10095275 | 3300009545 | Bacteria | 2966 |
| 216 | Ga0105238_10044004 | 3300009551 | Bacteria | 4516 |
| 217 | Ga0105238_10193544 | 3300009551 | Bacteria | 2009 |
| 218 | Ga0105249_10008288 | 3300009553 | Bacteria | 9052 |
| 219 | Ga0105239_10171884 | 3300010375 | Bacteria | 2423 |
| 220 | Ga0105239_10312868 | 3300010375 | Bacteria | 1770 |
| 221 | Ga0105239_11006973 | 3300010375 | Bacteria | 958 |
| 222 | Ga0105239_11083825 | 3300010375 | Bacteria | 922 |
| 223 | Ga0105246_10014037 | 3300011119 | Bacteria | 5032 |
| 224 | Ga0157373_10333937 | 3300013100 | Bacteria | 1079 |
| 225 | Ga0157371_10022118 | 3300013102 | Bacteria | 4664 |
| 226 | Ga0157371_10134407 | 3300013102 | Bacteria | 1761 |
| 227 | Ga0157370_10387776 | 3300013104 | Bacteria | 1286 |
| 228 | Ga0157369_10242476 | 3300013105 | Bacteria | 1882 |
| 229 | Ga0157374_10308246 | 3300013296 | Unclassified | 1567 |
| 230 | Ga0157378_10011895 | 3300013297 | Bacteria | 7622 |
| 231 | Ga0157378_10059489 | 3300013297 | Bacteria | 3409 |
| 232 | Ga0157372_10026975 | 3300013307 | Bacteria | 6254 |
| 233 | Ga0157372_10591980 | 3300013307 | Bacteria | 1293 |
| 234 | Ga0157372_11163556 | 3300013307 | Bacteria | 892 |
| 235 | Ga0157375_10011247 | 3300013308 | Bacteria | 7898 |
| 236 | Ga0163163_10001710 | 3300014325 | Bacteria | 18534 |
| 237 | Ga0163163_10045479 | 3300014325 | Bacteria | 4308 |
| 238 | Ga0157380_10004849 | 3300014326 | Bacteria | 9367 |
| 239 | Ga0157377_10003757 | 3300014745 | Bacteria | 6888 |
| 240 | Ga0157379_10031646 | 3300014968 | Bacteria | 4714 |
| 241 | Ga0157379_10116794 | 3300014968 | Bacteria | 2400 |
| 242 | Ga0157376_10002411 | 3300014969 | Bacteria | 12632 |
| 243 | Ga0163161_10001476 | 3300017792 | Bacteria | 17368 |
| 244 | Ga0197907_10034627 | 3300020069 | Bacteria | 2290 |
| 245 | Ga0206356_10149498 | 3300020070 | Bacteria | 1033 |
| 246 | Ga0206356_11516001 | 3300020070 | Bacteria | 847 |
| 247 | Ga0206356_11782481 | 3300020070 | Bacteria | 2692 |
| 248 | Ga0206356_11846112 | 3300020070 | Bacteria | 1551 |
| 249 | Ga0206351_10124265 | 3300020077 | Bacteria | 738 |
| 250 | Ga0206352_10069452 | 3300020078 | Bacteria | 1030 |
| 251 | Ga0206350_11124917 | 3300020080 | Bacteria | 1129 |
| 252 | Ga0206354_10235034 | 3300020081 | Bacteria | 947 |
| 253 | Ga0206353_11809109 | 3300020082 | Bacteria | 1862 |
| 254 | Ga0224712_10259867 | 3300022467 | Bacteria | 804 |
| 255 | Ga0209233_1008959 | 3300025261 | Bacteria | 3063 |
| 256 | Ga0207666_1000224 | 3300025271 | Bacteria | 8258 |
| 257 | Ga0207673_1000001 | 3300025290 | Bacteria | 29268 |
| 258 | Ga0207697_10002732 | 3300025315 | Bacteria | 9004 |
| 259 | Ga0207697_10032683 | 3300025315 | Bacteria | 2129 |
| 260 | Ga0207682_10000056 | 3300025893 | Bacteria | 48265 |
| 261 | Ga0207692_10063961 | 3300025898 | Bacteria | 1914 |
| 262 | Ga0207642_10001098 | 3300025899 | Bacteria | 8391 |
| 263 | Ga0207642_10093155 | 3300025899 | Bacteria | 1493 |
| 264 | Ga0207710_10169993 | 3300025900 | Bacteria | 1065 |
| 265 | Ga0207688_10003180 | 3300025901 | Bacteria | 8955 |
| 266 | Ga0207680_10016469 | 3300025903 | Bacteria | 3882 |
| 267 | Ga0207647_10007813 | 3300025904 | Bacteria | 7699 |
| 268 | Ga0207647_10037671 | 3300025904 | Bacteria | 3064 |
| 269 | Ga0207685_10054018 | 3300025905 | Bacteria | 1563 |
| 270 | Ga0207699_10185925 | 3300025906 | Bacteria | 1399 |
| 271 | Ga0207699_10295613 | 3300025906 | Unclassified | 1129 |
| 272 | Ga0207699_10373578 | 3300025906 | Bacteria | 1011 |
| 273 | Ga0207645_10000249 | 3300025907 | Bacteria | 44921 |
| 274 | Ga0207643_10000187 | 3300025908 | Bacteria | 42567 |
| 275 | Ga0207705_10012753 | 3300025909 | Bacteria | 6064 |
| 276 | Ga0207705_10021541 | 3300025909 | Bacteria | 4601 |
| 277 | Ga0207684_10005931 | 3300025910 | Bacteria | 11183 |
| 278 | Ga0207654_10002376 | 3300025911 | Bacteria | 9636 |
| 279 | Ga0207707_10008213 | 3300025912 | Bacteria | 9059 |
| 280 | Ga0207707_10028228 | 3300025912 | Bacteria | 4905 |
| 281 | Ga0207707_10082519 | 3300025912 | Bacteria | 2806 |
| 282 | Ga0207707_10109695 | 3300025912 | Bacteria | 2412 |
| 283 | Ga0207707_10234401 | 3300025912 | Bacteria | 1597 |
| 284 | Ga0207707_10299765 | 3300025912 | Bacteria | 1390 |
| 285 | Ga0207707_10326177 | 3300025912 | Bacteria | 1325 |
| 286 | Ga0207671_10026338 | 3300025914 | Bacteria | 4360 |
| 287 | Ga0207671_10136790 | 3300025914 | Bacteria | 1884 |
| 288 | Ga0207693_10004402 | 3300025915 | Bacteria | 11913 |
| 289 | Ga0207693_10055395 | 3300025915 | Bacteria | 3111 |
| 290 | Ga0207663_10007138 | 3300025916 | Bacteria | 5774 |
| 291 | Ga0207663_10169015 | 3300025916 | Bacteria | 1551 |
| 292 | Ga0207663_10379412 | 3300025916 | Bacteria | 1077 |
| 293 | Ga0207660_10101618 | 3300025917 | Bacteria | 2148 |
| 294 | Ga0207660_10125208 | 3300025917 | Bacteria | 1951 |
| 295 | Ga0207660_10231954 | 3300025917 | Bacteria | 1451 |
| 296 | Ga0207660_10592181 | 3300025917 | Bacteria | 903 |
| 297 | Ga0207662_10003317 | 3300025918 | Bacteria | 8258 |
| 298 | Ga0207662_10044847 | 3300025918 | Bacteria | 2612 |
| 299 | Ga0207662_10257435 | 3300025918 | Unclassified | 1147 |
| 300 | Ga0207657_10007814 | 3300025919 | Bacteria | 10915 |
| 301 | Ga0207657_10012795 | 3300025919 | Bacteria | 8258 |
| 302 | Ga0207657_10028541 | 3300025919 | Bacteria | 5089 |
| 303 | Ga0207657_10060252 | 3300025919 | Bacteria | 3257 |
| 304 | Ga0207649_10000852 | 3300025920 | Bacteria | 19557 |
| 305 | Ga0207649_10492361 | 3300025920 | Unclassified | 931 |
| 306 | Ga0207649_10640367 | 3300025920 | Bacteria | 821 |
| 307 | Ga0207652_10009431 | 3300025921 | Bacteria | 7850 |
| 308 | Ga0207652_10023346 | 3300025921 | Bacteria | 5123 |
| 309 | Ga0207652_10181717 | 3300025921 | Bacteria | 1890 |
| 310 | Ga0207652_10267242 | 3300025921 | Bacteria | 1543 |
| 311 | Ga0207646_10108441 | 3300025922 | Bacteria | 2491 |
| 312 | Ga0207681_10006377 | 3300025923 | Bacteria | 7241 |
| 313 | Ga0207694_10175657 | 3300025924 | Bacteria | 1735 |
| 314 | Ga0207659_10003644 | 3300025926 | Bacteria | 9276 |
| 315 | Ga0207659_10305525 | 3300025926 | Bacteria | 1308 |
| 316 | Ga0207687_10065991 | 3300025927 | Bacteria | 2571 |
| 317 | Ga0207700_10132649 | 3300025928 | Bacteria | 2036 |
| 318 | Ga0207664_10045030 | 3300025929 | Bacteria | 3458 |
| 319 | Ga0207664_10271289 | 3300025929 | Bacteria | 1486 |
| 320 | Ga0207644_10020542 | 3300025931 | Bacteria | 4491 |
| 321 | Ga0207690_10023701 | 3300025932 | Bacteria | 3834 |
| 322 | Ga0207690_10036618 | 3300025932 | Bacteria | 3178 |
| 323 | Ga0207706_10001175 | 3300025933 | Bacteria | 26500 |
| 324 | Ga0207706_10006829 | 3300025933 | Bacteria | 10549 |
| 325 | Ga0207706_10053280 | 3300025933 | Bacteria | 3572 |
| 326 | Ga0207686_10000898 | 3300025934 | Bacteria | 17933 |
| 327 | Ga0207709_10006803 | 3300025935 | Bacteria | 6396 |
| 328 | Ga0207709_10053131 | 3300025935 | Bacteria | 2492 |
| 329 | Ga0207709_10357963 | 3300025935 | Unclassified | 1104 |
| 330 | Ga0207670_10002663 | 3300025936 | Bacteria | 9392 |
| 331 | Ga0207670_10492173 | 3300025936 | Unclassified | 994 |
| 332 | Ga0207669_10000534 | 3300025937 | Bacteria | 16573 |
| 333 | Ga0207704_10026200 | 3300025938 | Bacteria | 3195 |
| 334 | Ga0207665_10307599 | 3300025939 | Bacteria | 1186 |
| 335 | Ga0207691_10001992 | 3300025940 | Bacteria | 19980 |
| 336 | Ga0207691_10235001 | 3300025940 | Bacteria | 1586 |
| 337 | Ga0207711_10217910 | 3300025941 | Bacteria | 1745 |
| 338 | Ga0207711_10475323 | 3300025941 | Unclassified | 1164 |
| 339 | Ga0207689_10000424 | 3300025942 | Bacteria | 39635 |
| 340 | Ga0207661_10002538 | 3300025944 | Bacteria | 12565 |
| 341 | Ga0207661_10196111 | 3300025944 | Bacteria | 1773 |
| 342 | Ga0207679_10000187 | 3300025945 | Bacteria | 49895 |
| 343 | Ga0207679_10182235 | 3300025945 | Bacteria | 1738 |
| 344 | Ga0207667_10182647 | 3300025949 | Bacteria | 2153 |
| 345 | Ga0207667_10224059 | 3300025949 | Bacteria | 1926 |
| 346 | Ga0207667_10521007 | 3300025949 | Bacteria | 1204 |
| 347 | Ga0207651_10073255 | 3300025960 | Bacteria | 2435 |
| 348 | Ga0207712_10001563 | 3300025961 | Bacteria | 15410 |
| 349 | Ga0207712_10092033 | 3300025961 | Bacteria | 2235 |
| 350 | Ga0207668_10000807 | 3300025972 | Bacteria | 19183 |
| 351 | Ga0207668_10519897 | 3300025972 | Unclassified | 1027 |
| 352 | Ga0207640_10026149 | 3300025981 | Bacteria | 3540 |
| 353 | Ga0207640_10319023 | 3300025981 | Bacteria | 1236 |
| 354 | Ga0207658_10016316 | 3300025986 | Bacteria | 5108 |
| 355 | Ga0207658_10024327 | 3300025986 | Bacteria | 4237 |
| 356 | Ga0207658_10099770 | 3300025986 | Bacteria | 2272 |
| 357 | Ga0207658_10335314 | 3300025986 | Bacteria | 1313 |
| 358 | Ga0207677_10008612 | 3300026023 | Bacteria | 5710 |
| 359 | Ga0207703_10004096 | 3300026035 | Bacteria | 12028 |
| 360 | Ga0207703_10301557 | 3300026035 | Unclassified | 1461 |
| 361 | Ga0207678_10010172 | 3300026067 | Bacteria | 8258 |
| 362 | Ga0207678_10087689 | 3300026067 | Bacteria | 2659 |
| 363 | Ga0207678_10159384 | 3300026067 | Bacteria | 1927 |
| 364 | Ga0207708_10007098 | 3300026075 | Bacteria | 8275 |
| 365 | Ga0207708_10009482 | 3300026075 | Bacteria | 7211 |
| 366 | Ga0207702_10195449 | 3300026078 | Bacteria | 1872 |
| 367 | Ga0207702_10246459 | 3300026078 | Bacteria | 1676 |
| 368 | Ga0207641_10001747 | 3300026088 | Bacteria | 20964 |
| 369 | Ga0207648_10001031 | 3300026089 | Bacteria | 31313 |
| 370 | Ga0207648_10009238 | 3300026089 | Bacteria | 9470 |
| 371 | Ga0207648_10065841 | 3300026089 | Bacteria | 3159 |
| 372 | Ga0207674_10015762 | 3300026116 | Bacteria | 8291 |
| 373 | Ga0207674_10347251 | 3300026116 | Bacteria | 1434 |
| 374 | Ga0207675_100010495 | 3300026118 | Bacteria | 8678 |
| 375 | Ga0207675_100388450 | 3300026118 | Bacteria | 1373 |
| 376 | Ga0207683_10000727 | 3300026121 | Bacteria | 29910 |
| 377 | Ga0207683_10486395 | 3300026121 | Unclassified | 1139 |
| 378 | Ga0207698_10001591 | 3300026142 | Bacteria | 13231 |
| 379 | Ga0207698_10040765 | 3300026142 | Bacteria | 3454 |
| 380 | Ga0207698_10217996 | 3300026142 | Bacteria | 1722 |
| 381 | Ga0209968_1002657 | 3300027526 | Bacteria | 2691 |
| 382 | Ga0209999_1006567 | 3300027543 | Bacteria | 2090 |
| 383 | Ga0210002_1000950 | 3300027617 | Bacteria | 3996 |
| 384 | Ga0209971_1020944 | 3300027682 | Bacteria | 1555 |
| 385 | Ga0209998_10006128 | 3300027717 | Bacteria | 2501 |
| 386 | Ga0209998_10007092 | 3300027717 | Bacteria | 2323 |
| 387 | Ga0209813_10076578 | 3300027866 | Bacteria | 1098 |
| 388 | Ga0209974_10038087 | 3300027876 | Bacteria | 1598 |
| 389 | Ga0209974_10095556 | 3300027876 | Bacteria | 1034 |
| 390 | Ga0207428_10000150 | 3300027907 | Bacteria | 94699 |
| 391 | Ga0207428_10000360 | 3300027907 | Bacteria | 58478 |
| 392 | Ga0207428_10001312 | 3300027907 | Bacteria | 26468 |
| 393 | Ga0268265_10003058 | 3300028380 | Bacteria | 12198 |
| 394 | Ga0268264_10002038 | 3300028381 | Bacteria | 18063 |
| 395 | Ga0268264_10032654 | 3300028381 | Bacteria | 4272 |
| 396 | Ga0265337_1001436 | 3300028556 | Bacteria | 11727 |
| 397 | Ga0265338_10078817 | 3300028800 | Bacteria | 2776 |
| 398 | Ga0265325_10000030 | 3300031241 | Bacteria | 103532 |
| 399 | Ga0265325_10003470 | 3300031241 | Bacteria | 10281 |
| 400 | Ga0265325_10014638 | 3300031241 | Bacteria | 4427 |
| 401 | Ga0265325_10112669 | 3300031241 | Bacteria | 1320 |
| 402 | Ga0265340_10050951 | 3300031247 | Bacteria | 2006 |
| 403 | Ga0265340_10088816 | 3300031247 | Bacteria | 1447 |
| 404 | Ga0265339_10065631 | 3300031249 | Bacteria | 1945 |
| 405 | Ga0265339_10124148 | 3300031249 | Bacteria | 1325 |
| 406 | Ga0265339_10270033 | 3300031249 | Bacteria | 818 |
| 407 | Ga0265331_10013598 | 3300031250 | Bacteria | 4370 |
| 408 | Ga0265316_10059331 | 3300031344 | Bacteria | 2976 |
| 409 | Ga0265316_10291964 | 3300031344 | Bacteria | 1189 |
| 410 | Ga0265313_10019962 | 3300031595 | Bacteria | 3712 |
| 411 | Ga0265313_10061106 | 3300031595 | Bacteria | 1765 |
| 412 | Ga0265313_10155657 | 3300031595 | Bacteria | 973 |
| 413 | Ga0307508_10392924 | 3300031616 | Bacteria | 978 |
| 414 | Ga0265314_10008756 | 3300031711 | Bacteria | 8650 |
| 415 | Ga0265314_10124343 | 3300031711 | Bacteria | 1618 |
| 416 | Ga0265314_10160132 | 3300031711 | Bacteria | 1371 |
| 417 | Ga0265342_10007190 | 3300031712 | Bacteria | 8190 |
| 418 | Ga0265342_10025981 | 3300031712 | Bacteria | 3674 |
| 419 | Ga0316583_10000116 | 3300032133 | Bacteria | 18613 |
| 420 | Ga0373950_0007317 | 3300034818 | Bacteria | 1710 |
| 421 | Ga0373926_0060367 | 3300035083 | Bacteria | 1381 |
| 422 | Ga0373934_0040238 | 3300035086 | Bacteria | 1843 |
