F482913

General Info

Members Datasets Scaffolds Average Seq Length
836 397 835 225

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0410636|Ga0501034_0410636_183_959
Length 258
Sequence MARKPKHQSQTPAPPSAPPPRGTSDRDKAIDALIALLAERPFDEIGLAEIAGRAGIKLSQLRAEFGSPLAIFAAHVKDIDRRVLDGGDTDMSDEAPRDRLFEVLMRRLDAMKPYREAVRSMLRSARRHPSLALALNAMAVRSQQWMLEAAGIHASGPKGLMRAQGSALMFARVLSVWIDDEDEGLDRTMAALDRGLASAERWAGFLNDLCAVPKCLVRGHRGSQRGLASIHHPEEPRSGPRRMTGTAPRPSILPLWVR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
387 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
388 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
389 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
390 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
391 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
392 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.32
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 6.46
Rhizosphere 90.67
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772988 2209111006 Bacteria 11988
2 ARcpr5oldR_c000150 3300000041 Bacteria 12077
3 ARSoilYngRDRAFT_c00394 3300000042 Bacteria 5757
4 ARcpr5yngRDRAFT_c000123 3300000043 Bacteria 12049
5 ARSoilOldRDRAFT_c000007 3300000044 Bacteria 55959
6 ARCol0oldRDRAFT_c00020 3300000045 Bacteria 12065
7 ARCol0yngRDRAFT_1000290 3300000652 Bacteria 7781
8 JGI24746J21847_1001263 3300001977 Bacteria 4039
9 JGI24747J21853_1005813 3300001978 Bacteria 1149
10 JGI24737J22298_10014250 3300001990 Bacteria 2582
11 JGI24750J21931_1000532 3300002070 Bacteria 5867
12 JGI24745J21846_1001764 3300002073 Bacteria 2134
13 JGI24748J21848_1001717 3300002074 Bacteria 2430
14 JGI24738J21930_10001430 3300002075 Bacteria 6625
15 JGI24744J21845_10003290 3300002077 Bacteria 3319
16 JGI24035J26624_1000877 3300002126 Bacteria 2842
17 JGI24034J26672_10000969 3300002239 Bacteria 3750
18 JGI24742J22300_10000325 3300002244 Bacteria 7086
19 Ga0065716_1001614 3300005277 Bacteria 5215
20 Ga0065704_10072439 3300005289 Bacteria 8525
21 Ga0065712_10071797 3300005290 Bacteria 5059
22 Ga0065715_10003150 3300005293 Bacteria 9200
23 Ga0065715_10089667 3300005293 Bacteria 9013
24 Ga0070658_10008781 3300005327 Bacteria 8120
25 Ga0070676_10033910 3300005328 Bacteria 2929
26 Ga0070683_100036987 3300005329 Bacteria 4467
27 Ga0070690_100012762 3300005330 Bacteria 4948
28 Ga0070690_100122896 3300005330 Bacteria 1744
29 Ga0070670_100006862 3300005331 Bacteria 9649
30 Ga0070677_10000988 3300005333 Bacteria 9191
31 Ga0068869_100006414 3300005334 Bacteria 7460
32 Ga0070666_10029109 3300005335 Bacteria 3629
33 Ga0070680_100002248 3300005336 Bacteria 14256
34 Ga0070680_100024074 3300005336 Bacteria 4860
35 Ga0070680_100044425 3300005336 Bacteria 3610
36 Ga0070680_100074935 3300005336 Bacteria 2785
37 Ga0070680_100080355 3300005336 Bacteria 2688
38 Ga0070680_100158004 3300005336 Bacteria 1905
39 Ga0070680_100268648 3300005336 Bacteria 1444
40 Ga0070682_100011702 3300005337 Bacteria 5017
41 Ga0070682_100213593 3300005337 Bacteria 1369
42 Ga0070682_100456343 3300005337 Bacteria 980
43 Ga0068868_100002461 3300005338 Bacteria 12859
44 Ga0070660_100024777 3300005339 Bacteria 4455
45 Ga0070660_100034337 3300005339 Bacteria 3831
46 Ga0070660_100158724 3300005339 Bacteria 1821
47 Ga0070689_100074333 3300005340 Bacteria 2659
48 Ga0070689_100287691 3300005340 Bacteria 1365
49 Ga0070689_100298063 3300005340 Bacteria 1341
50 Ga0070691_10001048 3300005341 Bacteria 11394
51 Ga0070691_10127262 3300005341 Bacteria 1288
52 Ga0070687_100001539 3300005343 Bacteria 8169
53 Ga0070687_100002921 3300005343 Bacteria 6556
54 Ga0070661_100142399 3300005344 Bacteria 1808
55 Ga0070692_10001006 3300005345 Bacteria 9699
56 Ga0070692_10073538 3300005345 Bacteria 1826
57 Ga0070668_100034942 3300005347 Bacteria 3831
58 Ga0070668_100095260 3300005347 Bacteria 2351
59 Ga0070668_100281096 3300005347 Unclassified 1390
60 Ga0070669_100002469 3300005353 Bacteria 13390
61 Ga0070669_100112134 3300005353 Bacteria 2071
62 Ga0070669_100527797 3300005353 Bacteria 982
63 Ga0070675_100007875 3300005354 Bacteria 8257
64 Ga0070675_100192967 3300005354 Bacteria 1765
65 Ga0070671_100027809 3300005355 Bacteria 4655
66 Ga0070674_100026094 3300005356 Bacteria 3812
67 Ga0070674_100230633 3300005356 Bacteria 1445
68 Ga0070673_100000950 3300005364 Bacteria 16418
69 Ga0070673_100484704 3300005364 Bacteria 1117
70 Ga0070688_100003204 3300005365 Bacteria 8386
71 Ga0070659_100006909 3300005366 Bacteria 8218
72 Ga0070659_100086149 3300005366 Bacteria 2513
73 Ga0070659_100286565 3300005366 Unclassified 1371
74 Ga0070659_100661369 3300005366 Bacteria 901
75 Ga0070667_100182185 3300005367 Bacteria 1858
76 Ga0070667_100227279 3300005367 Bacteria 1663
77 Ga0070709_10014181 3300005434 Bacteria 4502
78 Ga0070714_100049845 3300005435 Bacteria 3564
79 Ga0070714_100167523 3300005435 Bacteria 1992
80 Ga0070714_100168615 3300005435 Bacteria 1985
81 Ga0070714_100337229 3300005435 Bacteria 1413
82 Ga0070713_100207921 3300005436 Bacteria 1770
83 Ga0070710_10019546 3300005437 Bacteria 3502
84 Ga0070710_10028747 3300005437 Bacteria 2976
85 Ga0070701_10001420 3300005438 Bacteria 8867
86 Ga0070701_10016393 3300005438 Bacteria 3444
87 Ga0070711_100063686 3300005439 Bacteria 2574
88 Ga0070711_100151412 3300005439 Bacteria 1749
89 Ga0070711_100190525 3300005439 Bacteria 1576
90 Ga0070700_100014469 3300005441 Bacteria 4455
91 Ga0070694_100027621 3300005444 Bacteria 3687
92 Ga0070694_100058571 3300005444 Bacteria 2621
93 Ga0070694_100136162 3300005444 Bacteria 1780
94 Ga0070708_100487167 3300005445 Bacteria 1163
95 Ga0070663_100175121 3300005455 Bacteria 1661
96 Ga0070662_100059002 3300005457 Bacteria 2794
97 Ga0070662_100095940 3300005457 Bacteria 2236
98 Ga0070662_100162522 3300005457 Bacteria 1748
99 Ga0070681_10028339 3300005458 Bacteria 5629
100 Ga0070681_10039416 3300005458 Bacteria 4736
101 Ga0070681_10054250 3300005458 Bacteria 3994
102 Ga0070681_10200162 3300005458 Bacteria 1916
103 Ga0068867_100001504 3300005459 Bacteria 16138
104 Ga0068867_100444073 3300005459 Bacteria 1104
105 Ga0070685_10023092 3300005466 Bacteria 3401
106 Ga0070685_10064625 3300005466 Bacteria 2152
107 Ga0070707_100980370 3300005468 Unclassified 810
108 Ga0070699_100332377 3300005518 Bacteria 1367
109 Ga0070679_100058641 3300005530 Bacteria 3836
110 Ga0070679_100124721 3300005530 Bacteria 2558
111 Ga0070679_100142953 3300005530 Bacteria 2371
112 Ga0070679_100259971 3300005530 Bacteria 1691
113 Ga0070684_100003143 3300005535 Bacteria 12332
114 Ga0070684_100129503 3300005535 Bacteria 2276
115 Ga0068853_100006565 3300005539 Bacteria 9267
116 Ga0068853_100199077 3300005539 Bacteria 1822
117 Ga0070672_100153037 3300005543 Bacteria 1909
118 Ga0070672_100168917 3300005543 Bacteria 1818
119 Ga0070686_100003197 3300005544 Bacteria 8978
120 Ga0070686_100393737 3300005544 Unclassified 1052
121 Ga0070695_100014595 3300005545 Bacteria 4736
122 Ga0070696_100006401 3300005546 Bacteria 7881
123 Ga0070696_100024235 3300005546 Bacteria 4123
124 Ga0070696_100105465 3300005546 Bacteria 2025
125 Ga0070693_100023336 3300005547 Bacteria 3306
126 Ga0070693_100126925 3300005547 Bacteria 1589
127 Ga0070704_100018521 3300005549 Bacteria 4455
128 Ga0068855_100034704 3300005563 Bacteria 6012
129 Ga0068855_100050850 3300005563 Bacteria 4882
130 Ga0068855_100055497 3300005563 Bacteria 4653
131 Ga0068855_100063448 3300005563 Bacteria 4312
132 Ga0068855_100092066 3300005563 Bacteria 3496
133 Ga0068855_100421556 3300005563 Bacteria 1460
134 Ga0070664_100065346 3300005564 Bacteria 3103
135 Ga0070664_101111406 3300005564 Bacteria 745
136 Ga0068857_100000616 3300005577 Bacteria 26168
137 Ga0068857_100450248 3300005577 Bacteria 1203
138 Ga0068854_100003096 3300005578 Bacteria 10357
139 Ga0068854_100039018 3300005578 Bacteria 3343
140 Ga0068854_100086516 3300005578 Bacteria 2324
141 Ga0068856_100003598 3300005614 Bacteria 15595
142 Ga0068856_100302258 3300005614 Bacteria 1618
143 Ga0068852_100006718 3300005616 Bacteria 8344
144 Ga0068852_100333399 3300005616 Bacteria 1477
145 Ga0068859_100012599 3300005617 Bacteria 8504
146 Ga0068859_100202356 3300005617 Bacteria 2071
147 Ga0068864_100001534 3300005618 Bacteria 19014
148 Ga0068866_10003980 3300005718 Bacteria 6062
149 Ga0068861_100728868 3300005719 Bacteria 924
150 Ga0068870_10000289 3300005840 Bacteria 18688
151 Ga0068858_100009901 3300005842 Bacteria 9055
152 Ga0068858_100051708 3300005842 Bacteria 3801
153 Ga0068860_100017484 3300005843 Bacteria 6987
154 Ga0068860_100029565 3300005843 Bacteria 5272
155 Ga0068862_100005504 3300005844 Bacteria 10580
156 Ga0068862_100239992 3300005844 Bacteria 1647
157 Ga0081455_10000540 3300005937 Bacteria 49195
158 Ga0081455_10008929 3300005937 Bacteria 10360
159 Ga0081455_10014732 3300005937 Bacteria 7633
160 Ga0070717_10294740 3300006028 Bacteria 1441
161 Ga0075368_10058580 3300006042 Bacteria 1539
162 Ga0075363_100018969 3300006048 Bacteria 3433
163 Ga0075363_100090855 3300006048 Bacteria 1680
164 Ga0075363_100119038 3300006048 Bacteria 1473
165 Ga0070716_100034968 3300006173 Bacteria 2759
166 Ga0070712_100171085 3300006175 Bacteria 1685
167 Ga0070712_100706908 3300006175 Bacteria 860
168 Ga0075362_10044204 3300006177 Bacteria 1974
169 Ga0075367_10057035 3300006178 Bacteria 2322
170 Ga0075427_10000344 3300006194 Bacteria 5117
171 Ga0097621_100001930 3300006237 Bacteria 14142
172 Ga0097621_100094037 3300006237 Bacteria 2513
173 Ga0075370_10254295 3300006353 Bacteria 1041
174 Ga0068871_100001884 3300006358 Bacteria 14190
175 Ga0075428_100005389 3300006844 Bacteria 14223
176 Ga0075428_100313407 3300006844 Bacteria 1686
177 Ga0075430_100000426 3300006846 Bacteria 31396
178 Ga0075431_100005525 3300006847 Bacteria 12476
179 Ga0075433_10000029 3300006852 Bacteria 55893
180 Ga0075433_10005937 3300006852 Bacteria 9616
181 Ga0075433_10010527 3300006852 Bacteria 7429
182 Ga0075434_100000208 3300006871 Bacteria 39868
183 Ga0075434_100003871 3300006871 Bacteria 13392
184 Ga0075434_100058176 3300006871 Bacteria 3842
185 Ga0075434_100059772 3300006871 Bacteria 3790
186 Ga0075434_100097978 3300006871 Bacteria 2937
187 Ga0075434_100244633 3300006871 Bacteria 1814
188 Ga0075429_100000734 3300006880 Bacteria 25672
189 Ga0075436_100259605 3300006914 Bacteria 1239
190 Ga0075436_100284281 3300006914 Unclassified 1183
191 Ga0075436_100302194 3300006914 Bacteria 1147
192 Ga0097620_100012598 3300006931 Bacteria 8504
193 Ga0097620_100202349 3300006931 Bacteria 2071
194 Ga0075435_100001396 3300007076 Bacteria 15545
195 Ga0075435_100035116 3300007076 Bacteria 3977
196 Ga0075435_100056535 3300007076 Bacteria 3172
197 Ga0075435_100081695 3300007076 Bacteria 2655
198 Ga0075435_100253011 3300007076 Bacteria 1500
199 Ga0105240_10045619 3300009093 Bacteria 5559
200 Ga0105240_11075781 3300009093 Bacteria 857
201 Ga0111539_10001931 3300009094 Bacteria 27629
202 Ga0105245_10002784 3300009098 Bacteria 15726
203 Ga0105245_10011288 3300009098 Bacteria 7780
204 Ga0105245_10909693 3300009098 Unclassified 922
205 Ga0105247_10003272 3300009101 Bacteria 10625
206 Ga0105247_10510540 3300009101 Bacteria 877
207 Ga0105243_10131082 3300009148 Bacteria 2126
208 Ga0105243_10151695 3300009148 Bacteria 1989
209 Ga0105241_10000940 3300009174 Bacteria 21996
210 Ga0105241_10034680 3300009174 Bacteria 3792
211 Ga0105242_10259660 3300009176 Bacteria 1569
212 Ga0105248_10012521 3300009177 Bacteria 9355
213 Ga0105248_10013721 3300009177 Bacteria 8920
214 Ga0105248_10096829 3300009177 Bacteria 3324
215 Ga0105237_10095275 3300009545 Bacteria 2966
216 Ga0105238_10044004 3300009551 Bacteria 4516
217 Ga0105238_10193544 3300009551 Bacteria 2009
218 Ga0105249_10008288 3300009553 Bacteria 9052
219 Ga0105239_10171884 3300010375 Bacteria 2423
220 Ga0105239_10312868 3300010375 Bacteria 1770
221 Ga0105239_11006973 3300010375 Bacteria 958
222 Ga0105239_11083825 3300010375 Bacteria 922