| 423 | Ga0373934_0046589 | 3300035086 | Bacteria | 1715 |
| 424 | Ga0373934_0089871 | 3300035086 | Unclassified | 1237 |
| 425 | Ga0373944_0006033 | 3300035089 | Bacteria | 3208 |
| 426 | Ga0373944_0042431 | 3300035089 | Bacteria | 1410 |
| 427 | Ga0373949_0025691 | 3300035090 | Bacteria | 1376 |
| 428 | Ga0373951_0009307 | 3300035091 | Bacteria | 2213 |
| 429 | Ga0373923_0000187 | 3300035111 | Bacteria | 12538 |
| 430 | Ga0373923_0016081 | 3300035111 | Bacteria | 2835 |
| 431 | Ga0373923_0055263 | 3300035111 | Bacteria | 1673 |
| 432 | Ga0373939_0002170 | 3300035114 | Bacteria | 4659 |
| 433 | Ga0373945_0000395 | 3300035116 | Bacteria | 12509 |
| 434 | Ga0373945_0003211 | 3300035116 | Bacteria | 5126 |
| 435 | Ga0373953_0019396 | 3300035117 | Bacteria | 2529 |
| 436 | Ga0373953_0034980 | 3300035117 | Unclassified | 1972 |
| 437 | Ga0373953_0046283 | 3300035117 | Bacteria | 1746 |
| 438 | Ga0373954_0017828 | 3300035118 | Bacteria | 3192 |
| 439 | Ga0373954_0034984 | 3300035118 | Bacteria | 2328 |
| 440 | Ga0373954_0066955 | 3300035118 | Bacteria | 1701 |
| 441 | Ga0373954_0115911 | 3300035118 | Bacteria | 1298 |
| 442 | Ga0373956_0005701 | 3300035119 | Bacteria | 4979 |
| 443 | Ga0373956_0254698 | 3300035119 | Bacteria | 835 |
| 444 | Ga0373957_0135237 | 3300035120 | Unclassified | 1005 |
| 445 | Ga0373960_0000484 | 3300035121 | Bacteria | 7885 |
| 446 | Ga0373943_0034727 | 3300035170 | Bacteria | 2406 |
| 447 | Ga0373943_0071276 | 3300035170 | Bacteria | 1760 |
| 448 | Ga0373946_0004740 | 3300035171 | Bacteria | 4887 |
| 449 | Ga0373955_0002533 | 3300035172 | Bacteria | 7993 |
| 450 | Ga0373955_0005096 | 3300035172 | Bacteria | 5871 |
| 451 | Ga0373955_0007708 | 3300035172 | Bacteria | 4958 |
| 452 | Ga0373955_0023343 | 3300035172 | Bacteria | 3149 |
| 453 | Ga0373955_0109181 | 3300035172 | Bacteria | 1598 |
| 454 | Ga0373924_0005631 | 3300035410 | Bacteria | 4441 |
| 455 | Ga0373924_0015589 | 3300035410 | Bacteria | 2891 |
| 456 | Ga0373924_0016367 | 3300035410 | Bacteria | 2829 |
| 457 | Ga0373931_0156013 | 3300035691 | Unclassified | 1334 |
| 458 | Ga0373935_0054490 | 3300035692 | Unclassified | 2546 |
| 459 | Ga0373935_0167895 | 3300035692 | Bacteria | 1499 |
| 460 | Ga0373927_0379891 | 3300035695 | Unclassified | 931 |
| 461 | Ga0373933_0001526 | 3300035724 | Bacteria | 13510 |
| 462 | Ga0373933_0008071 | 3300035724 | Bacteria | 5746 |
| 463 | Ga0373933_0009795 | 3300035724 | Bacteria | 5244 |
| 464 | Ga0373933_0013460 | 3300035724 | Bacteria | 4535 |
| 465 | Ga0373933_0043828 | 3300035724 | Bacteria | 2648 |
| 466 | Ga0373947_0021752 | 3300035725 | Bacteria | 3714 |
| 467 | Ga0373947_0030734 | 3300035725 | Bacteria | 3157 |
| 468 | Ga0373947_0113525 | 3300035725 | Bacteria | 1714 |
| 469 | Ga0373937_0002031 | 3300036401 | Bacteria | 16910 |
| 470 | Ga0373937_0002067 | 3300036401 | Bacteria | 16792 |
| 471 | Ga0373937_0004072 | 3300036401 | Bacteria | 12397 |
| 472 | Ga0373937_0008320 | 3300036401 | Bacteria | 9010 |
| 473 | Ga0373937_0087024 | 3300036401 | Bacteria | 2891 |
| 474 | Ga0373925_0001686 | 3300037068 | Bacteria | 18583 |
| 475 | Ga0373925_0031318 | 3300037068 | Bacteria | 3908 |
| 476 | Ga0395899_0019740 | 3300037312 | Bacteria | 5117 |
| 477 | Ga0395900_0052617 | 3300037418 | Bacteria | 4191 |
| 478 | Ga0395898_0004229 | 3300037466 | Bacteria | 15742 |
| 479 | Ga0395901_0080318 | 3300038443 | Bacteria | 3405 |
| 480 | Ga0436361_0130184 | 3300039447 | Bacteria | 6038 |
| 481 | Ga0439450_016497 | 3300042008 | Bacteria | 1528 |
| 482 | Ga0466963_0070500 | 3300044694 | Bacteria | 2351 |
| 483 | Ga0466957_0063752 | 3300044842 | Bacteria | 2266 |
| 484 | Ga0466958_0082359 | 3300045836 | Bacteria | 1982 |
| 485 | Ga0466958_0219030 | 3300045836 | Unclassified | 1214 |
| 486 | Ga0466967_0029718 | 3300045976 | Bacteria | 4578 |
| 487 | Ga0466967_0857896 | 3300045976 | Unclassified | 902 |
| 488 | Ga0495592_0004354 | 3300046454 | Bacteria | 10357 |
| 489 | Ga0495592_0027953 | 3300046454 | Bacteria | 4272 |
| 490 | Ga0495592_0031428 | 3300046454 | Bacteria | 4012 |
| 491 | Ga0495603_0001272 | 3300046455 | Bacteria | 14676 |
| 492 | Ga0495629_0183377 | 3300046459 | Bacteria | 1450 |
| 493 | Ga0495641_0009857 | 3300046461 | Bacteria | 5623 |
| 494 | Ga0495641_0157066 | 3300046461 | Bacteria | 1017 |
| 495 | Ga0495651_0017193 | 3300046462 | Bacteria | 5604 |
| 496 | Ga0495651_0017806 | 3300046462 | Bacteria | 5501 |
| 497 | Ga0495651_0019768 | 3300046462 | Bacteria | 5221 |
| 498 | Ga0495651_0128542 | 3300046462 | Bacteria | 1852 |
| 499 | Ga0495651_0407738 | 3300046462 | Bacteria | 886 |
| 500 | Ga0495653_0023158 | 3300046463 | Bacteria | 5023 |
| 501 | Ga0495653_0106288 | 3300046463 | Bacteria | 2025 |
| 502 | Ga0495653_0124757 | 3300046463 | Bacteria | 1830 |
| 503 | Ga0495653_0445627 | 3300046463 | Bacteria | 815 |
| 504 | Ga0495582_0024852 | 3300046473 | Bacteria | 3280 |
| 505 | Ga0495605_0129230 | 3300046474 | Unclassified | 1140 |
| 506 | Ga0495639_0026384 | 3300046475 | Bacteria | 2567 |
| 507 | Ga0495662_0002967 | 3300046476 | Bacteria | 8560 |
| 508 | Ga0495662_0039088 | 3300046476 | Bacteria | 2292 |
| 509 | Ga0495664_0015764 | 3300046477 | Bacteria | 4301 |
| 510 | Ga0495664_0027553 | 3300046477 | Bacteria | 3313 |
| 511 | Ga0495664_0040651 | 3300046477 | Bacteria | 2750 |
| 512 | Ga0495584_0052151 | 3300046491 | Unclassified | 2059 |
| 513 | Ga0495585_0003052 | 3300046492 | Bacteria | 11521 |
| 514 | Ga0495607_0003738 | 3300046501 | Bacteria | 11518 |
| 515 | Ga0495608_0020801 | 3300046511 | Bacteria | 4508 |
| 516 | Ga0495618_0013696 | 3300046514 | Bacteria | 4934 |
| 517 | Ga0495618_0052342 | 3300046514 | Bacteria | 2580 |
| 518 | Ga0495618_0408031 | 3300046514 | Bacteria | 830 |
| 519 | Ga0495628_0004484 | 3300046516 | Bacteria | 12371 |
| 520 | Ga0495630_0166620 | 3300046517 | Unclassified | 1677 |
| 521 | Ga0495630_0175702 | 3300046517 | Bacteria | 1632 |
| 522 | Ga0495637_0015585 | 3300046520 | Bacteria | 3566 |
| 523 | Ga0495644_0000312 | 3300046523 | Bacteria | 22452 |
| 524 | Ga0495666_0003560 | 3300046526 | Bacteria | 7872 |
| 525 | Ga0495652_0023265 | 3300046529 | Bacteria | 5493 |
| 526 | Ga0495652_0051909 | 3300046529 | Bacteria | 3499 |
| 527 | Ga0495652_0134790 | 3300046529 | Bacteria | 1950 |
| 528 | Ga0495652_0158435 | 3300046529 | Bacteria | 1760 |
| 529 | Ga0495652_0194778 | 3300046529 | Unclassified | 1543 |
| 530 | Ga0495665_0007736 | 3300046531 | Bacteria | 5814 |
| 531 | Ga0495665_0177461 | 3300046531 | Bacteria | 1108 |
| 532 | Ga0495640_0022952 | 3300046533 | Bacteria | 4556 |
| 533 | Ga0495640_0032635 | 3300046533 | Bacteria | 3708 |
| 534 | Ga0495640_0040917 | 3300046533 | Bacteria | 3242 |
| 535 | Ga0495640_0166599 | 3300046533 | Bacteria | 1409 |
| 536 | Ga0495586_0226771 | 3300046535 | Bacteria | 1062 |
| 537 | Ga0495587_0182006 | 3300046536 | Bacteria | 1191 |
| 538 | Ga0495645_0001254 | 3300046543 | Bacteria | 17310 |
| 539 | Ga0495645_0023097 | 3300046543 | Bacteria | 4503 |
| 540 | Ga0495645_0262966 | 3300046543 | Bacteria | 1141 |
| 541 | Ga0495622_0003315 | 3300046557 | Bacteria | 7609 |
| 542 | Ga0495633_0001295 | 3300046558 | Bacteria | 19775 |
| 543 | Ga0495667_0013991 | 3300046559 | Bacteria | 5418 |
| 544 | Ga0495667_0056627 | 3300046559 | Bacteria | 2577 |
| 545 | Ga0495667_0396024 | 3300046559 | Bacteria | 870 |
| 546 | Ga0495656_0000338 | 3300046615 | Bacteria | 16110 |
| 547 | Ga0495634_0041890 | 3300046642 | Bacteria | 3109 |
| 548 | Ga0495634_0354786 | 3300046642 | Unclassified | 877 |
| 549 | Ga0495611_0003977 | 3300046648 | Bacteria | 6430 |
| 550 | Ga0495635_0017003 | 3300046663 | Bacteria | 5079 |
| 551 | Ga0495635_0018319 | 3300046663 | Bacteria | 4886 |
| 552 | Ga0495635_0049373 | 3300046663 | Bacteria | 2900 |
| 553 | Ga0495635_0066075 | 3300046663 | Bacteria | 2481 |
| 554 | Ga0495659_0000500 | 3300046664 | Bacteria | 14469 |
| 555 | Ga0495661_0012316 | 3300046665 | Bacteria | 5775 |
| 556 | Ga0495588_0007831 | 3300046674 | Bacteria | 4878 |
| 557 | Ga0495657_0025807 | 3300046675 | Bacteria | 4169 |
| 558 | Ga0495657_0060535 | 3300046675 | Bacteria | 2508 |
| 559 | Ga0495599_0003098 | 3300046678 | Bacteria | 9682 |
| 560 | Ga0495599_0082617 | 3300046678 | Unclassified | 2006 |
| 561 | Ga0495599_0193896 | 3300046678 | Bacteria | 1249 |
| 562 | Ga0495623_0001432 | 3300046679 | Bacteria | 16175 |
| 563 | Ga0495623_0002450 | 3300046679 | Bacteria | 12303 |
| 564 | Ga0495646_0002685 | 3300046680 | Bacteria | 11010 |
| 565 | Ga0495646_0254689 | 3300046680 | Bacteria | 939 |
| 566 | Ga0495647_0010841 | 3300046681 | Bacteria | 3112 |
| 567 | Ga0495647_0070479 | 3300046681 | Bacteria | 1398 |
| 568 | Ga0495658_0036768 | 3300046683 | Bacteria | 2703 |
| 569 | Ga0495658_0354600 | 3300046683 | Unclassified | 932 |
| 570 | Ga0495613_0043715 | 3300046689 | Unclassified | 3314 |
| 571 | Ga0495613_0274231 | 3300046689 | Bacteria | 1172 |
| 572 | Ga0495613_0380244 | 3300046689 | Bacteria | 966 |
| 573 | Ga0495624_0165859 | 3300046690 | Bacteria | 1348 |
| 574 | Ga0495670_0000232 | 3300046691 | Bacteria | 25466 |
| 575 | Ga0495671_0108037 | 3300046692 | Bacteria | 1359 |
| 576 | Ga0495589_0021795 | 3300046794 | Bacteria | 3274 |
| 577 | Ga0495600_0012643 | 3300046809 | Bacteria | 5284 |
| 578 | Ga0495600_0033437 | 3300046809 | Bacteria | 3338 |
| 579 | Ga0495600_0077665 | 3300046809 | Bacteria | 2168 |
| 580 | Ga0495581_0004228 | 3300047315 | Bacteria | 8276 |
| 581 | Ga0495581_0359211 | 3300047315 | Bacteria | 850 |
| 582 | Ga0495604_0023070 | 3300047317 | Bacteria | 4966 |
| 583 | Ga0495604_0026371 | 3300047317 | Bacteria | 4626 |
| 584 | Ga0495604_0028582 | 3300047317 | Bacteria | 4436 |
| 585 | Ga0495604_0054077 | 3300047317 | Bacteria | 3100 |
| 586 | Ga0495674_0021621 | 3300047319 | Bacteria | 5947 |
| 587 | Ga0495674_0053744 | 3300047319 | Bacteria | 3539 |
| 588 | Ga0495674_0071493 | 3300047319 | Bacteria | 2994 |
| 589 | Ga0495680_0005660 | 3300047322 | Bacteria | 11705 |
| 590 | Ga0495680_0013213 | 3300047322 | Bacteria | 7213 |
| 591 | Ga0495680_0013375 | 3300047322 | Bacteria | 7163 |
| 592 | Ga0495680_0096671 | 3300047322 | Bacteria | 2205 |
| 593 | Ga0495680_0153143 | 3300047322 | Bacteria | 1679 |
| 594 | Ga0495680_0465328 | 3300047322 | Bacteria | 863 |
| 595 | Ga0495675_0001159 | 3300047444 | Bacteria | 15992 |
| 596 | Ga0495675_0074768 | 3300047444 | Bacteria | 2135 |
| 597 | Ga0495677_0020408 | 3300047445 | Unclassified | 2402 |
| 598 | Ga0495679_011022 | 3300047446 | Bacteria | 3515 |
| 599 | Ga0495684_0009284 | 3300047471 | Bacteria | 7592 |
| 600 | Ga0495684_0139189 | 3300047471 | Bacteria | 1820 |
| 601 | Ga0495593_0002529 | 3300047673 | Bacteria | 10984 |
| 602 | Ga0495602_0001877 | 3300048088 | Bacteria | 21025 |
| 603 | Ga0495602_0016985 | 3300048088 | Bacteria | 7301 |
| 604 | Ga0495602_0093353 | 3300048088 | Bacteria | 2490 |
| 605 | Ga0495602_0365239 | 3300048088 | Unclassified | 1038 |
| 606 | Ga0495614_0026235 | 3300048089 | Bacteria | 2511 |
| 607 | Ga0495614_0260052 | 3300048089 | Bacteria | 796 |
| 608 | Ga0496100_0006271 | 3300048903 | Bacteria | 6475 |
| 609 | Ga0496100_0030488 | 3300048903 | Bacteria | 3346 |
| 610 | Ga0496100_0123679 | 3300048903 | Bacteria | 1813 |
| 611 | Ga0496101_0000833 | 3300048904 | Bacteria | 18156 |
| 612 | Ga0496101_0021356 | 3300048904 | Bacteria | 4448 |
| 613 | Ga0496101_0143775 | 3300048904 | Bacteria | 1820 |
| 614 | Ga0496102_0011433 | 3300048905 | Bacteria | 7653 |
| 615 | Ga0496102_0045178 | 3300048905 | Bacteria | 3998 |
| 616 | Ga0496103_0000963 | 3300048906 | Bacteria | 20444 |
| 617 | Ga0496103_0043097 | 3300048906 | Bacteria | 2778 |
| 618 | Ga0496103_0043842 | 3300048906 | Bacteria | 2755 |
| 619 | Ga0496103_0419923 | 3300048906 | Bacteria | 858 |
| 620 | Ga0496104_0000065 | 3300048907 | Bacteria | 108770 |
| 621 | Ga0496104_0005391 | 3300048907 | Bacteria | 11192 |
| 622 | Ga0496104_0038325 | 3300048907 | Bacteria | 4484 |
| 623 | Ga0496104_0040089 | 3300048907 | Bacteria | 4388 |
| 624 | Ga0496104_0120340 | 3300048907 | Bacteria | 2520 |
| 625 | Ga0496105_0010839 | 3300048908 | Bacteria | 7176 |
| 626 | Ga0496105_0023647 | 3300048908 | Bacteria | 4986 |
| 627 | Ga0496105_0167840 | 3300048908 | Bacteria | 1800 |
| 628 | Ga0496106_0002101 | 3300048909 | Bacteria | 14928 |
| 629 | Ga0496106_0033955 | 3300048909 | Bacteria | 3808 |
| 630 | Ga0496106_0044691 | 3300048909 | Bacteria | 3325 |
| 631 | Ga0496106_0274819 | 3300048909 | Bacteria | 1349 |
| 632 | Ga0496107_0011980 | 3300048910 | Bacteria | 6051 |
| 633 | Ga0496107_0067509 | 3300048910 | Bacteria | 2595 |
| 634 | Ga0496108_0016701 | 3300048911 | Bacteria | 5996 |
| 635 | Ga0496108_0027237 | 3300048911 | Bacteria | 4717 |
| 636 | Ga0496108_0028578 | 3300048911 | Bacteria | 4614 |
| 637 | Ga0496108_0043867 | 3300048911 | Bacteria | 3735 |
| 638 | Ga0496109_0001690 | 3300048912 | Bacteria | 18382 |
| 639 | Ga0496109_0005126 | 3300048912 | Bacteria | 10937 |
| 640 | Ga0496109_0015815 | 3300048912 | Bacteria | 6587 |
| 641 | Ga0496109_0093978 | 3300048912 | Bacteria | 2775 |
| 642 | Ga0496110_0023713 | 3300048913 | Bacteria | 5220 |
| 643 | Ga0496110_0031756 | 3300048913 | Bacteria | 4558 |
| 644 | Ga0496110_0285028 | 3300048913 | Bacteria | 1504 |
| 645 | Ga0496110_0593173 | 3300048913 | Bacteria | 1005 |
| 646 | Ga0496111_0025624 | 3300048914 | Bacteria | 4161 |
| 647 | Ga0496111_0079212 | 3300048914 | Bacteria | 2396 |
| 648 | Ga0496111_0094465 | 3300048914 | Bacteria | 2193 |
| 649 | Ga0496112_0023903 | 3300048915 | Bacteria | 5846 |
| 650 | Ga0496112_0102795 | 3300048915 | Bacteria | 2827 |
| 651 | Ga0496112_0161739 | 3300048915 | Bacteria | 2205 |
| 652 | Ga0496112_1010316 | 3300048915 | Bacteria | 751 |
| 653 | Ga0496113_0000329 | 3300048916 | Bacteria | 22567 |
| 654 | Ga0496113_0035504 | 3300048916 | Bacteria | 3646 |
| 655 | Ga0496113_0083893 | 3300048916 | Bacteria | 2445 |
| 656 | Ga0496114_0009201 | 3300048917 | Bacteria | 7835 |
| 657 | Ga0496115_0044892 | 3300048918 | Bacteria | 3526 |
| 658 | Ga0496115_0050554 | 3300048918 | Bacteria | 3330 |
| 659 | Ga0496115_0073180 | 3300048918 | Bacteria | 2781 |
| 660 | Ga0496115_0184978 | 3300048918 | Bacteria | 1721 |
| 661 | Ga0496115_0297969 | 3300048918 | Bacteria | 1322 |
| 662 | Ga0501031_0006312 | 3300049568 | Bacteria | 7730 |
| 663 | Ga0501031_0060301 | 3300049568 | Bacteria | 2472 |
| 664 | Ga0501032_0015540 | 3300049569 | Bacteria | 5368 |
| 665 | Ga0501032_0017462 | 3300049569 | Bacteria | 5040 |
| 666 | Ga0501033_0030659 | 3300049570 | Bacteria | 4040 |
| 667 | Ga0501033_0107183 | 3300049570 | Bacteria | 2035 |
| 668 | Ga0501033_0113285 | 3300049570 | Bacteria | 1972 |
| 669 | Ga0501034_0001584 | 3300049571 | Bacteria | 29619 |
| 670 | Ga0501034_0031753 | 3300049571 | Bacteria | 5364 |
| 671 | Ga0501034_0071243 | 3300049571 | Bacteria | 3486 |
| 672 | Ga0501034_0244523 | 3300049571 | Bacteria | 1739 |
| 673 | Ga0501034_0340083 | 3300049571 | Bacteria | 1431 |
| 674 | Ga0501034_0410636 | 3300049571 | Unclassified | 1276 |
| 675 | Ga0501034_0673519 | 3300049571 | Bacteria | 935 |
| 676 | Ga0501036_0001347 | 3300049572 | Bacteria | 18840 |
| 677 | Ga0501036_0009565 | 3300049572 | Bacteria | 7973 |
| 678 | Ga0501036_0018017 | 3300049572 | Bacteria | 5912 |
| 679 | Ga0501036_0044766 | 3300049572 | Bacteria | 3750 |
| 680 | Ga0501036_0112893 | 3300049572 | Bacteria | 2296 |
| 681 | Ga0501037_0001187 | 3300049573 | Bacteria | 19240 |
| 682 | Ga0501037_0069506 | 3300049573 | Bacteria | 2563 |
| 683 | Ga0501037_0083619 | 3300049573 | Bacteria | 2312 |
| 684 | Ga0501037_0097960 | 3300049573 | Bacteria | 2119 |
| 685 | Ga0501037_0203275 | 3300049573 | Bacteria | 1399 |
| 686 | Ga0501038_0019987 | 3300049574 | Bacteria | 6028 |
| 687 | Ga0501038_0020401 | 3300049574 | Bacteria | 5958 |
| 688 | Ga0501038_0065777 | 3300049574 | Bacteria | 3088 |
| 689 | Ga0501038_0507482 | 3300049574 | Bacteria | 921 |
| 690 | Ga0501039_0018702 | 3300049575 | Bacteria | 5318 |
| 691 | Ga0501039_0074330 | 3300049575 | Bacteria | 2641 |
| 692 | Ga0501039_0123670 | 3300049575 | Bacteria | 2028 |
| 693 | Ga0501039_0518880 | 3300049575 | Bacteria | 935 |
| 694 | Ga0501040_0062313 | 3300049576 | Bacteria | 2566 |
| 695 | Ga0501040_0063757 | 3300049576 | Bacteria | 2536 |
| 696 | Ga0501042_0180269 | 3300049578 | Bacteria | 1524 |
| 697 | Ga0501043_0001872 | 3300049579 | Bacteria | 18031 |
| 698 | Ga0501043_0010758 | 3300049579 | Bacteria | 7165 |
| 699 | Ga0501043_0070280 | 3300049579 | Bacteria | 2750 |
| 700 | Ga0501046_0038531 | 3300049580 | Bacteria | 3835 |
| 701 | Ga0501046_0053120 | 3300049580 | Bacteria | 3192 |
| 702 | Ga0501047_0006650 | 3300049581 | Bacteria | 10866 |
| 703 | Ga0501047_0011585 | 3300049581 | Bacteria | 8344 |
| 704 | Ga0501047_0016035 | 3300049581 | Bacteria | 7144 |
| 705 | Ga0501047_0023087 | 3300049581 | Bacteria | 5971 |
| 706 | Ga0501047_0056959 | 3300049581 | Bacteria | 3780 |
| 707 | Ga0501047_0119174 | 3300049581 | Bacteria | 2521 |
| 708 | Ga0501047_0135638 | 3300049581 | Bacteria | 2341 |
| 709 | Ga0501047_0177364 | 3300049581 | Bacteria | 1998 |
| 710 | Ga0501047_0282384 | 3300049581 | Bacteria | 1504 |
| 711 | Ga0501048_0000039 | 3300049582 | Bacteria | 63521 |
| 712 | Ga0501048_0012298 | 3300049582 | Bacteria | 6370 |
| 713 | Ga0501048_0023363 | 3300049582 | Bacteria | 4519 |
| 714 | Ga0501067_0006525 | 3300049583 | Bacteria | 6467 |
| 715 | Ga0501067_0225015 | 3300049583 | Bacteria | 1045 |
| 716 | Ga0501068_0007550 | 3300049584 | Bacteria | 6017 |
| 717 | Ga0501068_0012538 | 3300049584 | Bacteria | 4810 |
| 718 | Ga0501068_0060494 | 3300049584 | Bacteria | 2300 |
| 719 | Ga0501068_0126059 | 3300049584 | Bacteria | 1599 |
| 720 | Ga0501068_0152702 | 3300049584 | Bacteria | 1452 |
| 721 | Ga0501069_0020092 | 3300049585 | Bacteria | 3615 |
| 722 | Ga0501069_0021374 | 3300049585 | Bacteria | 3510 |
| 723 | Ga0501069_0090850 | 3300049585 | Bacteria | 1727 |
| 724 | Ga0501069_0254017 | 3300049585 | Bacteria | 1026 |
| 725 | Ga0501070_0006927 | 3300049586 | Bacteria | 9649 |
| 726 | Ga0501070_0008380 | 3300049586 | Bacteria | 8733 |
| 727 | Ga0501070_0009049 | 3300049586 | Bacteria | 8424 |
| 728 | Ga0501070_0010886 | 3300049586 | Bacteria | 7683 |
| 729 | Ga0501070_0033855 | 3300049586 | Bacteria | 4275 |
| 730 | Ga0501070_0077826 | 3300049586 | Bacteria | 2744 |
| 731 | Ga0501070_0206242 | 3300049586 | Bacteria | 1614 |
| 732 | Ga0501070_0335663 | 3300049586 | Bacteria | 1228 |
| 733 | Ga0501070_0400366 | 3300049586 | Bacteria | 1110 |
| 734 | Ga0501071_0014377 | 3300049587 | Bacteria | 5412 |
| 735 | Ga0501071_0020484 | 3300049587 | Bacteria | 4597 |
| 736 | Ga0501071_0267814 | 3300049587 | Bacteria | 1291 |
| 737 | Ga0501072_0019231 | 3300049588 | Bacteria | 5277 |
| 738 | Ga0501072_0117623 | 3300049588 | Bacteria | 2117 |
| 739 | Ga0501072_0135982 | 3300049588 | Bacteria | 1959 |
| 740 | Ga0501072_0206496 | 3300049588 | Bacteria | 1566 |
| 741 | Ga0501073_0015959 | 3300049589 | Bacteria | 5443 |
| 742 | Ga0501073_0027790 | 3300049589 | Bacteria | 4043 |
| 743 | Ga0501073_0309152 | 3300049589 | Bacteria | 1090 |
| 744 | Ga0501074_0006728 | 3300049590 | Bacteria | 8292 |
| 745 | Ga0501074_0021551 | 3300049590 | Bacteria | 4679 |
| 746 | Ga0501074_0031302 | 3300049590 | Bacteria | 3854 |
| 747 | Ga0501074_0099312 | 3300049590 | Bacteria | 2084 |
| 748 | Ga0501074_0497655 | 3300049590 | Bacteria | 863 |
| 749 | Ga0501075_0109585 | 3300049591 | Bacteria | 2099 |
| 750 | Ga0501075_0132237 | 3300049591 | Bacteria | 1901 |
| 751 | Ga0501076_0125461 | 3300049592 | Bacteria | 2080 |
| 752 | Ga0501076_0184391 | 3300049592 | Bacteria | 1702 |
| 753 | Ga0501077_0011615 | 3300049593 | Bacteria | 5504 |
| 754 | Ga0501077_0080756 | 3300049593 | Bacteria | 2060 |
| 755 | Ga0501079_0013096 | 3300049741 | Bacteria | 6324 |
| 756 | Ga0501079_0408742 | 3300049741 | Bacteria | 1065 |
| 757 | Ga0501079_0607745 | 3300049741 | Unclassified | 860 |
| 758 | Ga0501080_0000022 | 3300049742 | Bacteria | 90630 |
| 759 | Ga0501080_0026488 | 3300049742 | Bacteria | 5387 |
| 760 | Ga0501080_0053406 | 3300049742 | Bacteria | 3762 |
| 761 | Ga0501080_0146136 | 3300049742 | Bacteria | 2185 |
| 762 | Ga0501080_0263059 | 3300049742 | Bacteria | 1571 |
| 763 | Ga0501080_0266102 | 3300049742 | Bacteria | 1561 |
| 764 | Ga0501080_0312795 | 3300049742 | Bacteria | 1423 |
| 765 | Ga0501080_0399828 | 3300049742 | Bacteria | 1236 |
| 766 | Ga0501080_0411889 | 3300049742 | Bacteria | 1215 |
| 767 | Ga0501080_0451264 | 3300049742 | Bacteria | 1153 |
| 768 | Ga0501081_0208998 | 3300049743 | Bacteria | 1417 |
| 769 | Ga0501083_0001941 | 3300049744 | Bacteria | 14225 |
| 770 | Ga0501083_0024820 | 3300049744 | Bacteria | 4152 |
| 771 | Ga0501083_0026149 | 3300049744 | Bacteria | 4037 |
| 772 | Ga0501083_0058001 | 3300049744 | Bacteria | 2591 |
| 773 | Ga0501083_0128696 | 3300049744 | Bacteria | 1660 |
| 774 | Ga0501035_0000655 | 3300049822 | Bacteria | 38162 |
| 775 | Ga0501035_0008096 | 3300049822 | Bacteria | 9797 |
| 776 | Ga0501035_0031789 | 3300049822 | Bacteria | 4807 |
| 777 | Ga0501035_0155709 | 3300049822 | Bacteria | 1980 |
| 778 | Ga0501035_0159289 | 3300049822 | Bacteria | 1955 |
| 779 | Ga0501035_0216398 | 3300049822 | Bacteria | 1637 |
| 780 | Ga0501044_0005112 | 3300049823 | Bacteria | 14631 |
| 781 | Ga0501044_0023300 | 3300049823 | Bacteria | 6586 |
| 782 | Ga0501044_0037388 | 3300049823 | Bacteria | 5074 |
| 783 | Ga0501044_0106451 | 3300049823 | Bacteria | 2816 |
| 784 | Ga0501044_0128195 | 3300049823 | Bacteria | 2533 |
| 785 | Ga0501044_0298846 | 3300049823 | Bacteria | 1539 |
| 786 | Ga0501044_0324039 | 3300049823 | Bacteria | 1464 |
| 787 | Ga0501044_0354220 | 3300049823 | Bacteria | 1387 |
| 788 | Ga0501045_0065925 | 3300049824 | Bacteria | 2659 |
| 789 | Ga0501045_0126373 | 3300049824 | Bacteria | 1900 |
| 790 | nmdc:mga03683_35426_c1 | 3300050489 | Bacteria | 2025 |
| 791 | nmdc:mga00v17_146286_c1 | 3300050491 | Bacteria | 1517 |
| 792 | nmdc:mga0k408_75369_c1 | 3300050493 | Bacteria | 1971 |
| 793 | nmdc:mga06z11_445988_c1 | 3300050494 | Bacteria | 782 |
| 794 | nmdc:mga0n895_54135_c1 | 3300050512 | Bacteria | 3945 |
| 795 | nmdc:mga0n895_96925_c1 | 3300050512 | Bacteria | 2954 |
| 796 | nmdc:mga0rr50_148960_c1 | 3300050513 | Bacteria | 1889 |
| 797 | nmdc:mga0rr50_710982_c1 | 3300050513 | Unclassified | 857 |
| 798 | nmdc:mga08x19_243843_c1 | 3300050514 | Unclassified | 1239 |
| 799 | Ga0495601_0000225 | 3300053077 | Bacteria | 30328 |
| 800 | Ga0495601_0001233 | 3300053077 | Bacteria | 14029 |
| 801 | Ga0495601_0002814 | 3300053077 | Bacteria | 9872 |
| 802 | Ga0495601_0007348 | 3300053077 | Bacteria | 6458 |
| 803 | Ga0495612_0000405 | 3300053078 | Bacteria | 17265 |
| 804 | Ga0495612_0005171 | 3300053078 | Bacteria | 5390 |
| 805 | Ga0495612_0007159 | 3300053078 | Bacteria | 4564 |
| 806 | Ga0495612_0027580 | 3300053078 | Bacteria | 2284 |
| 807 | Ga0495595_0000616 | 3300053084 | Bacteria | 13570 |
| 808 | Ga0495595_0003155 | 3300053084 | Bacteria | 6538 |
| 809 | Ga0495595_0014630 | 3300053084 | Bacteria | 3332 |
| 810 | Ga0495595_0016278 | 3300053084 | Bacteria | 3178 |
| 811 | Ga0495595_0088257 | 3300053084 | Bacteria | 1485 |
| 812 | Ga0495619_0000083 | 3300053085 | Bacteria | 70312 |
| 813 | Ga0495619_0001284 | 3300053085 | Bacteria | 16486 |
| 814 | Ga0495619_0012744 | 3300053085 | Bacteria | 5291 |
| 815 | Ga0495619_0044225 | 3300053085 | Bacteria | 2923 |
| 816 | Ga0495619_0045033 | 3300053085 | Bacteria | 2897 |
| 817 | Ga0495619_0329939 | 3300053085 | Bacteria | 1056 |
| 818 | Ga0500566_0060799 | 3300053094 | Bacteria | 2139 |
| 819 | Ga0500566_0217555 | 3300053094 | Bacteria | 952 |
| 820 | Ga0500641_0140510 | 3300053096 | Bacteria | 1043 |
| 821 | Ga0500650_0163553 | 3300053098 | Bacteria | 1026 |
| 822 | Ga0500562_030034 | 3300053108 | Bacteria | 1431 |
| 823 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 824 | Ga0500618_024028 | 3300053125 | Bacteria | 1471 |
| 825 | Ga0500658_0078082 | 3300053134 | Bacteria | 1411 |
| 826 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 827 | Ga0501084_0013445 | 3300054114 | Bacteria | 6774 |
| 828 | Ga0501084_0669724 | 3300054114 | Bacteria | 876 |
| 829 | Ga0501082_0021232 | 3300060353 | Bacteria | 5602 |
| 830 | Ga0501082_0083499 | 3300060353 | Bacteria | 2756 |
| 831 | Ga0501082_0089643 | 3300060353 | Bacteria | 2655 |
| 832 | Ga0501082_0105235 | 3300060353 | Bacteria | 2441 |
| 833 | Ga0466962_0061657 | 3300061719 | Bacteria | 1790 |
| 834 | Ga0530510_0107854 | 3300061734 | Bacteria | 2038 |
| 835 | Ga0530510_0580173 | 3300061734 | Unclassified | 852 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061734 | Ga0530510_0107854 | Ga0530510_0107854_1322_1912 | 176 |
| 2 | 3300020080 | Ga0206350_11124917 | Ga0206350_111249171 | 188 |
| 3 | 3300005327 | Ga0070658_10008781 | Ga0070658_100087812 | 189 |
| 4 | 3300005336 | Ga0070680_100080355 | Ga0070680_1000803553 | 189 |
| 5 | 3300005563 | Ga0068855_100050850 | Ga0068855_1000508505 | 189 |
| 6 | 3300005578 | Ga0068854_100086516 | Ga0068854_1000865162 | 189 |
| 7 | 3300009093 | Ga0105240_10045619 | Ga0105240_100456195 | 189 |
| 8 | 3300013102 | Ga0157371_10134407 | Ga0157371_101344072 | 189 |