223 Ga0105246_10014037 3300011119 Bacteria 5032
224 Ga0157373_10333937 3300013100 Bacteria 1079
225 Ga0157371_10022118 3300013102 Bacteria 4664
226 Ga0157371_10134407 3300013102 Bacteria 1761
227 Ga0157370_10387776 3300013104 Bacteria 1286
228 Ga0157369_10242476 3300013105 Bacteria 1882
229 Ga0157374_10308246 3300013296 Unclassified 1567
230 Ga0157378_10011895 3300013297 Bacteria 7622
231 Ga0157378_10059489 3300013297 Bacteria 3409
232 Ga0157372_10026975 3300013307 Bacteria 6254
233 Ga0157372_10591980 3300013307 Bacteria 1293
234 Ga0157372_11163556 3300013307 Bacteria 892
235 Ga0157375_10011247 3300013308 Bacteria 7898
236 Ga0163163_10001710 3300014325 Bacteria 18534
237 Ga0163163_10045479 3300014325 Bacteria 4308
238 Ga0157380_10004849 3300014326 Bacteria 9367
239 Ga0157377_10003757 3300014745 Bacteria 6888
240 Ga0157379_10031646 3300014968 Bacteria 4714
241 Ga0157379_10116794 3300014968 Bacteria 2400
242 Ga0157376_10002411 3300014969 Bacteria 12632
243 Ga0163161_10001476 3300017792 Bacteria 17368
244 Ga0197907_10034627 3300020069 Bacteria 2290
245 Ga0206356_10149498 3300020070 Bacteria 1033
246 Ga0206356_11516001 3300020070 Bacteria 847
247 Ga0206356_11782481 3300020070 Bacteria 2692
248 Ga0206356_11846112 3300020070 Bacteria 1551
249 Ga0206351_10124265 3300020077 Bacteria 738
250 Ga0206352_10069452 3300020078 Bacteria 1030
251 Ga0206350_11124917 3300020080 Bacteria 1129
252 Ga0206354_10235034 3300020081 Bacteria 947
253 Ga0206353_11809109 3300020082 Bacteria 1862
254 Ga0224712_10259867 3300022467 Bacteria 804
255 Ga0209233_1008959 3300025261 Bacteria 3063
256 Ga0207666_1000224 3300025271 Bacteria 8258
257 Ga0207673_1000001 3300025290 Bacteria 29268
258 Ga0207697_10002732 3300025315 Bacteria 9004
259 Ga0207697_10032683 3300025315 Bacteria 2129
260 Ga0207682_10000056 3300025893 Bacteria 48265
261 Ga0207692_10063961 3300025898 Bacteria 1914
262 Ga0207642_10001098 3300025899 Bacteria 8391
263 Ga0207642_10093155 3300025899 Bacteria 1493
264 Ga0207710_10169993 3300025900 Bacteria 1065
265 Ga0207688_10003180 3300025901 Bacteria 8955
266 Ga0207680_10016469 3300025903 Bacteria 3882
267 Ga0207647_10007813 3300025904 Bacteria 7699
268 Ga0207647_10037671 3300025904 Bacteria 3064
269 Ga0207685_10054018 3300025905 Bacteria 1563
270 Ga0207699_10185925 3300025906 Bacteria 1399
271 Ga0207699_10295613 3300025906 Unclassified 1129
272 Ga0207699_10373578 3300025906 Bacteria 1011
273 Ga0207645_10000249 3300025907 Bacteria 44921
274 Ga0207643_10000187 3300025908 Bacteria 42567
275 Ga0207705_10012753 3300025909 Bacteria 6064
276 Ga0207705_10021541 3300025909 Bacteria 4601
277 Ga0207684_10005931 3300025910 Bacteria 11183
278 Ga0207654_10002376 3300025911 Bacteria 9636
279 Ga0207707_10008213 3300025912 Bacteria 9059
280 Ga0207707_10028228 3300025912 Bacteria 4905
281 Ga0207707_10082519 3300025912 Bacteria 2806
282 Ga0207707_10109695 3300025912 Bacteria 2412
283 Ga0207707_10234401 3300025912 Bacteria 1597
284 Ga0207707_10299765 3300025912 Bacteria 1390
285 Ga0207707_10326177 3300025912 Bacteria 1325
286 Ga0207671_10026338 3300025914 Bacteria 4360
287 Ga0207671_10136790 3300025914 Bacteria 1884
288 Ga0207693_10004402 3300025915 Bacteria 11913
289 Ga0207693_10055395 3300025915 Bacteria 3111
290 Ga0207663_10007138 3300025916 Bacteria 5774
291 Ga0207663_10169015 3300025916 Bacteria 1551
292 Ga0207663_10379412 3300025916 Bacteria 1077
293 Ga0207660_10101618 3300025917 Bacteria 2148
294 Ga0207660_10125208 3300025917 Bacteria 1951
295 Ga0207660_10231954 3300025917 Bacteria 1451
296 Ga0207660_10592181 3300025917 Bacteria 903
297 Ga0207662_10003317 3300025918 Bacteria 8258
298 Ga0207662_10044847 3300025918 Bacteria 2612
299 Ga0207662_10257435 3300025918 Unclassified 1147
300 Ga0207657_10007814 3300025919 Bacteria 10915
301 Ga0207657_10012795 3300025919 Bacteria 8258
302 Ga0207657_10028541 3300025919 Bacteria 5089
303 Ga0207657_10060252 3300025919 Bacteria 3257
304 Ga0207649_10000852 3300025920 Bacteria 19557
305 Ga0207649_10492361 3300025920 Unclassified 931
306 Ga0207649_10640367 3300025920 Bacteria 821
307 Ga0207652_10009431 3300025921 Bacteria 7850
308 Ga0207652_10023346 3300025921 Bacteria 5123
309 Ga0207652_10181717 3300025921 Bacteria 1890
310 Ga0207652_10267242 3300025921 Bacteria 1543
311 Ga0207646_10108441 3300025922 Bacteria 2491
312 Ga0207681_10006377 3300025923 Bacteria 7241
313 Ga0207694_10175657 3300025924 Bacteria 1735
314 Ga0207659_10003644 3300025926 Bacteria 9276
315 Ga0207659_10305525 3300025926 Bacteria 1308
316 Ga0207687_10065991 3300025927 Bacteria 2571
317 Ga0207700_10132649 3300025928 Bacteria 2036
318 Ga0207664_10045030 3300025929 Bacteria 3458
319 Ga0207664_10271289 3300025929 Bacteria 1486
320 Ga0207644_10020542 3300025931 Bacteria 4491
321 Ga0207690_10023701 3300025932 Bacteria 3834
322 Ga0207690_10036618 3300025932 Bacteria 3178
323 Ga0207706_10001175 3300025933 Bacteria 26500
324 Ga0207706_10006829 3300025933 Bacteria 10549
325 Ga0207706_10053280 3300025933 Bacteria 3572
326 Ga0207686_10000898 3300025934 Bacteria 17933
327 Ga0207709_10006803 3300025935 Bacteria 6396
328 Ga0207709_10053131 3300025935 Bacteria 2492
329 Ga0207709_10357963 3300025935 Unclassified 1104
330 Ga0207670_10002663 3300025936 Bacteria 9392
331 Ga0207670_10492173 3300025936 Unclassified 994
332 Ga0207669_10000534 3300025937 Bacteria 16573
333 Ga0207704_10026200 3300025938 Bacteria 3195
334 Ga0207665_10307599 3300025939 Bacteria 1186
335 Ga0207691_10001992 3300025940 Bacteria 19980
336 Ga0207691_10235001 3300025940 Bacteria 1586
337 Ga0207711_10217910 3300025941 Bacteria 1745
338 Ga0207711_10475323 3300025941 Unclassified 1164
339 Ga0207689_10000424 3300025942 Bacteria 39635
340 Ga0207661_10002538 3300025944 Bacteria 12565
341 Ga0207661_10196111 3300025944 Bacteria 1773
342 Ga0207679_10000187 3300025945 Bacteria 49895
343 Ga0207679_10182235 3300025945 Bacteria 1738
344 Ga0207667_10182647 3300025949 Bacteria 2153
345 Ga0207667_10224059 3300025949 Bacteria 1926
346 Ga0207667_10521007 3300025949 Bacteria 1204
347 Ga0207651_10073255 3300025960 Bacteria 2435
348 Ga0207712_10001563 3300025961 Bacteria 15410
349 Ga0207712_10092033 3300025961 Bacteria 2235
350 Ga0207668_10000807 3300025972 Bacteria 19183
351 Ga0207668_10519897 3300025972 Unclassified 1027
352 Ga0207640_10026149 3300025981 Bacteria 3540
353 Ga0207640_10319023 3300025981 Bacteria 1236
354 Ga0207658_10016316 3300025986 Bacteria 5108
355 Ga0207658_10024327 3300025986 Bacteria 4237
356 Ga0207658_10099770 3300025986 Bacteria 2272
357 Ga0207658_10335314 3300025986 Bacteria 1313
358 Ga0207677_10008612 3300026023 Bacteria 5710
359 Ga0207703_10004096 3300026035 Bacteria 12028
360 Ga0207703_10301557 3300026035 Unclassified 1461
361 Ga0207678_10010172 3300026067 Bacteria 8258
362 Ga0207678_10087689 3300026067 Bacteria 2659
363 Ga0207678_10159384 3300026067 Bacteria 1927
364 Ga0207708_10007098 3300026075 Bacteria 8275
365 Ga0207708_10009482 3300026075 Bacteria 7211
366 Ga0207702_10195449 3300026078 Bacteria 1872
367 Ga0207702_10246459 3300026078 Bacteria 1676
368 Ga0207641_10001747 3300026088 Bacteria 20964
369 Ga0207648_10001031 3300026089 Bacteria 31313
370 Ga0207648_10009238 3300026089 Bacteria 9470
371 Ga0207648_10065841 3300026089 Bacteria 3159
372 Ga0207674_10015762 3300026116 Bacteria 8291
373 Ga0207674_10347251 3300026116 Bacteria 1434
374 Ga0207675_100010495 3300026118 Bacteria 8678
375 Ga0207675_100388450 3300026118 Bacteria 1373
376 Ga0207683_10000727 3300026121 Bacteria 29910
377 Ga0207683_10486395 3300026121 Unclassified 1139
378 Ga0207698_10001591 3300026142 Bacteria 13231
379 Ga0207698_10040765 3300026142 Bacteria 3454
380 Ga0207698_10217996 3300026142 Bacteria 1722
381 Ga0209968_1002657 3300027526 Bacteria 2691
382 Ga0209999_1006567 3300027543 Bacteria 2090
383 Ga0210002_1000950 3300027617 Bacteria 3996
384 Ga0209971_1020944 3300027682 Bacteria 1555
385 Ga0209998_10006128 3300027717 Bacteria 2501
386 Ga0209998_10007092 3300027717 Bacteria 2323
387 Ga0209813_10076578 3300027866 Bacteria 1098
388 Ga0209974_10038087 3300027876 Bacteria 1598
389 Ga0209974_10095556 3300027876 Bacteria 1034
390 Ga0207428_10000150 3300027907 Bacteria 94699
391 Ga0207428_10000360 3300027907 Bacteria 58478
392 Ga0207428_10001312 3300027907 Bacteria 26468
393 Ga0268265_10003058 3300028380 Bacteria 12198
394 Ga0268264_10002038 3300028381 Bacteria 18063
395 Ga0268264_10032654 3300028381 Bacteria 4272
396 Ga0265337_1001436 3300028556 Bacteria 11727
397 Ga0265338_10078817 3300028800 Bacteria 2776
398 Ga0265325_10000030 3300031241 Bacteria 103532
399 Ga0265325_10003470 3300031241 Bacteria 10281
400 Ga0265325_10014638 3300031241 Bacteria 4427
401 Ga0265325_10112669 3300031241 Bacteria 1320
402 Ga0265340_10050951 3300031247 Bacteria 2006
403 Ga0265340_10088816 3300031247 Bacteria 1447
404 Ga0265339_10065631 3300031249 Bacteria 1945
405 Ga0265339_10124148 3300031249 Bacteria 1325
406 Ga0265339_10270033 3300031249 Bacteria 818
407 Ga0265331_10013598 3300031250 Bacteria 4370
408 Ga0265316_10059331 3300031344 Bacteria 2976
409 Ga0265316_10291964 3300031344 Bacteria 1189
410 Ga0265313_10019962 3300031595 Bacteria 3712
411 Ga0265313_10061106 3300031595 Bacteria 1765
412 Ga0265313_10155657 3300031595 Bacteria 973
413 Ga0307508_10392924 3300031616 Bacteria 978
414 Ga0265314_10008756 3300031711 Bacteria 8650
415 Ga0265314_10124343 3300031711 Bacteria 1618
416 Ga0265314_10160132 3300031711 Bacteria 1371
417 Ga0265342_10007190 3300031712 Bacteria 8190
418 Ga0265342_10025981 3300031712 Bacteria 3674
419 Ga0316583_10000116 3300032133 Bacteria 18613
420 Ga0373950_0007317 3300034818 Bacteria 1710
421 Ga0373926_0060367 3300035083 Bacteria 1381
422 Ga0373934_0040238 3300035086 Bacteria 1843
423 Ga0373934_0046589 3300035086 Bacteria 1715
424 Ga0373934_0089871 3300035086 Unclassified 1237
425 Ga0373944_0006033 3300035089 Bacteria 3208
426 Ga0373944_0042431 3300035089 Bacteria 1410
427 Ga0373949_0025691 3300035090 Bacteria 1376
428 Ga0373951_0009307 3300035091 Bacteria 2213
429 Ga0373923_0000187 3300035111 Bacteria 12538
430 Ga0373923_0016081 3300035111 Bacteria 2835
431 Ga0373923_0055263 3300035111 Bacteria 1673
432 Ga0373939_0002170 3300035114 Bacteria 4659
433 Ga0373945_0000395 3300035116 Bacteria 12509
434 Ga0373945_0003211 3300035116 Bacteria 5126
435 Ga0373953_0019396 3300035117 Bacteria 2529
436 Ga0373953_0034980 3300035117 Unclassified 1972
437 Ga0373953_0046283 3300035117 Bacteria 1746
438 Ga0373954_0017828 3300035118 Bacteria 3192
439 Ga0373954_0034984 3300035118 Bacteria 2328
440 Ga0373954_0066955 3300035118 Bacteria 1701
441 Ga0373954_0115911 3300035118 Bacteria 1298
442 Ga0373956_0005701 3300035119 Bacteria 4979
443 Ga0373956_0254698 3300035119 Bacteria 835
444 Ga0373957_0135237 3300035120 Unclassified 1005
445 Ga0373960_0000484 3300035121 Bacteria 7885
446 Ga0373943_0034727 3300035170 Bacteria 2406
447 Ga0373943_0071276 3300035170 Bacteria 1760
448 Ga0373946_0004740 3300035171 Bacteria 4887
449 Ga0373955_0002533 3300035172 Bacteria 7993
450 Ga0373955_0005096 3300035172 Bacteria 5871
451 Ga0373955_0007708 3300035172 Bacteria 4958
452 Ga0373955_0023343 3300035172 Bacteria 3149
453 Ga0373955_0109181 3300035172 Bacteria 1598
454 Ga0373924_0005631 3300035410 Bacteria 4441
455 Ga0373924_0015589 3300035410 Bacteria 2891
456 Ga0373924_0016367 3300035410 Bacteria 2829
457 Ga0373931_0156013 3300035691 Unclassified 1334
458 Ga0373935_0054490 3300035692 Unclassified 2546
459 Ga0373935_0167895 3300035692 Bacteria 1499
460 Ga0373927_0379891 3300035695 Unclassified 931
461 Ga0373933_0001526 3300035724 Bacteria 13510
462 Ga0373933_0008071 3300035724 Bacteria 5746
463 Ga0373933_0009795 3300035724 Bacteria 5244
464 Ga0373933_0013460 3300035724 Bacteria 4535
465 Ga0373933_0043828 3300035724 Bacteria 2648
466 Ga0373947_0021752 3300035725 Bacteria 3714
467 Ga0373947_0030734 3300035725 Bacteria 3157