| 9 | 3300013105 | Ga0157369_10242476 | Ga0157369_102424762 | 189 |
| 10 | 3300020069 | Ga0197907_10034627 | Ga0197907_100346272 | 189 |
| 11 | 3300020070 | Ga0206356_11782481 | Ga0206356_117824812 | 189 |
| 12 | 3300020082 | Ga0206353_11809109 | Ga0206353_118091092 | 189 |
| 13 | 3300022467 | Ga0224712_10259867 | Ga0224712_102598671 | 189 |
| 14 | 3300025909 | Ga0207705_10012753 | Ga0207705_100127533 | 189 |
| 15 | 3300025912 | Ga0207707_10109695 | Ga0207707_101096951 | 189 |
| 16 | 3300025981 | Ga0207640_10319023 | Ga0207640_103190232 | 189 |
| 17 | 3300061719 | Ga0466962_0061657 | Ga0466962_0061657_673_1347 | 190 |
| 18 | 3300049575 | Ga0501039_0074330 | Ga0501039_0074330_654_1304 | 196 |
| 19 | 3300049576 | Ga0501040_0062313 | Ga0501040_0062313_1405_2055 | 196 |
| 20 | 3300049584 | Ga0501068_0126059 | Ga0501068_0126059_385_1035 | 196 |
| 21 | 3300049587 | Ga0501071_0020484 | Ga0501071_0020484_1923_2573 | 196 |
| 22 | 3300049588 | Ga0501072_0117623 | Ga0501072_0117623_1052_1702 | 196 |
| 23 | 3300049591 | Ga0501075_0109585 | Ga0501075_0109585_461_1111 | 196 |
| 24 | 3300049592 | Ga0501076_0125461 | Ga0501076_0125461_377_1027 | 196 |
| 25 | 3300049742 | Ga0501080_0053406 | Ga0501080_0053406_1522_2172 | 196 |
| 26 | 3300054114 | Ga0501084_0013445 | Ga0501084_0013445_2006_2656 | 196 |
| 27 | 3300046683 | Ga0495658_0036768 | Ga0495658_0036768_736_1434 | 197 |
| 28 | 3300005336 | Ga0070680_100268648 | Ga0070680_1002686482 | 200 |
| 29 | 3300038443 | Ga0395901_0080318 | Ga0395901_0080318_1595_2296 | 200 |
| 30 | 3300046531 | Ga0495665_0177461 | Ga0495665_0177461_443_1087 | 200 |
| 31 | 3300046681 | Ga0495647_0070479 | Ga0495647_0070479_32_676 | 200 |
| 32 | 3300006194 | Ga0075427_10000344 | Ga0075427_100003444 | 201 |
| 33 | 3300006844 | Ga0075428_100005389 | Ga0075428_10000538912 | 201 |
| 34 | 3300006846 | Ga0075430_100000426 | Ga0075430_10000042620 | 201 |
| 35 | 3300006847 | Ga0075431_100005525 | Ga0075431_10000552512 | 201 |
| 36 | 3300006852 | Ga0075433_10000029 | Ga0075433_1000002931 | 201 |
| 37 | 3300006871 | Ga0075434_100000208 | Ga0075434_10000020832 | 201 |
| 38 | 3300006880 | Ga0075429_100000734 | Ga0075429_10000073419 | 201 |
| 39 | 3300007076 | Ga0075435_100001396 | Ga0075435_10000139614 | 201 |
| 40 | 3300027907 | Ga0207428_10000360 | Ga0207428_1000036033 | 201 |
| 41 | 3300035111 | Ga0373923_0055263 | Ga0373923_0055263_343_1053 | 201 |
| 42 | 3300046642 | Ga0495634_0041890 | Ga0495634_0041890_81_791 | 201 |
| 43 | 3300046689 | Ga0495613_0380244 | Ga0495613_0380244_185_895 | 201 |
| 44 | 3300046692 | Ga0495671_0108037 | Ga0495671_0108037_218_922 | 201 |
| 45 | 3300047322 | Ga0495680_0465328 | Ga0495680_0465328_81_815 | 201 |
| 46 | 3300005336 | Ga0070680_100044425 | Ga0070680_1000444253 | 202 |
| 47 | 3300005340 | Ga0070689_100287691 | Ga0070689_1002876912 | 202 |
| 48 | 3300005347 | Ga0070668_100281096 | Ga0070668_1002810961 | 202 |
| 49 | 3300005353 | Ga0070669_100527797 | Ga0070669_1005277971 | 202 |
| 50 | 3300005366 | Ga0070659_100286565 | Ga0070659_1002865652 | 202 |
| 51 | 3300005444 | Ga0070694_100136162 | Ga0070694_1001361622 | 202 |
| 52 | 3300005455 | Ga0070663_100175121 | Ga0070663_1001751212 | 202 |
| 53 | 3300005458 | Ga0070681_10028339 | Ga0070681_100283391 | 202 |
| 54 | 3300005468 | Ga0070707_100980370 | Ga0070707_1009803701 | 202 |
| 55 | 3300005543 | Ga0070672_100168917 | Ga0070672_1001689172 | 202 |
| 56 | 3300005546 | Ga0070696_100105465 | Ga0070696_1001054652 | 202 |
| 57 | 3300005937 | Ga0081455_10008929 | Ga0081455_1000892910 | 202 |
| 58 | 3300006871 | Ga0075434_100097978 | Ga0075434_1000979783 | 202 |
| 59 | 3300009098 | Ga0105245_10909693 | Ga0105245_109096931 | 202 |
| 60 | 3300009101 | Ga0105247_10510540 | Ga0105247_105105401 | 202 |
| 61 | 3300009174 | Ga0105241_10034680 | Ga0105241_100346803 | 202 |
| 62 | 3300009176 | Ga0105242_10259660 | Ga0105242_102596602 | 202 |
| 63 | 3300025910 | Ga0207684_10005931 | Ga0207684_1000593112 | 202 |
| 64 | 3300025912 | Ga0207707_10028228 | Ga0207707_100282282 | 202 |
| 65 | 3300025917 | Ga0207660_10125208 | Ga0207660_101252082 | 202 |
| 66 | 3300025918 | Ga0207662_10257435 | Ga0207662_102574352 | 202 |
| 67 | 3300025919 | Ga0207657_10060252 | Ga0207657_100602522 | 202 |
| 68 | 3300025921 | Ga0207652_10181717 | Ga0207652_101817172 | 202 |
| 69 | 3300025922 | Ga0207646_10108441 | Ga0207646_101084412 | 202 |
| 70 | 3300025935 | Ga0207709_10357963 | Ga0207709_103579632 | 202 |
| 71 | 3300025936 | Ga0207670_10492173 | Ga0207670_104921731 | 202 |
| 72 | 3300025941 | Ga0207711_10475323 | Ga0207711_104753232 | 202 |
| 73 | 3300025972 | Ga0207668_10519897 | Ga0207668_105198972 | 202 |
| 74 | 3300026067 | Ga0207678_10087689 | Ga0207678_100876892 | 202 |
| 75 | 3300026089 | Ga0207648_10065841 | Ga0207648_100658413 | 202 |
| 76 | 3300026121 | Ga0207683_10486395 | Ga0207683_104863952 | 202 |
| 77 | 3300035090 | Ga0373949_0025691 | Ga0373949_0025691_452_1156 | 202 |
| 78 | 3300035691 | Ga0373931_0156013 | Ga0373931_0156013_426_1130 | 202 |
| 79 | 3300037068 | Ga0373925_0031318 | Ga0373925_0031318_123_833 | 202 |
| 80 | 3300047322 | Ga0495680_0153143 | Ga0495680_0153143_772_1476 | 202 |
| 81 | 3300048904 | Ga0496101_0143775 | Ga0496101_0143775_501_1205 | 202 |
| 82 | 3300048905 | Ga0496102_0045178 | Ga0496102_0045178_2843_3547 | 202 |
| 83 | 3300048906 | Ga0496103_0043842 | Ga0496103_0043842_454_1158 | 202 |
| 84 | 3300048909 | Ga0496106_0044691 | Ga0496106_0044691_591_1295 | 202 |
| 85 | 3300048918 | Ga0496115_0050554 | Ga0496115_0050554_2233_2937 | 202 |
| 86 | 3300048918 | Ga0496115_0184978 | Ga0496115_0184978_405_1109 | 202 |
| 87 | 3300050512 | nmdc:mga0n895_96925_c1 | nmdc:mga0n895_96925_c1_774_1478 | 202 |
| 88 | 3300005937 | Ga0081455_10014732 | Ga0081455_1001473211 | 203 |
| 89 | 3300006175 | Ga0070712_100706908 | Ga0070712_1007069081 | 203 |
| 90 | 3300035089 | Ga0373944_0006033 | Ga0373944_0006033_849_1553 | 203 |
| 91 | 3300035116 | Ga0373945_0003211 | Ga0373945_0003211_3663_4367 | 203 |
| 92 | 3300046463 | Ga0495653_0445627 | Ga0495653_0445627_61_765 | 203 |
| 93 | 3300046476 | Ga0495662_0039088 | Ga0495662_0039088_436_1140 | 203 |
| 94 | 3300046477 | Ga0495664_0040651 | Ga0495664_0040651_372_1076 | 203 |
| 95 | 3300046514 | Ga0495618_0052342 | Ga0495618_0052342_1171_1875 | 203 |
| 96 | 3300046517 | Ga0495630_0175702 | Ga0495630_0175702_539_1243 | 203 |
| 97 | 3300046529 | Ga0495652_0158435 | Ga0495652_0158435_852_1556 | 203 |
| 98 | 3300046543 | Ga0495645_0262966 | Ga0495645_0262966_236_940 | 203 |
| 99 | 3300046663 | Ga0495635_0066075 | Ga0495635_0066075_561_1265 | 203 |
| 100 | 3300047319 | Ga0495674_0053744 | Ga0495674_0053744_975_1679 | 203 |
| 101 | 3300047471 | Ga0495684_0139189 | Ga0495684_0139189_419_1123 | 203 |
| 102 | 3300053078 | Ga0495612_0027580 | Ga0495612_0027580_1032_1736 | 203 |
| 103 | 3300053085 | Ga0495619_0044225 | Ga0495619_0044225_1780_2484 | 203 |
| 104 | 3300053125 | Ga0500618_024028 | Ga0500618_024028_124_828 | 203 |
| 105 | 3300005435 | Ga0070714_100049845 | Ga0070714_1000498452 | 204 |
| 106 | 3300005563 | Ga0068855_100092066 | Ga0068855_1000920664 | 204 |
| 107 | 3300005616 | Ga0068852_100333399 | Ga0068852_1003333992 | 204 |
| 108 | 3300009093 | Ga0105240_11075781 | Ga0105240_110757812 | 204 |
| 109 | 3300009551 | Ga0105238_10193544 | Ga0105238_101935442 | 204 |
| 110 | 3300013307 | Ga0157372_11163556 | Ga0157372_111635561 | 204 |
| 111 | 3300020070 | Ga0206356_11516001 | Ga0206356_115160012 | 204 |
| 112 | 3300025924 | Ga0207694_10175657 | Ga0207694_101756572 | 204 |
| 113 | 3300025929 | Ga0207664_10271289 | Ga0207664_102712892 | 204 |
| 114 | 3300026142 | Ga0207698_10040765 | Ga0207698_100407652 | 204 |
| 115 | 3300026142 | Ga0207698_10217996 | Ga0207698_102179962 | 204 |
| 116 | 3300005336 | Ga0070680_100024074 | Ga0070680_1000240744 | 205 |
| 117 | 3300005339 | Ga0070660_100158724 | Ga0070660_1001587242 | 205 |
| 118 | 3300005435 | Ga0070714_100167523 | Ga0070714_1001675232 | 205 |
| 119 | 3300005439 | Ga0070711_100190525 | Ga0070711_1001905252 | 205 |
| 120 | 3300005445 | Ga0070708_100487167 | Ga0070708_1004871671 | 205 |
| 121 | 3300005458 | Ga0070681_10054250 | Ga0070681_100542505 | 205 |
| 122 | 3300005530 | Ga0070679_100142953 | Ga0070679_1001429532 | 205 |
| 123 | 3300005563 | Ga0068855_100063448 | Ga0068855_1000634482 | 205 |
| 124 | 3300013104 | Ga0157370_10387776 | Ga0157370_103877762 | 205 |
| 125 | 3300020070 | Ga0206356_10149498 | Ga0206356_101494982 | 205 |
| 126 | 3300025906 | Ga0207699_10373578 | Ga0207699_103735782 | 205 |
| 127 | 3300025909 | Ga0207705_10021541 | Ga0207705_100215413 | 205 |
| 128 | 3300025912 | Ga0207707_10082519 | Ga0207707_100825194 | 205 |
| 129 | 3300025912 | Ga0207707_10299765 | Ga0207707_102997651 | 205 |
| 130 | 3300025914 | Ga0207671_10136790 | Ga0207671_101367902 | 205 |
| 131 | 3300025916 | Ga0207663_10379412 | Ga0207663_103794122 | 205 |
| 132 | 3300025917 | Ga0207660_10101618 | Ga0207660_101016182 | 205 |
| 133 | 3300025919 | Ga0207657_10007814 | Ga0207657_100078148 | 205 |
| 134 | 3300025920 | Ga0207649_10640367 | Ga0207649_106403671 | 205 |
| 135 | 3300025921 | Ga0207652_10023346 | Ga0207652_100233462 | 205 |
| 136 | 3300025929 | Ga0207664_10045030 | Ga0207664_100450304 | 205 |
| 137 | 3300031241 | Ga0265325_10014638 | Ga0265325_100146382 | 205 |
| 138 | 3300031241 | Ga0265325_10112669 | Ga0265325_101126692 | 205 |
| 139 | 3300031249 | Ga0265339_10065631 | Ga0265339_100656312 | 205 |
| 140 | 3300031249 | Ga0265339_10270033 | Ga0265339_102700331 | 205 |
| 141 | 3300031595 | Ga0265313_10019962 | Ga0265313_100199624 | 205 |
| 142 | 3300031711 | Ga0265314_10124343 | Ga0265314_101243432 | 205 |
| 143 | 3300031712 | Ga0265342_10007190 | Ga0265342_100071908 | 205 |
| 144 | 3300031712 | Ga0265342_10025981 | Ga0265342_100259814 | 205 |
| 145 | 3300049571 | Ga0501034_0673519 | Ga0501034_0673519_38_712 | 205 |
| 146 | 3300049581 | Ga0501047_0056959 | Ga0501047_0056959_1552_2226 | 205 |
| 147 | 3300049742 | Ga0501080_0266102 | Ga0501080_0266102_809_1483 | 205 |
| 148 | 3300006871 | Ga0075434_100059772 | Ga0075434_1000597724 | 206 |
| 149 | 3300006871 | Ga0075434_100244633 | Ga0075434_1002446332 | 206 |
| 150 | 3300006914 | Ga0075436_100302194 | Ga0075436_1003021941 | 206 |
| 151 | 3300007076 | Ga0075435_100081695 | Ga0075435_1000816953 | 206 |
| 152 | 3300045836 | Ga0466958_0082359 | Ga0466958_0082359_634_1326 | 206 |
| 153 | 3300045976 | Ga0466967_0029718 | Ga0466967_0029718_1651_2343 | 206 |
| 154 | 3300050512 | nmdc:mga0n895_54135_c1 | nmdc:mga0n895_54135_c1_2092_2772 | 206 |
| 155 | 3300005337 | Ga0070682_100456343 | Ga0070682_1004563432 | 207 |
| 156 | 3300005439 | Ga0070711_100063686 | Ga0070711_1000636862 | 207 |
| 157 | 3300005458 | Ga0070681_10200162 | Ga0070681_102001622 | 207 |
| 158 | 3300005564 | Ga0070664_100065346 | Ga0070664_1000653462 | 207 |
| 159 | 3300005842 | Ga0068858_100051708 | Ga0068858_1000517083 | 207 |
| 160 | 3300006358 | Ga0068871_100001884 | Ga0068871_1000018846 | 207 |
| 161 | 3300009098 | Ga0105245_10011288 | Ga0105245_100112884 | 207 |
| 162 | 3300013297 | Ga0157378_10059489 | Ga0157378_100594893 | 207 |
| 163 | 3300026035 | Ga0207703_10301557 | Ga0207703_103015572 | 207 |
| 164 | 3300032133 | Ga0316583_10000116 | Ga0316583_100001164 | 207 |
| 165 | 3300035086 | Ga0373934_0046589 | Ga0373934_0046589_774_1484 | 207 |
| 166 | 3300035111 | Ga0373923_0016081 | Ga0373923_0016081_1616_2326 | 207 |
| 167 | 3300035172 | Ga0373955_0007708 | Ga0373955_0007708_2378_3088 | 207 |
| 168 | 3300035410 | Ga0373924_0016367 | Ga0373924_0016367_1360_2070 | 207 |
| 169 | 3300035692 | Ga0373935_0167895 | Ga0373935_0167895_553_1263 | 207 |
| 170 | 3300035724 | Ga0373933_0008071 | Ga0373933_0008071_2835_3545 | 207 |
| 171 | 3300036401 | Ga0373937_0002067 | Ga0373937_0002067_7319_8029 | 207 |
| 172 | 3300046454 | Ga0495592_0027953 | Ga0495592_0027953_2630_3340 | 207 |
| 173 | 3300046462 | Ga0495651_0019768 | Ga0495651_0019768_4126_4836 | 207 |
| 174 | 3300046529 | Ga0495652_0051909 | Ga0495652_0051909_2438_3148 | 207 |
| 175 | 3300046535 | Ga0495586_0226771 | Ga0495586_0226771_115_825 | 207 |
| 176 | 3300046559 | Ga0495667_0056627 | Ga0495667_0056627_1516_2226 | 207 |
| 177 | 3300046663 | Ga0495635_0017003 | Ga0495635_0017003_1358_2068 | 207 |
| 178 | 3300046679 | Ga0495623_0002450 | Ga0495623_0002450_9317_10027 | 207 |
| 179 | 3300046809 | Ga0495600_0012643 | Ga0495600_0012643_1880_2590 | 207 |
| 180 | 3300047319 | Ga0495674_0071493 | Ga0495674_0071493_561_1271 | 207 |
| 181 | 3300047322 | Ga0495680_0013213 | Ga0495680_0013213_1659_2369 | 207 |
| 182 | 3300047444 | Ga0495675_0001159 | Ga0495675_0001159_14166_14876 | 207 |
| 183 | 3300048088 | Ga0495602_0001877 | Ga0495602_0001877_8809_9519 | 207 |
| 184 | 3300048911 | Ga0496108_0016701 | Ga0496108_0016701_351_1061 | 207 |
| 185 | 3300048914 | Ga0496111_0094465 | Ga0496111_0094465_1125_1835 | 207 |
| 186 | 3300053077 | Ga0495601_0002814 | Ga0495601_0002814_6102_6812 | 207 |
| 187 | 3300053084 | Ga0495595_0000616 | Ga0495595_0000616_12492_13202 | 207 |
| 188 | 3300006177 | Ga0075362_10044204 | Ga0075362_100442041 | 208 |
| 189 | 3300037312 | Ga0395899_0019740 | Ga0395899_0019740_1780_2481 | 208 |
| 190 | 3300037418 | Ga0395900_0052617 | Ga0395900_0052617_2026_2727 | 208 |
| 191 | 3300037466 | Ga0395898_0004229 | Ga0395898_0004229_12655_13356 | 208 |
| 192 | 3300044694 | Ga0466963_0070500 | Ga0466963_0070500_1318_2010 | 208 |
| 193 | 3300044842 | Ga0466957_0063752 | Ga0466957_0063752_877_1569 | 208 |
| 194 | 3300045836 | Ga0466958_0219030 | Ga0466958_0219030_331_1023 | 208 |
| 195 | 3300045976 | Ga0466967_0857896 | Ga0466967_0857896_150_842 | 208 |
| 196 | 3300048089 | Ga0495614_0260052 | Ga0495614_0260052_15_728 | 208 |
| 197 | 3300050493 | nmdc:mga0k408_75369_c1 | nmdc:mga0k408_75369_c1_457_1158 | 208 |
| 198 | 3300006844 | Ga0075428_100313407 | Ga0075428_1003134072 | 209 |
| 199 | 3300035083 | Ga0373926_0060367 | Ga0373926_0060367_469_1167 | 209 |
| 200 | 3300035725 | Ga0373947_0113525 | Ga0373947_0113525_812_1510 | 209 |
| 201 | 3300046533 | Ga0495640_0166599 | Ga0495640_0166599_340_1038 | 209 |
| 202 | 3300046689 | Ga0495613_0274231 | Ga0495613_0274231_122_820 | 209 |
| 203 | 3300046690 | Ga0495624_0165859 | Ga0495624_0165859_56_754 | 209 |
| 204 | 3300048907 | Ga0496104_0005391 | Ga0496104_0005391_1612_2331 | 209 |
| 205 | 3300048913 | Ga0496110_0593173 | Ga0496110_0593173_159_875 | 209 |
| 206 | 3300053094 | Ga0500566_0060799 | Ga0500566_0060799_283_981 | 209 |
| 207 | 3300006871 | Ga0075434_100058176 | Ga0075434_1000581763 | 210 |
| 208 | 3300006914 | Ga0075436_100284281 | Ga0075436_1002842812 | 210 |
| 209 | 3300007076 | Ga0075435_100253011 | Ga0075435_1002530112 | 210 |
| 210 | 3300025261 | Ga0209233_1008959 | Ga0209233_10089592 | 210 |
| 211 | 3300025906 | Ga0207699_10295613 | Ga0207699_102956132 | 210 |
| 212 | 3300035119 | Ga0373956_0254698 | Ga0373956_0254698_80_790 | 210 |
| 213 | 3300046514 | Ga0495618_0408031 | Ga0495618_0408031_35_760 | 210 |
| 214 | 3300048915 | Ga0496112_1010316 | Ga0496112_1010316_20_727 | 210 |
| 215 | 3300049570 | Ga0501033_0030659 | Ga0501033_0030659_693_1418 | 210 |
| 216 | 3300049572 | Ga0501036_0044766 | Ga0501036_0044766_2387_3112 | 210 |
| 217 | 3300049573 | Ga0501037_0097960 | Ga0501037_0097960_893_1618 | 210 |
| 218 | 3300049574 | Ga0501038_0020401 | Ga0501038_0020401_4335_5060 | 210 |
| 219 | 3300049581 | Ga0501047_0023087 | Ga0501047_0023087_3835_4560 | 210 |
| 220 | 3300049586 | Ga0501070_0010886 | Ga0501070_0010886_880_1605 | 210 |
| 221 | 3300049588 | Ga0501072_0206496 | Ga0501072_0206496_283_993 | 210 |
| 222 | 3300049742 | Ga0501080_0312795 | Ga0501080_0312795_516_1241 | 210 |
| 223 | 3300049822 | Ga0501035_0155709 | Ga0501035_0155709_223_948 | 210 |
| 224 | 3300049823 | Ga0501044_0037388 | Ga0501044_0037388_3345_4070 | 210 |
| 225 | 3300050513 | nmdc:mga0rr50_148960_c1 | nmdc:mga0rr50_148960_c1_751_1485 | 210 |
| 226 | 3300050514 | nmdc:mga08x19_243843_c1 | nmdc:mga08x19_243843_c1_407_1141 | 210 |
| 227 | 3300006042 | Ga0075368_10058580 | Ga0075368_100585802 | 211 |
| 228 | 3300006048 | Ga0075363_100090855 | Ga0075363_1000908552 | 211 |
| 229 | 3300006353 | Ga0075370_10254295 | Ga0075370_102542951 | 211 |
| 230 | 3300010375 | Ga0105239_11006973 | Ga0105239_110069732 | 211 |
| 231 | 3300027866 | Ga0209813_10076578 | Ga0209813_100765782 | 211 |
| 232 | 3300031616 | Ga0307508_10392924 | Ga0307508_103929241 | 211 |
| 233 | 3300039447 | Ga0436361_0130184 | Ga0436361_0130184_5031_5858 | 211 |
| 234 | 3300048903 | Ga0496100_0030488 | Ga0496100_0030488_2232_2933 | 211 |
| 235 | 3300048904 | Ga0496101_0000833 | Ga0496101_0000833_12744_13445 | 211 |
| 236 | 3300048905 | Ga0496102_0011433 | Ga0496102_0011433_1205_1912 | 211 |
| 237 | 3300048906 | Ga0496103_0043097 | Ga0496103_0043097_31_732 | 211 |
| 238 | 3300048907 | Ga0496104_0038325 | Ga0496104_0038325_3001_3702 | 211 |
| 239 | 3300048907 | Ga0496104_0120340 | Ga0496104_0120340_1654_2355 | 211 |
| 240 | 3300048908 | Ga0496105_0023647 | Ga0496105_0023647_1563_2264 | 211 |
| 241 | 3300048909 | Ga0496106_0002101 | Ga0496106_0002101_9708_10409 | 211 |
| 242 | 3300048909 | Ga0496106_0274819 | Ga0496106_0274819_181_882 | 211 |
| 243 | 3300048910 | Ga0496107_0011980 | Ga0496107_0011980_3783_4484 | 211 |
| 244 | 3300048911 | Ga0496108_0028578 | Ga0496108_0028578_1923_2624 | 211 |
| 245 | 3300048911 | Ga0496108_0043867 | Ga0496108_0043867_1962_2663 | 211 |
| 246 | 3300048912 | Ga0496109_0005126 | Ga0496109_0005126_3328_4029 | 211 |
| 247 | 3300048912 | Ga0496109_0015815 | Ga0496109_0015815_2603_3304 | 211 |
| 248 | 3300048913 | Ga0496110_0023713 | Ga0496110_0023713_2708_3409 | 211 |
| 249 | 3300048913 | Ga0496110_0031756 | Ga0496110_0031756_1919_2620 | 211 |
| 250 | 3300048914 | Ga0496111_0025624 | Ga0496111_0025624_1640_2341 | 211 |
| 251 | 3300048914 | Ga0496111_0079212 | Ga0496111_0079212_737_1438 | 211 |
| 252 | 3300048915 | Ga0496112_0023903 | Ga0496112_0023903_3141_3842 | 211 |
| 253 | 3300048915 | Ga0496112_0102795 | Ga0496112_0102795_1840_2541 | 211 |
| 254 | 3300048916 | Ga0496113_0035504 | Ga0496113_0035504_713_1414 | 211 |
| 255 | 3300048916 | Ga0496113_0083893 | Ga0496113_0083893_1342_2043 | 211 |
| 256 | 3300048918 | Ga0496115_0073180 | Ga0496115_0073180_1416_2117 | 211 |
| 257 | 3300050489 | nmdc:mga03683_35426_c1 | nmdc:mga03683_35426_c1_1075_1776 | 211 |
| 258 | 3300050513 | nmdc:mga0rr50_710982_c1 | nmdc:mga0rr50_710982_c1_105_806 | 211 |
| 259 | 3300053108 | Ga0500562_030034 | Ga0500562_030034_318_1019 | 211 |
| 260 | iso_pu_bacteria | 2643221547 | 2643754955 | 211 |
| 261 | 3300005434 | Ga0070709_10014181 | Ga0070709_100141812 | 212 |
| 262 | 3300005435 | Ga0070714_100337229 | Ga0070714_1003372292 | 212 |
| 263 | 3300005437 | Ga0070710_10019546 | Ga0070710_100195464 | 212 |
| 264 | 3300025906 | Ga0207699_10185925 | Ga0207699_101859251 | 212 |
| 265 | 3300025915 | Ga0207693_10055395 | Ga0207693_100553951 | 212 |
| 266 | 3300028556 | Ga0265337_1001436 | Ga0265337_100143611 | 212 |
| 267 | 3300031711 | Ga0265314_10160132 | Ga0265314_101601322 | 212 |
| 268 | 3300035170 | Ga0373943_0071276 | Ga0373943_0071276_864_1556 | 213 |
| 269 | 3300049585 | Ga0501069_0254017 | Ga0501069_0254017_187_885 | 213 |
| 270 | 3300049588 | Ga0501072_0019231 | Ga0501072_0019231_2635_3336 | 213 |
| 271 | 3300031241 | Ga0265325_10003470 | Ga0265325_100034707 | 214 |
| 272 | 3300031595 | Ga0265313_10155657 | Ga0265313_101556572 | 214 |
| 273 | 3300035086 | Ga0373934_0040238 | Ga0373934_0040238_491_1189 | 214 |
| 274 | 3300035117 | Ga0373953_0046283 | Ga0373953_0046283_593_1291 | 214 |
| 275 | 3300035118 | Ga0373954_0034984 | Ga0373954_0034984_554_1252 | 214 |
| 276 | 3300035172 | Ga0373955_0002533 | Ga0373955_0002533_6245_6943 | 214 |
| 277 | 3300035724 | Ga0373933_0001526 | Ga0373933_0001526_7337_8035 | 214 |
| 278 | 3300036401 | Ga0373937_0002031 | Ga0373937_0002031_2349_3047 | 214 |
| 279 | 3300046462 | Ga0495651_0017806 | Ga0495651_0017806_4391_5089 | 214 |
| 280 | 3300046463 | Ga0495653_0106288 | Ga0495653_0106288_721_1419 | 214 |
| 281 | 3300046536 | Ga0495587_0182006 | Ga0495587_0182006_15_713 | 214 |
| 282 | 3300046675 | Ga0495657_0060535 | Ga0495657_0060535_517_1215 | 214 |
| 283 | 3300046809 | Ga0495600_0077665 | Ga0495600_0077665_309_1007 | 214 |
| 284 | 3300047317 | Ga0495604_0054077 | Ga0495604_0054077_2301_2999 | 214 |
| 285 | 3300047322 | Ga0495680_0096671 | Ga0495680_0096671_801_1499 | 214 |
| 286 | 3300047444 | Ga0495675_0074768 | Ga0495675_0074768_477_1175 | 214 |
| 287 | 3300048088 | Ga0495602_0093353 | Ga0495602_0093353_124_822 | 214 |
| 288 | 3300049568 | Ga0501031_0060301 | Ga0501031_0060301_788_1495 | 214 |
| 289 | 3300049569 | Ga0501032_0015540 | Ga0501032_0015540_592_1299 | 214 |
| 290 | 3300049569 | Ga0501032_0017462 | Ga0501032_0017462_3451_4158 | 214 |
| 291 | 3300049570 | Ga0501033_0113285 | Ga0501033_0113285_730_1437 | 214 |
| 292 | 3300049571 | Ga0501034_0031753 | Ga0501034_0031753_1164_1871 | 214 |
| 293 | 3300049571 | Ga0501034_0244523 | Ga0501034_0244523_410_1117 | 214 |
| 294 | 3300049572 | Ga0501036_0009565 | Ga0501036_0009565_3700_4407 | 214 |
| 295 | 3300049572 | Ga0501036_0018017 | Ga0501036_0018017_2979_3686 | 214 |
| 296 | 3300049573 | Ga0501037_0001187 | Ga0501037_0001187_4728_5435 | 214 |
| 297 | 3300049574 | Ga0501038_0019987 | Ga0501038_0019987_1457_2164 | 214 |
| 298 | 3300049574 | Ga0501038_0065777 | Ga0501038_0065777_1506_2213 | 214 |
| 299 | 3300049575 | Ga0501039_0018702 | Ga0501039_0018702_791_1498 | 214 |
| 300 | 3300049575 | Ga0501039_0123670 | Ga0501039_0123670_592_1299 | 214 |
| 301 | 3300049576 | Ga0501040_0063757 | Ga0501040_0063757_955_1662 | 214 |
| 302 | 3300049579 | Ga0501043_0001872 | Ga0501043_0001872_2645_3352 | 214 |
| 303 | 3300049580 | Ga0501046_0038531 | Ga0501046_0038531_1790_2497 | 214 |
| 304 | 3300049581 | Ga0501047_0011585 | Ga0501047_0011585_758_1465 | 214 |
| 305 | 3300049581 | Ga0501047_0016035 | Ga0501047_0016035_4137_4844 | 214 |
| 306 | 3300049581 | Ga0501047_0282384 | Ga0501047_0282384_63_770 | 214 |
| 307 | 3300049582 | Ga0501048_0012298 | Ga0501048_0012298_1104_1811 | 214 |
| 308 | 3300049582 | Ga0501048_0023363 | Ga0501048_0023363_2748_3455 | 214 |
| 309 | 3300049583 | Ga0501067_0006525 | Ga0501067_0006525_1190_1897 | 214 |
| 310 | 3300049584 | Ga0501068_0007550 | Ga0501068_0007550_592_1299 | 214 |
| 311 | 3300049584 | Ga0501068_0012538 | Ga0501068_0012538_797_1504 | 214 |
| 312 | 3300049584 | Ga0501068_0060494 | Ga0501068_0060494_1339_2046 | 214 |
| 313 | 3300049585 | Ga0501069_0021374 | Ga0501069_0021374_2033_2740 | 214 |
| 314 | 3300049585 | Ga0501069_0090850 | Ga0501069_0090850_23_730 | 214 |
| 315 | 3300049586 | Ga0501070_0008380 | Ga0501070_0008380_7097_7804 | 214 |
| 316 | 3300049586 | Ga0501070_0077826 | Ga0501070_0077826_1603_2310 | 214 |
| 317 | 3300049587 | Ga0501071_0014377 | Ga0501071_0014377_4012_4719 | 214 |
| 318 | 3300049587 | Ga0501071_0267814 | Ga0501071_0267814_256_963 | 214 |
| 319 | 3300049588 | Ga0501072_0135982 | Ga0501072_0135982_571_1278 | 214 |
| 320 | 3300049589 | Ga0501073_0015959 | Ga0501073_0015959_4107_4814 | 214 |
| 321 | 3300049589 | Ga0501073_0027790 | Ga0501073_0027790_1022_1729 | 214 |
| 322 | 3300049590 | Ga0501074_0006728 | Ga0501074_0006728_6335_7042 | 214 |
| 323 | 3300049590 | Ga0501074_0031302 | Ga0501074_0031302_551_1258 | 214 |
| 324 | 3300049591 | Ga0501075_0132237 | Ga0501075_0132237_330_1037 | 214 |
| 325 | 3300049741 | Ga0501079_0013096 | Ga0501079_0013096_3382_4089 | 214 |
| 326 | 3300049742 | Ga0501080_0026488 | Ga0501080_0026488_3825_4532 | 214 |
| 327 | 3300049743 | Ga0501081_0208998 | Ga0501081_0208998_609_1316 | 214 |
| 328 | 3300049744 | Ga0501083_0024820 | Ga0501083_0024820_2539_3246 | 214 |
| 329 | 3300049744 | Ga0501083_0026149 | Ga0501083_0026149_835_1542 | 214 |
| 330 | 3300049822 | Ga0501035_0008096 | Ga0501035_0008096_1701_2408 | 214 |
| 331 | 3300049822 | Ga0501035_0031789 | Ga0501035_0031789_2993_3700 | 214 |
| 332 | 3300049823 | Ga0501044_0023300 | Ga0501044_0023300_2429_3136 | 214 |
| 333 | 3300049823 | Ga0501044_0106451 | Ga0501044_0106451_1756_2463 | 214 |
| 334 | 3300049824 | Ga0501045_0126373 | Ga0501045_0126373_399_1106 | 214 |
| 335 | 3300053077 | Ga0495601_0001233 | Ga0495601_0001233_9846_10544 | 214 |
| 336 | 3300053085 | Ga0495619_0045033 | Ga0495619_0045033_1698_2396 | 214 |
| 337 | 3300053096 | Ga0500641_0140510 | Ga0500641_0140510_79_795 | 214 |
| 338 | 3300060353 | Ga0501082_0083499 | Ga0501082_0083499_1344_2051 | 214 |
| 339 | 3300060353 | Ga0501082_0089643 | Ga0501082_0089643_644_1351 | 214 |
| 340 | 3300006048 | Ga0075363_100119038 | Ga0075363_1001190381 | 215 |
| 341 | 3300028800 | Ga0265338_10078817 | Ga0265338_100788173 | 215 |
| 342 | 3300031247 | Ga0265340_10050951 | Ga0265340_100509512 | 215 |
| 343 | 3300035114 | Ga0373939_0002170 | Ga0373939_0002170_2976_3668 | 215 |
| 344 | 3300035172 | Ga0373955_0109181 | Ga0373955_0109181_703_1407 | 215 |
| 345 | 3300046462 | Ga0495651_0407738 | Ga0495651_0407738_110_814 | 215 |
| 346 | 3300046559 | Ga0495667_0396024 | Ga0495667_0396024_64_768 | 215 |
| 347 | 3300049568 | Ga0501031_0006312 | Ga0501031_0006312_6152_6880 | 215 |