468 Ga0373947_0113525 3300035725 Bacteria 1714
469 Ga0373937_0002031 3300036401 Bacteria 16910
470 Ga0373937_0002067 3300036401 Bacteria 16792
471 Ga0373937_0004072 3300036401 Bacteria 12397
472 Ga0373937_0008320 3300036401 Bacteria 9010
473 Ga0373937_0087024 3300036401 Bacteria 2891
474 Ga0373925_0001686 3300037068 Bacteria 18583
475 Ga0373925_0031318 3300037068 Bacteria 3908
476 Ga0395899_0019740 3300037312 Bacteria 5117
477 Ga0395900_0052617 3300037418 Bacteria 4191
478 Ga0395898_0004229 3300037466 Bacteria 15742
479 Ga0395901_0080318 3300038443 Bacteria 3405
480 Ga0436361_0130184 3300039447 Bacteria 6038
481 Ga0439450_016497 3300042008 Bacteria 1528
482 Ga0466963_0070500 3300044694 Bacteria 2351
483 Ga0466957_0063752 3300044842 Bacteria 2266
484 Ga0466958_0082359 3300045836 Bacteria 1982
485 Ga0466958_0219030 3300045836 Unclassified 1214
486 Ga0466967_0029718 3300045976 Bacteria 4578
487 Ga0466967_0857896 3300045976 Unclassified 902
488 Ga0495592_0004354 3300046454 Bacteria 10357
489 Ga0495592_0027953 3300046454 Bacteria 4272
490 Ga0495592_0031428 3300046454 Bacteria 4012
491 Ga0495603_0001272 3300046455 Bacteria 14676
492 Ga0495629_0183377 3300046459 Bacteria 1450
493 Ga0495641_0009857 3300046461 Bacteria 5623
494 Ga0495641_0157066 3300046461 Bacteria 1017
495 Ga0495651_0017193 3300046462 Bacteria 5604
496 Ga0495651_0017806 3300046462 Bacteria 5501
497 Ga0495651_0019768 3300046462 Bacteria 5221
498 Ga0495651_0128542 3300046462 Bacteria 1852
499 Ga0495651_0407738 3300046462 Bacteria 886
500 Ga0495653_0023158 3300046463 Bacteria 5023
501 Ga0495653_0106288 3300046463 Bacteria 2025
502 Ga0495653_0124757 3300046463 Bacteria 1830
503 Ga0495653_0445627 3300046463 Bacteria 815
504 Ga0495582_0024852 3300046473 Bacteria 3280
505 Ga0495605_0129230 3300046474 Unclassified 1140
506 Ga0495639_0026384 3300046475 Bacteria 2567
507 Ga0495662_0002967 3300046476 Bacteria 8560
508 Ga0495662_0039088 3300046476 Bacteria 2292
509 Ga0495664_0015764 3300046477 Bacteria 4301
510 Ga0495664_0027553 3300046477 Bacteria 3313
511 Ga0495664_0040651 3300046477 Bacteria 2750
512 Ga0495584_0052151 3300046491 Unclassified 2059
513 Ga0495585_0003052 3300046492 Bacteria 11521
514 Ga0495607_0003738 3300046501 Bacteria 11518
515 Ga0495608_0020801 3300046511 Bacteria 4508
516 Ga0495618_0013696 3300046514 Bacteria 4934
517 Ga0495618_0052342 3300046514 Bacteria 2580
518 Ga0495618_0408031 3300046514 Bacteria 830
519 Ga0495628_0004484 3300046516 Bacteria 12371
520 Ga0495630_0166620 3300046517 Unclassified 1677
521 Ga0495630_0175702 3300046517 Bacteria 1632
522 Ga0495637_0015585 3300046520 Bacteria 3566
523 Ga0495644_0000312 3300046523 Bacteria 22452
524 Ga0495666_0003560 3300046526 Bacteria 7872
525 Ga0495652_0023265 3300046529 Bacteria 5493
526 Ga0495652_0051909 3300046529 Bacteria 3499
527 Ga0495652_0134790 3300046529 Bacteria 1950
528 Ga0495652_0158435 3300046529 Bacteria 1760
529 Ga0495652_0194778 3300046529 Unclassified 1543
530 Ga0495665_0007736 3300046531 Bacteria 5814
531 Ga0495665_0177461 3300046531 Bacteria 1108
532 Ga0495640_0022952 3300046533 Bacteria 4556
533 Ga0495640_0032635 3300046533 Bacteria 3708
534 Ga0495640_0040917 3300046533 Bacteria 3242
535 Ga0495640_0166599 3300046533 Bacteria 1409
536 Ga0495586_0226771 3300046535 Bacteria 1062
537 Ga0495587_0182006 3300046536 Bacteria 1191
538 Ga0495645_0001254 3300046543 Bacteria 17310
539 Ga0495645_0023097 3300046543 Bacteria 4503
540 Ga0495645_0262966 3300046543 Bacteria 1141
541 Ga0495622_0003315 3300046557 Bacteria 7609
542 Ga0495633_0001295 3300046558 Bacteria 19775
543 Ga0495667_0013991 3300046559 Bacteria 5418
544 Ga0495667_0056627 3300046559 Bacteria 2577
545 Ga0495667_0396024 3300046559 Bacteria 870
546 Ga0495656_0000338 3300046615 Bacteria 16110
547 Ga0495634_0041890 3300046642 Bacteria 3109
548 Ga0495634_0354786 3300046642 Unclassified 877
549 Ga0495611_0003977 3300046648 Bacteria 6430
550 Ga0495635_0017003 3300046663 Bacteria 5079
551 Ga0495635_0018319 3300046663 Bacteria 4886
552 Ga0495635_0049373 3300046663 Bacteria 2900
553 Ga0495635_0066075 3300046663 Bacteria 2481
554 Ga0495659_0000500 3300046664 Bacteria 14469
555 Ga0495661_0012316 3300046665 Bacteria 5775
556 Ga0495588_0007831 3300046674 Bacteria 4878
557 Ga0495657_0025807 3300046675 Bacteria 4169
558 Ga0495657_0060535 3300046675 Bacteria 2508
559 Ga0495599_0003098 3300046678 Bacteria 9682
560 Ga0495599_0082617 3300046678 Unclassified 2006
561 Ga0495599_0193896 3300046678 Bacteria 1249
562 Ga0495623_0001432 3300046679 Bacteria 16175
563 Ga0495623_0002450 3300046679 Bacteria 12303
564 Ga0495646_0002685 3300046680 Bacteria 11010
565 Ga0495646_0254689 3300046680 Bacteria 939
566 Ga0495647_0010841 3300046681 Bacteria 3112
567 Ga0495647_0070479 3300046681 Bacteria 1398
568 Ga0495658_0036768 3300046683 Bacteria 2703
569 Ga0495658_0354600 3300046683 Unclassified 932
570 Ga0495613_0043715 3300046689 Unclassified 3314
571 Ga0495613_0274231 3300046689 Bacteria 1172
572 Ga0495613_0380244 3300046689 Bacteria 966
573 Ga0495624_0165859 3300046690 Bacteria 1348
574 Ga0495670_0000232 3300046691 Bacteria 25466
575 Ga0495671_0108037 3300046692 Bacteria 1359
576 Ga0495589_0021795 3300046794 Bacteria 3274
577 Ga0495600_0012643 3300046809 Bacteria 5284
578 Ga0495600_0033437 3300046809 Bacteria 3338
579 Ga0495600_0077665 3300046809 Bacteria 2168
580 Ga0495581_0004228 3300047315 Bacteria 8276
581 Ga0495581_0359211 3300047315 Bacteria 850
582 Ga0495604_0023070 3300047317 Bacteria 4966
583 Ga0495604_0026371 3300047317 Bacteria 4626
584 Ga0495604_0028582 3300047317 Bacteria 4436
585 Ga0495604_0054077 3300047317 Bacteria 3100
586 Ga0495674_0021621 3300047319 Bacteria 5947
587 Ga0495674_0053744 3300047319 Bacteria 3539
588 Ga0495674_0071493 3300047319 Bacteria 2994
589 Ga0495680_0005660 3300047322 Bacteria 11705
590 Ga0495680_0013213 3300047322 Bacteria 7213
591 Ga0495680_0013375 3300047322 Bacteria 7163
592 Ga0495680_0096671 3300047322 Bacteria 2205
593 Ga0495680_0153143 3300047322 Bacteria 1679
594 Ga0495680_0465328 3300047322 Bacteria 863
595 Ga0495675_0001159 3300047444 Bacteria 15992
596 Ga0495675_0074768 3300047444 Bacteria 2135
597 Ga0495677_0020408 3300047445 Unclassified 2402
598 Ga0495679_011022 3300047446 Bacteria 3515
599 Ga0495684_0009284 3300047471 Bacteria 7592
600 Ga0495684_0139189 3300047471 Bacteria 1820
601 Ga0495593_0002529 3300047673 Bacteria 10984
602 Ga0495602_0001877 3300048088 Bacteria 21025
603 Ga0495602_0016985 3300048088 Bacteria 7301
604 Ga0495602_0093353 3300048088 Bacteria 2490
605 Ga0495602_0365239 3300048088 Unclassified 1038
606 Ga0495614_0026235 3300048089 Bacteria 2511
607 Ga0495614_0260052 3300048089 Bacteria 796
608 Ga0496100_0006271 3300048903 Bacteria 6475
609 Ga0496100_0030488 3300048903 Bacteria 3346
610 Ga0496100_0123679 3300048903 Bacteria 1813
611 Ga0496101_0000833 3300048904 Bacteria 18156
612 Ga0496101_0021356 3300048904 Bacteria 4448
613 Ga0496101_0143775 3300048904 Bacteria 1820
614 Ga0496102_0011433 3300048905 Bacteria 7653
615 Ga0496102_0045178 3300048905 Bacteria 3998
616 Ga0496103_0000963 3300048906 Bacteria 20444
617 Ga0496103_0043097 3300048906 Bacteria 2778
618 Ga0496103_0043842 3300048906 Bacteria 2755
619 Ga0496103_0419923 3300048906 Bacteria 858
620 Ga0496104_0000065 3300048907 Bacteria 108770
621 Ga0496104_0005391 3300048907 Bacteria 11192
622 Ga0496104_0038325 3300048907 Bacteria 4484
623 Ga0496104_0040089 3300048907 Bacteria 4388
624 Ga0496104_0120340 3300048907 Bacteria 2520
625 Ga0496105_0010839 3300048908 Bacteria 7176
626 Ga0496105_0023647 3300048908 Bacteria 4986
627 Ga0496105_0167840 3300048908 Bacteria 1800
628 Ga0496106_0002101 3300048909 Bacteria 14928
629 Ga0496106_0033955 3300048909 Bacteria 3808
630 Ga0496106_0044691 3300048909 Bacteria 3325
631 Ga0496106_0274819 3300048909 Bacteria 1349
632 Ga0496107_0011980 3300048910 Bacteria 6051
633 Ga0496107_0067509 3300048910 Bacteria 2595
634 Ga0496108_0016701 3300048911 Bacteria 5996
635 Ga0496108_0027237 3300048911 Bacteria 4717
636 Ga0496108_0028578 3300048911 Bacteria 4614
637 Ga0496108_0043867 3300048911 Bacteria 3735
638 Ga0496109_0001690 3300048912 Bacteria 18382
639 Ga0496109_0005126 3300048912 Bacteria 10937
640 Ga0496109_0015815 3300048912 Bacteria 6587
641 Ga0496109_0093978 3300048912 Bacteria 2775
642 Ga0496110_0023713 3300048913 Bacteria 5220
643 Ga0496110_0031756 3300048913 Bacteria 4558
644 Ga0496110_0285028 3300048913 Bacteria 1504
645 Ga0496110_0593173 3300048913 Bacteria 1005
646 Ga0496111_0025624 3300048914 Bacteria 4161
647 Ga0496111_0079212 3300048914 Bacteria 2396
648 Ga0496111_0094465 3300048914 Bacteria 2193
649 Ga0496112_0023903 3300048915 Bacteria 5846
650 Ga0496112_0102795 3300048915 Bacteria 2827
651 Ga0496112_0161739 3300048915 Bacteria 2205
652 Ga0496112_1010316 3300048915 Bacteria 751
653 Ga0496113_0000329 3300048916 Bacteria 22567
654 Ga0496113_0035504 3300048916 Bacteria 3646
655 Ga0496113_0083893 3300048916 Bacteria 2445
656 Ga0496114_0009201 3300048917 Bacteria 7835
657 Ga0496115_0044892 3300048918 Bacteria 3526
658 Ga0496115_0050554 3300048918 Bacteria 3330
659 Ga0496115_0073180 3300048918 Bacteria 2781
660 Ga0496115_0184978 3300048918 Bacteria 1721
661 Ga0496115_0297969 3300048918 Bacteria 1322
662 Ga0501031_0006312 3300049568 Bacteria 7730
663 Ga0501031_0060301 3300049568 Bacteria 2472
664 Ga0501032_0015540 3300049569 Bacteria 5368
665 Ga0501032_0017462 3300049569 Bacteria 5040
666 Ga0501033_0030659 3300049570 Bacteria 4040
667 Ga0501033_0107183 3300049570 Bacteria 2035
668 Ga0501033_0113285 3300049570 Bacteria 1972
669 Ga0501034_0001584 3300049571 Bacteria 29619
670 Ga0501034_0031753 3300049571 Bacteria 5364
671 Ga0501034_0071243 3300049571 Bacteria 3486
672 Ga0501034_0244523 3300049571 Bacteria 1739
673 Ga0501034_0340083 3300049571 Bacteria 1431
674 Ga0501034_0410636 3300049571 Unclassified 1276
675 Ga0501034_0673519 3300049571 Bacteria 935
676 Ga0501036_0001347 3300049572 Bacteria 18840
677 Ga0501036_0009565 3300049572 Bacteria 7973
678 Ga0501036_0018017 3300049572 Bacteria 5912
679 Ga0501036_0044766 3300049572 Bacteria 3750
680 Ga0501036_0112893 3300049572 Bacteria 2296
681 Ga0501037_0001187 3300049573 Bacteria 19240
682 Ga0501037_0069506 3300049573 Bacteria 2563
683 Ga0501037_0083619 3300049573 Bacteria 2312
684 Ga0501037_0097960 3300049573 Bacteria 2119
685 Ga0501037_0203275 3300049573 Bacteria 1399
686 Ga0501038_0019987 3300049574 Bacteria 6028
687 Ga0501038_0020401 3300049574 Bacteria 5958
688 Ga0501038_0065777 3300049574 Bacteria 3088
689 Ga0501038_0507482 3300049574 Bacteria 921
690 Ga0501039_0018702 3300049575 Bacteria 5318
691 Ga0501039_0074330 3300049575 Bacteria 2641
692 Ga0501039_0123670 3300049575 Bacteria 2028
693 Ga0501039_0518880 3300049575 Bacteria 935
694 Ga0501040_0062313 3300049576 Bacteria 2566
695 Ga0501040_0063757 3300049576 Bacteria 2536
696 Ga0501042_0180269 3300049578 Bacteria 1524
697 Ga0501043_0001872 3300049579 Bacteria 18031
698 Ga0501043_0010758 3300049579 Bacteria 7165
699 Ga0501043_0070280 3300049579 Bacteria 2750
700 Ga0501046_0038531 3300049580 Bacteria 3835
701 Ga0501046_0053120 3300049580 Bacteria 3192
702 Ga0501047_0006650 3300049581 Bacteria 10866
703 Ga0501047_0011585 3300049581 Bacteria 8344
704 Ga0501047_0016035 3300049581 Bacteria 7144
705 Ga0501047_0023087 3300049581 Bacteria 5971
706 Ga0501047_0056959 3300049581 Bacteria 3780
707 Ga0501047_0119174 3300049581 Bacteria 2521
708 Ga0501047_0135638 3300049581 Bacteria 2341
709 Ga0501047_0177364 3300049581 Bacteria 1998
710 Ga0501047_0282384 3300049581 Bacteria 1504
711 Ga0501048_0000039 3300049582 Bacteria 63521
712 Ga0501048_0012298 3300049582 Bacteria 6370
713 Ga0501048_0023363 3300049582 Bacteria 4519
714 Ga0501067_0006525 3300049583 Bacteria 6467
715 Ga0501067_0225015 3300049583 Bacteria 1045
716 Ga0501068_0007550 3300049584 Bacteria 6017