| 348 | 3300049570 | Ga0501033_0107183 | Ga0501033_0107183_249_977 | 215 |
| 349 | 3300049571 | Ga0501034_0001584 | Ga0501034_0001584_18547_19263 | 215 |
| 350 | 3300049571 | Ga0501034_0071243 | Ga0501034_0071243_590_1300 | 215 |
| 351 | 3300049572 | Ga0501036_0001347 | Ga0501036_0001347_6821_7537 | 215 |
| 352 | 3300049572 | Ga0501036_0112893 | Ga0501036_0112893_727_1455 | 215 |
| 353 | 3300049573 | Ga0501037_0069506 | Ga0501037_0069506_1643_2359 | 215 |
| 354 | 3300049573 | Ga0501037_0083619 | Ga0501037_0083619_673_1401 | 215 |
| 355 | 3300049573 | Ga0501037_0203275 | Ga0501037_0203275_510_1220 | 215 |
| 356 | 3300049574 | Ga0501038_0507482 | Ga0501038_0507482_130_840 | 215 |
| 357 | 3300049575 | Ga0501039_0518880 | Ga0501039_0518880_137_865 | 215 |
| 358 | 3300049578 | Ga0501042_0180269 | Ga0501042_0180269_313_1029 | 215 |
| 359 | 3300049579 | Ga0501043_0010758 | Ga0501043_0010758_1437_2153 | 215 |
| 360 | 3300049579 | Ga0501043_0070280 | Ga0501043_0070280_1199_1927 | 215 |
| 361 | 3300049580 | Ga0501046_0053120 | Ga0501046_0053120_926_1642 | 215 |
| 362 | 3300049581 | Ga0501047_0006650 | Ga0501047_0006650_2772_3488 | 215 |
| 363 | 3300049581 | Ga0501047_0119174 | Ga0501047_0119174_1433_2161 | 215 |
| 364 | 3300049581 | Ga0501047_0135638 | Ga0501047_0135638_281_991 | 215 |
| 365 | 3300049582 | Ga0501048_0000039 | Ga0501048_0000039_43726_44442 | 215 |
| 366 | 3300049583 | Ga0501067_0225015 | Ga0501067_0225015_130_846 | 215 |
| 367 | 3300049584 | Ga0501068_0152702 | Ga0501068_0152702_607_1323 | 215 |
| 368 | 3300049586 | Ga0501070_0009049 | Ga0501070_0009049_7182_7898 | 215 |
| 369 | 3300049589 | Ga0501073_0309152 | Ga0501073_0309152_170_886 | 215 |
| 370 | 3300049590 | Ga0501074_0021551 | Ga0501074_0021551_3455_4171 | 215 |
| 371 | 3300049590 | Ga0501074_0099312 | Ga0501074_0099312_1168_1878 | 215 |
| 372 | 3300049741 | Ga0501079_0408742 | Ga0501079_0408742_284_994 | 215 |
| 373 | 3300049742 | Ga0501080_0000022 | Ga0501080_0000022_17290_18006 | 215 |
| 374 | 3300049744 | Ga0501083_0001941 | Ga0501083_0001941_6120_6836 | 215 |
| 375 | 3300049744 | Ga0501083_0058001 | Ga0501083_0058001_1180_1890 | 215 |
| 376 | 3300049822 | Ga0501035_0216398 | Ga0501035_0216398_731_1459 | 215 |
| 377 | 3300049823 | Ga0501044_0005112 | Ga0501044_0005112_12820_13536 | 215 |
| 378 | 3300049823 | Ga0501044_0128195 | Ga0501044_0128195_1108_1812 | 215 |
| 379 | 3300049823 | Ga0501044_0298846 | Ga0501044_0298846_513_1229 | 215 |
| 380 | 3300049823 | Ga0501044_0324039 | Ga0501044_0324039_579_1307 | 215 |
| 381 | 3300049823 | Ga0501044_0354220 | Ga0501044_0354220_485_1195 | 215 |
| 382 | 3300049824 | Ga0501045_0065925 | Ga0501045_0065925_1537_2253 | 215 |
| 383 | 3300050491 | nmdc:mga00v17_146286_c1 | nmdc:mga00v17_146286_c1_247_948 | 215 |
| 384 | 3300050494 | nmdc:mga06z11_445988_c1 | nmdc:mga06z11_445988_c1_38_739 | 215 |
| 385 | 3300053084 | Ga0495595_0088257 | Ga0495595_0088257_608_1312 | 215 |
| 386 | 3300053098 | Ga0500650_0163553 | Ga0500650_0163553_205_906 | 215 |
| 387 | 3300053134 | Ga0500658_0078082 | Ga0500658_0078082_339_1040 | 215 |
| 388 | 3300054114 | Ga0501084_0669724 | Ga0501084_0669724_59_769 | 215 |
| 389 | 3300060353 | Ga0501082_0021232 | Ga0501082_0021232_4722_5432 | 215 |
| 390 | 3300060353 | Ga0501082_0105235 | Ga0501082_0105235_1635_2351 | 215 |
| 391 | 3300005344 | Ga0070661_100142399 | Ga0070661_1001423992 | 216 |
| 392 | 3300005367 | Ga0070667_100182185 | Ga0070667_1001821852 | 216 |
| 393 | 3300005435 | Ga0070714_100168615 | Ga0070714_1001686152 | 216 |
| 394 | 3300005436 | Ga0070713_100207921 | Ga0070713_1002079212 | 216 |
| 395 | 3300005437 | Ga0070710_10028747 | Ga0070710_100287472 | 216 |
| 396 | 3300005457 | Ga0070662_100162522 | Ga0070662_1001625222 | 216 |
| 397 | 3300005544 | Ga0070686_100393737 | Ga0070686_1003937371 | 216 |
| 398 | 3300006028 | Ga0070717_10294740 | Ga0070717_102947402 | 216 |
| 399 | 3300006173 | Ga0070716_100034968 | Ga0070716_1000349683 | 216 |
| 400 | 3300006237 | Ga0097621_100094037 | Ga0097621_1000940372 | 216 |
| 401 | 3300009148 | Ga0105243_10151695 | Ga0105243_101516952 | 216 |
| 402 | 3300009177 | Ga0105248_10096829 | Ga0105248_100968292 | 216 |
| 403 | 3300013296 | Ga0157374_10308246 | Ga0157374_103082462 | 216 |
| 404 | 3300013307 | Ga0157372_10591980 | Ga0157372_105919801 | 216 |
| 405 | 3300014968 | Ga0157379_10116794 | Ga0157379_101167942 | 216 |
| 406 | 3300025898 | Ga0207692_10063961 | Ga0207692_100639612 | 216 |
| 407 | 3300025905 | Ga0207685_10054018 | Ga0207685_100540182 | 216 |
| 408 | 3300025912 | Ga0207707_10326177 | Ga0207707_103261771 | 216 |
| 409 | 3300025920 | Ga0207649_10492361 | Ga0207649_104923611 | 216 |
| 410 | 3300025927 | Ga0207687_10065991 | Ga0207687_100659913 | 216 |
| 411 | 3300025928 | Ga0207700_10132649 | Ga0207700_101326492 | 216 |
| 412 | 3300025931 | Ga0207644_10020542 | Ga0207644_100205426 | 216 |
| 413 | 3300025933 | Ga0207706_10006829 | Ga0207706_100068296 | 216 |
| 414 | 3300025941 | Ga0207711_10217910 | Ga0207711_102179102 | 216 |
| 415 | 3300025949 | Ga0207667_10182647 | Ga0207667_101826471 | 216 |
| 416 | 3300025986 | Ga0207658_10024327 | Ga0207658_100243274 | 216 |
| 417 | 3300031249 | Ga0265339_10124148 | Ga0265339_101241482 | 216 |
| 418 | 3300031250 | Ga0265331_10013598 | Ga0265331_100135983 | 216 |
| 419 | 3300031711 | Ga0265314_10008756 | Ga0265314_100087569 | 216 |
| 420 | 3300034818 | Ga0373950_0007317 | Ga0373950_0007317_407_1135 | 216 |
| 421 | 3300035086 | Ga0373934_0089871 | Ga0373934_0089871_518_1213 | 216 |
| 422 | 3300035089 | Ga0373944_0042431 | Ga0373944_0042431_522_1217 | 216 |
| 423 | 3300035111 | Ga0373923_0000187 | Ga0373923_0000187_9222_9917 | 216 |
| 424 | 3300035116 | Ga0373945_0000395 | Ga0373945_0000395_9082_9777 | 216 |
| 425 | 3300035117 | Ga0373953_0034980 | Ga0373953_0034980_143_838 | 216 |
| 426 | 3300035118 | Ga0373954_0017828 | Ga0373954_0017828_509_1204 | 216 |
| 427 | 3300035118 | Ga0373954_0115911 | Ga0373954_0115911_362_1057 | 216 |
| 428 | 3300035120 | Ga0373957_0135237 | Ga0373957_0135237_101_796 | 216 |
| 429 | 3300035170 | Ga0373943_0034727 | Ga0373943_0034727_1666_2361 | 216 |
| 430 | 3300035171 | Ga0373946_0004740 | Ga0373946_0004740_528_1223 | 216 |
| 431 | 3300035172 | Ga0373955_0005096 | Ga0373955_0005096_3811_4506 | 216 |
| 432 | 3300035172 | Ga0373955_0023343 | Ga0373955_0023343_890_1585 | 216 |
| 433 | 3300035410 | Ga0373924_0005631 | Ga0373924_0005631_2057_2752 | 216 |
| 434 | 3300035692 | Ga0373935_0054490 | Ga0373935_0054490_1169_1864 | 216 |
| 435 | 3300035695 | Ga0373927_0379891 | Ga0373927_0379891_45_740 | 216 |
| 436 | 3300035724 | Ga0373933_0013460 | Ga0373933_0013460_519_1214 | 216 |
| 437 | 3300035724 | Ga0373933_0043828 | Ga0373933_0043828_1296_1991 | 216 |
| 438 | 3300035725 | Ga0373947_0021752 | Ga0373947_0021752_326_1021 | 216 |
| 439 | 3300036401 | Ga0373937_0008320 | Ga0373937_0008320_6561_7256 | 216 |
| 440 | 3300036401 | Ga0373937_0087024 | Ga0373937_0087024_531_1226 | 216 |
| 441 | 3300046454 | Ga0495592_0031428 | Ga0495592_0031428_3033_3728 | 216 |
| 442 | 3300046455 | Ga0495603_0001272 | Ga0495603_0001272_4186_4881 | 216 |
| 443 | 3300046459 | Ga0495629_0183377 | Ga0495629_0183377_612_1307 | 216 |
| 444 | 3300046461 | Ga0495641_0009857 | Ga0495641_0009857_1250_1945 | 216 |
| 445 | 3300046462 | Ga0495651_0017193 | Ga0495651_0017193_3831_4526 | 216 |
| 446 | 3300046463 | Ga0495653_0124757 | Ga0495653_0124757_744_1439 | 216 |
| 447 | 3300046473 | Ga0495582_0024852 | Ga0495582_0024852_776_1471 | 216 |
| 448 | 3300046474 | Ga0495605_0129230 | Ga0495605_0129230_207_902 | 216 |
| 449 | 3300046475 | Ga0495639_0026384 | Ga0495639_0026384_328_1023 | 216 |
| 450 | 3300046476 | Ga0495662_0002967 | Ga0495662_0002967_7729_8424 | 216 |
| 451 | 3300046477 | Ga0495664_0027553 | Ga0495664_0027553_465_1160 | 216 |
| 452 | 3300046491 | Ga0495584_0052151 | Ga0495584_0052151_784_1479 | 216 |
| 453 | 3300046492 | Ga0495585_0003052 | Ga0495585_0003052_6168_6863 | 216 |
| 454 | 3300046501 | Ga0495607_0003738 | Ga0495607_0003738_5572_6267 | 216 |
| 455 | 3300046511 | Ga0495608_0020801 | Ga0495608_0020801_3519_4214 | 216 |
| 456 | 3300046514 | Ga0495618_0013696 | Ga0495618_0013696_2985_3680 | 216 |
| 457 | 3300046517 | Ga0495630_0166620 | Ga0495630_0166620_656_1351 | 216 |
| 458 | 3300046520 | Ga0495637_0015585 | Ga0495637_0015585_2201_2896 | 216 |
| 459 | 3300046523 | Ga0495644_0000312 | Ga0495644_0000312_12017_12712 | 216 |
| 460 | 3300046526 | Ga0495666_0003560 | Ga0495666_0003560_3413_4108 | 216 |
| 461 | 3300046529 | Ga0495652_0134790 | Ga0495652_0134790_945_1640 | 216 |
| 462 | 3300046529 | Ga0495652_0194778 | Ga0495652_0194778_523_1218 | 216 |
| 463 | 3300046531 | Ga0495665_0007736 | Ga0495665_0007736_2582_3277 | 216 |
| 464 | 3300046533 | Ga0495640_0022952 | Ga0495640_0022952_1810_2505 | 216 |
| 465 | 3300046533 | Ga0495640_0032635 | Ga0495640_0032635_2988_3683 | 216 |
| 466 | 3300046543 | Ga0495645_0023097 | Ga0495645_0023097_220_915 | 216 |
| 467 | 3300046557 | Ga0495622_0003315 | Ga0495622_0003315_2979_3674 | 216 |
| 468 | 3300046558 | Ga0495633_0001295 | Ga0495633_0001295_8023_8718 | 216 |
| 469 | 3300046615 | Ga0495656_0000338 | Ga0495656_0000338_9418_10113 | 216 |
| 470 | 3300046642 | Ga0495634_0354786 | Ga0495634_0354786_137_832 | 216 |
| 471 | 3300046648 | Ga0495611_0003977 | Ga0495611_0003977_743_1438 | 216 |
| 472 | 3300046663 | Ga0495635_0049373 | Ga0495635_0049373_444_1139 | 216 |
| 473 | 3300046664 | Ga0495659_0000500 | Ga0495659_0000500_6106_6801 | 216 |
| 474 | 3300046665 | Ga0495661_0012316 | Ga0495661_0012316_4679_5374 | 216 |
| 475 | 3300046674 | Ga0495588_0007831 | Ga0495588_0007831_696_1391 | 216 |
| 476 | 3300046678 | Ga0495599_0082617 | Ga0495599_0082617_185_880 | 216 |
| 477 | 3300046678 | Ga0495599_0193896 | Ga0495599_0193896_471_1166 | 216 |
| 478 | 3300046680 | Ga0495646_0002685 | Ga0495646_0002685_102_797 | 216 |
| 479 | 3300046681 | Ga0495647_0010841 | Ga0495647_0010841_782_1477 | 216 |
| 480 | 3300046683 | Ga0495658_0354600 | Ga0495658_0354600_46_741 | 216 |
| 481 | 3300046689 | Ga0495613_0043715 | Ga0495613_0043715_1655_2350 | 216 |
| 482 | 3300046691 | Ga0495670_0000232 | Ga0495670_0000232_5825_6520 | 216 |
| 483 | 3300046794 | Ga0495589_0021795 | Ga0495589_0021795_1005_1700 | 216 |
| 484 | 3300046809 | Ga0495600_0033437 | Ga0495600_0033437_782_1477 | 216 |
| 485 | 3300047315 | Ga0495581_0004228 | Ga0495581_0004228_4849_5544 | 216 |
| 486 | 3300047315 | Ga0495581_0359211 | Ga0495581_0359211_42_737 | 216 |
| 487 | 3300047317 | Ga0495604_0026371 | Ga0495604_0026371_49_744 | 216 |
| 488 | 3300047317 | Ga0495604_0028582 | Ga0495604_0028582_1753_2448 | 216 |
| 489 | 3300047319 | Ga0495674_0021621 | Ga0495674_0021621_369_1064 | 216 |
| 490 | 3300047322 | Ga0495680_0005660 | Ga0495680_0005660_7219_7914 | 216 |
| 491 | 3300047322 | Ga0495680_0013375 | Ga0495680_0013375_6323_7018 | 216 |
| 492 | 3300047445 | Ga0495677_0020408 | Ga0495677_0020408_754_1449 | 216 |
| 493 | 3300047446 | Ga0495679_011022 | Ga0495679_011022_30_725 | 216 |
| 494 | 3300047471 | Ga0495684_0009284 | Ga0495684_0009284_3913_4608 | 216 |
| 495 | 3300047673 | Ga0495593_0002529 | Ga0495593_0002529_3518_4213 | 216 |
| 496 | 3300048088 | Ga0495602_0365239 | Ga0495602_0365239_325_1020 | 216 |
| 497 | 3300048089 | Ga0495614_0026235 | Ga0495614_0026235_543_1238 | 216 |
| 498 | 3300048903 | Ga0496100_0123679 | Ga0496100_0123679_232_942 | 216 |
| 499 | 3300048904 | Ga0496101_0021356 | Ga0496101_0021356_1004_1714 | 216 |
| 500 | 3300048906 | Ga0496103_0419923 | Ga0496103_0419923_92_802 | 216 |
| 501 | 3300048907 | Ga0496104_0040089 | Ga0496104_0040089_3446_4156 | 216 |
| 502 | 3300048908 | Ga0496105_0010839 | Ga0496105_0010839_3532_4242 | 216 |
| 503 | 3300048909 | Ga0496106_0033955 | Ga0496106_0033955_2525_3235 | 216 |
| 504 | 3300048910 | Ga0496107_0067509 | Ga0496107_0067509_1338_2048 | 216 |
| 505 | 3300048912 | Ga0496109_0093978 | Ga0496109_0093978_1545_2255 | 216 |
| 506 | 3300048917 | Ga0496114_0009201 | Ga0496114_0009201_4042_4752 | 216 |
| 507 | 3300048918 | Ga0496115_0044892 | Ga0496115_0044892_93_803 | 216 |
| 508 | 3300049586 | Ga0501070_0335663 | Ga0501070_0335663_206_904 | 216 |
| 509 | 3300049822 | Ga0501035_0159289 | Ga0501035_0159289_566_1264 | 216 |
| 510 | 3300053077 | Ga0495601_0007348 | Ga0495601_0007348_2299_2994 | 216 |
| 511 | 3300053078 | Ga0495612_0005171 | Ga0495612_0005171_262_972 | 216 |
| 512 | 3300053078 | Ga0495612_0007159 | Ga0495612_0007159_2984_3679 | 216 |
| 513 | 3300053084 | Ga0495595_0003155 | Ga0495595_0003155_1805_2500 | 216 |