717 Ga0501068_0012538 3300049584 Bacteria 4810
718 Ga0501068_0060494 3300049584 Bacteria 2300
719 Ga0501068_0126059 3300049584 Bacteria 1599
720 Ga0501068_0152702 3300049584 Bacteria 1452
721 Ga0501069_0020092 3300049585 Bacteria 3615
722 Ga0501069_0021374 3300049585 Bacteria 3510
723 Ga0501069_0090850 3300049585 Bacteria 1727
724 Ga0501069_0254017 3300049585 Bacteria 1026
725 Ga0501070_0006927 3300049586 Bacteria 9649
726 Ga0501070_0008380 3300049586 Bacteria 8733
727 Ga0501070_0009049 3300049586 Bacteria 8424
728 Ga0501070_0010886 3300049586 Bacteria 7683
729 Ga0501070_0033855 3300049586 Bacteria 4275
730 Ga0501070_0077826 3300049586 Bacteria 2744
731 Ga0501070_0206242 3300049586 Bacteria 1614
732 Ga0501070_0335663 3300049586 Bacteria 1228
733 Ga0501070_0400366 3300049586 Bacteria 1110
734 Ga0501071_0014377 3300049587 Bacteria 5412
735 Ga0501071_0020484 3300049587 Bacteria 4597
736 Ga0501071_0267814 3300049587 Bacteria 1291
737 Ga0501072_0019231 3300049588 Bacteria 5277
738 Ga0501072_0117623 3300049588 Bacteria 2117
739 Ga0501072_0135982 3300049588 Bacteria 1959
740 Ga0501072_0206496 3300049588 Bacteria 1566
741 Ga0501073_0015959 3300049589 Bacteria 5443
742 Ga0501073_0027790 3300049589 Bacteria 4043
743 Ga0501073_0309152 3300049589 Bacteria 1090
744 Ga0501074_0006728 3300049590 Bacteria 8292
745 Ga0501074_0021551 3300049590 Bacteria 4679
746 Ga0501074_0031302 3300049590 Bacteria 3854
747 Ga0501074_0099312 3300049590 Bacteria 2084
748 Ga0501074_0497655 3300049590 Bacteria 863
749 Ga0501075_0109585 3300049591 Bacteria 2099
750 Ga0501075_0132237 3300049591 Bacteria 1901
751 Ga0501076_0125461 3300049592 Bacteria 2080
752 Ga0501076_0184391 3300049592 Bacteria 1702
753 Ga0501077_0011615 3300049593 Bacteria 5504
754 Ga0501077_0080756 3300049593 Bacteria 2060
755 Ga0501079_0013096 3300049741 Bacteria 6324
756 Ga0501079_0408742 3300049741 Bacteria 1065
757 Ga0501079_0607745 3300049741 Unclassified 860
758 Ga0501080_0000022 3300049742 Bacteria 90630
759 Ga0501080_0026488 3300049742 Bacteria 5387
760 Ga0501080_0053406 3300049742 Bacteria 3762
761 Ga0501080_0146136 3300049742 Bacteria 2185
762 Ga0501080_0263059 3300049742 Bacteria 1571
763 Ga0501080_0266102 3300049742 Bacteria 1561
764 Ga0501080_0312795 3300049742 Bacteria 1423
765 Ga0501080_0399828 3300049742 Bacteria 1236
766 Ga0501080_0411889 3300049742 Bacteria 1215
767 Ga0501080_0451264 3300049742 Bacteria 1153
768 Ga0501081_0208998 3300049743 Bacteria 1417
769 Ga0501083_0001941 3300049744 Bacteria 14225
770 Ga0501083_0024820 3300049744 Bacteria 4152
771 Ga0501083_0026149 3300049744 Bacteria 4037
772 Ga0501083_0058001 3300049744 Bacteria 2591
773 Ga0501083_0128696 3300049744 Bacteria 1660
774 Ga0501035_0000655 3300049822 Bacteria 38162
775 Ga0501035_0008096 3300049822 Bacteria 9797
776 Ga0501035_0031789 3300049822 Bacteria 4807
777 Ga0501035_0155709 3300049822 Bacteria 1980
778 Ga0501035_0159289 3300049822 Bacteria 1955
779 Ga0501035_0216398 3300049822 Bacteria 1637
780 Ga0501044_0005112 3300049823 Bacteria 14631
781 Ga0501044_0023300 3300049823 Bacteria 6586
782 Ga0501044_0037388 3300049823 Bacteria 5074
783 Ga0501044_0106451 3300049823 Bacteria 2816
784 Ga0501044_0128195 3300049823 Bacteria 2533
785 Ga0501044_0298846 3300049823 Bacteria 1539
786 Ga0501044_0324039 3300049823 Bacteria 1464
787 Ga0501044_0354220 3300049823 Bacteria 1387
788 Ga0501045_0065925 3300049824 Bacteria 2659
789 Ga0501045_0126373 3300049824 Bacteria 1900
790 nmdc:mga03683_35426_c1 3300050489 Bacteria 2025
791 nmdc:mga00v17_146286_c1 3300050491 Bacteria 1517
792 nmdc:mga0k408_75369_c1 3300050493 Bacteria 1971
793 nmdc:mga06z11_445988_c1 3300050494 Bacteria 782
794 nmdc:mga0n895_54135_c1 3300050512 Bacteria 3945
795 nmdc:mga0n895_96925_c1 3300050512 Bacteria 2954
796 nmdc:mga0rr50_148960_c1 3300050513 Bacteria 1889
797 nmdc:mga0rr50_710982_c1 3300050513 Unclassified 857
798 nmdc:mga08x19_243843_c1 3300050514 Unclassified 1239
799 Ga0495601_0000225 3300053077 Bacteria 30328
800 Ga0495601_0001233 3300053077 Bacteria 14029
801 Ga0495601_0002814 3300053077 Bacteria 9872
802 Ga0495601_0007348 3300053077 Bacteria 6458
803 Ga0495612_0000405 3300053078 Bacteria 17265
804 Ga0495612_0005171 3300053078 Bacteria 5390
805 Ga0495612_0007159 3300053078 Bacteria 4564
806 Ga0495612_0027580 3300053078 Bacteria 2284
807 Ga0495595_0000616 3300053084 Bacteria 13570
808 Ga0495595_0003155 3300053084 Bacteria 6538
809 Ga0495595_0014630 3300053084 Bacteria 3332
810 Ga0495595_0016278 3300053084 Bacteria 3178
811 Ga0495595_0088257 3300053084 Bacteria 1485
812 Ga0495619_0000083 3300053085 Bacteria 70312
813 Ga0495619_0001284 3300053085 Bacteria 16486
814 Ga0495619_0012744 3300053085 Bacteria 5291
815 Ga0495619_0044225 3300053085 Bacteria 2923
816 Ga0495619_0045033 3300053085 Bacteria 2897
817 Ga0495619_0329939 3300053085 Bacteria 1056
818 Ga0500566_0060799 3300053094 Bacteria 2139
819 Ga0500566_0217555 3300053094 Bacteria 952
820 Ga0500641_0140510 3300053096 Bacteria 1043
821 Ga0500650_0163553 3300053098 Bacteria 1026
822 Ga0500562_030034 3300053108 Bacteria 1431
823 Ga0500595_000003 3300053119 Bacteria 419332
824 Ga0500618_024028 3300053125 Bacteria 1471
825 Ga0500658_0078082 3300053134 Bacteria 1411
826 Ga0500616_0000002 3300053153 Bacteria 1611257
827 Ga0501084_0013445 3300054114 Bacteria 6774
828 Ga0501084_0669724 3300054114 Bacteria 876
829 Ga0501082_0021232 3300060353 Bacteria 5602
830 Ga0501082_0083499 3300060353 Bacteria 2756
831 Ga0501082_0089643 3300060353 Bacteria 2655
832 Ga0501082_0105235 3300060353 Bacteria 2441
833 Ga0466962_0061657 3300061719 Bacteria 1790
834 Ga0530510_0107854 3300061734 Bacteria 2038
835 Ga0530510_0580173 3300061734 Unclassified 852

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0107854 Ga0530510_0107854_1322_1912 176
2 3300020080 Ga0206350_11124917 Ga0206350_111249171 188
3 3300005327 Ga0070658_10008781 Ga0070658_100087812 189
4 3300005336 Ga0070680_100080355 Ga0070680_1000803553 189
5 3300005563 Ga0068855_100050850 Ga0068855_1000508505 189
6 3300005578 Ga0068854_100086516 Ga0068854_1000865162 189
7 3300009093 Ga0105240_10045619 Ga0105240_100456195 189
8 3300013102 Ga0157371_10134407 Ga0157371_101344072 189
9 3300013105 Ga0157369_10242476 Ga0157369_102424762 189
10 3300020069 Ga0197907_10034627 Ga0197907_100346272 189
11 3300020070 Ga0206356_11782481 Ga0206356_117824812 189
12 3300020082 Ga0206353_11809109 Ga0206353_118091092 189
13 3300022467 Ga0224712_10259867 Ga0224712_102598671 189
14 3300025909 Ga0207705_10012753 Ga0207705_100127533 189
15 3300025912 Ga0207707_10109695 Ga0207707_101096951 189
16 3300025981 Ga0207640_10319023 Ga0207640_103190232 189
17 3300061719 Ga0466962_0061657 Ga0466962_0061657_673_1347 190
18 3300049575 Ga0501039_0074330 Ga0501039_0074330_654_1304 196
19 3300049576 Ga0501040_0062313 Ga0501040_0062313_1405_2055 196
20 3300049584 Ga0501068_0126059 Ga0501068_0126059_385_1035 196
21 3300049587 Ga0501071_0020484 Ga0501071_0020484_1923_2573 196
22 3300049588 Ga0501072_0117623 Ga0501072_0117623_1052_1702 196
23 3300049591 Ga0501075_0109585 Ga0501075_0109585_461_1111 196
24 3300049592 Ga0501076_0125461 Ga0501076_0125461_377_1027 196
25 3300049742 Ga0501080_0053406 Ga0501080_0053406_1522_2172 196
26 3300054114 Ga0501084_0013445 Ga0501084_0013445_2006_2656 196
27 3300046683 Ga0495658_0036768 Ga0495658_0036768_736_1434 197
28 3300005336 Ga0070680_100268648 Ga0070680_1002686482 200
29 3300038443 Ga0395901_0080318 Ga0395901_0080318_1595_2296 200
30 3300046531 Ga0495665_0177461 Ga0495665_0177461_443_1087 200
31 3300046681 Ga0495647_0070479 Ga0495647_0070479_32_676 200
32 3300006194 Ga0075427_10000344 Ga0075427_100003444 201
33 3300006844 Ga0075428_100005389 Ga0075428_10000538912 201
34 3300006846 Ga0075430_100000426 Ga0075430_10000042620 201
35 3300006847 Ga0075431_100005525 Ga0075431_10000552512 201
36 3300006852 Ga0075433_10000029 Ga0075433_1000002931 201
37 3300006871 Ga0075434_100000208 Ga0075434_10000020832 201
38 3300006880 Ga0075429_100000734 Ga0075429_10000073419 201
39 3300007076 Ga0075435_100001396 Ga0075435_10000139614 201
40 3300027907 Ga0207428_10000360 Ga0207428_1000036033 201
41 3300035111 Ga0373923_0055263 Ga0373923_0055263_343_1053 201
42 3300046642 Ga0495634_0041890 Ga0495634_0041890_81_791 201
43 3300046689 Ga0495613_0380244 Ga0495613_0380244_185_895 201
44 3300046692 Ga0495671_0108037 Ga0495671_0108037_218_922 201
45 3300047322 Ga0495680_0465328 Ga0495680_0465328_81_815 201
46 3300005336 Ga0070680_100044425 Ga0070680_1000444253 202
47 3300005340 Ga0070689_100287691 Ga0070689_1002876912 202
48 3300005347 Ga0070668_100281096 Ga0070668_1002810961 202
49 3300005353 Ga0070669_100527797 Ga0070669_1005277971 202
50 3300005366 Ga0070659_100286565 Ga0070659_1002865652 202
51 3300005444 Ga0070694_100136162 Ga0070694_1001361622 202
52 3300005455 Ga0070663_100175121 Ga0070663_1001751212 202
53 3300005458 Ga0070681_10028339 Ga0070681_100283391 202
54 3300005468 Ga0070707_100980370 Ga0070707_1009803701 202
55 3300005543 Ga0070672_100168917 Ga0070672_1001689172 202
56 3300005546 Ga0070696_100105465 Ga0070696_1001054652 202
57 3300005937 Ga0081455_10008929 Ga0081455_1000892910 202
58 3300006871 Ga0075434_100097978 Ga0075434_1000979783 202
59 3300009098 Ga0105245_10909693 Ga0105245_109096931 202
60 3300009101 Ga0105247_10510540 Ga0105247_105105401 202
61 3300009174 Ga0105241_10034680 Ga0105241_100346803 202
62 3300009176 Ga0105242_10259660 Ga0105242_102596602 202
63 3300025910 Ga0207684_10005931 Ga0207684_1000593112 202
64 3300025912 Ga0207707_10028228 Ga0207707_100282282 202
65 3300025917 Ga0207660_10125208 Ga0207660_101252082 202
66 3300025918 Ga0207662_10257435 Ga0207662_102574352 202
67 3300025919 Ga0207657_10060252 Ga0207657_100602522 202
68 3300025921 Ga0207652_10181717 Ga0207652_101817172 202
69 3300025922 Ga0207646_10108441 Ga0207646_101084412 202
70 3300025935 Ga0207709_10357963 Ga0207709_103579632 202
71 3300025936 Ga0207670_10492173 Ga0207670_104921731 202
72 3300025941 Ga0207711_10475323 Ga0207711_104753232 202
73 3300025972 Ga0207668_10519897 Ga0207668_105198972 202
74 3300026067 Ga0207678_10087689 Ga0207678_100876892 202
75 3300026089 Ga0207648_10065841 Ga0207648_100658413 202
76 3300026121 Ga0207683_10486395 Ga0207683_104863952 202
77 3300035090 Ga0373949_0025691 Ga0373949_0025691_452_1156 202
78 3300035691 Ga0373931_0156013 Ga0373931_0156013_426_1130 202
79 3300037068 Ga0373925_0031318 Ga0373925_0031318_123_833 202
80 3300047322 Ga0495680_0153143 Ga0495680_0153143_772_1476 202
81 3300048904 Ga0496101_0143775 Ga0496101_0143775_501_1205 202
82 3300048905 Ga0496102_0045178 Ga0496102_0045178_2843_3547 202
83 3300048906 Ga0496103_0043842 Ga0496103_0043842_454_1158 202
84 3300048909 Ga0496106_0044691 Ga0496106_0044691_591_1295 202
85 3300048918 Ga0496115_0050554 Ga0496115_0050554_2233_2937 202
86 3300048918 Ga0496115_0184978 Ga0496115_0184978_405_1109 202
87 3300050512 nmdc:mga0n895_96925_c1 nmdc:mga0n895_96925_c1_774_1478 202
88 3300005937 Ga0081455_10014732 Ga0081455_1001473211 203
89 3300006175 Ga0070712_100706908 Ga0070712_1007069081 203
90 3300035089 Ga0373944_0006033 Ga0373944_0006033_849_1553 203
91 3300035116 Ga0373945_0003211 Ga0373945_0003211_3663_4367 203
92 3300046463 Ga0495653_0445627 Ga0495653_0445627_61_765 203
93 3300046476 Ga0495662_0039088 Ga0495662_0039088_436_1140 203
94 3300046477 Ga0495664_0040651 Ga0495664_0040651_372_1076 203
95 3300046514 Ga0495618_0052342 Ga0495618_0052342_1171_1875 203
96 3300046517 Ga0495630_0175702 Ga0495630_0175702_539_1243 203
97 3300046529 Ga0495652_0158435 Ga0495652_0158435_852_1556 203
98 3300046543 Ga0495645_0262966 Ga0495645_0262966_236_940 203
99 3300046663 Ga0495635_0066075 Ga0495635_0066075_561_1265 203
100 3300047319 Ga0495674_0053744 Ga0495674_0053744_975_1679 203
101 3300047471 Ga0495684_0139189 Ga0495684_0139189_419_1123 203
102 3300053078 Ga0495612_0027580 Ga0495612_0027580_1032_1736 203
103 3300053085 Ga0495619_0044225 Ga0495619_0044225_1780_2484 203
104 3300053125 Ga0500618_024028 Ga0500618_024028_124_828 203
105 3300005435 Ga0070714_100049845 Ga0070714_1000498452 204
106 3300005563 Ga0068855_100092066 Ga0068855_1000920664 204
107 3300005616 Ga0068852_100333399 Ga0068852_1003333992 204
108 3300009093 Ga0105240_11075781 Ga0105240_110757812 204
109 3300009551 Ga0105238_10193544 Ga0105238_101935442 204
110 3300013307 Ga0157372_11163556 Ga0157372_111635561 204
111 3300020070 Ga0206356_11516001 Ga0206356_115160012 204
112 3300025924 Ga0207694_10175657 Ga0207694_101756572 204
113 3300025929 Ga0207664_10271289 Ga0207664_102712892 204
114 3300026142 Ga0207698_10040765 Ga0207698_100407652 204
115 3300026142 Ga0207698_10217996 Ga0207698_102179962 204
116 3300005336 Ga0070680_100024074 Ga0070680_1000240744 205
117 3300005339 Ga0070660_100158724 Ga0070660_1001587242 205
118 3300005435 Ga0070714_100167523 Ga0070714_1001675232 205
119 3300005439 Ga0070711_100190525 Ga0070711_1001905252 205
120 3300005445 Ga0070708_100487167 Ga0070708_1004871671 205
121 3300005458 Ga0070681_10054250 Ga0070681_100542505 205
122 3300005530 Ga0070679_100142953 Ga0070679_1001429532 205
123 3300005563 Ga0068855_100063448 Ga0068855_1000634482 205
124 3300013104 Ga0157370_10387776 Ga0157370_103877762 205
125 3300020070 Ga0206356_10149498 Ga0206356_101494982 205
126 3300025906 Ga0207699_10373578 Ga0207699_103735782 205
127 3300025909 Ga0207705_10021541 Ga0207705_100215413 205
128 3300025912 Ga0207707_10082519 Ga0207707_100825194 205
129 3300025912 Ga0207707_10299765 Ga0207707_102997651 205
130 3300025914 Ga0207671_10136790 Ga0207671_101367902 205
131 3300025916 Ga0207663_10379412 Ga0207663_103794122 205
132 3300025917 Ga0207660_10101618 Ga0207660_101016182 205
133 3300025919 Ga0207657_10007814 Ga0207657_100078148 205
134 3300025920 Ga0207649_10640367 Ga0207649_106403671 205
135 3300025921 Ga0207652_10023346 Ga0207652_100233462 205
136 3300025929 Ga0207664_10045030 Ga0207664_100450304 205
137 3300031241 Ga0265325_10014638 Ga0265325_100146382 205
138 3300031241 Ga0265325_10112669 Ga0265325_101126692 205
139 3300031249 Ga0265339_10065631 Ga0265339_100656312 205
140 3300031249 Ga0265339_10270033 Ga0265339_102700331 205
141 3300031595 Ga0265313_10019962 Ga0265313_100199624 205
142 3300031711 Ga0265314_10124343 Ga0265314_101243432 205
143 3300031712 Ga0265342_10007190 Ga0265342_100071908 205
144 3300031712 Ga0265342_10025981 Ga0265342_100259814 205
145 3300049571 Ga0501034_0673519 Ga0501034_0673519_38_712 205
146 3300049581 Ga0501047_0056959 Ga0501047_0056959_1552_2226 205
147 3300049742 Ga0501080_0266102 Ga0501080_0266102_809_1483 205
148 3300006871 Ga0075434_100059772 Ga0075434_1000597724 206
149 3300006871 Ga0075434_100244633 Ga0075434_1002446332 206
150 3300006914 Ga0075436_100302194 Ga0075436_1003021941 206
151 3300007076 Ga0075435_100081695 Ga0075435_1000816953 206
152 3300045836 Ga0466958_0082359 Ga0466958_0082359_634_1326 206
153 3300045976 Ga0466967_0029718 Ga0466967_0029718_1651_2343 206
154 3300050512 nmdc:mga0n895_54135_c1 nmdc:mga0n895_54135_c1_2092_2772 206
155 3300005337 Ga0070682_100456343 Ga0070682_1004563432 207
156 3300005439 Ga0070711_100063686 Ga0070711_1000636862 207
157 3300005458 Ga0070681_10200162 Ga0070681_102001622 207
158 3300005564 Ga0070664_100065346 Ga0070664_1000653462 207
159 3300005842 Ga0068858_100051708 Ga0068858_1000517083 207
160 3300006358 Ga0068871_100001884 Ga0068871_1000018846 207
161 3300009098 Ga0105245_10011288 Ga0105245_100112884 207
162 3300013297 Ga0157378_10059489 Ga0157378_100594893 207
163 3300026035 Ga0207703_10301557 Ga0207703_103015572 207
164 3300032133 Ga0316583_10000116 Ga0316583_100001164 207
165 3300035086 Ga0373934_0046589 Ga0373934_0046589_774_1484 207
166 3300035111 Ga0373923_0016081 Ga0373923_0016081_1616_2326 207
167 3300035172 Ga0373955_0007708 Ga0373955_0007708_2378_3088 207
168 3300035410 Ga0373924_0016367 Ga0373924_0016367_1360_2070 207
169 3300035692 Ga0373935_0167895 Ga0373935_0167895_553_1263 207
170 3300035724 Ga0373933_0008071 Ga0373933_0008071_2835_3545 207
171 3300036401 Ga0373937_0002067 Ga0373937_0002067_7319_8029 207
172 3300046454 Ga0495592_0027953 Ga0495592_0027953_2630_3340 207
173 3300046462 Ga0495651_0019768 Ga0495651_0019768_4126_4836 207
174 3300046529 Ga0495652_0051909 Ga0495652_0051909_2438_3148 207
175 3300046535 Ga0495586_0226771 Ga0495586_0226771_115_825 207
176 3300046559 Ga0495667_0056627 Ga0495667_0056627_1516_2226 207
177 3300046663 Ga0495635_0017003 Ga0495635_0017003_1358_2068 207
178 3300046679 Ga0495623_0002450 Ga0495623_0002450_9317_10027 207
179 3300046809 Ga0495600_0012643 Ga0495600_0012643_1880_2590 207
180 3300047319 Ga0495674_0071493 Ga0495674_0071493_561_1271 207
181 3300047322 Ga0495680_0013213 Ga0495680_0013213_1659_2369 207
182 3300047444 Ga0495675_0001159 Ga0495675_0001159_14166_14876 207
183 3300048088 Ga0495602_0001877 Ga0495602_0001877_8809_9519 207
184 3300048911 Ga0496108_0016701 Ga0496108_0016701_351_1061 207
185 3300048914 Ga0496111_0094465 Ga0496111_0094465_1125_1835 207
186 3300053077 Ga0495601_0002814 Ga0495601_0002814_6102_6812 207
187 3300053084 Ga0495595_0000616 Ga0495595_0000616_12492_13202 207
188 3300006177 Ga0075362_10044204 Ga0075362_100442041 208
189 3300037312 Ga0395899_0019740 Ga0395899_0019740_1780_2481 208
190 3300037418 Ga0395900_0052617 Ga0395900_0052617_2026_2727 208
191 3300037466 Ga0395898_0004229 Ga0395898_0004229_12655_13356 208
192 3300044694 Ga0466963_0070500 Ga0466963_0070500_1318_2010 208
193 3300044842 Ga0466957_0063752 Ga0466957_0063752_877_1569 208
194 3300045836 Ga0466958_0219030 Ga0466958_0219030_331_1023 208
195 3300045976 Ga0466967_0857896 Ga0466967_0857896_150_842 208
196 3300048089 Ga0495614_0260052 Ga0495614_0260052_15_728 208
197 3300050493 nmdc:mga0k408_75369_c1 nmdc:mga0k408_75369_c1_457_1158 208
198 3300006844 Ga0075428_100313407 Ga0075428_1003134072 209
199 3300035083 Ga0373926_0060367 Ga0373926_0060367_469_1167 209
200 3300035725 Ga0373947_0113525 Ga0373947_0113525_812_1510 209
201 3300046533 Ga0495640_0166599 Ga0495640_0166599_340_1038 209
202 3300046689 Ga0495613_0274231 Ga0495613_0274231_122_820 209
203 3300046690 Ga0495624_0165859 Ga0495624_0165859_56_754 209
204 3300048907 Ga0496104_0005391 Ga0496104_0005391_1612_2331 209
205 3300048913 Ga0496110_0593173 Ga0496110_0593173_159_875 209
206 3300053094 Ga0500566_0060799 Ga0500566_0060799_283_981 209
207 3300006871 Ga0075434_100058176 Ga0075434_1000581763 210
208 3300006914 Ga0075436_100284281 Ga0075436_1002842812 210
209 3300007076 Ga0075435_100253011 Ga0075435_1002530112 210
210 3300025261 Ga0209233_1008959 Ga0209233_10089592 210
211 3300025906 Ga0207699_10295613 Ga0207699_102956132 210
212 3300035119 Ga0373956_0254698 Ga0373956_0254698_80_790 210
213 3300046514 Ga0495618_0408031 Ga0495618_0408031_35_760 210
214 3300048915 Ga0496112_1010316 Ga0496112_1010316_20_727 210
215 3300049570 Ga0501033_0030659 Ga0501033_0030659_693_1418 210
216 3300049572 Ga0501036_0044766 Ga0501036_0044766_2387_3112 210
217 3300049573 Ga0501037_0097960 Ga0501037_0097960_893_1618 210
218 3300049574 Ga0501038_0020401 Ga0501038_0020401_4335_5060 210
219 3300049581 Ga0501047_0023087 Ga0501047_0023087_3835_4560 210
220 3300049586 Ga0501070_0010886 Ga0501070_0010886_880_1605 210
221 3300049588 Ga0501072_0206496 Ga0501072_0206496_283_993 210
222 3300049742 Ga0501080_0312795 Ga0501080_0312795_516_1241 210
223 3300049822 Ga0501035_0155709 Ga0501035_0155709_223_948 210
224 3300049823 Ga0501044_0037388 Ga0501044_0037388_3345_4070 210
225 3300050513 nmdc:mga0rr50_148960_c1 nmdc:mga0rr50_148960_c1_751_1485 210
226 3300050514 nmdc:mga08x19_243843_c1 nmdc:mga08x19_243843_c1_407_1141 210
227 3300006042 Ga0075368_10058580 Ga0075368_100585802 211
228 3300006048 Ga0075363_100090855 Ga0075363_1000908552 211
229 3300006353 Ga0075370_10254295 Ga0075370_102542951 211
230 3300010375 Ga0105239_11006973 Ga0105239_110069732 211
231 3300027866 Ga0209813_10076578 Ga0209813_100765782 211
232 3300031616 Ga0307508_10392924 Ga0307508_103929241 211
233 3300039447 Ga0436361_0130184 Ga0436361_0130184_5031_5858 211
234 3300048903 Ga0496100_0030488 Ga0496100_0030488_2232_2933 211
235 3300048904 Ga0496101_0000833 Ga0496101_0000833_12744_13445 211
236 3300048905 Ga0496102_0011433 Ga0496102_0011433_1205_1912 211
237 3300048906 Ga0496103_0043097 Ga0496103_0043097_31_732 211
238 3300048907 Ga0496104_0038325 Ga0496104_0038325_3001_3702 211
239 3300048907 Ga0496104_0120340 Ga0496104_0120340_1654_2355 211
240 3300048908 Ga0496105_0023647 Ga0496105_0023647_1563_2264 211
241 3300048909 Ga0496106_0002101 Ga0496106_0002101_9708_10409 211
242 3300048909 Ga0496106_0274819 Ga0496106_0274819_181_882 211
243 3300048910 Ga0496107_0011980 Ga0496107_0011980_3783_4484 211
244 3300048911 Ga0496108_0028578 Ga0496108_0028578_1923_2624 211
245 3300048911 Ga0496108_0043867 Ga0496108_0043867_1962_2663 211
246 3300048912 Ga0496109_0005126 Ga0496109_0005126_3328_4029 211
247 3300048912 Ga0496109_0015815 Ga0496109_0015815_2603_3304 211
248 3300048913 Ga0496110_0023713 Ga0496110_0023713_2708_3409 211
249 3300048913 Ga0496110_0031756 Ga0496110_0031756_1919_2620 211
250 3300048914 Ga0496111_0025624 Ga0496111_0025624_1640_2341 211
251 3300048914 Ga0496111_0079212 Ga0496111_0079212_737_1438 211
252 3300048915 Ga0496112_0023903 Ga0496112_0023903_3141_3842 211
253 3300048915 Ga0496112_0102795 Ga0496112_0102795_1840_2541 211
254 3300048916 Ga0496113_0035504 Ga0496113_0035504_713_1414 211
255 3300048916 Ga0496113_0083893 Ga0496113_0083893_1342_2043 211
256 3300048918 Ga0496115_0073180 Ga0496115_0073180_1416_2117 211
257 3300050489 nmdc:mga03683_35426_c1 nmdc:mga03683_35426_c1_1075_1776 211
258 3300050513 nmdc:mga0rr50_710982_c1 nmdc:mga0rr50_710982_c1_105_806 211
259 3300053108 Ga0500562_030034 Ga0500562_030034_318_1019 211
260 iso_pu_bacteria 2643221547 2643754955 211
261 3300005434 Ga0070709_10014181 Ga0070709_100141812 212
262 3300005435 Ga0070714_100337229 Ga0070714_1003372292 212
263 3300005437 Ga0070710_10019546 Ga0070710_100195464 212
264 3300025906 Ga0207699_10185925 Ga0207699_101859251 212
265 3300025915 Ga0207693_10055395 Ga0207693_100553951 212
266 3300028556 Ga0265337_1001436 Ga0265337_100143611 212
267 3300031711 Ga0265314_10160132 Ga0265314_101601322 212
268 3300035170 Ga0373943_0071276 Ga0373943_0071276_864_1556 213
269 3300049585 Ga0501069_0254017 Ga0501069_0254017_187_885 213
270 3300049588 Ga0501072_0019231 Ga0501072_0019231_2635_3336 213
271 3300031241 Ga0265325_10003470 Ga0265325_100034707 214
272 3300031595 Ga0265313_10155657 Ga0265313_101556572 214
273 3300035086 Ga0373934_0040238 Ga0373934_0040238_491_1189 214
274 3300035117 Ga0373953_0046283 Ga0373953_0046283_593_1291 214
275 3300035118 Ga0373954_0034984 Ga0373954_0034984_554_1252 214
276 3300035172 Ga0373955_0002533 Ga0373955_0002533_6245_6943 214
277 3300035724 Ga0373933_0001526 Ga0373933_0001526_7337_8035 214
278 3300036401 Ga0373937_0002031 Ga0373937_0002031_2349_3047 214
279 3300046462 Ga0495651_0017806 Ga0495651_0017806_4391_5089 214
280 3300046463 Ga0495653_0106288 Ga0495653_0106288_721_1419 214
281 3300046536 Ga0495587_0182006 Ga0495587_0182006_15_713 214
282 3300046675 Ga0495657_0060535 Ga0495657_0060535_517_1215 214
283 3300046809 Ga0495600_0077665 Ga0495600_0077665_309_1007 214
284 3300047317 Ga0495604_0054077 Ga0495604_0054077_2301_2999 214
285 3300047322 Ga0495680_0096671 Ga0495680_0096671_801_1499 214
286 3300047444 Ga0495675_0074768 Ga0495675_0074768_477_1175 214
287 3300048088 Ga0495602_0093353 Ga0495602_0093353_124_822 214
288 3300049568 Ga0501031_0060301 Ga0501031_0060301_788_1495 214
289 3300049569 Ga0501032_0015540 Ga0501032_0015540_592_1299 214
290 3300049569 Ga0501032_0017462 Ga0501032_0017462_3451_4158 214
291 3300049570 Ga0501033_0113285 Ga0501033_0113285_730_1437 214
292 3300049571 Ga0501034_0031753 Ga0501034_0031753_1164_1871 214
293 3300049571 Ga0501034_0244523 Ga0501034_0244523_410_1117 214
294 3300049572 Ga0501036_0009565 Ga0501036_0009565_3700_4407 214
295 3300049572 Ga0501036_0018017 Ga0501036_0018017_2979_3686 214
296 3300049573 Ga0501037_0001187 Ga0501037_0001187_4728_5435 214
297 3300049574 Ga0501038_0019987 Ga0501038_0019987_1457_2164 214
298 3300049574 Ga0501038_0065777 Ga0501038_0065777_1506_2213 214
299 3300049575 Ga0501039_0018702 Ga0501039_0018702_791_1498 214
300 3300049575 Ga0501039_0123670 Ga0501039_0123670_592_1299 214
301 3300049576 Ga0501040_0063757 Ga0501040_0063757_955_1662 214
302 3300049579 Ga0501043_0001872 Ga0501043_0001872_2645_3352 214
303 3300049580 Ga0501046_0038531 Ga0501046_0038531_1790_2497 214
304 3300049581 Ga0501047_0011585 Ga0501047_0011585_758_1465 214
305 3300049581 Ga0501047_0016035 Ga0501047_0016035_4137_4844 214
306 3300049581 Ga0501047_0282384 Ga0501047_0282384_63_770 214
307 3300049582 Ga0501048_0012298 Ga0501048_0012298_1104_1811 214
308 3300049582 Ga0501048_0023363 Ga0501048_0023363_2748_3455 214
309 3300049583 Ga0501067_0006525 Ga0501067_0006525_1190_1897 214
310 3300049584 Ga0501068_0007550 Ga0501068_0007550_592_1299 214
311 3300049584 Ga0501068_0012538 Ga0501068_0012538_797_1504 214
312 3300049584 Ga0501068_0060494 Ga0501068_0060494_1339_2046 214
313 3300049585 Ga0501069_0021374 Ga0501069_0021374_2033_2740 214
314 3300049585 Ga0501069_0090850 Ga0501069_0090850_23_730 214
315 3300049586 Ga0501070_0008380 Ga0501070_0008380_7097_7804 214
316 3300049586 Ga0501070_0077826 Ga0501070_0077826_1603_2310 214
317 3300049587 Ga0501071_0014377 Ga0501071_0014377_4012_4719 214
318 3300049587 Ga0501071_0267814 Ga0501071_0267814_256_963 214
319 3300049588 Ga0501072_0135982 Ga0501072_0135982_571_1278 214
320 3300049589 Ga0501073_0015959 Ga0501073_0015959_4107_4814 214
321 3300049589 Ga0501073_0027790 Ga0501073_0027790_1022_1729 214
322 3300049590 Ga0501074_0006728 Ga0501074_0006728_6335_7042 214
323 3300049590 Ga0501074_0031302 Ga0501074_0031302_551_1258 214
324 3300049591 Ga0501075_0132237 Ga0501075_0132237_330_1037 214
325 3300049741 Ga0501079_0013096 Ga0501079_0013096_3382_4089 214
326 3300049742 Ga0501080_0026488 Ga0501080_0026488_3825_4532 214
327 3300049743 Ga0501081_0208998 Ga0501081_0208998_609_1316 214
328 3300049744 Ga0501083_0024820 Ga0501083_0024820_2539_3246 214
329 3300049744 Ga0501083_0026149 Ga0501083_0026149_835_1542 214
330 3300049822 Ga0501035_0008096 Ga0501035_0008096_1701_2408 214
331 3300049822 Ga0501035_0031789 Ga0501035_0031789_2993_3700 214
332 3300049823 Ga0501044_0023300 Ga0501044_0023300_2429_3136 214
333 3300049823 Ga0501044_0106451 Ga0501044_0106451_1756_2463 214
334 3300049824 Ga0501045_0126373 Ga0501045_0126373_399_1106 214
335 3300053077 Ga0495601_0001233 Ga0495601_0001233_9846_10544 214
336 3300053085 Ga0495619_0045033 Ga0495619_0045033_1698_2396 214
337 3300053096 Ga0500641_0140510 Ga0500641_0140510_79_795 214
338 3300060353 Ga0501082_0083499 Ga0501082_0083499_1344_2051 214
339 3300060353 Ga0501082_0089643 Ga0501082_0089643_644_1351 214
340 3300006048 Ga0075363_100119038 Ga0075363_1001190381 215
341 3300028800 Ga0265338_10078817 Ga0265338_100788173 215
342 3300031247 Ga0265340_10050951 Ga0265340_100509512 215
343 3300035114 Ga0373939_0002170 Ga0373939_0002170_2976_3668 215
344 3300035172 Ga0373955_0109181 Ga0373955_0109181_703_1407 215
345 3300046462 Ga0495651_0407738 Ga0495651_0407738_110_814 215
346 3300046559 Ga0495667_0396024 Ga0495667_0396024_64_768 215
347 3300049568 Ga0501031_0006312 Ga0501031_0006312_6152_6880 215
348 3300049570 Ga0501033_0107183 Ga0501033_0107183_249_977 215
349 3300049571 Ga0501034_0001584 Ga0501034_0001584_18547_19263 215
350 3300049571 Ga0501034_0071243 Ga0501034_0071243_590_1300 215
351 3300049572 Ga0501036_0001347 Ga0501036_0001347_6821_7537 215
352 3300049572 Ga0501036_0112893 Ga0501036_0112893_727_1455 215
353 3300049573 Ga0501037_0069506 Ga0501037_0069506_1643_2359 215
354 3300049573 Ga0501037_0083619 Ga0501037_0083619_673_1401 215
355 3300049573 Ga0501037_0203275 Ga0501037_0203275_510_1220 215
356 3300049574 Ga0501038_0507482 Ga0501038_0507482_130_840 215
357 3300049575 Ga0501039_0518880 Ga0501039_0518880_137_865 215
358 3300049578 Ga0501042_0180269 Ga0501042_0180269_313_1029 215
359 3300049579 Ga0501043_0010758 Ga0501043_0010758_1437_2153 215
360 3300049579 Ga0501043_0070280 Ga0501043_0070280_1199_1927 215
361 3300049580 Ga0501046_0053120 Ga0501046_0053120_926_1642 215
362 3300049581 Ga0501047_0006650 Ga0501047_0006650_2772_3488 215
363 3300049581 Ga0501047_0119174 Ga0501047_0119174_1433_2161 215
364 3300049581 Ga0501047_0135638 Ga0501047_0135638_281_991 215
365 3300049582 Ga0501048_0000039 Ga0501048_0000039_43726_44442 215
366 3300049583 Ga0501067_0225015 Ga0501067_0225015_130_846 215
367 3300049584 Ga0501068_0152702 Ga0501068_0152702_607_1323 215
368 3300049586 Ga0501070_0009049 Ga0501070_0009049_7182_7898 215
369 3300049589 Ga0501073_0309152 Ga0501073_0309152_170_886 215
370 3300049590 Ga0501074_0021551 Ga0501074_0021551_3455_4171 215
371 3300049590 Ga0501074_0099312 Ga0501074_0099312_1168_1878 215
372 3300049741 Ga0501079_0408742 Ga0501079_0408742_284_994 215
373 3300049742 Ga0501080_0000022 Ga0501080_0000022_17290_18006 215
374 3300049744 Ga0501083_0001941 Ga0501083_0001941_6120_6836 215
375 3300049744 Ga0501083_0058001 Ga0501083_0058001_1180_1890 215
376 3300049822 Ga0501035_0216398 Ga0501035_0216398_731_1459 215
377 3300049823 Ga0501044_0005112 Ga0501044_0005112_12820_13536 215
378 3300049823 Ga0501044_0128195 Ga0501044_0128195_1108_1812 215
379 3300049823 Ga0501044_0298846 Ga0501044_0298846_513_1229 215
380 3300049823 Ga0501044_0324039 Ga0501044_0324039_579_1307 215
381 3300049823 Ga0501044_0354220 Ga0501044_0354220_485_1195 215
382 3300049824 Ga0501045_0065925 Ga0501045_0065925_1537_2253 215
383 3300050491 nmdc:mga00v17_146286_c1 nmdc:mga00v17_146286_c1_247_948 215
384 3300050494 nmdc:mga06z11_445988_c1 nmdc:mga06z11_445988_c1_38_739 215
385 3300053084 Ga0495595_0088257 Ga0495595_0088257_608_1312 215
386 3300053098 Ga0500650_0163553 Ga0500650_0163553_205_906 215
387 3300053134 Ga0500658_0078082 Ga0500658_0078082_339_1040 215
388 3300054114 Ga0501084_0669724 Ga0501084_0669724_59_769 215
389 3300060353 Ga0501082_0021232 Ga0501082_0021232_4722_5432 215
390 3300060353 Ga0501082_0105235 Ga0501082_0105235_1635_2351 215
391 3300005344 Ga0070661_100142399 Ga0070661_1001423992 216
392 3300005367 Ga0070667_100182185 Ga0070667_1001821852 216
393 3300005435 Ga0070714_100168615 Ga0070714_1001686152 216
394 3300005436 Ga0070713_100207921 Ga0070713_1002079212 216
395 3300005437 Ga0070710_10028747 Ga0070710_100287472 216
396 3300005457 Ga0070662_100162522 Ga0070662_1001625222 216
397 3300005544 Ga0070686_100393737 Ga0070686_1003937371 216
398 3300006028 Ga0070717_10294740 Ga0070717_102947402 216
399 3300006173 Ga0070716_100034968 Ga0070716_1000349683 216
400 3300006237 Ga0097621_100094037 Ga0097621_1000940372 216
401 3300009148 Ga0105243_10151695 Ga0105243_101516952 216
402 3300009177 Ga0105248_10096829 Ga0105248_100968292 216
403 3300013296 Ga0157374_10308246 Ga0157374_103082462 216
404 3300013307 Ga0157372_10591980 Ga0157372_105919801 216
405 3300014968 Ga0157379_10116794 Ga0157379_101167942 216
406 3300025898 Ga0207692_10063961 Ga0207692_100639612 216
407 3300025905 Ga0207685_10054018 Ga0207685_100540182 216
408 3300025912 Ga0207707_10326177 Ga0207707_103261771 216
409 3300025920 Ga0207649_10492361 Ga0207649_104923611 216
410 3300025927 Ga0207687_10065991 Ga0207687_100659913 216
411 3300025928 Ga0207700_10132649 Ga0207700_101326492 216
412 3300025931 Ga0207644_10020542 Ga0207644_100205426 216
413 3300025933 Ga0207706_10006829 Ga0207706_100068296 216
414 3300025941 Ga0207711_10217910 Ga0207711_102179102 216
415 3300025949 Ga0207667_10182647 Ga0207667_101826471 216
416 3300025986 Ga0207658_10024327 Ga0207658_100243274 216
417 3300031249 Ga0265339_10124148 Ga0265339_101241482 216
418 3300031250 Ga0265331_10013598 Ga0265331_100135983 216
419 3300031711 Ga0265314_10008756 Ga0265314_100087569 216
420 3300034818 Ga0373950_0007317 Ga0373950_0007317_407_1135 216
421 3300035086 Ga0373934_0089871 Ga0373934_0089871_518_1213 216
422 3300035089 Ga0373944_0042431 Ga0373944_0042431_522_1217 216
423 3300035111 Ga0373923_0000187 Ga0373923_0000187_9222_9917 216
424 3300035116 Ga0373945_0000395 Ga0373945_0000395_9082_9777 216
425 3300035117 Ga0373953_0034980 Ga0373953_0034980_143_838 216
426 3300035118 Ga0373954_0017828 Ga0373954_0017828_509_1204 216
427 3300035118 Ga0373954_0115911 Ga0373954_0115911_362_1057 216
428 3300035120 Ga0373957_0135237 Ga0373957_0135237_101_796 216
429 3300035170 Ga0373943_0034727 Ga0373943_0034727_1666_2361 216
430 3300035171 Ga0373946_0004740 Ga0373946_0004740_528_1223 216
431 3300035172 Ga0373955_0005096 Ga0373955_0005096_3811_4506 216
432 3300035172 Ga0373955_0023343 Ga0373955_0023343_890_1585 216
433 3300035410 Ga0373924_0005631 Ga0373924_0005631_2057_2752 216
434 3300035692 Ga0373935_0054490 Ga0373935_0054490_1169_1864 216
435 3300035695 Ga0373927_0379891 Ga0373927_0379891_45_740 216
436 3300035724 Ga0373933_0013460 Ga0373933_0013460_519_1214 216
437 3300035724 Ga0373933_0043828 Ga0373933_0043828_1296_1991 216
438 3300035725 Ga0373947_0021752 Ga0373947_0021752_326_1021 216
439 3300036401 Ga0373937_0008320 Ga0373937_0008320_6561_7256 216
440 3300036401 Ga0373937_0087024 Ga0373937_0087024_531_1226 216
441 3300046454 Ga0495592_0031428 Ga0495592_0031428_3033_3728 216
442 3300046455 Ga0495603_0001272 Ga0495603_0001272_4186_4881 216
443 3300046459 Ga0495629_0183377 Ga0495629_0183377_612_1307 216
444 3300046461 Ga0495641_0009857 Ga0495641_0009857_1250_1945 216
445 3300046462 Ga0495651_0017193 Ga0495651_0017193_3831_4526 216
446 3300046463 Ga0495653_0124757 Ga0495653_0124757_744_1439 216
447 3300046473 Ga0495582_0024852 Ga0495582_0024852_776_1471 216
448 3300046474 Ga0495605_0129230 Ga0495605_0129230_207_902 216
449 3300046475 Ga0495639_0026384 Ga0495639_0026384_328_1023 216
450 3300046476 Ga0495662_0002967 Ga0495662_0002967_7729_8424 216
451 3300046477 Ga0495664_0027553 Ga0495664_0027553_465_1160 216
452 3300046491 Ga0495584_0052151 Ga0495584_0052151_784_1479 216
453 3300046492 Ga0495585_0003052 Ga0495585_0003052_6168_6863 216
454 3300046501 Ga0495607_0003738 Ga0495607_0003738_5572_6267 216
455 3300046511 Ga0495608_0020801 Ga0495608_0020801_3519_4214 216
456 3300046514 Ga0495618_0013696 Ga0495618_0013696_2985_3680 216
457 3300046517 Ga0495630_0166620 Ga0495630_0166620_656_1351 216
458 3300046520 Ga0495637_0015585 Ga0495637_0015585_2201_2896 216
459 3300046523 Ga0495644_0000312 Ga0495644_0000312_12017_12712 216
460 3300046526 Ga0495666_0003560 Ga0495666_0003560_3413_4108 216
461 3300046529 Ga0495652_0134790 Ga0495652_0134790_945_1640 216
462 3300046529 Ga0495652_0194778 Ga0495652_0194778_523_1218 216
463 3300046531 Ga0495665_0007736 Ga0495665_0007736_2582_3277 216
464 3300046533 Ga0495640_0022952 Ga0495640_0022952_1810_2505 216
465 3300046533 Ga0495640_0032635 Ga0495640_0032635_2988_3683 216
466 3300046543 Ga0495645_0023097 Ga0495645_0023097_220_915 216
467 3300046557 Ga0495622_0003315 Ga0495622_0003315_2979_3674 216
468 3300046558 Ga0495633_0001295 Ga0495633_0001295_8023_8718 216
469 3300046615 Ga0495656_0000338 Ga0495656_0000338_9418_10113 216
470 3300046642 Ga0495634_0354786 Ga0495634_0354786_137_832 216
471 3300046648 Ga0495611_0003977 Ga0495611_0003977_743_1438 216
472 3300046663 Ga0495635_0049373 Ga0495635_0049373_444_1139 216
473 3300046664 Ga0495659_0000500 Ga0495659_0000500_6106_6801 216
474 3300046665 Ga0495661_0012316 Ga0495661_0012316_4679_5374 216
475 3300046674 Ga0495588_0007831 Ga0495588_0007831_696_1391 216