| 514 | 3300053084 | Ga0495595_0014630 | Ga0495595_0014630_259_954 | 216 |
| 515 | 3300053085 | Ga0495619_0000083 | Ga0495619_0000083_51104_51799 | 216 |
| 516 | 3300053085 | Ga0495619_0012744 | Ga0495619_0012744_4069_4764 | 216 |
| 517 | 3300053094 | Ga0500566_0217555 | Ga0500566_0217555_128_835 | 216 |
| 518 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_242381_243088 | 216 |
| 519 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1433746_1434453 | 216 |
| 520 | 2209111006 | 2214772988 | 2213792958 | 217 |
| 521 | 3300000041 | ARcpr5oldR_c000150 | ARcpr5oldR_00015013 | 217 |
| 522 | 3300000042 | ARSoilYngRDRAFT_c00394 | ARSoilYngRDRAFT_003942 | 217 |
| 523 | 3300000043 | ARcpr5yngRDRAFT_c000123 | ARcpr5yngRDRAFT_00012313 | 217 |
| 524 | 3300000044 | ARSoilOldRDRAFT_c000007 | ARSoilOldRDRAFT_00000761 | 217 |
| 525 | 3300000045 | ARCol0oldRDRAFT_c00020 | ARCol0oldRDRAFT_0002013 | 217 |
| 526 | 3300000652 | ARCol0yngRDRAFT_1000290 | ARCol0yngRDRAFT_10002905 | 217 |
| 527 | 3300001977 | JGI24746J21847_1001263 | JGI24746J21847_10012632 | 217 |
| 528 | 3300001978 | JGI24747J21853_1005813 | JGI24747J21853_10058132 | 217 |
| 529 | 3300001990 | JGI24737J22298_10014250 | JGI24737J22298_100142502 | 217 |
| 530 | 3300002070 | JGI24750J21931_1000532 | JGI24750J21931_10005322 | 217 |
| 531 | 3300002073 | JGI24745J21846_1001764 | JGI24745J21846_10017642 | 217 |
| 532 | 3300002074 | JGI24748J21848_1001717 | JGI24748J21848_10017172 | 217 |
| 533 | 3300002075 | JGI24738J21930_10001430 | JGI24738J21930_100014303 | 217 |
| 534 | 3300002077 | JGI24744J21845_10003290 | JGI24744J21845_100032901 | 217 |
| 535 | 3300002126 | JGI24035J26624_1000877 | JGI24035J26624_10008772 | 217 |
| 536 | 3300002239 | JGI24034J26672_10000969 | JGI24034J26672_100009694 | 217 |
| 537 | 3300002244 | JGI24742J22300_10000325 | JGI24742J22300_100003255 | 217 |
| 538 | 3300005277 | Ga0065716_1001614 | Ga0065716_10016144 | 217 |
| 539 | 3300005289 | Ga0065704_10072439 | Ga0065704_100724392 | 217 |
| 540 | 3300005290 | Ga0065712_10071797 | Ga0065712_100717974 | 217 |
| 541 | 3300005293 | Ga0065715_10003150 | Ga0065715_100031503 | 217 |
| 542 | 3300005293 | Ga0065715_10089667 | Ga0065715_1008966711 | 217 |
| 543 | 3300005328 | Ga0070676_10033910 | Ga0070676_100339102 | 217 |
| 544 | 3300005329 | Ga0070683_100036987 | Ga0070683_1000369872 | 217 |
| 545 | 3300005330 | Ga0070690_100012762 | Ga0070690_1000127623 | 217 |
| 546 | 3300005330 | Ga0070690_100122896 | Ga0070690_1001228962 | 217 |
| 547 | 3300005331 | Ga0070670_100006862 | Ga0070670_10000686212 | 217 |
| 548 | 3300005333 | Ga0070677_10000988 | Ga0070677_100009882 | 217 |
| 549 | 3300005334 | Ga0068869_100006414 | Ga0068869_1000064141 | 217 |
| 550 | 3300005335 | Ga0070666_10029109 | Ga0070666_100291092 | 217 |
| 551 | 3300005336 | Ga0070680_100002248 | Ga0070680_10000224810 | 217 |
| 552 | 3300005336 | Ga0070680_100074935 | Ga0070680_1000749352 | 217 |
| 553 | 3300005336 | Ga0070680_100158004 | Ga0070680_1001580043 | 217 |
| 554 | 3300005337 | Ga0070682_100011702 | Ga0070682_1000117024 | 217 |
| 555 | 3300005337 | Ga0070682_100213593 | Ga0070682_1002135932 | 217 |
| 556 | 3300005338 | Ga0068868_100002461 | Ga0068868_10000246111 | 217 |
| 557 | 3300005339 | Ga0070660_100024777 | Ga0070660_1000247772 | 217 |
| 558 | 3300005339 | Ga0070660_100034337 | Ga0070660_1000343372 | 217 |
| 559 | 3300005340 | Ga0070689_100074333 | Ga0070689_1000743332 | 217 |
| 560 | 3300005340 | Ga0070689_100298063 | Ga0070689_1002980632 | 217 |
| 561 | 3300005341 | Ga0070691_10001048 | Ga0070691_1000104812 | 217 |
| 562 | 3300005341 | Ga0070691_10127262 | Ga0070691_101272622 | 217 |
| 563 | 3300005343 | Ga0070687_100001539 | Ga0070687_10000153910 | 217 |
| 564 | 3300005343 | Ga0070687_100002921 | Ga0070687_1000029212 | 217 |
| 565 | 3300005345 | Ga0070692_10001006 | Ga0070692_100010062 | 217 |
| 566 | 3300005345 | Ga0070692_10073538 | Ga0070692_100735382 | 217 |
| 567 | 3300005347 | Ga0070668_100034942 | Ga0070668_1000349422 | 217 |
| 568 | 3300005347 | Ga0070668_100095260 | Ga0070668_1000952602 | 217 |
| 569 | 3300005353 | Ga0070669_100002469 | Ga0070669_10000246911 | 217 |
| 570 | 3300005353 | Ga0070669_100112134 | Ga0070669_1001121342 | 217 |
| 571 | 3300005354 | Ga0070675_100007875 | Ga0070675_1000078752 | 217 |
| 572 | 3300005354 | Ga0070675_100192967 | Ga0070675_1001929672 | 217 |
| 573 | 3300005355 | Ga0070671_100027809 | Ga0070671_1000278094 | 217 |
| 574 | 3300005356 | Ga0070674_100026094 | Ga0070674_1000260943 | 217 |
| 575 | 3300005356 | Ga0070674_100230633 | Ga0070674_1002306332 | 217 |
| 576 | 3300005364 | Ga0070673_100000950 | Ga0070673_1000009507 | 217 |
| 577 | 3300005364 | Ga0070673_100484704 | Ga0070673_1004847042 | 217 |
| 578 | 3300005365 | Ga0070688_100003204 | Ga0070688_1000032042 | 217 |
| 579 | 3300005366 | Ga0070659_100006909 | Ga0070659_1000069092 | 217 |
| 580 | 3300005366 | Ga0070659_100086149 | Ga0070659_1000861492 | 217 |
| 581 | 3300005366 | Ga0070659_100661369 | Ga0070659_1006613691 | 217 |
| 582 | 3300005367 | Ga0070667_100227279 | Ga0070667_1002272791 | 217 |
| 583 | 3300005438 | Ga0070701_10001420 | Ga0070701_100014203 | 217 |
| 584 | 3300005438 | Ga0070701_10016393 | Ga0070701_100163934 | 217 |
| 585 | 3300005439 | Ga0070711_100151412 | Ga0070711_1001514122 | 217 |
| 586 | 3300005441 | Ga0070700_100014469 | Ga0070700_1000144692 | 217 |
| 587 | 3300005444 | Ga0070694_100027621 | Ga0070694_1000276212 | 217 |
| 588 | 3300005444 | Ga0070694_100058571 | Ga0070694_1000585712 | 217 |
| 589 | 3300005457 | Ga0070662_100059002 | Ga0070662_1000590022 | 217 |
| 590 | 3300005457 | Ga0070662_100095940 | Ga0070662_1000959401 | 217 |
| 591 | 3300005458 | Ga0070681_10039416 | Ga0070681_100394162 | 217 |
| 592 | 3300005459 | Ga0068867_100001504 | Ga0068867_10000150419 | 217 |
| 593 | 3300005459 | Ga0068867_100444073 | Ga0068867_1004440732 | 217 |
| 594 | 3300005466 | Ga0070685_10023092 | Ga0070685_100230924 | 217 |
| 595 | 3300005466 | Ga0070685_10064625 | Ga0070685_100646252 | 217 |
| 596 | 3300005518 | Ga0070699_100332377 | Ga0070699_1003323772 | 217 |
| 597 | 3300005530 | Ga0070679_100058641 | Ga0070679_1000586413 | 217 |
| 598 | 3300005530 | Ga0070679_100124721 | Ga0070679_1001247212 | 217 |
| 599 | 3300005530 | Ga0070679_100259971 | Ga0070679_1002599712 | 217 |
| 600 | 3300005535 | Ga0070684_100003143 | Ga0070684_1000031432 | 217 |
| 601 | 3300005535 | Ga0070684_100129503 | Ga0070684_1001295032 | 217 |
| 602 | 3300005539 | Ga0068853_100006565 | Ga0068853_10000656512 | 217 |
| 603 | 3300005539 | Ga0068853_100199077 | Ga0068853_1001990772 | 217 |
| 604 | 3300005543 | Ga0070672_100153037 | Ga0070672_1001530372 | 217 |
| 605 | 3300005544 | Ga0070686_100003197 | Ga0070686_1000031972 | 217 |
| 606 | 3300005545 | Ga0070695_100014595 | Ga0070695_1000145952 | 217 |
| 607 | 3300005546 | Ga0070696_100006401 | Ga0070696_1000064012 | 217 |
| 608 | 3300005546 | Ga0070696_100024235 | Ga0070696_1000242352 | 217 |
| 609 | 3300005547 | Ga0070693_100023336 | Ga0070693_1000233363 | 217 |
| 610 | 3300005547 | Ga0070693_100126925 | Ga0070693_1001269251 | 217 |
| 611 | 3300005549 | Ga0070704_100018521 | Ga0070704_1000185212 | 217 |
| 612 | 3300005563 | Ga0068855_100034704 | Ga0068855_1000347044 | 217 |
| 613 | 3300005563 | Ga0068855_100055497 | Ga0068855_1000554973 | 217 |
| 614 | 3300005563 | Ga0068855_100421556 | Ga0068855_1004215562 | 217 |
| 615 | 3300005564 | Ga0070664_101111406 | Ga0070664_1011114061 | 217 |
| 616 | 3300005577 | Ga0068857_100000616 | Ga0068857_1000006162 | 217 |
| 617 | 3300005577 | Ga0068857_100450248 | Ga0068857_1004502481 | 217 |
| 618 | 3300005578 | Ga0068854_100003096 | Ga0068854_1000030969 | 217 |
| 619 | 3300005578 | Ga0068854_100039018 | Ga0068854_1000390183 | 217 |
| 620 | 3300005614 | Ga0068856_100003598 | Ga0068856_10000359811 | 217 |
| 621 | 3300005614 | Ga0068856_100302258 | Ga0068856_1003022582 | 217 |
| 622 | 3300005616 | Ga0068852_100006718 | Ga0068852_10000671810 | 217 |
| 623 | 3300005617 | Ga0068859_100012599 | Ga0068859_1000125997 | 217 |
| 624 | 3300005617 | Ga0068859_100202356 | Ga0068859_1002023562 | 217 |
| 625 | 3300005618 | Ga0068864_100001534 | Ga0068864_10000153416 | 217 |
| 626 | 3300005718 | Ga0068866_10003980 | Ga0068866_100039804 | 217 |
| 627 | 3300005719 | Ga0068861_100728868 | Ga0068861_1007288682 | 217 |
| 628 | 3300005840 | Ga0068870_10000289 | Ga0068870_1000028915 | 217 |
| 629 | 3300005842 | Ga0068858_100009901 | Ga0068858_1000099012 | 217 |
| 630 | 3300005843 | Ga0068860_100017484 | Ga0068860_1000174846 | 217 |
| 631 | 3300005843 | Ga0068860_100029565 | Ga0068860_1000295655 | 217 |
| 632 | 3300005844 | Ga0068862_100005504 | Ga0068862_1000055043 | 217 |
| 633 | 3300005844 | Ga0068862_100239992 | Ga0068862_1002399922 | 217 |
| 634 | 3300005937 | Ga0081455_10000540 | Ga0081455_1000054053 | 217 |
| 635 | 3300006048 | Ga0075363_100018969 | Ga0075363_1000189692 | 217 |
| 636 | 3300006175 | Ga0070712_100171085 | Ga0070712_1001710852 | 217 |
| 637 | 3300006178 | Ga0075367_10057035 | Ga0075367_100570352 | 217 |
| 638 | 3300006237 | Ga0097621_100001930 | Ga0097621_1000019304 | 217 |
| 639 | 3300006852 | Ga0075433_10005937 | Ga0075433_100059372 | 217 |
| 640 | 3300006852 | Ga0075433_10010527 | Ga0075433_100105279 | 217 |
| 641 | 3300006871 | Ga0075434_100003871 | Ga0075434_10000387111 | 217 |
| 642 | 3300006914 | Ga0075436_100259605 | Ga0075436_1002596052 | 217 |
| 643 | 3300006931 | Ga0097620_100012598 | Ga0097620_1000125984 | 217 |
| 644 | 3300006931 | Ga0097620_100202349 | Ga0097620_1002023492 | 217 |
| 645 | 3300007076 | Ga0075435_100035116 | Ga0075435_1000351162 | 217 |
| 646 | 3300007076 | Ga0075435_100056535 | Ga0075435_1000565353 | 217 |
| 647 | 3300009094 | Ga0111539_10001931 | Ga0111539_1000193128 | 217 |
| 648 | 3300009098 | Ga0105245_10002784 | Ga0105245_1000278415 | 217 |
| 649 | 3300009101 | Ga0105247_10003272 | Ga0105247_100032723 | 217 |
| 650 | 3300009148 | Ga0105243_10131082 | Ga0105243_101310822 | 217 |
| 651 | 3300009174 | Ga0105241_10000940 | Ga0105241_100009402 | 217 |
| 652 | 3300009177 | Ga0105248_10012521 | Ga0105248_1001252110 | 217 |
| 653 | 3300009177 | Ga0105248_10013721 | Ga0105248_1001372110 | 217 |
| 654 | 3300009545 | Ga0105237_10095275 | Ga0105237_100952752 | 217 |
| 655 | 3300009551 | Ga0105238_10044004 | Ga0105238_100440044 | 217 |
| 656 | 3300009553 | Ga0105249_10008288 | Ga0105249_1000828811 | 217 |
| 657 | 3300010375 | Ga0105239_10171884 | Ga0105239_101718842 | 217 |
| 658 | 3300010375 | Ga0105239_10312868 | Ga0105239_103128682 | 217 |
| 659 | 3300010375 | Ga0105239_11083825 | Ga0105239_110838251 | 217 |
| 660 | 3300011119 | Ga0105246_10014037 | Ga0105246_100140374 | 217 |
| 661 | 3300013100 | Ga0157373_10333937 | Ga0157373_103339372 | 217 |
| 662 | 3300013102 | Ga0157371_10022118 | Ga0157371_100221185 | 217 |
| 663 | 3300013297 | Ga0157378_10011895 | Ga0157378_1001189510 | 217 |
| 664 | 3300013307 | Ga0157372_10026975 | Ga0157372_100269754 | 217 |
| 665 | 3300013308 | Ga0157375_10011247 | Ga0157375_1001124710 | 217 |
| 666 | 3300014325 | Ga0163163_10001710 | Ga0163163_1000171011 | 217 |
| 667 | 3300014325 | Ga0163163_10045479 | Ga0163163_100454793 | 217 |
| 668 | 3300014326 | Ga0157380_10004849 | Ga0157380_1000484911 | 217 |
| 669 | 3300014745 | Ga0157377_10003757 | Ga0157377_100037573 | 217 |
| 670 | 3300014968 | Ga0157379_10031646 | Ga0157379_100316462 | 217 |
| 671 | 3300014969 | Ga0157376_10002411 | Ga0157376_100024112 | 217 |
| 672 | 3300017792 | Ga0163161_10001476 | Ga0163161_1000147612 | 217 |
| 673 | 3300020070 | Ga0206356_11846112 | Ga0206356_118461122 | 217 |
| 674 | 3300020077 | Ga0206351_10124265 | Ga0206351_101242651 | 217 |
| 675 | 3300020078 | Ga0206352_10069452 | Ga0206352_100694521 | 217 |
| 676 | 3300020081 | Ga0206354_10235034 | Ga0206354_102350342 | 217 |
| 677 | 3300025271 | Ga0207666_1000224 | Ga0207666_10002242 | 217 |
| 678 | 3300025290 | Ga0207673_1000001 | Ga0207673_10000015 | 217 |
| 679 | 3300025315 | Ga0207697_10002732 | Ga0207697_100027322 | 217 |
| 680 | 3300025315 | Ga0207697_10032683 | Ga0207697_100326832 | 217 |
| 681 | 3300025893 | Ga0207682_10000056 | Ga0207682_1000005621 | 217 |
| 682 | 3300025899 | Ga0207642_10001098 | Ga0207642_100010982 | 217 |
| 683 | 3300025899 | Ga0207642_10093155 | Ga0207642_100931552 | 217 |
| 684 | 3300025900 | Ga0207710_10169993 | Ga0207710_101699932 | 217 |
| 685 | 3300025901 | Ga0207688_10003180 | Ga0207688_1000318010 | 217 |
| 686 | 3300025903 | Ga0207680_10016469 | Ga0207680_100164692 | 217 |
| 687 | 3300025904 | Ga0207647_10007813 | Ga0207647_1000781310 | 217 |