476 3300046678 Ga0495599_0082617 Ga0495599_0082617_185_880 216
477 3300046678 Ga0495599_0193896 Ga0495599_0193896_471_1166 216
478 3300046680 Ga0495646_0002685 Ga0495646_0002685_102_797 216
479 3300046681 Ga0495647_0010841 Ga0495647_0010841_782_1477 216
480 3300046683 Ga0495658_0354600 Ga0495658_0354600_46_741 216
481 3300046689 Ga0495613_0043715 Ga0495613_0043715_1655_2350 216
482 3300046691 Ga0495670_0000232 Ga0495670_0000232_5825_6520 216
483 3300046794 Ga0495589_0021795 Ga0495589_0021795_1005_1700 216
484 3300046809 Ga0495600_0033437 Ga0495600_0033437_782_1477 216
485 3300047315 Ga0495581_0004228 Ga0495581_0004228_4849_5544 216
486 3300047315 Ga0495581_0359211 Ga0495581_0359211_42_737 216
487 3300047317 Ga0495604_0026371 Ga0495604_0026371_49_744 216
488 3300047317 Ga0495604_0028582 Ga0495604_0028582_1753_2448 216
489 3300047319 Ga0495674_0021621 Ga0495674_0021621_369_1064 216
490 3300047322 Ga0495680_0005660 Ga0495680_0005660_7219_7914 216
491 3300047322 Ga0495680_0013375 Ga0495680_0013375_6323_7018 216
492 3300047445 Ga0495677_0020408 Ga0495677_0020408_754_1449 216
493 3300047446 Ga0495679_011022 Ga0495679_011022_30_725 216
494 3300047471 Ga0495684_0009284 Ga0495684_0009284_3913_4608 216
495 3300047673 Ga0495593_0002529 Ga0495593_0002529_3518_4213 216
496 3300048088 Ga0495602_0365239 Ga0495602_0365239_325_1020 216
497 3300048089 Ga0495614_0026235 Ga0495614_0026235_543_1238 216
498 3300048903 Ga0496100_0123679 Ga0496100_0123679_232_942 216
499 3300048904 Ga0496101_0021356 Ga0496101_0021356_1004_1714 216
500 3300048906 Ga0496103_0419923 Ga0496103_0419923_92_802 216
501 3300048907 Ga0496104_0040089 Ga0496104_0040089_3446_4156 216
502 3300048908 Ga0496105_0010839 Ga0496105_0010839_3532_4242 216
503 3300048909 Ga0496106_0033955 Ga0496106_0033955_2525_3235 216
504 3300048910 Ga0496107_0067509 Ga0496107_0067509_1338_2048 216
505 3300048912 Ga0496109_0093978 Ga0496109_0093978_1545_2255 216
506 3300048917 Ga0496114_0009201 Ga0496114_0009201_4042_4752 216
507 3300048918 Ga0496115_0044892 Ga0496115_0044892_93_803 216
508 3300049586 Ga0501070_0335663 Ga0501070_0335663_206_904 216
509 3300049822 Ga0501035_0159289 Ga0501035_0159289_566_1264 216
510 3300053077 Ga0495601_0007348 Ga0495601_0007348_2299_2994 216
511 3300053078 Ga0495612_0005171 Ga0495612_0005171_262_972 216
512 3300053078 Ga0495612_0007159 Ga0495612_0007159_2984_3679 216
513 3300053084 Ga0495595_0003155 Ga0495595_0003155_1805_2500 216
514 3300053084 Ga0495595_0014630 Ga0495595_0014630_259_954 216
515 3300053085 Ga0495619_0000083 Ga0495619_0000083_51104_51799 216
516 3300053085 Ga0495619_0012744 Ga0495619_0012744_4069_4764 216
517 3300053094 Ga0500566_0217555 Ga0500566_0217555_128_835 216
518 3300053119 Ga0500595_000003 Ga0500595_000003_242381_243088 216
519 3300053153 Ga0500616_0000002 Ga0500616_0000002_1433746_1434453 216
520 2209111006 2214772988 2213792958 217
521 3300000041 ARcpr5oldR_c000150 ARcpr5oldR_00015013 217
522 3300000042 ARSoilYngRDRAFT_c00394 ARSoilYngRDRAFT_003942 217
523 3300000043 ARcpr5yngRDRAFT_c000123 ARcpr5yngRDRAFT_00012313 217
524 3300000044 ARSoilOldRDRAFT_c000007 ARSoilOldRDRAFT_00000761 217
525 3300000045 ARCol0oldRDRAFT_c00020 ARCol0oldRDRAFT_0002013 217
526 3300000652 ARCol0yngRDRAFT_1000290 ARCol0yngRDRAFT_10002905 217
527 3300001977 JGI24746J21847_1001263 JGI24746J21847_10012632 217
528 3300001978 JGI24747J21853_1005813 JGI24747J21853_10058132 217
529 3300001990 JGI24737J22298_10014250 JGI24737J22298_100142502 217
530 3300002070 JGI24750J21931_1000532 JGI24750J21931_10005322 217
531 3300002073 JGI24745J21846_1001764 JGI24745J21846_10017642 217
532 3300002074 JGI24748J21848_1001717 JGI24748J21848_10017172 217
533 3300002075 JGI24738J21930_10001430 JGI24738J21930_100014303 217
534 3300002077 JGI24744J21845_10003290 JGI24744J21845_100032901 217
535 3300002126 JGI24035J26624_1000877 JGI24035J26624_10008772 217
536 3300002239 JGI24034J26672_10000969 JGI24034J26672_100009694 217
537 3300002244 JGI24742J22300_10000325 JGI24742J22300_100003255 217
538 3300005277 Ga0065716_1001614 Ga0065716_10016144 217
539 3300005289 Ga0065704_10072439 Ga0065704_100724392 217
540 3300005290 Ga0065712_10071797 Ga0065712_100717974 217
541 3300005293 Ga0065715_10003150 Ga0065715_100031503 217
542 3300005293 Ga0065715_10089667 Ga0065715_1008966711 217
543 3300005328 Ga0070676_10033910 Ga0070676_100339102 217
544 3300005329 Ga0070683_100036987 Ga0070683_1000369872 217
545 3300005330 Ga0070690_100012762 Ga0070690_1000127623 217
546 3300005330 Ga0070690_100122896 Ga0070690_1001228962 217
547 3300005331 Ga0070670_100006862 Ga0070670_10000686212 217
548 3300005333 Ga0070677_10000988 Ga0070677_100009882 217
549 3300005334 Ga0068869_100006414 Ga0068869_1000064141 217
550 3300005335 Ga0070666_10029109 Ga0070666_100291092 217
551 3300005336 Ga0070680_100002248 Ga0070680_10000224810 217
552 3300005336 Ga0070680_100074935 Ga0070680_1000749352 217
553 3300005336 Ga0070680_100158004 Ga0070680_1001580043 217
554 3300005337 Ga0070682_100011702 Ga0070682_1000117024 217
555 3300005337 Ga0070682_100213593 Ga0070682_1002135932 217
556 3300005338 Ga0068868_100002461 Ga0068868_10000246111 217
557 3300005339 Ga0070660_100024777 Ga0070660_1000247772 217
558 3300005339 Ga0070660_100034337 Ga0070660_1000343372 217
559 3300005340 Ga0070689_100074333 Ga0070689_1000743332 217
560 3300005340 Ga0070689_100298063 Ga0070689_1002980632 217
561 3300005341 Ga0070691_10001048 Ga0070691_1000104812 217
562 3300005341 Ga0070691_10127262 Ga0070691_101272622 217
563 3300005343 Ga0070687_100001539 Ga0070687_10000153910 217
564 3300005343 Ga0070687_100002921 Ga0070687_1000029212 217
565 3300005345 Ga0070692_10001006 Ga0070692_100010062 217
566 3300005345 Ga0070692_10073538 Ga0070692_100735382 217
567 3300005347 Ga0070668_100034942 Ga0070668_1000349422 217
568 3300005347 Ga0070668_100095260 Ga0070668_1000952602 217
569 3300005353 Ga0070669_100002469 Ga0070669_10000246911 217
570 3300005353 Ga0070669_100112134 Ga0070669_1001121342 217
571 3300005354 Ga0070675_100007875 Ga0070675_1000078752 217
572 3300005354 Ga0070675_100192967 Ga0070675_1001929672 217
573 3300005355 Ga0070671_100027809 Ga0070671_1000278094 217
574 3300005356 Ga0070674_100026094 Ga0070674_1000260943 217
575 3300005356 Ga0070674_100230633 Ga0070674_1002306332 217
576 3300005364 Ga0070673_100000950 Ga0070673_1000009507 217
577 3300005364 Ga0070673_100484704 Ga0070673_1004847042 217
578 3300005365 Ga0070688_100003204 Ga0070688_1000032042 217
579 3300005366 Ga0070659_100006909 Ga0070659_1000069092 217
580 3300005366 Ga0070659_100086149 Ga0070659_1000861492 217
581 3300005366 Ga0070659_100661369 Ga0070659_1006613691 217
582 3300005367 Ga0070667_100227279 Ga0070667_1002272791 217
583 3300005438 Ga0070701_10001420 Ga0070701_100014203 217
584 3300005438 Ga0070701_10016393 Ga0070701_100163934 217
585 3300005439 Ga0070711_100151412 Ga0070711_1001514122 217
586 3300005441 Ga0070700_100014469 Ga0070700_1000144692 217
587 3300005444 Ga0070694_100027621 Ga0070694_1000276212 217
588 3300005444 Ga0070694_100058571 Ga0070694_1000585712 217
589 3300005457 Ga0070662_100059002 Ga0070662_1000590022 217
590 3300005457 Ga0070662_100095940 Ga0070662_1000959401 217
591 3300005458 Ga0070681_10039416 Ga0070681_100394162 217
592 3300005459 Ga0068867_100001504 Ga0068867_10000150419 217
593 3300005459 Ga0068867_100444073 Ga0068867_1004440732 217
594 3300005466 Ga0070685_10023092 Ga0070685_100230924 217
595 3300005466 Ga0070685_10064625 Ga0070685_100646252 217
596 3300005518 Ga0070699_100332377 Ga0070699_1003323772 217
597 3300005530 Ga0070679_100058641 Ga0070679_1000586413 217
598 3300005530 Ga0070679_100124721 Ga0070679_1001247212 217
599 3300005530 Ga0070679_100259971 Ga0070679_1002599712 217
600 3300005535 Ga0070684_100003143 Ga0070684_1000031432 217
601 3300005535 Ga0070684_100129503 Ga0070684_1001295032 217
602 3300005539 Ga0068853_100006565 Ga0068853_10000656512 217
603 3300005539 Ga0068853_100199077 Ga0068853_1001990772 217
604 3300005543 Ga0070672_100153037 Ga0070672_1001530372 217
605 3300005544 Ga0070686_100003197 Ga0070686_1000031972 217
606 3300005545 Ga0070695_100014595 Ga0070695_1000145952 217
607 3300005546 Ga0070696_100006401 Ga0070696_1000064012 217
608 3300005546 Ga0070696_100024235 Ga0070696_1000242352 217
609 3300005547 Ga0070693_100023336 Ga0070693_1000233363 217
610 3300005547 Ga0070693_100126925 Ga0070693_1001269251 217
611 3300005549 Ga0070704_100018521 Ga0070704_1000185212 217
612 3300005563 Ga0068855_100034704 Ga0068855_1000347044 217
613 3300005563 Ga0068855_100055497 Ga0068855_1000554973 217
614 3300005563 Ga0068855_100421556 Ga0068855_1004215562 217
615 3300005564 Ga0070664_101111406 Ga0070664_1011114061 217
616 3300005577 Ga0068857_100000616 Ga0068857_1000006162 217
617 3300005577 Ga0068857_100450248 Ga0068857_1004502481 217
618 3300005578 Ga0068854_100003096 Ga0068854_1000030969 217
619 3300005578 Ga0068854_100039018 Ga0068854_1000390183 217
620 3300005614 Ga0068856_100003598 Ga0068856_10000359811 217
621 3300005614 Ga0068856_100302258 Ga0068856_1003022582 217
622 3300005616 Ga0068852_100006718 Ga0068852_10000671810 217
623 3300005617 Ga0068859_100012599 Ga0068859_1000125997 217
624 3300005617 Ga0068859_100202356 Ga0068859_1002023562 217
625 3300005618 Ga0068864_100001534 Ga0068864_10000153416 217
626 3300005718 Ga0068866_10003980 Ga0068866_100039804 217
627 3300005719 Ga0068861_100728868 Ga0068861_1007288682 217
628 3300005840 Ga0068870_10000289 Ga0068870_1000028915 217
629 3300005842 Ga0068858_100009901 Ga0068858_1000099012 217
630 3300005843 Ga0068860_100017484 Ga0068860_1000174846 217
631 3300005843 Ga0068860_100029565 Ga0068860_1000295655 217
632 3300005844 Ga0068862_100005504 Ga0068862_1000055043 217
633 3300005844 Ga0068862_100239992 Ga0068862_1002399922 217
634 3300005937 Ga0081455_10000540 Ga0081455_1000054053 217
635 3300006048 Ga0075363_100018969 Ga0075363_1000189692 217
636 3300006175 Ga0070712_100171085 Ga0070712_1001710852 217
637 3300006178 Ga0075367_10057035 Ga0075367_100570352 217
638 3300006237 Ga0097621_100001930 Ga0097621_1000019304 217
639 3300006852 Ga0075433_10005937 Ga0075433_100059372 217
640 3300006852 Ga0075433_10010527 Ga0075433_100105279 217
641 3300006871 Ga0075434_100003871 Ga0075434_10000387111 217
642 3300006914 Ga0075436_100259605 Ga0075436_1002596052 217
643 3300006931 Ga0097620_100012598 Ga0097620_1000125984 217
644 3300006931 Ga0097620_100202349 Ga0097620_1002023492 217
645 3300007076 Ga0075435_100035116 Ga0075435_1000351162 217
646 3300007076 Ga0075435_100056535 Ga0075435_1000565353 217
647 3300009094 Ga0111539_10001931 Ga0111539_1000193128 217
648 3300009098 Ga0105245_10002784 Ga0105245_1000278415 217
649 3300009101 Ga0105247_10003272 Ga0105247_100032723 217
650 3300009148 Ga0105243_10131082 Ga0105243_101310822 217
651 3300009174 Ga0105241_10000940 Ga0105241_100009402 217
652 3300009177 Ga0105248_10012521 Ga0105248_1001252110 217
653 3300009177 Ga0105248_10013721 Ga0105248_1001372110 217
654 3300009545 Ga0105237_10095275 Ga0105237_100952752 217
655 3300009551 Ga0105238_10044004 Ga0105238_100440044 217
656 3300009553 Ga0105249_10008288 Ga0105249_1000828811 217
657 3300010375 Ga0105239_10171884 Ga0105239_101718842 217
658 3300010375 Ga0105239_10312868 Ga0105239_103128682 217
659 3300010375 Ga0105239_11083825 Ga0105239_110838251 217
660 3300011119 Ga0105246_10014037 Ga0105246_100140374 217
661 3300013100 Ga0157373_10333937 Ga0157373_103339372 217
662 3300013102 Ga0157371_10022118 Ga0157371_100221185 217
663 3300013297 Ga0157378_10011895 Ga0157378_1001189510 217
664 3300013307 Ga0157372_10026975 Ga0157372_100269754 217
665 3300013308 Ga0157375_10011247 Ga0157375_1001124710 217
666 3300014325 Ga0163163_10001710 Ga0163163_1000171011 217
667 3300014325 Ga0163163_10045479 Ga0163163_100454793 217
668 3300014326 Ga0157380_10004849 Ga0157380_1000484911 217
669 3300014745 Ga0157377_10003757 Ga0157377_100037573 217
670 3300014968 Ga0157379_10031646 Ga0157379_100316462 217
671 3300014969 Ga0157376_10002411 Ga0157376_100024112 217
672 3300017792 Ga0163161_10001476 Ga0163161_1000147612 217
673 3300020070 Ga0206356_11846112 Ga0206356_118461122 217
674 3300020077 Ga0206351_10124265 Ga0206351_101242651 217
675 3300020078 Ga0206352_10069452 Ga0206352_100694521 217
676 3300020081 Ga0206354_10235034 Ga0206354_102350342 217
677 3300025271 Ga0207666_1000224 Ga0207666_10002242 217
678 3300025290 Ga0207673_1000001 Ga0207673_10000015 217
679 3300025315 Ga0207697_10002732 Ga0207697_100027322 217
680 3300025315 Ga0207697_10032683 Ga0207697_100326832 217
681 3300025893 Ga0207682_10000056 Ga0207682_1000005621 217
682 3300025899 Ga0207642_10001098 Ga0207642_100010982 217
683 3300025899 Ga0207642_10093155 Ga0207642_100931552 217
684 3300025900 Ga0207710_10169993 Ga0207710_101699932 217
685 3300025901 Ga0207688_10003180 Ga0207688_1000318010 217
686 3300025903 Ga0207680_10016469 Ga0207680_100164692 217
687 3300025904 Ga0207647_10007813 Ga0207647_1000781310 217
688 3300025904 Ga0207647_10037671 Ga0207647_100376714 217
689 3300025907 Ga0207645_10000249 Ga0207645_1000024920 217
690 3300025908 Ga0207643_10000187 Ga0207643_1000018715 217
691 3300025911 Ga0207654_10002376 Ga0207654_100023764 217
692 3300025912 Ga0207707_10008213 Ga0207707_100082132 217
693 3300025912 Ga0207707_10234401 Ga0207707_102344012 217
694 3300025914 Ga0207671_10026338 Ga0207671_100263381 217
695 3300025915 Ga0207693_10004402 Ga0207693_1000440212 217
696 3300025916 Ga0207663_10007138 Ga0207663_100071382 217
697 3300025916 Ga0207663_10169015 Ga0207663_101690152 217
698 3300025917 Ga0207660_10231954 Ga0207660_102319541 217
699 3300025917 Ga0207660_10592181 Ga0207660_105921812 217
700 3300025918 Ga0207662_10003317 Ga0207662_1000331710 217
701 3300025918 Ga0207662_10044847 Ga0207662_100448472 217
702 3300025919 Ga0207657_10012795 Ga0207657_100127952 217
703 3300025919 Ga0207657_10028541 Ga0207657_100285412 217
704 3300025920 Ga0207649_10000852 Ga0207649_1000085216 217
705 3300025921 Ga0207652_10009431 Ga0207652_100094312 217
706 3300025921 Ga0207652_10267242 Ga0207652_102672422 217
707 3300025923 Ga0207681_10006377 Ga0207681_100063775 217
708 3300025926 Ga0207659_10003644 Ga0207659_1000364411 217
709 3300025926 Ga0207659_10305525 Ga0207659_103055252 217
710 3300025932 Ga0207690_10023701 Ga0207690_100237013 217
711 3300025932 Ga0207690_10036618 Ga0207690_100366184 217
712 3300025933 Ga0207706_10001175 Ga0207706_1000117527 217
713 3300025933 Ga0207706_10053280 Ga0207706_100532804 217
714 3300025934 Ga0207686_10000898 Ga0207686_1000089815 217
715 3300025935 Ga0207709_10006803 Ga0207709_100068032 217
716 3300025935 Ga0207709_10053131 Ga0207709_100531312 217
717 3300025936 Ga0207670_10002663 Ga0207670_1000266310 217
718 3300025937 Ga0207669_10000534 Ga0207669_1000053412 217
719 3300025938 Ga0207704_10026200 Ga0207704_100262003 217
720 3300025939 Ga0207665_10307599 Ga0207665_103075992 217
721 3300025940 Ga0207691_10001992 Ga0207691_100019927 217
722 3300025940 Ga0207691_10235001 Ga0207691_102350012 217
723 3300025942 Ga0207689_10000424 Ga0207689_1000042440 217
724 3300025944 Ga0207661_10002538 Ga0207661_1000253816 217
725 3300025944 Ga0207661_10196111 Ga0207661_101961112 217
726 3300025945 Ga0207679_10000187 Ga0207679_1000018715 217
727 3300025945 Ga0207679_10182235 Ga0207679_101822351 217
728 3300025949 Ga0207667_10224059 Ga0207667_102240592 217
729 3300025949 Ga0207667_10521007 Ga0207667_105210072 217
730 3300025960 Ga0207651_10073255 Ga0207651_100732552 217
731 3300025961 Ga0207712_10001563 Ga0207712_1000156317 217
732 3300025961 Ga0207712_10092033 Ga0207712_100920332 217
733 3300025972 Ga0207668_10000807 Ga0207668_1000080713 217
734 3300025981 Ga0207640_10026149 Ga0207640_100261494 217
735 3300025986 Ga0207658_10016316 Ga0207658_100163161 217
736 3300025986 Ga0207658_10099770 Ga0207658_100997702 217
737 3300025986 Ga0207658_10335314 Ga0207658_103353142 217
738 3300026023 Ga0207677_10008612 Ga0207677_100086126 217
739 3300026035 Ga0207703_10004096 Ga0207703_100040967 217
740 3300026067 Ga0207678_10010172 Ga0207678_1001017210 217
741 3300026067 Ga0207678_10159384 Ga0207678_101593842 217
742 3300026075 Ga0207708_10007098 Ga0207708_1000709810 217
743 3300026075 Ga0207708_10009482 Ga0207708_100094827 217
744 3300026078 Ga0207702_10195449 Ga0207702_101954492 217
745 3300026078 Ga0207702_10246459 Ga0207702_102464592 217
746 3300026088 Ga0207641_10001747 Ga0207641_100017471 217
747 3300026089 Ga0207648_10001031 Ga0207648_100010311 217
748 3300026089 Ga0207648_10009238 Ga0207648_100092382 217
749 3300026116 Ga0207674_10015762 Ga0207674_100157622 217
750 3300026116 Ga0207674_10347251 Ga0207674_103472512 217
751 3300026118 Ga0207675_100010495 Ga0207675_10001049510 217
752 3300026118 Ga0207675_100388450 Ga0207675_1003884501 217
753 3300026121 Ga0207683_10000727 Ga0207683_1000072713 217
754 3300026142 Ga0207698_10001591 Ga0207698_100015913 217
755 3300027526 Ga0209968_1002657 Ga0209968_10026571 217
756 3300027543 Ga0209999_1006567 Ga0209999_10065672 217
757 3300027617 Ga0210002_1000950 Ga0210002_10009504 217
758 3300027682 Ga0209971_1020944 Ga0209971_10209442 217
759 3300027717 Ga0209998_10006128 Ga0209998_100061282 217
760 3300027717 Ga0209998_10007092 Ga0209998_100070922 217
761 3300027876 Ga0209974_10038087 Ga0209974_100380871 217
762 3300027876 Ga0209974_10095556 Ga0209974_100955562 217
763 3300027907 Ga0207428_10000150 Ga0207428_1000015090 217
764 3300027907 Ga0207428_10001312 Ga0207428_100013122 217
765 3300028380 Ga0268265_10003058 Ga0268265_100030582 217
766 3300028381 Ga0268264_10002038 Ga0268264_1000203816 217
767 3300028381 Ga0268264_10032654 Ga0268264_100326542 217
768 3300031241 Ga0265325_10000030 Ga0265325_1000003036 217
769 3300031247 Ga0265340_10088816 Ga0265340_100888162 217
770 3300031344 Ga0265316_10059331 Ga0265316_100593312 217
771 3300031344 Ga0265316_10291964 Ga0265316_102919642 217
772 3300031595 Ga0265313_10061106 Ga0265313_100611062 217
773 3300035091 Ga0373951_0009307 Ga0373951_0009307_1146_1841 217
774 3300035117 Ga0373953_0019396 Ga0373953_0019396_870_1565 217
775 3300035118 Ga0373954_0066955 Ga0373954_0066955_372_1067 217
776 3300035119 Ga0373956_0005701 Ga0373956_0005701_3615_4310 217
777 3300035121 Ga0373960_0000484 Ga0373960_0000484_5236_5931 217
778 3300035410 Ga0373924_0015589 Ga0373924_0015589_1524_2219 217
779 3300035724 Ga0373933_0009795 Ga0373933_0009795_2505_3200 217
780 3300035725 Ga0373947_0030734 Ga0373947_0030734_84_779 217
781 3300036401 Ga0373937_0004072 Ga0373937_0004072_9186_9881 217
782 3300037068 Ga0373925_0001686 Ga0373925_0001686_4312_5007 217
783 3300042008 Ga0439450_016497 Ga0439450_016497_636_1331 217
784 3300046454 Ga0495592_0004354 Ga0495592_0004354_7828_8523 217
785 3300046461 Ga0495641_0157066 Ga0495641_0157066_220_915 217
786 3300046462 Ga0495651_0128542 Ga0495651_0128542_628_1323 217
787 3300046463 Ga0495653_0023158 Ga0495653_0023158_3309_4004 217
788 3300046477 Ga0495664_0015764 Ga0495664_0015764_2513_3208 217
789 3300046516 Ga0495628_0004484 Ga0495628_0004484_3949_4644 217
790 3300046529 Ga0495652_0023265 Ga0495652_0023265_3383_4078 217
791 3300046533 Ga0495640_0040917 Ga0495640_0040917_594_1289 217
792 3300046543 Ga0495645_0001254 Ga0495645_0001254_5476_6171 217
793 3300046559 Ga0495667_0013991 Ga0495667_0013991_2478_3173 217
794 3300046663 Ga0495635_0018319 Ga0495635_0018319_28_723 217
795 3300046675 Ga0495657_0025807 Ga0495657_0025807_1324_2019 217
796 3300046678 Ga0495599_0003098 Ga0495599_0003098_2431_3126 217
797 3300046679 Ga0495623_0001432 Ga0495623_0001432_6655_7350 217
798 3300046680 Ga0495646_0254689 Ga0495646_0254689_66_761 217
799 3300047317 Ga0495604_0023070 Ga0495604_0023070_3175_3870 217
800 3300048088 Ga0495602_0016985 Ga0495602_0016985_5724_6419 217
801 3300048903 Ga0496100_0006271 Ga0496100_0006271_4335_5030 217
802 3300048906 Ga0496103_0000963 Ga0496103_0000963_11335_12030 217
803 3300048907 Ga0496104_0000065 Ga0496104_0000065_85101_85799 217
804 3300048908 Ga0496105_0167840 Ga0496105_0167840_883_1578 217
805 3300048911 Ga0496108_0027237 Ga0496108_0027237_599_1294 217
806 3300048912 Ga0496109_0001690 Ga0496109_0001690_662_1357 217
807 3300048913 Ga0496110_0285028 Ga0496110_0285028_188_883 217
808 3300048915 Ga0496112_0161739 Ga0496112_0161739_803_1498 217
809 3300048916 Ga0496113_0000329 Ga0496113_0000329_11113_11808 217
810 3300048918 Ga0496115_0297969 Ga0496115_0297969_426_1124 217
811 3300049571 Ga0501034_0340083 Ga0501034_0340083_493_1206 217
812 3300049571 Ga0501034_0410636 Ga0501034_0410636_183_959 217
813 3300049581 Ga0501047_0177364 Ga0501047_0177364_120_848 217
814 3300049585 Ga0501069_0020092 Ga0501069_0020092_2212_2931 217
815 3300049586 Ga0501070_0006927 Ga0501070_0006927_2061_2780 217
816 3300049586 Ga0501070_0033855 Ga0501070_0033855_2838_3557 217
817 3300049586 Ga0501070_0206242 Ga0501070_0206242_540_1253 217
818 3300049586 Ga0501070_0400366 Ga0501070_0400366_191_910 217
819 3300049590 Ga0501074_0497655 Ga0501074_0497655_104_832 217
820 3300049592 Ga0501076_0184391 Ga0501076_0184391_879_1574 217
821 3300049593 Ga0501077_0011615 Ga0501077_0011615_1729_2424 217
822 3300049593 Ga0501077_0080756 Ga0501077_0080756_1274_1972 217
823 3300049741 Ga0501079_0607745 Ga0501079_0607745_129_824 217
824 3300049742 Ga0501080_0146136 Ga0501080_0146136_576_1304 217
825 3300049742 Ga0501080_0263059 Ga0501080_0263059_826_1545 217
826 3300049742 Ga0501080_0399828 Ga0501080_0399828_292_1005 217
827 3300049742 Ga0501080_0411889 Ga0501080_0411889_179_898 217
828 3300049742 Ga0501080_0451264 Ga0501080_0451264_322_1017 217
829 3300049744 Ga0501083_0128696 Ga0501083_0128696_908_1636 217
830 3300049822 Ga0501035_0000655 Ga0501035_0000655_12833_13549 217
831 3300053077 Ga0495601_0000225 Ga0495601_0000225_20062_20757 217
832 3300053078 Ga0495612_0000405 Ga0495612_0000405_12546_13241 217
833 3300053084 Ga0495595_0016278 Ga0495595_0016278_1959_2654 217
834 3300053085 Ga0495619_0001284 Ga0495619_0001284_5902_6597 217
835 3300053085 Ga0495619_0329939 Ga0495619_0329939_119_823 217
836 3300061734 Ga0530510_0580173 Ga0530510_0580173_59_754 217

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ni7-assembly1.cif.gz_B crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.8097 21 197
3ni7-assembly1.cif.gz_A crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.8044 23 197
3ni7-assembly1.cif.gz_B crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.7934 21 197
3ni7-assembly1.cif.gz_A crystal structure of the tetr transcriptional regulator from nitrosomonas europaea atcc 19718 0.7802 23 197
3c07-assembly1.cif.gz_A crystal structure of a tetr family transcriptional regulator from streptomyces coelicolor a3(2) 0.7704 23 197
ID Description Score Start End Superfamily
6hodA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9551 21 64 1.10.10.60
6ho0A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9533 21 64 1.10.10.60
3g1oA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9502 22 64 1.10.10.60
6azhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9493 23 68 1.10.10.60
5f04A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9475 21 64 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7W0XMZ9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9855 22 209 GO:0003677
AF-A0A2N6B5K2-F1-model_v4 TetR family transcriptional regulator 0.9807 22 209
AF-A0A346R4N6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9767 22 215 GO:0003677
AF-A0A327JWW7-F1-model_v4 HTH tetR-type domain-containing protein 0.9765 22 216 GO:0003677
AF-A0A5D0VHX0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9754 22 215 GO:0003677

Feature Viewer

pLDDT pTM Quality
85.62 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map