| 688 | 3300025904 | Ga0207647_10037671 | Ga0207647_100376714 | 217 |
| 689 | 3300025907 | Ga0207645_10000249 | Ga0207645_1000024920 | 217 |
| 690 | 3300025908 | Ga0207643_10000187 | Ga0207643_1000018715 | 217 |
| 691 | 3300025911 | Ga0207654_10002376 | Ga0207654_100023764 | 217 |
| 692 | 3300025912 | Ga0207707_10008213 | Ga0207707_100082132 | 217 |
| 693 | 3300025912 | Ga0207707_10234401 | Ga0207707_102344012 | 217 |
| 694 | 3300025914 | Ga0207671_10026338 | Ga0207671_100263381 | 217 |
| 695 | 3300025915 | Ga0207693_10004402 | Ga0207693_1000440212 | 217 |
| 696 | 3300025916 | Ga0207663_10007138 | Ga0207663_100071382 | 217 |
| 697 | 3300025916 | Ga0207663_10169015 | Ga0207663_101690152 | 217 |
| 698 | 3300025917 | Ga0207660_10231954 | Ga0207660_102319541 | 217 |
| 699 | 3300025917 | Ga0207660_10592181 | Ga0207660_105921812 | 217 |
| 700 | 3300025918 | Ga0207662_10003317 | Ga0207662_1000331710 | 217 |
| 701 | 3300025918 | Ga0207662_10044847 | Ga0207662_100448472 | 217 |
| 702 | 3300025919 | Ga0207657_10012795 | Ga0207657_100127952 | 217 |
| 703 | 3300025919 | Ga0207657_10028541 | Ga0207657_100285412 | 217 |
| 704 | 3300025920 | Ga0207649_10000852 | Ga0207649_1000085216 | 217 |
| 705 | 3300025921 | Ga0207652_10009431 | Ga0207652_100094312 | 217 |
| 706 | 3300025921 | Ga0207652_10267242 | Ga0207652_102672422 | 217 |
| 707 | 3300025923 | Ga0207681_10006377 | Ga0207681_100063775 | 217 |
| 708 | 3300025926 | Ga0207659_10003644 | Ga0207659_1000364411 | 217 |
| 709 | 3300025926 | Ga0207659_10305525 | Ga0207659_103055252 | 217 |
| 710 | 3300025932 | Ga0207690_10023701 | Ga0207690_100237013 | 217 |
| 711 | 3300025932 | Ga0207690_10036618 | Ga0207690_100366184 | 217 |
| 712 | 3300025933 | Ga0207706_10001175 | Ga0207706_1000117527 | 217 |
| 713 | 3300025933 | Ga0207706_10053280 | Ga0207706_100532804 | 217 |
| 714 | 3300025934 | Ga0207686_10000898 | Ga0207686_1000089815 | 217 |
| 715 | 3300025935 | Ga0207709_10006803 | Ga0207709_100068032 | 217 |
| 716 | 3300025935 | Ga0207709_10053131 | Ga0207709_100531312 | 217 |
| 717 | 3300025936 | Ga0207670_10002663 | Ga0207670_1000266310 | 217 |
| 718 | 3300025937 | Ga0207669_10000534 | Ga0207669_1000053412 | 217 |
| 719 | 3300025938 | Ga0207704_10026200 | Ga0207704_100262003 | 217 |
| 720 | 3300025939 | Ga0207665_10307599 | Ga0207665_103075992 | 217 |
| 721 | 3300025940 | Ga0207691_10001992 | Ga0207691_100019927 | 217 |
| 722 | 3300025940 | Ga0207691_10235001 | Ga0207691_102350012 | 217 |
| 723 | 3300025942 | Ga0207689_10000424 | Ga0207689_1000042440 | 217 |
| 724 | 3300025944 | Ga0207661_10002538 | Ga0207661_1000253816 | 217 |
| 725 | 3300025944 | Ga0207661_10196111 | Ga0207661_101961112 | 217 |
| 726 | 3300025945 | Ga0207679_10000187 | Ga0207679_1000018715 | 217 |
| 727 | 3300025945 | Ga0207679_10182235 | Ga0207679_101822351 | 217 |
| 728 | 3300025949 | Ga0207667_10224059 | Ga0207667_102240592 | 217 |
| 729 | 3300025949 | Ga0207667_10521007 | Ga0207667_105210072 | 217 |
| 730 | 3300025960 | Ga0207651_10073255 | Ga0207651_100732552 | 217 |
| 731 | 3300025961 | Ga0207712_10001563 | Ga0207712_1000156317 | 217 |
| 732 | 3300025961 | Ga0207712_10092033 | Ga0207712_100920332 | 217 |
| 733 | 3300025972 | Ga0207668_10000807 | Ga0207668_1000080713 | 217 |
| 734 | 3300025981 | Ga0207640_10026149 | Ga0207640_100261494 | 217 |
| 735 | 3300025986 | Ga0207658_10016316 | Ga0207658_100163161 | 217 |
| 736 | 3300025986 | Ga0207658_10099770 | Ga0207658_100997702 | 217 |
| 737 | 3300025986 | Ga0207658_10335314 | Ga0207658_103353142 | 217 |
| 738 | 3300026023 | Ga0207677_10008612 | Ga0207677_100086126 | 217 |
| 739 | 3300026035 | Ga0207703_10004096 | Ga0207703_100040967 | 217 |
| 740 | 3300026067 | Ga0207678_10010172 | Ga0207678_1001017210 | 217 |
| 741 | 3300026067 | Ga0207678_10159384 | Ga0207678_101593842 | 217 |
| 742 | 3300026075 | Ga0207708_10007098 | Ga0207708_1000709810 | 217 |
| 743 | 3300026075 | Ga0207708_10009482 | Ga0207708_100094827 | 217 |
| 744 | 3300026078 | Ga0207702_10195449 | Ga0207702_101954492 | 217 |
| 745 | 3300026078 | Ga0207702_10246459 | Ga0207702_102464592 | 217 |
| 746 | 3300026088 | Ga0207641_10001747 | Ga0207641_100017471 | 217 |
| 747 | 3300026089 | Ga0207648_10001031 | Ga0207648_100010311 | 217 |
| 748 | 3300026089 | Ga0207648_10009238 | Ga0207648_100092382 | 217 |
| 749 | 3300026116 | Ga0207674_10015762 | Ga0207674_100157622 | 217 |
| 750 | 3300026116 | Ga0207674_10347251 | Ga0207674_103472512 | 217 |
| 751 | 3300026118 | Ga0207675_100010495 | Ga0207675_10001049510 | 217 |
| 752 | 3300026118 | Ga0207675_100388450 | Ga0207675_1003884501 | 217 |
| 753 | 3300026121 | Ga0207683_10000727 | Ga0207683_1000072713 | 217 |
| 754 | 3300026142 | Ga0207698_10001591 | Ga0207698_100015913 | 217 |
| 755 | 3300027526 | Ga0209968_1002657 | Ga0209968_10026571 | 217 |
| 756 | 3300027543 | Ga0209999_1006567 | Ga0209999_10065672 | 217 |
| 757 | 3300027617 | Ga0210002_1000950 | Ga0210002_10009504 | 217 |
| 758 | 3300027682 | Ga0209971_1020944 | Ga0209971_10209442 | 217 |
| 759 | 3300027717 | Ga0209998_10006128 | Ga0209998_100061282 | 217 |
| 760 | 3300027717 | Ga0209998_10007092 | Ga0209998_100070922 | 217 |
| 761 | 3300027876 | Ga0209974_10038087 | Ga0209974_100380871 | 217 |
| 762 | 3300027876 | Ga0209974_10095556 | Ga0209974_100955562 | 217 |
| 763 | 3300027907 | Ga0207428_10000150 | Ga0207428_1000015090 | 217 |
| 764 | 3300027907 | Ga0207428_10001312 | Ga0207428_100013122 | 217 |
| 765 | 3300028380 | Ga0268265_10003058 | Ga0268265_100030582 | 217 |
| 766 | 3300028381 | Ga0268264_10002038 | Ga0268264_1000203816 | 217 |
| 767 | 3300028381 | Ga0268264_10032654 | Ga0268264_100326542 | 217 |
| 768 | 3300031241 | Ga0265325_10000030 | Ga0265325_1000003036 | 217 |
| 769 | 3300031247 | Ga0265340_10088816 | Ga0265340_100888162 | 217 |
| 770 | 3300031344 | Ga0265316_10059331 | Ga0265316_100593312 | 217 |
| 771 | 3300031344 | Ga0265316_10291964 | Ga0265316_102919642 | 217 |
| 772 | 3300031595 | Ga0265313_10061106 | Ga0265313_100611062 | 217 |
| 773 | 3300035091 | Ga0373951_0009307 | Ga0373951_0009307_1146_1841 | 217 |
| 774 | 3300035117 | Ga0373953_0019396 | Ga0373953_0019396_870_1565 | 217 |
| 775 | 3300035118 | Ga0373954_0066955 | Ga0373954_0066955_372_1067 | 217 |
| 776 | 3300035119 | Ga0373956_0005701 | Ga0373956_0005701_3615_4310 | 217 |
| 777 | 3300035121 | Ga0373960_0000484 | Ga0373960_0000484_5236_5931 | 217 |
| 778 | 3300035410 | Ga0373924_0015589 | Ga0373924_0015589_1524_2219 | 217 |
| 779 | 3300035724 | Ga0373933_0009795 | Ga0373933_0009795_2505_3200 | 217 |
| 780 | 3300035725 | Ga0373947_0030734 | Ga0373947_0030734_84_779 | 217 |
| 781 | 3300036401 | Ga0373937_0004072 | Ga0373937_0004072_9186_9881 | 217 |
| 782 | 3300037068 | Ga0373925_0001686 | Ga0373925_0001686_4312_5007 | 217 |
| 783 | 3300042008 | Ga0439450_016497 | Ga0439450_016497_636_1331 | 217 |
| 784 | 3300046454 | Ga0495592_0004354 | Ga0495592_0004354_7828_8523 | 217 |
| 785 | 3300046461 | Ga0495641_0157066 | Ga0495641_0157066_220_915 | 217 |
| 786 | 3300046462 | Ga0495651_0128542 | Ga0495651_0128542_628_1323 | 217 |
| 787 | 3300046463 | Ga0495653_0023158 | Ga0495653_0023158_3309_4004 | 217 |
| 788 | 3300046477 | Ga0495664_0015764 | Ga0495664_0015764_2513_3208 | 217 |
| 789 | 3300046516 | Ga0495628_0004484 | Ga0495628_0004484_3949_4644 | 217 |
| 790 | 3300046529 | Ga0495652_0023265 | Ga0495652_0023265_3383_4078 | 217 |
| 791 | 3300046533 | Ga0495640_0040917 | Ga0495640_0040917_594_1289 | 217 |
| 792 | 3300046543 | Ga0495645_0001254 | Ga0495645_0001254_5476_6171 | 217 |
| 793 | 3300046559 | Ga0495667_0013991 | Ga0495667_0013991_2478_3173 | 217 |
| 794 | 3300046663 | Ga0495635_0018319 | Ga0495635_0018319_28_723 | 217 |
| 795 | 3300046675 | Ga0495657_0025807 | Ga0495657_0025807_1324_2019 | 217 |
| 796 | 3300046678 | Ga0495599_0003098 | Ga0495599_0003098_2431_3126 | 217 |
| 797 | 3300046679 | Ga0495623_0001432 | Ga0495623_0001432_6655_7350 | 217 |
| 798 | 3300046680 | Ga0495646_0254689 | Ga0495646_0254689_66_761 | 217 |
| 799 | 3300047317 | Ga0495604_0023070 | Ga0495604_0023070_3175_3870 | 217 |
| 800 | 3300048088 | Ga0495602_0016985 | Ga0495602_0016985_5724_6419 | 217 |
| 801 | 3300048903 | Ga0496100_0006271 | Ga0496100_0006271_4335_5030 | 217 |
| 802 | 3300048906 | Ga0496103_0000963 | Ga0496103_0000963_11335_12030 | 217 |
| 803 | 3300048907 | Ga0496104_0000065 | Ga0496104_0000065_85101_85799 | 217 |
| 804 | 3300048908 | Ga0496105_0167840 | Ga0496105_0167840_883_1578 | 217 |
| 805 | 3300048911 | Ga0496108_0027237 | Ga0496108_0027237_599_1294 | 217 |
| 806 | 3300048912 | Ga0496109_0001690 | Ga0496109_0001690_662_1357 | 217 |
| 807 | 3300048913 | Ga0496110_0285028 | Ga0496110_0285028_188_883 | 217 |
| 808 | 3300048915 | Ga0496112_0161739 | Ga0496112_0161739_803_1498 | 217 |
| 809 | 3300048916 | Ga0496113_0000329 | Ga0496113_0000329_11113_11808 | 217 |
| 810 | 3300048918 | Ga0496115_0297969 | Ga0496115_0297969_426_1124 | 217 |
| 811 | 3300049571 | Ga0501034_0340083 | Ga0501034_0340083_493_1206 | 217 |
| 812 | 3300049571 | Ga0501034_0410636 | Ga0501034_0410636_183_959 | 217 |
| 813 | 3300049581 | Ga0501047_0177364 | Ga0501047_0177364_120_848 | 217 |
| 814 | 3300049585 | Ga0501069_0020092 | Ga0501069_0020092_2212_2931 | 217 |
| 815 | 3300049586 | Ga0501070_0006927 | Ga0501070_0006927_2061_2780 | 217 |
| 816 | 3300049586 | Ga0501070_0033855 | Ga0501070_0033855_2838_3557 | 217 |
| 817 | 3300049586 | Ga0501070_0206242 | Ga0501070_0206242_540_1253 | 217 |
| 818 | 3300049586 | Ga0501070_0400366 | Ga0501070_0400366_191_910 | 217 |
| 819 | 3300049590 | Ga0501074_0497655 | Ga0501074_0497655_104_832 | 217 |
| 820 | 3300049592 | Ga0501076_0184391 | Ga0501076_0184391_879_1574 | 217 |
| 821 | 3300049593 | Ga0501077_0011615 | Ga0501077_0011615_1729_2424 | 217 |
| 822 | 3300049593 | Ga0501077_0080756 | Ga0501077_0080756_1274_1972 | 217 |
| 823 | 3300049741 | Ga0501079_0607745 | Ga0501079_0607745_129_824 | 217 |
| 824 | 3300049742 | Ga0501080_0146136 | Ga0501080_0146136_576_1304 | 217 |
| 825 | 3300049742 | Ga0501080_0263059 | Ga0501080_0263059_826_1545 | 217 |
| 826 | 3300049742 | Ga0501080_0399828 | Ga0501080_0399828_292_1005 | 217 |
| 827 | 3300049742 | Ga0501080_0411889 | Ga0501080_0411889_179_898 | 217 |
| 828 | 3300049742 | Ga0501080_0451264 | Ga0501080_0451264_322_1017 | 217 |
| 829 | 3300049744 | Ga0501083_0128696 | Ga0501083_0128696_908_1636 | 217 |
| 830 | 3300049822 | Ga0501035_0000655 | Ga0501035_0000655_12833_13549 | 217 |
| 831 | 3300053077 | Ga0495601_0000225 | Ga0495601_0000225_20062_20757 | 217 |
| 832 | 3300053078 | Ga0495612_0000405 | Ga0495612_0000405_12546_13241 | 217 |
| 833 | 3300053084 | Ga0495595_0016278 | Ga0495595_0016278_1959_2654 | 217 |
| 834 | 3300053085 | Ga0495619_0001284 | Ga0495619_0001284_5902_6597 | 217 |
| 835 | 3300053085 | Ga0495619_0329939 | Ga0495619_0329939_119_823 | 217 |
| 836 | 3300061734 | Ga0530510_0580173 | Ga0530510_0580173_59_754 | 217 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ni7-assembly1.cif.gz_B | crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 | 0.8097 | 21 | 197 |
| 3ni7-assembly1.cif.gz_A | crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 | 0.8044 | 23 | 197 |
| 3ni7-assembly1.cif.gz_B | crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 | 0.7934 | 21 | 197 |
| 3ni7-assembly1.cif.gz_A | crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 | 0.7802 | 23 | 197 |
| 3c07-assembly1.cif.gz_A | crystal structure of a tetr family transcriptional regulator from streptomyces coelicolor a3(2) | 0.7704 | 23 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hodA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9551 | 21 | 64 | 1.10.10.60 |
| 6ho0A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9533 | 21 | 64 | 1.10.10.60 |
| 3g1oA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9502 | 22 | 64 | 1.10.10.60 |
| 6azhA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9493 | 23 | 68 | 1.10.10.60 |
| 5f04A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9475 | 21 | 64 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0XMZ9-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9855 | 22 | 209 |
GO:0003677
|
| AF-A0A2N6B5K2-F1-model_v4 | TetR family transcriptional regulator | 0.9807 | 22 | 209 |
|
| AF-A0A346R4N6-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9767 | 22 | 215 |
GO:0003677
|
| AF-A0A327JWW7-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9765 | 22 | 216 |
GO:0003677
|
| AF-A0A5D0VHX0-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9754 | 22 | 215 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar