F482896

General Info

Members Datasets Scaffolds Average Seq Length
836 409 827 143

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0327641|Ga0436363_0327641_81_533
Length 150
Sequence MNTETALPEGNLSLVTLGVASLQRSIAFYETLGFKRKAKASDGVGFFKAGACAIAVWPSEELAKDANFANEGMAESFRGVALAWNCRSKGDVDKVIKRAKSAGAVVRKPAQDVFWGGYSGYFADLDGHLWEVAYNPHFPMAEDGRLEIPG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2773857925 Microvirga vignae BR3299 Isolate Unclassified
5 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
6 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
7 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
8 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
9 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
10 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
11 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
12 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
13 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
14 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
15 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
16 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
17 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
28 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
29 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
30 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
31 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
139 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
158 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
247 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
258 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
259 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
260 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
261 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
264 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
265 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
266 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
267 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
268 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
269 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
270 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
271 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
274 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
276 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
277 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
282 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
285 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
286 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
287 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
288 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
304 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
305 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
306 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
307 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
308 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
309 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
312 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
313 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
320 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
323 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
324 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
329 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
330 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
341 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
357 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
358 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
359 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
390 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
391 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
406 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0.48
Rhizoplane 7.42
Rhizosphere 90.07
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214748018 2209111006 Bacteria 3411
2 ARSoilYngRDRAFT_c00630 3300000042 Bacteria 3581
3 ARcpr5yngRDRAFT_c000865 3300000043 Bacteria 3587
4 ARSoilOldRDRAFT_c000163 3300000044 Bacteria 11284
5 ARCol0yngRDRAFT_1000023 3300000652 Bacteria 28722
6 JGI24032J14994_102472 3300001430 Unclassified 658
7 JGI24752J21851_1004962 3300001976 Bacteria 1740
8 JGI24746J21847_1001103 3300001977 Bacteria 4246
9 JGI24740J21852_10060130 3300001979 Unclassified 1051
10 JGI24739J22299_10000209 3300001989 Bacteria 19461
11 JGI24737J22298_10000739 3300001990 Bacteria 11509
12 JGI24737J22298_10003173 3300001990 Bacteria 5839
13 JGI24743J22301_10029838 3300001991 Unclassified 1071
14 JGI24750J21931_1004243 3300002070 Bacteria 1731
15 JGI24750J21931_1047560 3300002070 Bacteria 663
16 JGI24745J21846_1000377 3300002073 Bacteria 3904
17 JGI24748J21848_1004941 3300002074 Bacteria 1538
18 JGI24738J21930_10000520 3300002075 Bacteria 10976
19 JGI24749J21850_1000283 3300002076 Bacteria 7793
20 JGI24744J21845_10015850 3300002077 Bacteria 1503
21 JGI24744J21845_10078976 3300002077 Bacteria 601
22 JGI24035J26624_1010270 3300002126 Unclassified 929
23 JGI24034J26672_10012331 3300002239 Bacteria 1287
24 JGI24742J22300_10000279 3300002244 Bacteria 7687
25 JGI25405J52794_10116340 3300003911 Unclassified 601
26 Ga0065714_10231999 3300005288 Bacteria 814
27 Ga0065704_10102335 3300005289 Bacteria 2209
28 Ga0065712_10070789 3300005290 Bacteria 5705
29 Ga0065715_10099305 3300005293 Bacteria 3429
30 Ga0065715_10125489 3300005293 Bacteria 2129
31 Ga0065715_10390111 3300005293 Bacteria 895
32 Ga0070658_10812213 3300005327 Bacteria 812
33 Ga0070676_10002633 3300005328 Bacteria 9237
34 Ga0070683_100010864 3300005329 Bacteria 7839
35 Ga0070690_100012955 3300005330 Bacteria 4917
36 Ga0070690_100844279 3300005330 Bacteria 713
37 Ga0070670_100008185 3300005331 Bacteria 8903
38 Ga0070670_100148297 3300005331 Bacteria 2030
39 Ga0070677_10000109 3300005333 Bacteria 26990
40 Ga0068869_100004148 3300005334 Bacteria 8986
41 Ga0068869_100258341 3300005334 Bacteria 1394
42 Ga0070666_10022824 3300005335 Bacteria 4067
43 Ga0070666_10143141 3300005335 Bacteria 1666
44 Ga0070666_10593102 3300005335 Bacteria 808
45 Ga0070680_100022932 3300005336 Bacteria 4974
46 Ga0070680_100242970 3300005336 Bacteria 1522
47 Ga0070680_101411609 3300005336 Bacteria 603
48 Ga0070682_100000459 3300005337 Bacteria 25698
49 Ga0070682_100493834 3300005337 Bacteria 947
50 Ga0070682_100508390 3300005337 Bacteria 935
51 Ga0068868_100000443 3300005338 Bacteria 27815
52 Ga0070660_100005284 3300005339 Bacteria 8931
53 Ga0070660_100041218 3300005339 Bacteria 3519
54 Ga0070660_100080982 3300005339 Bacteria 2548
55 Ga0070660_100612727 3300005339 Bacteria 911
56 Ga0070689_100000423 3300005340 Bacteria 24943
57 Ga0070689_100023357 3300005340 Bacteria 4628
58 Ga0070691_10001927 3300005341 Bacteria 9119
59 Ga0070691_10006906 3300005341 Bacteria 5193
60 Ga0070691_10120243 3300005341 Bacteria 1322
61 Ga0070687_100008328 3300005343 Bacteria 4385
62 Ga0070661_100003440 3300005344 Bacteria 10933
63 Ga0070661_100004323 3300005344 Bacteria 9801
64 Ga0070661_100088598 3300005344 Bacteria 2291
65 Ga0070661_101084605 3300005344 Bacteria 667
66 Ga0070692_10000262 3300005345 Bacteria 14685
67 Ga0070668_100001027 3300005347 Bacteria 19571
68 Ga0070668_100271025 3300005347 Bacteria 1415
69 Ga0070669_100016848 3300005353 Bacteria 5216
70 Ga0070669_100024237 3300005353 Bacteria 4350
71 Ga0070675_100036920 3300005354 Bacteria 3978
72 Ga0070675_100072259 3300005354 Bacteria 2864
73 Ga0070671_100000889 3300005355 Bacteria 21815
74 Ga0070671_100249224 3300005355 Bacteria 1508
75 Ga0070674_100001251 3300005356 Bacteria 13361
76 Ga0070674_100223967 3300005356 Bacteria 1464
77 Ga0070673_100000050 3300005364 Bacteria 49499
78 Ga0070673_100295228 3300005364 Bacteria 1425
79 Ga0070673_101110781 3300005364 Bacteria 739
80 Ga0070673_101856597 3300005364 Bacteria 571
81 Ga0070688_100001640 3300005365 Bacteria 11206
82 Ga0070688_100020856 3300005365 Bacteria 3818
83 Ga0070659_100054851 3300005366 Bacteria 3140
84 Ga0070659_100203138 3300005366 Bacteria 1632
85 Ga0070659_101325279 3300005366 Unclassified 639
86 Ga0070667_100010954 3300005367 Bacteria 7498
87 Ga0070667_100069382 3300005367 Bacteria 2999
88 Ga0070667_100406486 3300005367 Bacteria 1240
89 Ga0070667_100439211 3300005367 Bacteria 1191
90 Ga0070667_100593223 3300005367 Bacteria 1020
91 Ga0070703_10002811 3300005406 Bacteria 4987
92 Ga0070703_10028544 3300005406 Bacteria 1669
93 Ga0070709_10015243 3300005434 Bacteria 4368
94 Ga0070709_10081687 3300005434 Bacteria 2110
95 Ga0070714_100179077 3300005435 Bacteria 1928
96 Ga0070713_100000012 3300005436 Bacteria 137708
97 Ga0070710_10709619 3300005437 Unclassified 710
98 Ga0070701_10000093 3300005438 Bacteria 25004
99 Ga0070701_10047371 3300005438 Bacteria 2214
100 Ga0070711_100020995 3300005439 Bacteria 4218
101 Ga0070711_100111375 3300005439 Bacteria 2010
102 Ga0070705_100003661 3300005440 Bacteria 7526
103 Ga0070700_100007763 3300005441 Bacteria 5812
104 Ga0070700_100021519 3300005441 Bacteria 3749
105 Ga0070694_100005185 3300005444 Bacteria 7865
106 Ga0070708_100020666 3300005445 Bacteria 5558
107 Ga0070708_100218825 3300005445 Bacteria 1786
108 Ga0070663_100002633 3300005455 Bacteria 10158
109 Ga0070663_100031761 3300005455 Bacteria 3632
110 Ga0070663_100134592 3300005455 Bacteria 1881
111 Ga0070678_100022908 3300005456 Bacteria 4151
112 Ga0070678_100033305 3300005456 Bacteria 3576
113 Ga0070678_100612588 3300005456 Bacteria 973
114 Ga0070662_100015806 3300005457 Bacteria 5061
115 Ga0070662_101313768 3300005457 Unclassified 622
116 Ga0070681_10001623 3300005458 Bacteria 20035
117 Ga0070681_10069010 3300005458 Bacteria 3501
118 Ga0070681_10705590 3300005458 Bacteria 925
119 Ga0070681_11004549 3300005458 Bacteria 754
120 Ga0068867_100001138 3300005459 Bacteria 18176
121 Ga0068867_100667403 3300005459 Bacteria 914
122 Ga0068867_100793056 3300005459 Bacteria 844
123 Ga0068867_100878849 3300005459 Bacteria 805
124 Ga0070685_10000984 3300005466 Bacteria 15313
125 Ga0070685_10114177 3300005466 Bacteria 1669
126 Ga0070706_100179090 3300005467 Bacteria 1979
127 Ga0070698_101443563 3300005471 Archaea 639
128 Ga0070699_100589986 3300005518 Bacteria 1013
129 Ga0070679_100013850 3300005530 Bacteria 7727
130 Ga0070679_101244613 3300005530 Bacteria 690
131 Ga0070684_100037719 3300005535 Bacteria 4147
132 Ga0070684_100067840 3300005535 Bacteria 3134
133 Ga0070684_100464266 3300005535 Bacteria 1171
134 Ga0070697_100030045 3300005536 Bacteria 4363
135 Ga0070697_100537695 3300005536 Bacteria 1024
136 Ga0070697_101685632 3300005536 Bacteria 567
137 Ga0068853_100002793 3300005539 Bacteria 13203
138 Ga0068853_100002995 3300005539 Bacteria 12889
139 Ga0068853_100013300 3300005539 Bacteria 6719
140 Ga0070672_100003943 3300005543 Bacteria 9675
141 Ga0070672_100041581 3300005543 Bacteria 3534
142 Ga0070686_100008091 3300005544 Bacteria 5875
143 Ga0070686_100082965 3300005544 Bacteria 2127
144 Ga0070695_100000824 3300005545 Bacteria 16725
145 Ga0070695_100032902 3300005545 Bacteria 3242
146 Ga0070695_100050648 3300005545 Bacteria 2662
147 Ga0070696_100012369 3300005546 Bacteria 5726
148 Ga0070696_100028235 3300005546 Bacteria 3827
149 Ga0070696_100583789 3300005546 Bacteria 899
150 Ga0070693_100001975 3300005547 Bacteria 9380
151 Ga0070693_100014668 3300005547 Bacteria 4021
152 Ga0070693_100111912 3300005547 Bacteria 1681
153 Ga0070693_100134965 3300005547 Bacteria 1547
154 Ga0070665_100000157 3300005548 Bacteria 124344
155 Ga0070665_100078063 3300005548 Bacteria 3318
156 Ga0070665_100093184 3300005548 Bacteria 3017
157 Ga0070665_100856036 3300005548 Bacteria 922
158 Ga0070704_100011005 3300005549 Bacteria 5520
159 Ga0068855_100015755 3300005563 Bacteria 9093
160 Ga0068855_100240618 3300005563 Bacteria 2023
161 Ga0068855_101151644 3300005563 Bacteria 808
162 Ga0070664_100059292 3300005564 Bacteria 3256
163 Ga0070664_100086902 3300005564 Bacteria 2702
164 Ga0070664_100220741 3300005564 Bacteria 1696
165 Ga0068857_100008305 3300005577 Bacteria 8971
166 Ga0068857_100026843 3300005577 Bacteria 5078
167 Ga0068854_100022991 3300005578 Bacteria 4254
168 Ga0068854_100097524 3300005578 Bacteria 2198
169 Ga0068856_100001210 3300005614 Bacteria 27080
170 Ga0068856_100003821 3300005614 Bacteria 15095
171 Ga0068856_100041409 3300005614 Bacteria 4527
172 Ga0068856_100078356 3300005614 Bacteria 3276
173 Ga0070702_100000497 3300005615 Bacteria 14109
174 Ga0070702_100228403 3300005615 Bacteria 1249
175 Ga0070702_101626769 3300005615 Bacteria 535
176 Ga0068852_100001222 3300005616 Bacteria 17091
177 Ga0068852_100105348 3300005616 Bacteria 2555
178 Ga0068852_100211425 3300005616 Bacteria 1840
179 Ga0068852_101060942 3300005616 Unclassified 830
180 Ga0068859_100026376 3300005617 Bacteria 5826
181 Ga0068859_100027984 3300005617 Bacteria 5651
182 Ga0068859_100134641 3300005617 Bacteria 2543
183 Ga0068864_100001074 3300005618 Bacteria 22938
184 Ga0068864_100358925 3300005618 Bacteria 1377
185 Ga0068864_100512744 3300005618 Unclassified 1155
186 Ga0068864_101186828 3300005618 Bacteria 761
187 Ga0068866_10017244 3300005718 Bacteria 3244
188 Ga0068866_10143816 3300005718 Bacteria 1373
189 Ga0068866_10647985 3300005718 Unclassified 719
190 Ga0068861_100001328 3300005719 Bacteria 15509
191 Ga0068870_10000051 3300005840 Bacteria 36782
192 Ga0068863_100008364 3300005841 Bacteria 10106
193 Ga0068863_100076285 3300005841 Bacteria 3171
194 Ga0068863_100485610 3300005841 Bacteria 1215
195 Ga0068858_100005147 3300005842 Bacteria 12813
196 Ga0068858_100108764 3300005842 Bacteria 2588
197 Ga0068858_100330898 3300005842 Bacteria 1457
198 Ga0068860_100001825 3300005843 Bacteria 22684
199 Ga0068860_100021392 3300005843 Bacteria 6263
200 Ga0068860_100560845 3300005843 Bacteria 1145
201 Ga0068862_100017904 3300005844 Bacteria 5899
202 Ga0081455_10000081 3300005937 Bacteria 103752
203 Ga0075363_100159594 3300006048 Bacteria 1276
204 Ga0070715_10007047 3300006163 Bacteria 3851
205 Ga0070716_100018353 3300006173 Bacteria 3643
206 Ga0070716_100418950 3300006173 Bacteria 968
207 Ga0070712_100016744 3300006175 Bacteria 4739
208 Ga0070712_100032887 3300006175 Bacteria 3505
209 Ga0070712_100927247 3300006175 Unclassified 752
210 Ga0097621_100001496 3300006237 Bacteria 16030
211 Ga0097621_100016302 3300006237 Bacteria 5613
212 Ga0097621_100274900 3300006237 Bacteria 1481
213 Ga0097621_101179577 3300006237 Bacteria 721
214 Ga0068871_100000576 3300006358 Bacteria 25122
215 Ga0068871_100021574 3300006358 Bacteria 4952
216 Ga0068871_100214734 3300006358 Bacteria 1665
217 Ga0075434_100008056 3300006871 Bacteria 9773
218 Ga0075434_100941695 3300006871 Bacteria 878
219 Ga0075429_100029763 3300006880 Bacteria 4744
220 Ga0068865_100003854 3300006881 Bacteria 8992
221 Ga0068865_100010914 3300006881 Bacteria 5669
222 Ga0068865_100322155 3300006881 Bacteria 1244
223 Ga0075436_100000426 3300006914 Bacteria 27028
224 Ga0075436_100028231 3300006914 Bacteria 3860
225 Ga0075436_100271937 3300006914 Bacteria 1210
226 Ga0075436_100465411 3300006914 Bacteria 922
227 Ga0097620_100026376 3300006931 Bacteria 5826
228 Ga0097620_100027983 3300006931 Bacteria 5651
229 Ga0097620_100134638 3300006931 Bacteria 2543
230 Ga0075435_100026536 3300007076 Bacteria 4521
231 Ga0075435_100292029 3300007076 Bacteria 1393
232 Ga0105244_10084313 3300009036 Bacteria 1570
233 Ga0105240_10018775 3300009093 Bacteria 9264
234 Ga0105240_10218962 3300009093 Bacteria 2219
235 Ga0105240_10541878 3300009093 Bacteria 1288
236 Ga0105240_10584149 3300009093 Bacteria 1232
237 Ga0105240_10779198 3300009093 Bacteria 1037
238 Ga0111539_10000757 3300009094 Bacteria 42016
239 Ga0111539_10585087 3300009094 Bacteria 1300
240 Ga0105245_10002488 3300009098 Bacteria 16638
241 Ga0105245_10189127 3300009098 Bacteria 1971
242 Ga0105247_10004963 3300009101 Bacteria 8458
243 Ga0105247_10009138 3300009101 Bacteria 6032
244 Ga0105247_10270153 3300009101 Unclassified 1169
245 Ga0105247_10487898 3300009101 Bacteria 895
246 Ga0105243_10003214 3300009148 Bacteria 13370
247 Ga0105243_10063065 3300009148 Bacteria 2969
248 Ga0105243_10071314 3300009148 Bacteria 2808
249 Ga0105243_10216819 3300009148 Bacteria 1689
250 Ga0105241_10013069 3300009174 Bacteria 6088
251 Ga0105241_10082049 3300009174 Bacteria 2527
252 Ga0105241_10137051 3300009174 Bacteria 1989
253 Ga0105241_12005357 3300009174 Bacteria 570
254 Ga0105242_10002016 3300009176 Bacteria 15990
255 Ga0105248_10003871 3300009177 Bacteria 16548
256 Ga0105248_10018471 3300009177 Bacteria 7706
257 Ga0105248_10148475 3300009177 Bacteria 2645
258 Ga0105248_10296617 3300009177 Bacteria 1820
259 Ga0105248_11623458 3300009177 Bacteria 733
260 Ga0105237_10001801 3300009545 Bacteria 27675
261 Ga0105237_10024783 3300009545 Bacteria 6138
262 Ga0105237_10025451 3300009545 Bacteria 6052
263 Ga0105238_10004248 3300009551 Bacteria 14237
264 Ga0105238_10133598 3300009551 Bacteria 2459
265 Ga0105238_10137144 3300009551 Bacteria 2424
266 Ga0105249_10001193 3300009553 Bacteria 22912
267 Ga0105249_10020158 3300009553 Bacteria 5958
268 Ga0105249_10236960 3300009553 Bacteria 1802
269 Ga0105249_10607224 3300009553 Bacteria 1149
270 Ga0105239_10030616 3300010375 Bacteria 5919
271 Ga0105239_10267471 3300010375 Bacteria 1922
272 Ga0105239_10526121 3300010375 Bacteria 1345
273 Ga0105239_10712648 3300010375 Bacteria 1148
274 Ga0105239_10789373 3300010375 Bacteria 1088
275 Ga0105246_10000231 3300011119 Bacteria 28580
276 Ga0105246_10509445 3300011119 Bacteria 1024
277 Ga0105246_10841000 3300011119 Bacteria 818
278 Ga0157345_1016400 3300012498 Bacteria 711
279 Ga0157342_1000445 3300012507 Bacteria 2507
280 Ga0157326_1003345 3300012513 Bacteria 1689
281 Ga0157338_1000781 3300012515 Bacteria 2049
282 Ga0157373_10011046 3300013100 Bacteria 6651
283 Ga0157371_10013762 3300013102 Bacteria 6130
284 Ga0157371_10215226 3300013102 Bacteria 1379
285 Ga0157371_11538920 3300013102 Bacteria 519
286 Ga0157370_10000832 3300013104 Bacteria 39082
287 Ga0157370_10246046 3300013104 Bacteria 1654
288 Ga0157369_10469673 3300013105 Bacteria 1302
289 Ga0157374_10035420 3300013296 Bacteria 4567
290 Ga0157374_10037940 3300013296 Bacteria 4426
291 Ga0157374_11320734 3300013296 Bacteria 743
292 Ga0157374_12134771 3300013296 Bacteria 587
293 Ga0157378_10022746 3300013297 Bacteria 5516
294 Ga0157378_10095614 3300013297 Bacteria 2706
295 Ga0157378_10149112 3300013297 Bacteria 2178
296 Ga0157378_10336913 3300013297 Bacteria 1470
297 Ga0163162_10006149 3300013306 Bacteria 11621
298 Ga0163162_10117622 3300013306 Bacteria 2760
299 Ga0163162_10122467 3300013306 Bacteria 2705
300 Ga0163162_10416440 3300013306 Bacteria 1476
301 Ga0163162_12223522 3300013306 Bacteria 630
302 Ga0157372_10025465 3300013307 Bacteria 6433
303 Ga0157372_10419050 3300013307 Bacteria 1560
304 Ga0157372_11542789 3300013307 Bacteria 765
305 Ga0157375_10021653 3300013308 Bacteria 5900
306 Ga0157375_10304086 3300013308 Bacteria 1758
307 Ga0163163_10001320 3300014325 Bacteria 20935
308 Ga0163163_10032310 3300014325 Bacteria 5054
309 Ga0163163_10143373 3300014325 Bacteria 2432
310 Ga0163163_10535745 3300014325 Bacteria 1233
311 Ga0163163_12197028 3300014325 Unclassified 611
312 Ga0157380_10002744 3300014326 Bacteria 11948
313 Ga0157380_10019743 3300014326 Bacteria 5027
314 Ga0157380_10047959 3300014326 Bacteria 3362
315 Ga0157377_10000164 3300014745 Bacteria 39592
316 Ga0157377_10100198 3300014745 Bacteria 1725
317 Ga0157377_11046017 3300014745 Bacteria 621
318 Ga0157379_10012672 3300014968 Bacteria 7369
319 Ga0157379_10094726 3300014968 Bacteria 2679
320 Ga0157379_10265766 3300014968 Bacteria 1559
321 Ga0157379_10291614 3300014968 Bacteria 1486
322 Ga0157379_10374963 3300014968 Unclassified 1305
323 Ga0157379_10445141 3300014968 Bacteria 1195
324 Ga0157376_10002102 3300014969 Bacteria 13394
325 Ga0157376_10009727 3300014969 Bacteria 7000
326 Ga0157376_10079367 3300014969 Bacteria 2813
327 Ga0163161_10002837 3300017792 Bacteria 12295
328 Ga0213876_10263921 3300021384 Bacteria 915
329 Ga0207666_1000051 3300025271 Bacteria 21813
330 Ga0207666_1006768 3300025271 Bacteria 1493
331 Ga0207673_1000958 3300025290 Bacteria 3106
332 Ga0207697_10000662 3300025315 Bacteria 19563
333 Ga0207697_10006653 3300025315 Bacteria 5209
334 Ga0207655_1070435 3300025728 Bacteria 1302
335 Ga0207653_10000546 3300025885 Bacteria 13918
336 Ga0207653_10013666 3300025885 Bacteria 2542
337 Ga0207682_10000072 3300025893 Bacteria 44659
338 Ga0207692_10027923 3300025898 Bacteria 2663
339 Ga0207642_10010607 3300025899 Bacteria 3257
340 Ga0207642_10075738 3300025899 Bacteria 1617
341 Ga0207642_10208714 3300025899 Bacteria 1084
342 Ga0207710_10009082 3300025900 Bacteria 4185
343 Ga0207710_10137418 3300025900 Unclassified 1178
344 Ga0207710_10223636 3300025900 Bacteria 935
345 Ga0207710_10329954 3300025900 Bacteria 775
346 Ga0207688_10000229 3300025901 Bacteria 25389
347 Ga0207688_10020259 3300025901 Bacteria 3630
348 Ga0207680_10025714 3300025903 Bacteria 3250
349 Ga0207680_10566024 3300025903 Bacteria 812
350 Ga0207647_10003353 3300025904 Bacteria 12014
351 Ga0207647_10019233 3300025904 Bacteria 4597
352 Ga0207685_10039891 3300025905 Bacteria 1746
353 Ga0207699_10012526 3300025906 Bacteria 4315
354 Ga0207699_10053089 3300025906 Bacteria 2402
355 Ga0207645_10000966 3300025907 Bacteria 23780
356 Ga0207643_10000004 3300025908 Bacteria 187006
357 Ga0207684_10126441 3300025910 Bacteria 2194
358 Ga0207654_10001472 3300025911 Bacteria 12448
359 Ga0207654_10055190 3300025911 Bacteria 2299
360 Ga0207707_10010417 3300025912 Bacteria 8067
361 Ga0207707_10026555 3300025912 Bacteria 5061
362 Ga0207695_10085826 3300025913 Bacteria 3176
363 Ga0207695_10284678 3300025913 Bacteria 1546
364 Ga0207695_10534683 3300025913 Bacteria 1054
365 Ga0207695_10596992 3300025913 Unclassified 985
366 Ga0207671_10026742 3300025914 Bacteria 4320
367 Ga0207671_10465240 3300025914 Bacteria 1008
368 Ga0207693_10001624 3300025915 Bacteria 19860
369 Ga0207693_10003724 3300025915 Bacteria 12993
370 Ga0207693_10028672 3300025915 Bacteria 4399
371 Ga0207693_10417378 3300025915 Bacteria 1049
372 Ga0207663_10063043 3300025916 Bacteria 2359
373 Ga0207663_10093512 3300025916 Bacteria 2001
374 Ga0207663_10189417 3300025916 Bacteria 1476
375 Ga0207663_10236502 3300025916 Bacteria 1337
376 Ga0207660_10000648 3300025917 Bacteria 23454
377 Ga0207660_10083840 3300025917 Bacteria 2348
378 Ga0207660_10144095 3300025917 Bacteria 1824
379 Ga0207660_10298926 3300025917 Bacteria 1281
380 Ga0207662_10000317 3300025918 Bacteria 21877
381 Ga0207662_10007326 3300025918 Bacteria 6001
382 Ga0207657_10002047 3300025919 Bacteria 21819
383 Ga0207657_10049663 3300025919 Bacteria 3654
384 Ga0207657_10057207 3300025919 Bacteria 3361
385 Ga0207649_10000037 3300025920 Bacteria 131159
386 Ga0207649_10000262 3300025920 Bacteria 41689
387 Ga0207649_10231460 3300025920 Bacteria 1322
388 Ga0207652_10045204 3300025921 Bacteria 3753
389 Ga0207652_10391323 3300025921 Bacteria 1254
390 Ga0207646_10822098 3300025922 Unclassified 827
391 Ga0207646_10987405 3300025922 Unclassified 744
392 Ga0207681_10025833 3300025923 Bacteria 3782
393 Ga0207681_10042994 3300025923 Bacteria 3021
394 Ga0207694_10088416 3300025924 Bacteria 2442
395 Ga0207694_10230136 3300025924 Bacteria 1513
396 Ga0207650_10004313 3300025925 Bacteria 9709
397 Ga0207650_10141954 3300025925 Bacteria 1889
398 Ga0207659_10001684 3300025926 Bacteria 13118
399 Ga0207687_10001501 3300025927 Bacteria 15981
400 Ga0207687_10704318 3300025927 Bacteria 857
401 Ga0207700_10000058 3300025928 Bacteria 70410
402 Ga0207700_10475083 3300025928 Bacteria 1104
403 Ga0207664_10156740 3300025929 Bacteria 1939
404 Ga0207664_11974379 3300025929 Bacteria 506
405 Ga0207644_10000467 3300025931 Bacteria 26087
406 Ga0207644_10230485 3300025931 Bacteria 1471
407 Ga0207690_10001228 3300025932 Bacteria 16182
408 Ga0207706_10001679 3300025933 Bacteria 21866
409 Ga0207706_10009690 3300025933 Bacteria 8840
410 Ga0207706_10066033 3300025933 Bacteria 3184
411 Ga0207686_10006089 3300025934 Bacteria 6480
412 Ga0207686_10325675 3300025934 Bacteria 1150
413 Ga0207709_10006275 3300025935 Bacteria 6677
414 Ga0207709_10013556 3300025935 Bacteria 4496
415 Ga0207709_10026438 3300025935 Bacteria 3334
416 Ga0207670_10014641 3300025936 Bacteria 4663
417 Ga0207670_10063548 3300025936 Bacteria 2526
418 Ga0207670_10175747 3300025936 Bacteria 1609
419 Ga0207669_10002049 3300025937 Bacteria 8529
420 Ga0207669_10341629 3300025937 Bacteria 1153
421 Ga0207669_10490369 3300025937 Bacteria 981
422 Ga0207669_11075571 3300025937 Unclassified 678
423 Ga0207704_10003529 3300025938 Bacteria 7115
424 Ga0207665_10027408 3300025939 Bacteria 3764
425 Ga0207665_10172346 3300025939 Bacteria 1563
426 Ga0207691_10002874 3300025940 Bacteria 16780
427 Ga0207691_10061507 3300025940 Bacteria 3411
428 Ga0207691_10318936 3300025940 Bacteria 1333
429 Ga0207711_10006776 3300025941 Bacteria 9628
430 Ga0207711_10025537 3300025941 Bacteria 4955
431 Ga0207711_10070613 3300025941 Bacteria 3029
432 Ga0207711_10190335 3300025941 Bacteria 1869
433 Ga0207711_10320427 3300025941 Bacteria 1432
434 Ga0207689_10000203 3300025942 Bacteria 52425
435 Ga0207689_10235266 3300025942 Bacteria 1514
436 Ga0207661_10012457 3300025944 Bacteria 6179
437 Ga0207661_10276806 3300025944 Bacteria 1499
438 Ga0207679_10000157 3300025945 Bacteria 56166
439 Ga0207679_10082307 3300025945 Bacteria 2464
440 Ga0207679_10164353 3300025945 Bacteria 1821
441 Ga0207679_10383000 3300025945 Unclassified 1233
442 Ga0207667_10033582 3300025949 Bacteria 5515
443 Ga0207667_10815216 3300025949 Bacteria 929
444 Ga0207651_10006717 3300025960 Bacteria 6061
445 Ga0207651_10675397 3300025960 Bacteria 908
446 Ga0207712_10002224 3300025961 Bacteria 12622
447 Ga0207712_10483484 3300025961 Bacteria 1056
448 Ga0207668_10003217 3300025972 Bacteria 9570
449 Ga0207668_10216753 3300025972 Bacteria 1534
450 Ga0207668_10296384 3300025972 Bacteria 1333
451 Ga0207640_10004454 3300025981 Bacteria 7591
452 Ga0207640_10309405 3300025981 Bacteria 1253
453 Ga0207640_10650680 3300025981 Bacteria 898
454 Ga0207658_10027932 3300025986 Bacteria 3969
455 Ga0207658_10159306 3300025986 Bacteria 1848
456 Ga0207658_10531504 3300025986 Bacteria 1050
457 Ga0207677_10001675 3300026023 Bacteria 11738
458 Ga0207677_10090314 3300026023 Bacteria 2226
459 Ga0207703_10001852 3300026035 Bacteria 18819
460 Ga0207703_10033946 3300026035 Bacteria 4047
461 Ga0207703_10157415 3300026035 Bacteria 1987
462 Ga0207703_10479003 3300026035 Bacteria 1166
463 Ga0207639_10071634 3300026041 Bacteria 2712
464 Ga0207639_10084659 3300026041 Bacteria 2519
465 Ga0207639_10401737 3300026041 Bacteria 1234
466 Ga0207639_11458194 3300026041 Bacteria 642
467 Ga0207678_10001809 3300026067 Bacteria 19589
468 Ga0207678_10012723 3300026067 Bacteria 7391
469 Ga0207678_10082363 3300026067 Bacteria 2753
470 Ga0207678_10598988 3300026067 Bacteria 966
471 Ga0207708_10001199 3300026075 Bacteria 19559
472 Ga0207708_10003067 3300026075 Bacteria 12308
473 Ga0207708_10347840 3300026075 Bacteria 1215
474 Ga0207702_10000045 3300026078 Bacteria 144714
475 Ga0207702_10003404 3300026078 Bacteria 14557
476 Ga0207702_10060437 3300026078 Bacteria 3231
477 Ga0207702_10110858 3300026078 Bacteria 2439
478 Ga0207641_10023651 3300026088 Bacteria 5062
479 Ga0207641_10075722 3300026088 Bacteria 2907
480 Ga0207641_10595331 3300026088 Bacteria 1082
481 Ga0207641_10747655 3300026088 Unclassified 965
482 Ga0207648_10002073 3300026089 Bacteria 21861
483 Ga0207648_10133046 3300026089 Bacteria 2189
484 Ga0207648_11423677 3300026089 Bacteria 651
485 Ga0207676_10000990 3300026095 Bacteria 21882
486 Ga0207676_10024942 3300026095 Bacteria 4432
487 Ga0207676_10270696 3300026095 Bacteria 1538
488 Ga0207676_10439308 3300026095 Unclassified 1228
489 Ga0207676_11557231 3300026095 Unclassified 658
490 Ga0207676_12297969 3300026095 Bacteria 537
491 Ga0207674_10000897 3300026116 Bacteria 38907
492 Ga0207674_10001401 3300026116 Bacteria 31105
493 Ga0207675_100001726 3300026118 Bacteria 21899
494 Ga0207675_100076333 3300026118 Bacteria 3138
495 Ga0207675_101458828 3300026118 Bacteria 705
496 Ga0207683_10001176 3300026121 Bacteria 23694
497 Ga0207683_10020527 3300026121 Bacteria 5652
498 Ga0207683_10561411 3300026121 Bacteria 1056
499 Ga0207683_10845913 3300026121 Bacteria 849
500 Ga0207698_10003743 3300026142 Bacteria 9193
501 Ga0209967_1015249 3300027364 Bacteria 1099
502 Ga0210002_1008815 3300027617 Bacteria 1538
503 Ga0209983_1005259 3300027665 Bacteria 2686
504 Ga0209971_1017323 3300027682 Bacteria 1708
505 Ga0209971_1033085 3300027682 Bacteria 1242
506 Ga0209966_1000247 3300027695 Bacteria 19895
507 Ga0209998_10002233 3300027717 Bacteria 4484
508 Ga0209998_10002778 3300027717 Bacteria 3953
509 Ga0209974_10015951 3300027876 Bacteria 2494
510 Ga0209974_10053834 3300027876 Bacteria 1356
511 Ga0209974_10131583 3300027876 Bacteria 892
512 Ga0207428_10000792 3300027907 Bacteria 35769
513 Ga0268266_10000003 3300028379 Bacteria 1701703
514 Ga0268266_10033993 3300028379 Bacteria 4334
515 Ga0268265_10002187 3300028380 Bacteria 15094
516 Ga0268265_10225652 3300028380 Bacteria 1642
517 Ga0268264_10018562 3300028381 Bacteria 5688
518 Ga0268264_10104372 3300028381 Bacteria 2470
519 Ga0268264_10464861 3300028381 Bacteria 1228
520 Ga0265338_10042419 3300028800 Bacteria 4237
521 Ga0265338_10539643 3300028800 Bacteria 817
522 Ga0265332_10436705 3300031238 Bacteria 541
523 Ga0265325_10000600 3300031241 Bacteria 26270
524 Ga0265340_10025762 3300031247 Bacteria 2977
525 Ga0265339_10401562 3300031249 Bacteria 640
526 Ga0265316_10021352 3300031344 Bacteria 5484
527 Ga0265316_10092697 3300031344 Bacteria 2303
528 Ga0307408_100072949 3300031548 Bacteria 2542
529 Ga0265313_10006817 3300031595 Bacteria 7977
530 Ga0316575_10071072 3300031665 Bacteria 1398
531 Ga0265342_10172281 3300031712 Bacteria 1190
532 Ga0316576_10595996 3300031727 Unclassified 807
533 Ga0316578_10208208 3300031728 Bacteria 1177
534 Ga0316578_10286107 3300031728 Bacteria 987
535 Ga0316578_10342957 3300031728 Bacteria 890
536 Ga0307413_10398590 3300031824 Bacteria 1077
537 Ga0307410_10068033 3300031852 Bacteria 2458
538 Ga0307407_10007668 3300031903 Bacteria 4900
539 Ga0307412_10070809 3300031911 Bacteria 2378
540 Ga0307409_100018694 3300031995 Bacteria 4668
541 Ga0307416_100071314 3300032002 Bacteria 2885
542 Ga0307414_10233760 3300032004 Bacteria 1517
543 Ga0307414_10300698 3300032004 Bacteria 1357
544 Ga0307411_10797125 3300032005 Bacteria 831
545 Ga0307415_100007254 3300032126 Bacteria 6051
546 Ga0373930_0000250 3300034816 Bacteria 6826
547 Ga0373930_0003593 3300034816 Bacteria 2471
548 Ga0373948_0000061 3300034817 Bacteria 11538
549 Ga0373948_0016450 3300034817 Bacteria 1367
550 Ga0373950_0000537 3300034818 Bacteria 4659
551 Ga0373950_0004026 3300034818 Bacteria 2137
552 Ga0373958_0000048 3300034819 Bacteria 11955
553 Ga0373958_0000826 3300034819 Bacteria 3960
554 Ga0373959_0000735 3300034820 Bacteria 5592
555 Ga0373938_0000471 3300034957 Bacteria 6519
556 Ga0373938_0000691 3300034957 Bacteria 5451
557 Ga0373926_0016674 3300035083 Bacteria 2516
558 Ga0373928_0005735 3300035084 Bacteria 2375
559 Ga0373929_0000096 3300035085 Bacteria 14516
560 Ga0373929_0003497 3300035085 Bacteria 2828
561 Ga0373934_0207910 3300035086 Unclassified 806
562 Ga0373940_0000023 3300035088 Bacteria 16767
563 Ga0373940_0043859 3300035088 Bacteria 1237
564 Ga0373944_0028788 3300035089 Bacteria 1655
565 Ga0373949_0001146 3300035090 Bacteria 7970
566 Ga0373949_0001755 3300035090 Bacteria 5985
567 Ga0373951_0000876 3300035091 Bacteria 8125
568 Ga0373951_0012771 3300035091 Bacteria 1888
569 Ga0373951_0034363 3300035091 Bacteria 1204
570 Ga0373952_0000126 3300035092 Bacteria 10768
571 Ga0373952_0004467 3300035092 Bacteria 2538
572 Ga0373923_0033921 3300035111 Bacteria 2069
573 Ga0373923_0066067 3300035111 Bacteria 1545
574 Ga0373923_0372536 3300035111 Bacteria 684
575 Ga0373932_0000553 3300035112 Bacteria 11476
576 Ga0373932_0016039 3300035112 Bacteria 1907
577 Ga0373936_0148732 3300035113 Bacteria 1014
578 Ga0373939_0000419 3300035114 Bacteria 10659
579 Ga0373939_0000663 3300035114 Bacteria 8540
580 Ga0373941_0000309 3300035115 Bacteria 9451
581 Ga0373941_0005456 3300035115 Bacteria 2994
582 Ga0373945_0305703 3300035116 Unclassified 682
583 Ga0373954_0004588 3300035118 Bacteria 5953
584 Ga0373954_0048635 3300035118 Bacteria 1987
585 Ga0373956_0060571 3300035119 Bacteria 1714
586 Ga0373956_0359398 3300035119 Bacteria 694
587 Ga0373957_0130326 3300035120 Unclassified 1023
588 Ga0373960_0002985 3300035121 Bacteria 3828
589 Ga0373960_0017748 3300035121 Bacteria 1847
590 Ga0373943_0064807 3300035170 Bacteria 1835
591 Ga0373943_0129399 3300035170 Bacteria 1350
592 Ga0373955_0017482 3300035172 Bacteria 3551
593 Ga0373955_0018792 3300035172 Bacteria 3444
594 Ga0373955_0242846 3300035172 Unclassified 1079
595 Ga0373955_0799976 3300035172 Bacteria 580
596 Ga0373942_0000081 3300035207 Bacteria 20661
597 Ga0373942_0005488 3300035207 Bacteria 2941
598 Ga0373942_0284926 3300035207 Unclassified 570
599 Ga0373961_0010016 3300035241 Bacteria 2330
600 Ga0373962_0000194 3300035242 Bacteria 12882
601 Ga0373962_0001329 3300035242 Bacteria 5825
602 Ga0373962_0279718 3300035242 Bacteria 587
603 Ga0316574_0057469 3300035398 Bacteria 2435
604 Ga0373924_0043119 3300035410 Bacteria 1852
605 Ga0373931_0001008 3300035691 Bacteria 11924
606 Ga0373931_0160221 3300035691 Bacteria 1319
607 Ga0373935_0077953 3300035692 Bacteria 2148
608 Ga0373935_0102433 3300035692 Bacteria 1889
609 Ga0373935_0736019 3300035692 Bacteria 726
610 Ga0373927_0300442 3300035695 Unclassified 1056
611 Ga0373933_0000753 3300035724 Bacteria 19821
612 Ga0373933_0004608 3300035724 Bacteria 7550
613 Ga0373933_0058259 3300035724 Bacteria 2323
614 Ga0373933_0361474 3300035724 Bacteria 944
615 Ga0373933_0380565 3300035724 Bacteria 919
616 Ga0373937_0000655 3300036401 Bacteria 30381
617 Ga0373937_0005483 3300036401 Bacteria 10870
618 Ga0373937_0011937 3300036401 Bacteria 7624
619 Ga0373937_0012043 3300036401 Bacteria 7589
620 Ga0373925_0649210 3300037068 Unclassified 869
621 Ga0373925_0759213 3300037068 Bacteria 799
622 Ga0373925_1046371 3300037068 Bacteria 672
623 Ga0373925_1589956 3300037068 Bacteria 534
624 Ga0395900_0000002 3300037418 Bacteria 671103
625 Ga0395898_0030042 3300037466 Bacteria 5440
626 Ga0395905_0019957 3300037471 Bacteria 6351
627 Ga0436364_0567052 3300037853 Unclassified 1674
628 Ga0395901_0000013 3300038443 Bacteria 375733
629 Ga0400489_13735 3300039093 Bacteria 1694
630 Ga0400489_56277 3300039093 Bacteria 2585
631 Ga0436365_0144344 3300039437 Bacteria 9268
632 Ga0436365_0691718 3300039437 Unclassified 581
633 Ga0436365_1657697 3300039437 Bacteria 665
634 Ga0436361_0621516 3300039447 Bacteria 650
635 Ga0436363_0327641 3300039450 Bacteria 1130
636 Ga0439448_0181842 3300042005 Bacteria 735
637 Ga0439455_0011926 3300042012 Bacteria 1942
638 Ga0439463_015735 3300042016 Bacteria 1871
639 Ga0439458_0113433 3300042157 Bacteria 710
640 Ga0439444_0144195 3300042437 Bacteria 571
641 Ga0439464_0045011 3300042439 Bacteria 1265
642 Ga0451577_0120856 3300042876 Bacteria 2346
643 Ga0466972_0453199 3300044658 Bacteria 603
644 Ga0453684_0223027 3300044712 Bacteria 2182
645 Ga0466960_0104697 3300044901 Bacteria 1462
646 Ga0466959_0693512 3300045049 Bacteria 683
647 Ga0451576_0006650 3300045051 Bacteria 14107
648 Ga0466967_0632186 3300045976 Bacteria 1058
649 Ga0495592_0067596 3300046454 Bacteria 2610
650 Ga0495603_0028204 3300046455 Bacteria 3386
651 Ga0495638_0453726 3300046460 Bacteria 654
652 Ga0495641_0041535 3300046461 Bacteria 2136
653 Ga0495651_0048616 3300046462 Bacteria 3275
654 Ga0495651_0133324 3300046462 Bacteria 1811
655 Ga0495653_0003231 3300046463 Bacteria 13066
656 Ga0495653_0108077 3300046463 Bacteria 2004
657 Ga0495653_0225385 3300046463 Bacteria 1257
658 Ga0495650_0082801 3300046471 Bacteria 1234
659 Ga0495580_0151887 3300046472 Bacteria 1604
660 Ga0495582_0539890 3300046473 Unclassified 674
661 Ga0495639_0011384 3300046475 Bacteria 3835
662 Ga0495662_0029637 3300046476 Bacteria 2642
663 Ga0495664_0002327 3300046477 Bacteria 10184
664 Ga0495664_0052695 3300046477 Bacteria 2419
665 Ga0495584_0198216 3300046491 Bacteria 1021
666 Ga0495594_0050759 3300046499 Bacteria 2282
667 Ga0495608_0000428 3300046511 Bacteria 29274
668 Ga0495608_0056952 3300046511 Bacteria 2580
669 Ga0495618_0022993 3300046514 Bacteria 3851
670 Ga0495628_0065732 3300046516 Bacteria 2835
671 Ga0495631_0289900 3300046518 Bacteria 697
672 Ga0495642_0017498 3300046528 Bacteria 2800
673 Ga0495652_0110912 3300046529 Bacteria 2206
674 Ga0495652_0113198 3300046529 Bacteria 2178
675 Ga0495665_0344311 3300046531 Unclassified 760
676 Ga0495640_0028613 3300046533 Bacteria 4010
677 Ga0495640_0167247 3300046533 Bacteria 1406
678 Ga0495586_0013401 3300046535 Bacteria 4347
679 Ga0495586_0038131 3300046535 Bacteria 2580
680 Ga0495587_0001490 3300046536 Bacteria 15605
681 Ga0495587_0038051 3300046536 Bacteria 2886
682 Ga0495645_0046734 3300046543 Bacteria 3154
683 Ga0495667_0034314 3300046559 Bacteria 3393
684 Ga0495667_0163059 3300046559 Bacteria 1433
685 Ga0495656_0293316 3300046615 Bacteria 832
686 Ga0495668_0255064 3300046616 Bacteria 960
687 Ga0495634_0141103 3300046642 Bacteria 1529
688 Ga0495634_0309440 3300046642 Bacteria 953
689 Ga0495625_0200083 3300046660 Bacteria 1319
690 Ga0495625_0381465 3300046660 Bacteria 884
691 Ga0495635_0004055 3300046663 Bacteria 10163
692 Ga0495657_0008984 3300046675 Bacteria 7603
693 Ga0495657_0068961 3300046675 Bacteria 2315
694 Ga0495599_0062738 3300046678 Bacteria 2321
695 Ga0495599_0220644 3300046678 Bacteria 1160
696 Ga0495623_0003897 3300046679 Bacteria 9840
697 Ga0495623_0162577 3300046679 Bacteria 1311
698 Ga0495646_0003693 3300046680 Bacteria 9553
699 Ga0495658_0147172 3300046683 Bacteria 1444
700 Ga0495658_0767441 3300046683 Bacteria 617
701 Ga0495669_0060091 3300046684 Bacteria 1718
702 Ga0495669_0386925 3300046684 Bacteria 677
703 Ga0495613_0050547 3300046689 Bacteria 3065
704 Ga0495624_0158258 3300046690 Bacteria 1384
705 Ga0495600_0000742 3300046809 Bacteria 17174
706 Ga0495600_0052886 3300046809 Bacteria 2652
707 Ga0495600_0424839 3300046809 Bacteria 824
708 Ga0495581_0038862 3300047315 Bacteria 2755
709 Ga0495604_0014112 3300047317 Bacteria 6370
710 Ga0495674_0020069 3300047319 Bacteria 6193
711 Ga0495676_0556255 3300047321 Bacteria 749
712 Ga0495680_0010686 3300047322 Bacteria 8187
713 Ga0495680_0018350 3300047322 Bacteria 5942
714 Ga0495680_0051288 3300047322 Bacteria 3222
715 Ga0495675_0047852 3300047444 Bacteria 2720
716 Ga0495675_0312852 3300047444 Bacteria 930
717 Ga0495677_0056502 3300047445 Bacteria 1450
718 Ga0495684_0147712 3300047471 Bacteria 1759
719 Ga0495593_0046887 3300047673 Bacteria 2302
720 Ga0495593_0127246 3300047673 Bacteria 1294
721 Ga0495602_0002995 3300048088 Bacteria 17317
722 Ga0495602_0205776 3300048088 Bacteria 1498
723 Ga0495602_1138817 3300048088 Bacteria 510
724 Ga0495614_0258948 3300048089 Bacteria 797
725 Ga0496100_0004611 3300048903 Bacteria 7325
726 Ga0496100_0015132 3300048903 Bacteria 4500
727 Ga0496100_0127627 3300048903 Bacteria 1787
728 Ga0496101_0002976 3300048904 Bacteria 10437
729 Ga0496101_0005327 3300048904 Bacteria 8192
730 Ga0496101_0814917 3300048904 Unclassified 736
731 Ga0496101_0816426 3300048904 Bacteria 735
732 Ga0496102_0013825 3300048905 Bacteria 7005
733 Ga0496102_0044088 3300048905 Bacteria 4047
734 Ga0496102_0085720 3300048905 Bacteria 2909
735 Ga0496102_0092433 3300048905 Bacteria 2801
736 Ga0496102_1521630 3300048905 Bacteria 588
737 Ga0496103_0005922 3300048906 Bacteria 7307
738 Ga0496103_0054581 3300048906 Bacteria 2477
739 Ga0496103_0129366 3300048906 Bacteria 1612
740 Ga0496103_0268591 3300048906 Bacteria 1097
741 Ga0496103_0445005 3300048906 Unclassified 831
742 Ga0496104_0004402 3300048907 Bacteria 12265
743 Ga0496104_0082923 3300048907 Bacteria 3058
744 Ga0496105_0018185 3300048908 Bacteria 5643
745 Ga0496105_0433909 3300048908 Bacteria 1039
746 Ga0496106_0007498 3300048909 Bacteria 8065
747 Ga0496106_0008091 3300048909 Bacteria 7767
748 Ga0496106_0129614 3300048909 Bacteria 1977
749 Ga0496106_0161071 3300048909 Bacteria 1774
750 Ga0496107_0016877 3300048910 Bacteria 5132
751 Ga0496107_0036310 3300048910 Bacteria 3534
752 Ga0496107_0042376 3300048910 Bacteria 3269
753 Ga0496107_1088131 3300048910 Bacteria 578
754 Ga0496108_0005285 3300048911 Bacteria 10421
755 Ga0496108_0040061 3300048911 Bacteria 3904
756 Ga0496108_0319815 3300048911 Bacteria 1353
757 Ga0496108_0634468 3300048911 Bacteria 929
758 Ga0496109_0000543 3300048912 Bacteria 31945
759 Ga0496109_0008460 3300048912 Bacteria 8746
760 Ga0496109_0039413 3300048912 Bacteria 4276
761 Ga0496110_0016819 3300048913 Bacteria 6111
762 Ga0496110_0072140 3300048913 Bacteria 3063
763 Ga0496110_0085742 3300048913 Bacteria 2811
764 Ga0496110_0139452 3300048913 Bacteria 2192
765 Ga0496110_0200388 3300048913 Bacteria 1813
766 Ga0496111_0025574 3300048914 Bacteria 4166
767 Ga0496111_0029448 3300048914 Bacteria 3900
768 Ga0496111_0162303 3300048914 Bacteria 1659
769 Ga0496111_0485367 3300048914 Bacteria 910
770 Ga0496112_0003072 3300048915 Bacteria 13667
771 Ga0496112_0083032 3300048915 Bacteria 3168
772 Ga0496112_0140244 3300048915 Bacteria 2387
773 Ga0496112_0355101 3300048915 Bacteria 1408
774 Ga0496112_0542833 3300048915 Bacteria 1097
775 Ga0496113_0021252 3300048916 Bacteria 4575
776 Ga0496113_0030289 3300048916 Bacteria 3917
777 Ga0496113_0118905 3300048916 Bacteria 2064
778 Ga0496113_0183715 3300048916 Bacteria 1658
779 Ga0496113_0753123 3300048916 Unclassified 775
780 Ga0496114_0510968 3300048917 Bacteria 1063
781 Ga0496115_0005720 3300048918 Bacteria 9050
782 Ga0496115_0009604 3300048918 Bacteria 7193
783 Ga0496115_0013470 3300048918 Bacteria 6187
784 Ga0496115_0035764 3300048918 Bacteria 3931
785 Ga0496115_0095238 3300048918 Bacteria 2436
786 Ga0496115_0802427 3300048918 Unclassified 732
787 Ga0501290_023607 3300049513 Bacteria 854
788 Ga0501046_0207514 3300049580 Bacteria 1455
789 Ga0501070_0667855 3300049586 Bacteria 824
790 Ga0501070_1009724 3300049586 Bacteria 645
791 Ga0501074_0058699 3300049590 Bacteria 2772
792 Ga0501075_0057288 3300049591 Bacteria 2934
793 Ga0501077_0077381 3300049593 Bacteria 2107
794 Ga0501077_0330782 3300049593 Bacteria 972
795 Ga0501238_061117 3300049671 Bacteria 575
796 Ga0501252_007217 3300049682 Bacteria 1254
797 Ga0501079_1403568 3300049741 Bacteria 549
798 Ga0501080_0119890 3300049742 Unclassified 2438
799 nmdc:mga03n38_376267_c1 3300050490 Bacteria 777
800 nmdc:mga09592_150274_c1 3300050508 Bacteria 2009
801 nmdc:mga09592_1574989_c1 3300050508 Bacteria 533
802 nmdc:mga06r32_445947_c1 3300050510 Bacteria 1274
803 nmdc:mga08y16_4145_c1 3300050511 Bacteria 15133
804 nmdc:mga0n895_115692_c1 3300050512 Bacteria 2700
805 nmdc:mga0n895_266438_c1 3300050512 Unclassified 1738
806 nmdc:mga0n895_4751_c1 3300050512 Bacteria 11226
807 nmdc:mga0n895_764754_c1 3300050512 Bacteria 958
808 nmdc:mga0rr50_17230_c1 3300050513 Bacteria 4817
809 nmdc:mga0rr50_42416_c1 3300050513 Bacteria 3322
810 nmdc:mga08x19_283728_c1 3300050514 Bacteria 1148
811 nmdc:mga08x19_647588_c1 3300050514 Bacteria 749
812 nmdc:mga08x19_836_c1 3300050514 Bacteria 19545
813 Ga0495601_0002457 3300053077 Bacteria 10527
814 Ga0495601_0006047 3300053077 Bacteria 7061
815 Ga0495612_0004300 3300053078 Bacteria 5912
816 Ga0495612_0012791 3300053078 Bacteria 3383
817 Ga0495595_0002370 3300053084 Bacteria 7343
818 Ga0495595_0004884 3300053084 Bacteria 5408
819 Ga0495619_0003606 3300053085 Bacteria 9972
820 Ga0495619_0004476 3300053085 Bacteria 8923
821 Ga0495619_0039955 3300053085 Bacteria 3064
822 Ga0500643_015533 3300053087 Bacteria 2607
823 Ga0500618_050808 3300053125 Bacteria 939
824 Ga0500616_0157618 3300053153 Bacteria 1044
825 Ga0501084_0256551 3300054114 Bacteria 1476
826 Ga0501084_0609379 3300054114 Bacteria 922
827 Ga0501082_0195408 3300060353 Bacteria 1760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_1046371 Ga0373925_1046371_52_456 119
2 3300035119 Ga0373956_0359398 Ga0373956_0359398_96_485 126
3 3300035172 Ga0373955_0799976 Ga0373955_0799976_96_485 126
4 3300036401 Ga0373937_0011937 Ga0373937_0011937_1079_1468 126
5 3300046679 Ga0495623_0162577 Ga0495623_0162577_90_479 126
6 3300035724 Ga0373933_0058259 Ga0373933_0058259_1013_1399 127
7 3300039437 Ga0436365_1657697 Ga0436365_1657697_99_500 129
8 3300049513 Ga0501290_023607 Ga0501290_023607_188_592 129
9 3300005293 Ga0065715_10390111 Ga0065715_103901112 131
10 3300005327 Ga0070658_10812213 Ga0070658_108122131 131
11 3300005335 Ga0070666_10593102 Ga0070666_105931021 131
12 3300005336 Ga0070680_101411609 Ga0070680_1014116091 131
13 3300005339 Ga0070660_100080982 Ga0070660_1000809822 131
14 3300005344 Ga0070661_100004323 Ga0070661_10000432312 131
15 3300005344 Ga0070661_101084605 Ga0070661_1010846051 131
16 3300005355 Ga0070671_100249224 Ga0070671_1002492242 131
17 3300005364 Ga0070673_101110781 Ga0070673_1011107812 131
18 3300005364 Ga0070673_101856597 Ga0070673_1018565971 131
19 3300005367 Ga0070667_100593223 Ga0070667_1005932231 131
20 3300005434 Ga0070709_10015243 Ga0070709_100152434 131
21 3300005434 Ga0070709_10081687 Ga0070709_100816871 131
22 3300005435 Ga0070714_100179077 Ga0070714_1001790772 131
23 3300005436 Ga0070713_100000012 Ga0070713_10000001251 131
24 3300005439 Ga0070711_100111375 Ga0070711_1001113751 131
25 3300005471 Ga0070698_101443563 Ga0070698_1014435631 131
26 3300005518 Ga0070699_100589986 Ga0070699_1005899861 131
27 3300005535 Ga0070684_100464266 Ga0070684_1004642662 131
28 3300005539 Ga0068853_100002793 Ga0068853_10000279315 131
29 3300005545 Ga0070695_100032902 Ga0070695_1000329022 131
30 3300005546 Ga0070696_100583789 Ga0070696_1005837892 131
31 3300005547 Ga0070693_100014668 Ga0070693_1000146683 131
32 3300005548 Ga0070665_100000157 Ga0070665_100000157104 131
33 3300005548 Ga0070665_100078063 Ga0070665_1000780632 131
34 3300005563 Ga0068855_101151644 Ga0068855_1011516442 131
35 3300005564 Ga0070664_100086902 Ga0070664_1000869021 131
36 3300005577 Ga0068857_100026843 Ga0068857_1000268432 131
37 3300005614 Ga0068856_100001210 Ga0068856_10000121022 131
38 3300005614 Ga0068856_100078356 Ga0068856_1000783563 131
39 3300005615 Ga0070702_101626769 Ga0070702_1016267691 131
40 3300005616 Ga0068852_100211425 Ga0068852_1002114252 131
41 3300005618 Ga0068864_101186828 Ga0068864_1011868281 131
42 3300005841 Ga0068863_100076285 Ga0068863_1000762852 131
43 3300005841 Ga0068863_100485610 Ga0068863_1004856102 131
44 3300005842 Ga0068858_100330898 Ga0068858_1003308982 131
45 3300006173 Ga0070716_100018353 Ga0070716_1000183534 131
46 3300006173 Ga0070716_100418950 Ga0070716_1004189502 131
47 3300006175 Ga0070712_100016744 Ga0070712_1000167443 131
48 3300006175 Ga0070712_100032887 Ga0070712_1000328875 131
49 3300006237 Ga0097621_100274900 Ga0097621_1002749002 131
50 3300006237 Ga0097621_101179577 Ga0097621_1011795771 131
51 3300006358 Ga0068871_100214734 Ga0068871_1002147342 131
52 3300006914 Ga0075436_100000426 Ga0075436_10000042622 131
53 3300006914 Ga0075436_100028231 Ga0075436_1000282312 131
54 3300006914 Ga0075436_100465411 Ga0075436_1004654112 131
55 3300007076 Ga0075435_100026536 Ga0075435_1000265364 131
56 3300009093 Ga0105240_10018775 Ga0105240_100187754 131
57 3300009093 Ga0105240_10541878 Ga0105240_105418783 131
58 3300009093 Ga0105240_10779198 Ga0105240_107791982 131
59 3300009174 Ga0105241_12005357 Ga0105241_120053571 131
60 3300009177 Ga0105248_11623458 Ga0105248_116234581 131
61 3300009545 Ga0105237_10001801 Ga0105237_100018014 131
62 3300009551 Ga0105238_10004248 Ga0105238_100042488 131
63 3300010375 Ga0105239_10267471 Ga0105239_102674712 131
64 3300010375 Ga0105239_10526121 Ga0105239_105261212 131
65 3300013100 Ga0157373_10011046 Ga0157373_100110464 131
66 3300013104 Ga0157370_10000832 Ga0157370_100008327 131
67 3300013296 Ga0157374_12134771 Ga0157374_121347712 131
68 3300013297 Ga0157378_10336913 Ga0157378_103369132 131
69 3300013306 Ga0163162_10416440 Ga0163162_104164402 131
70 3300013307 Ga0157372_10419050 Ga0157372_104190502 131
71 3300014325 Ga0163163_10143373 Ga0163163_101433732 131
72 3300014325 Ga0163163_10535745 Ga0163163_105357452 131
73 3300014968 Ga0157379_10094726 Ga0157379_100947263 131
74 3300014968 Ga0157379_10265766 Ga0157379_102657663 131
75 3300014968 Ga0157379_10445141 Ga0157379_104451412 131
76 3300025903 Ga0207680_10566024 Ga0207680_105660242 131
77 3300025906 Ga0207699_10012526 Ga0207699_100125263 131
78 3300025906 Ga0207699_10053089 Ga0207699_100530893 131
79 3300025911 Ga0207654_10055190 Ga0207654_100551902 131
80 3300025913 Ga0207695_10085826 Ga0207695_100858265 131
81 3300025913 Ga0207695_10534683 Ga0207695_105346832 131
82 3300025914 Ga0207671_10465240 Ga0207671_104652401 131
83 3300025915 Ga0207693_10001624 Ga0207693_1000162419 131
84 3300025915 Ga0207693_10003724 Ga0207693_100037243 131
85 3300025916 Ga0207663_10063043 Ga0207663_100630434 131
86 3300025916 Ga0207663_10189417 Ga0207663_101894172 131
87 3300025917 Ga0207660_10298926 Ga0207660_102989261 131
88 3300025920 Ga0207649_10000037 Ga0207649_1000003796 131
89 3300025920 Ga0207649_10231460 Ga0207649_102314602 131
90 3300025922 Ga0207646_10822098 Ga0207646_108220981 131
91 3300025924 Ga0207694_10088416 Ga0207694_100884162 131
92 3300025928 Ga0207700_10000058 Ga0207700_1000005837 131
93 3300025928 Ga0207700_10475083 Ga0207700_104750832 131
94 3300025929 Ga0207664_10156740 Ga0207664_101567402 131
95 3300025929 Ga0207664_11974379 Ga0207664_119743791 131
96 3300025931 Ga0207644_10230485 Ga0207644_102304852 131
97 3300025939 Ga0207665_10027408 Ga0207665_100274084 131
98 3300025941 Ga0207711_10070613 Ga0207711_100706132 131
99 3300025945 Ga0207679_10164353 Ga0207679_101643533 131
100 3300025960 Ga0207651_10675397 Ga0207651_106753972 131
101 3300026023 Ga0207677_10090314 Ga0207677_100903142 131
102 3300026035 Ga0207703_10157415 Ga0207703_101574152 131
103 3300026041 Ga0207639_10071634 Ga0207639_100716343 131
104 3300026041 Ga0207639_11458194 Ga0207639_114581941 131
105 3300026078 Ga0207702_10000045 Ga0207702_1000004532 131
106 3300026078 Ga0207702_10110858 Ga0207702_101108582 131
107 3300026088 Ga0207641_10075722 Ga0207641_100757222 131
108 3300026095 Ga0207676_10024942 Ga0207676_100249422 131
109 3300026095 Ga0207676_12297969 Ga0207676_122979692 131
110 3300026116 Ga0207674_10001401 Ga0207674_1000140111 131
111 3300028379 Ga0268266_10000003 Ga0268266_100000031687 131
112 3300028800 Ga0265338_10042419 Ga0265338_100424193 131
113 3300028800 Ga0265338_10539643 Ga0265338_105396432 131
114 3300031238 Ga0265332_10436705 Ga0265332_104367051 131
115 3300031241 Ga0265325_10000600 Ga0265325_1000060027 131
116 3300031249 Ga0265339_10401562 Ga0265339_104015621 131
117 3300031344 Ga0265316_10021352 Ga0265316_100213527 131
118 3300031344 Ga0265316_10092697 Ga0265316_100926972 131
119 3300031595 Ga0265313_10006817 Ga0265313_100068171 131
120 3300031712 Ga0265342_10172281 Ga0265342_101722812 131
121 3300031824 Ga0307413_10398590 Ga0307413_103985902 131
122 3300032004 Ga0307414_10300698 Ga0307414_103006983 131
123 3300035111 Ga0373923_0372536 Ga0373923_0372536_166_570 131
124 3300035170 Ga0373943_0129399 Ga0373943_0129399_355_759 131
125 3300035692 Ga0373935_0736019 Ga0373935_0736019_273_677 131
126 3300035724 Ga0373933_0361474 Ga0373933_0361474_34_438 131
127 3300035724 Ga0373933_0380565 Ga0373933_0380565_98_502 131
128 3300036401 Ga0373937_0005483 Ga0373937_0005483_208_612 131
129 3300037418 Ga0395900_0000002 Ga0395900_0000002_552507_552911 131
130 3300037466 Ga0395898_0030042 Ga0395898_0030042_3409_3813 131
131 3300037471 Ga0395905_0019957 Ga0395905_0019957_3271_3675 131
132 3300037853 Ga0436364_0567052 Ga0436364_0567052_232_636 131
133 3300038443 Ga0395901_0000013 Ga0395901_0000013_150874_151278 131
134 3300039447 Ga0436361_0621516 Ga0436361_0621516_17_421 131
135 3300046460 Ga0495638_0453726 Ga0495638_0453726_185_589 131
136 3300046471 Ga0495650_0082801 Ga0495650_0082801_325_729 131
137 3300046528 Ga0495642_0017498 Ga0495642_0017498_1960_2364 131
138 3300046616 Ga0495668_0255064 Ga0495668_0255064_336_740 131
139 3300046660 Ga0495625_0200083 Ga0495625_0200083_418_822 131
140 3300046660 Ga0495625_0381465 Ga0495625_0381465_97_501 131
141 3300046683 Ga0495658_0767441 Ga0495658_0767441_66_470 131
142 3300046684 Ga0495669_0386925 Ga0495669_0386925_217_621 131
143 3300048088 Ga0495602_1138817 Ga0495602_1138817_40_444 131
144 3300048903 Ga0496100_0127627 Ga0496100_0127627_884_1288 131
145 3300048904 Ga0496101_0816426 Ga0496101_0816426_32_436 131
146 3300048905 Ga0496102_0044088 Ga0496102_0044088_2937_3341 131
147 3300048905 Ga0496102_1521630 Ga0496102_1521630_83_487 131
148 3300048906 Ga0496103_0129366 Ga0496103_0129366_521_925 131
149 3300048907 Ga0496104_0082923 Ga0496104_0082923_1703_2107 131
150 3300048911 Ga0496108_0634468 Ga0496108_0634468_106_510 131
151 3300048912 Ga0496109_0039413 Ga0496109_0039413_1036_1440 131
152 3300048913 Ga0496110_0200388 Ga0496110_0200388_920_1324 131
153 3300048914 Ga0496111_0485367 Ga0496111_0485367_121_525 131
154 3300048915 Ga0496112_0083032 Ga0496112_0083032_1708_2112 131
155 3300048915 Ga0496112_0542833 Ga0496112_0542833_129_533 131
156 3300048916 Ga0496113_0118905 Ga0496113_0118905_1414_1818 131
157 3300048918 Ga0496115_0005720 Ga0496115_0005720_1721_2125 131
158 3300049580 Ga0501046_0207514 Ga0501046_0207514_818_1222 131
159 3300050490 nmdc:mga03n38_376267_c1 nmdc:mga03n38_376267_c1_221_625 131
160 3300050512 nmdc:mga0n895_115692_c1 nmdc:mga0n895_115692_c1_370_774 131
161 3300050512 nmdc:mga0n895_266438_c1 nmdc:mga0n895_266438_c1_309_713 131
162 3300050513 nmdc:mga0rr50_17230_c1 nmdc:mga0rr50_17230_c1_1679_2083 131
163 3300050513 nmdc:mga0rr50_42416_c1 nmdc:mga0rr50_42416_c1_2868_3272 131
164 3300050514 nmdc:mga08x19_283728_c1 nmdc:mga08x19_283728_c1_42_446 131
165 3300050514 nmdc:mga08x19_836_c1 nmdc:mga08x19_836_c1_14293_14697 131
166 iso_pu_bacteria 2508501050 2508727677 136
167 iso_pu_bacteria 2508501114 2509079881 136
168 iso_pu_bacteria 2773857925 2774869136 136
169 iso_pu_bacteria 2775506901 2776258406 136
170 iso_pu_bacteria 2835312727 2835319673 136
171 iso_pu_bacteria 2882456835 2882457635 136
172 iso_pu_bacteria 2884298095 2884301199 136
173 iso_pu_bacteria 2894232714 2894236143 136
174 3300031727 Ga0316576_10595996 Ga0316576_105959962 137
175 3300037068 Ga0373925_1589956 Ga0373925_1589956_35_454 137
176 3300039093 Ga0400489_56277 Ga0400489_56277_1728_2153 137
177 3300050514 nmdc:mga08x19_647588_c1 nmdc:mga08x19_647588_c1_92_514 138
178 3300005356 Ga0070674_100223967 Ga0070674_1002239672 139
179 3300005459 Ga0068867_100793056 Ga0068867_1007930562 139
180 3300005536 Ga0070697_101685632 Ga0070697_1016856322 139
181 3300005548 Ga0070665_100856036 Ga0070665_1008560362 139
182 3300006880 Ga0075429_100029763 Ga0075429_1000297632 139
183 3300009094 Ga0111539_10585087 Ga0111539_105850871 139
184 3300009148 Ga0105243_10216819 Ga0105243_102168192 139
185 3300009553 Ga0105249_10607224 Ga0105249_106072242 139
186 3300011119 Ga0105246_10841000 Ga0105246_108410002 139
187 3300014326 Ga0157380_10019743 Ga0157380_100197434 139
188 3300014745 Ga0157377_11046017 Ga0157377_110460172 139
189 3300025927 Ga0207687_10704318 Ga0207687_107043182 139
190 3300025961 Ga0207712_10483484 Ga0207712_104834842 139
191 3300025972 Ga0207668_10296384 Ga0207668_102963842 139
192 3300025981 Ga0207640_10650680 Ga0207640_106506802 139
193 3300026075 Ga0207708_10347840 Ga0207708_103478402 139
194 3300026089 Ga0207648_11423677 Ga0207648_114236771 139
195 3300031548 Ga0307408_100072949 Ga0307408_1000729492 139
196 3300031665 Ga0316575_10071072 Ga0316575_100710722 139
197 3300031728 Ga0316578_10208208 Ga0316578_102082082 139
198 3300031728 Ga0316578_10286107 Ga0316578_102861071 139
199 3300031728 Ga0316578_10342957 Ga0316578_103429572 139
200 3300031852 Ga0307410_10068033 Ga0307410_100680332 139
201 3300031903 Ga0307407_10007668 Ga0307407_100076682 139
202 3300031911 Ga0307412_10070809 Ga0307412_100708093 139
203 3300031995 Ga0307409_100018694 Ga0307409_1000186945 139
204 3300032002 Ga0307416_100071314 Ga0307416_1000713143 139
205 3300032004 Ga0307414_10233760 Ga0307414_102337602 139
206 3300032005 Ga0307411_10797125 Ga0307411_107971251 139
207 3300032126 Ga0307415_100007254 Ga0307415_1000072543 139
208 3300035398 Ga0316574_0057469 Ga0316574_0057469_1133_1564 139
209 3300039093 Ga0400489_13735 Ga0400489_13735_615_1043 139
210 3300044658 Ga0466972_0453199 Ga0466972_0453199_102_539 139
211 3300044901 Ga0466960_0104697 Ga0466960_0104697_555_989 139
212 3300045049 Ga0466959_0693512 Ga0466959_0693512_95_529 139
213 3300045976 Ga0466967_0632186 Ga0466967_0632186_336_764 139
214 3300046615 Ga0495656_0293316 Ga0495656_0293316_338_772 139
215 3300049671 Ga0501238_061117 Ga0501238_061117_41_475 139
216 3300049682 Ga0501252_007217 Ga0501252_007217_490_924 139
217 3300049741 Ga0501079_1403568 Ga0501079_1403568_104_526 139
218 3300050508 nmdc:mga09592_150274_c1 nmdc:mga09592_150274_c1_298_729 139
219 3300050510 nmdc:mga06r32_445947_c1 nmdc:mga06r32_445947_c1_549_980 139
220 3300053087 Ga0500643_015533 Ga0500643_015533_1553_1981 139
221 3300053153 Ga0500616_0157618 Ga0500616_0157618_338_772 139
222 iso_pu_bacteria 2897803580 2897806683 139
223 3300048910 Ga0496107_1088131 Ga0496107_1088131_98_529 140
224 3300048917 Ga0496114_0510968 Ga0496114_0510968_609_1037 140
225 3300049590 Ga0501074_0058699 Ga0501074_0058699_2314_2742 140
226 3300049742 Ga0501080_0119890 Ga0501080_0119890_868_1296 140
227 3300054114 Ga0501084_0609379 Ga0501084_0609379_231_659 140
228 3300025949 Ga0207667_10033582 Ga0207667_100335825 145
229 3300039437 Ga0436365_0691718 Ga0436365_0691718_71_511 145
230 2209111006 2214748018 2213758855 146
231 3300000042 ARSoilYngRDRAFT_c00630 ARSoilYngRDRAFT_006302 146
232 3300000043 ARcpr5yngRDRAFT_c000865 ARcpr5yngRDRAFT_0008652 146
233 3300000044 ARSoilOldRDRAFT_c000163 ARSoilOldRDRAFT_0001633 146
234 3300000652 ARCol0yngRDRAFT_1000023 ARCol0yngRDRAFT_100002330 146
235 3300001430 JGI24032J14994_102472 JGI24032J14994_1024721 146
236 3300001976 JGI24752J21851_1004962 JGI24752J21851_10049621 146
237 3300001977 JGI24746J21847_1001103 JGI24746J21847_10011032 146
238 3300001979 JGI24740J21852_10060130 JGI24740J21852_100601301 146
239 3300001989 JGI24739J22299_10000209 JGI24739J22299_1000020916 146
240 3300001990 JGI24737J22298_10000739 JGI24737J22298_100007397 146
241 3300001990 JGI24737J22298_10003173 JGI24737J22298_100031732 146
242 3300001991 JGI24743J22301_10029838 JGI24743J22301_100298382 146
243 3300002070 JGI24750J21931_1004243 JGI24750J21931_10042432 146
244 3300002070 JGI24750J21931_1047560 JGI24750J21931_10475601 146
245 3300002073 JGI24745J21846_1000377 JGI24745J21846_10003772 146
246 3300002074 JGI24748J21848_1004941 JGI24748J21848_10049411 146
247 3300002075 JGI24738J21930_10000520 JGI24738J21930_100005202 146
248 3300002076 JGI24749J21850_1000283 JGI24749J21850_10002833 146
249 3300002077 JGI24744J21845_10015850 JGI24744J21845_100158501 146
250 3300002077 JGI24744J21845_10078976 JGI24744J21845_100789761 146
251 3300002126 JGI24035J26624_1010270 JGI24035J26624_10102702 146
252 3300002239 JGI24034J26672_10012331 JGI24034J26672_100123312 146
253 3300002244 JGI24742J22300_10000279 JGI24742J22300_100002797 146
254 3300003911 JGI25405J52794_10116340 JGI25405J52794_101163401 146
255 3300005288 Ga0065714_10231999 Ga0065714_102319992 146
256 3300005289 Ga0065704_10102335 Ga0065704_101023352 146
257 3300005290 Ga0065712_10070789 Ga0065712_100707892 146
258 3300005293 Ga0065715_10099305 Ga0065715_100993052 146
259 3300005293 Ga0065715_10125489 Ga0065715_101254893 146
260 3300005328 Ga0070676_10002633 Ga0070676_100026337 146
261 3300005329 Ga0070683_100010864 Ga0070683_1000108643 146
262 3300005330 Ga0070690_100012955 Ga0070690_1000129554 146
263 3300005330 Ga0070690_100844279 Ga0070690_1008442792 146
264 3300005331 Ga0070670_100008185 Ga0070670_1000081853 146
265 3300005331 Ga0070670_100148297 Ga0070670_1001482972 146
266 3300005333 Ga0070677_10000109 Ga0070677_1000010915 146
267 3300005334 Ga0068869_100004148 Ga0068869_1000041487 146
268 3300005334 Ga0068869_100258341 Ga0068869_1002583412 146
269 3300005335 Ga0070666_10022824 Ga0070666_100228242 146
270 3300005335 Ga0070666_10143141 Ga0070666_101431412 146
271 3300005336 Ga0070680_100022932 Ga0070680_1000229323 146
272 3300005336 Ga0070680_100242970 Ga0070680_1002429702 146
273 3300005337 Ga0070682_100000459 Ga0070682_10000045918 146
274 3300005337 Ga0070682_100493834 Ga0070682_1004938342 146
275 3300005337 Ga0070682_100508390 Ga0070682_1005083902 146
276 3300005338 Ga0068868_100000443 Ga0068868_10000044323 146
277 3300005339 Ga0070660_100005284 Ga0070660_1000052843 146
278 3300005339 Ga0070660_100041218 Ga0070660_1000412184 146
279 3300005339 Ga0070660_100612727 Ga0070660_1006127271 146
280 3300005340 Ga0070689_100000423 Ga0070689_10000042311 146
281 3300005340 Ga0070689_100023357 Ga0070689_1000233574 146
282 3300005341 Ga0070691_10001927 Ga0070691_100019273 146
283 3300005341 Ga0070691_10006906 Ga0070691_100069065 146
284 3300005341 Ga0070691_10120243 Ga0070691_101202432 146
285 3300005343 Ga0070687_100008328 Ga0070687_1000083283 146
286 3300005344 Ga0070661_100003440 Ga0070661_1000034403 146
287 3300005344 Ga0070661_100088598 Ga0070661_1000885981 146
288 3300005345 Ga0070692_10000262 Ga0070692_100002626 146
289 3300005347 Ga0070668_100001027 Ga0070668_10000102715 146
290 3300005347 Ga0070668_100271025 Ga0070668_1002710252 146
291 3300005353 Ga0070669_100016848 Ga0070669_1000168483 146
292 3300005353 Ga0070669_100024237 Ga0070669_1000242374 146
293 3300005354 Ga0070675_100036920 Ga0070675_1000369203 146
294 3300005354 Ga0070675_100072259 Ga0070675_1000722592 146
295 3300005355 Ga0070671_100000889 Ga0070671_1000008894 146
296 3300005356 Ga0070674_100001251 Ga0070674_1000012519 146
297 3300005364 Ga0070673_100000050 Ga0070673_10000005041 146
298 3300005364 Ga0070673_100295228 Ga0070673_1002952282 146
299 3300005365 Ga0070688_100001640 Ga0070688_1000016405 146
300 3300005365 Ga0070688_100020856 Ga0070688_1000208563 146
301 3300005366 Ga0070659_100054851 Ga0070659_1000548513 146
302 3300005366 Ga0070659_100203138 Ga0070659_1002031382 146
303 3300005366 Ga0070659_101325279 Ga0070659_1013252791 146
304 3300005367 Ga0070667_100010954 Ga0070667_1000109546 146
305 3300005367 Ga0070667_100069382 Ga0070667_1000693822 146
306 3300005367 Ga0070667_100406486 Ga0070667_1004064862 146
307 3300005367 Ga0070667_100439211 Ga0070667_1004392112 146
308 3300005406 Ga0070703_10002811 Ga0070703_100028116 146
309 3300005406 Ga0070703_10028544 Ga0070703_100285442 146
310 3300005437 Ga0070710_10709619 Ga0070710_107096191 146
311 3300005438 Ga0070701_10000093 Ga0070701_100000939 146
312 3300005438 Ga0070701_10047371 Ga0070701_100473712 146
313 3300005439 Ga0070711_100020995 Ga0070711_1000209955 146
314 3300005440 Ga0070705_100003661 Ga0070705_1000036618 146
315 3300005441 Ga0070700_100007763 Ga0070700_1000077637 146
316 3300005441 Ga0070700_100021519 Ga0070700_1000215192 146
317 3300005444 Ga0070694_100005185 Ga0070694_1000051857 146
318 3300005445 Ga0070708_100020666 Ga0070708_1000206664 146
319 3300005445 Ga0070708_100218825 Ga0070708_1002188252 146
320 3300005455 Ga0070663_100002633 Ga0070663_1000026332 146
321 3300005455 Ga0070663_100031761 Ga0070663_1000317613 146
322 3300005455 Ga0070663_100134592 Ga0070663_1001345922 146
323 3300005456 Ga0070678_100022908 Ga0070678_1000229083 146
324 3300005456 Ga0070678_100033305 Ga0070678_1000333053 146
325 3300005456 Ga0070678_100612588 Ga0070678_1006125882 146
326 3300005457 Ga0070662_100015806 Ga0070662_1000158066 146
327 3300005457 Ga0070662_101313768 Ga0070662_1013137681 146
328 3300005458 Ga0070681_10001623 Ga0070681_1000162311 146
329 3300005458 Ga0070681_10069010 Ga0070681_100690102 146
330 3300005458 Ga0070681_10705590 Ga0070681_107055901 146
331 3300005458 Ga0070681_11004549 Ga0070681_110045492 146
332 3300005459 Ga0068867_100001138 Ga0068867_1000011389 146
333 3300005459 Ga0068867_100667403 Ga0068867_1006674032 146
334 3300005459 Ga0068867_100878849 Ga0068867_1008788492 146
335 3300005466 Ga0070685_10000984 Ga0070685_100009844 146
336 3300005466 Ga0070685_10114177 Ga0070685_101141772 146
337 3300005467 Ga0070706_100179090 Ga0070706_1001790902 146
338 3300005530 Ga0070679_100013850 Ga0070679_1000138504 146
339 3300005530 Ga0070679_101244613 Ga0070679_1012446131 146
340 3300005535 Ga0070684_100037719 Ga0070684_1000377193 146
341 3300005535 Ga0070684_100067840 Ga0070684_1000678401 146
342 3300005536 Ga0070697_100030045 Ga0070697_1000300455 146
343 3300005536 Ga0070697_100537695 Ga0070697_1005376952 146
344 3300005539 Ga0068853_100002995 Ga0068853_10000299510 146
345 3300005539 Ga0068853_100013300 Ga0068853_1000133005 146
346 3300005543 Ga0070672_100003943 Ga0070672_1000039438 146
347 3300005543 Ga0070672_100041581 Ga0070672_1000415813 146
348 3300005544 Ga0070686_100008091 Ga0070686_1000080912 146
349 3300005544 Ga0070686_100082965 Ga0070686_1000829652 146
350 3300005545 Ga0070695_100000824 Ga0070695_1000008243 146
351 3300005545 Ga0070695_100050648 Ga0070695_1000506482 146
352 3300005546 Ga0070696_100012369 Ga0070696_1000123696 146
353 3300005546 Ga0070696_100028235 Ga0070696_1000282353 146
354 3300005547 Ga0070693_100001975 Ga0070693_1000019757 146
355 3300005547 Ga0070693_100111912 Ga0070693_1001119121 146
356 3300005547 Ga0070693_100134965 Ga0070693_1001349652 146
357 3300005548 Ga0070665_100093184 Ga0070665_1000931842 146
358 3300005549 Ga0070704_100011005 Ga0070704_1000110057 146
359 3300005563 Ga0068855_100015755 Ga0068855_1000157556 146
360 3300005563 Ga0068855_100240618 Ga0068855_1002406182 146
361 3300005564 Ga0070664_100059292 Ga0070664_1000592923 146
362 3300005564 Ga0070664_100220741 Ga0070664_1002207412 146
363 3300005577 Ga0068857_100008305 Ga0068857_1000083056 146
364 3300005578 Ga0068854_100022991 Ga0068854_1000229913 146
365 3300005578 Ga0068854_100097524 Ga0068854_1000975242 146
366 3300005614 Ga0068856_100003821 Ga0068856_10000382112 146
367 3300005614 Ga0068856_100041409 Ga0068856_1000414091 146
368 3300005615 Ga0070702_100000497 Ga0070702_1000004978 146
369 3300005615 Ga0070702_100228403 Ga0070702_1002284032 146
370 3300005616 Ga0068852_100001222 Ga0068852_1000012228 146
371 3300005616 Ga0068852_100105348 Ga0068852_1001053482 146
372 3300005616 Ga0068852_101060942 Ga0068852_1010609422 146
373 3300005617 Ga0068859_100026376 Ga0068859_1000263762 146
374 3300005617 Ga0068859_100027984 Ga0068859_1000279846 146
375 3300005617 Ga0068859_100134641 Ga0068859_1001346413 146
376 3300005618 Ga0068864_100001074 Ga0068864_1000010747 146
377 3300005618 Ga0068864_100358925 Ga0068864_1003589251 146
378 3300005618 Ga0068864_100512744 Ga0068864_1005127442 146
379 3300005718 Ga0068866_10017244 Ga0068866_100172443 146
380 3300005718 Ga0068866_10143816 Ga0068866_101438162 146
381 3300005718 Ga0068866_10647985 Ga0068866_106479852 146
382 3300005719 Ga0068861_100001328 Ga0068861_10000132810 146
383 3300005840 Ga0068870_10000051 Ga0068870_1000005124 146
384 3300005841 Ga0068863_100008364 Ga0068863_1000083644 146
385 3300005842 Ga0068858_100005147 Ga0068858_1000051478 146
386 3300005842 Ga0068858_100108764 Ga0068858_1001087643 146
387 3300005843 Ga0068860_100001825 Ga0068860_10000182521 146
388 3300005843 Ga0068860_100021392 Ga0068860_1000213926 146
389 3300005843 Ga0068860_100560845 Ga0068860_1005608452 146
390 3300005844 Ga0068862_100017904 Ga0068862_1000179047 146
391 3300005937 Ga0081455_10000081 Ga0081455_1000008126 146
392 3300006048 Ga0075363_100159594 Ga0075363_1001595942 146
393 3300006163 Ga0070715_10007047 Ga0070715_100070474 146
394 3300006175 Ga0070712_100927247 Ga0070712_1009272471 146
395 3300006237 Ga0097621_100001496 Ga0097621_1000014967 146
396 3300006237 Ga0097621_100016302 Ga0097621_1000163024 146
397 3300006358 Ga0068871_100000576 Ga0068871_10000057626 146
398 3300006358 Ga0068871_100021574 Ga0068871_1000215744 146
399 3300006871 Ga0075434_100008056 Ga0075434_1000080567 146
400 3300006871 Ga0075434_100941695 Ga0075434_1009416951 146
401 3300006881 Ga0068865_100003854 Ga0068865_1000038547 146
402 3300006881 Ga0068865_100010914 Ga0068865_1000109145 146
403 3300006881 Ga0068865_100322155 Ga0068865_1003221552 146
404 3300006914 Ga0075436_100271937 Ga0075436_1002719372 146
405 3300006931 Ga0097620_100026376 Ga0097620_1000263762 146
406 3300006931 Ga0097620_100027983 Ga0097620_1000279832 146
407 3300006931 Ga0097620_100134638 Ga0097620_1001346383 146
408 3300007076 Ga0075435_100292029 Ga0075435_1002920292 146
409 3300009036 Ga0105244_10084313 Ga0105244_100843132 146
410 3300009093 Ga0105240_10218962 Ga0105240_102189622 146
411 3300009093 Ga0105240_10584149 Ga0105240_105841492 146
412 3300009094 Ga0111539_10000757 Ga0111539_1000075725 146
413 3300009098 Ga0105245_10002488 Ga0105245_100024888 146
414 3300009098 Ga0105245_10189127 Ga0105245_101891272 146
415 3300009101 Ga0105247_10004963 Ga0105247_100049633 146
416 3300009101 Ga0105247_10009138 Ga0105247_100091382 146
417 3300009101 Ga0105247_10270153 Ga0105247_102701531 146
418 3300009101 Ga0105247_10487898 Ga0105247_104878982 146
419 3300009148 Ga0105243_10003214 Ga0105243_100032147 146
420 3300009148 Ga0105243_10063065 Ga0105243_100630652 146
421 3300009148 Ga0105243_10071314 Ga0105243_100713142 146
422 3300009174 Ga0105241_10013069 Ga0105241_100130696 146
423 3300009174 Ga0105241_10082049 Ga0105241_100820493 146
424 3300009174 Ga0105241_10137051 Ga0105241_101370512 146
425 3300009176 Ga0105242_10002016 Ga0105242_100020162 146
426 3300009177 Ga0105248_10003871 Ga0105248_100038717 146
427 3300009177 Ga0105248_10018471 Ga0105248_100184715 146
428 3300009177 Ga0105248_10148475 Ga0105248_101484752 146
429 3300009177 Ga0105248_10296617 Ga0105248_102966172 146
430 3300009545 Ga0105237_10024783 Ga0105237_100247833 146
431 3300009545 Ga0105237_10025451 Ga0105237_100254516 146
432 3300009551 Ga0105238_10133598 Ga0105238_101335982 146
433 3300009551 Ga0105238_10137144 Ga0105238_101371442 146
434 3300009553 Ga0105249_10001193 Ga0105249_100011936 146
435 3300009553 Ga0105249_10020158 Ga0105249_100201586 146
436 3300009553 Ga0105249_10236960 Ga0105249_102369602 146
437 3300010375 Ga0105239_10030616 Ga0105239_100306162 146
438 3300010375 Ga0105239_10712648 Ga0105239_107126482 146
439 3300010375 Ga0105239_10789373 Ga0105239_107893732 146
440 3300011119 Ga0105246_10000231 Ga0105246_100002317 146
441 3300011119 Ga0105246_10509445 Ga0105246_105094452 146
442 3300012498 Ga0157345_1016400 Ga0157345_10164001 146
443 3300012507 Ga0157342_1000445 Ga0157342_10004453 146
444 3300012513 Ga0157326_1003345 Ga0157326_10033452 146
445 3300012515 Ga0157338_1000781 Ga0157338_10007812 146
446 3300013102 Ga0157371_10013762 Ga0157371_100137626 146
447 3300013102 Ga0157371_10215226 Ga0157371_102152262 146
448 3300013102 Ga0157371_11538920 Ga0157371_115389201 146
449 3300013104 Ga0157370_10246046 Ga0157370_102460462 146
450 3300013105 Ga0157369_10469673 Ga0157369_104696732 146
451 3300013296 Ga0157374_10035420 Ga0157374_100354202 146
452 3300013296 Ga0157374_10037940 Ga0157374_100379405 146
453 3300013296 Ga0157374_11320734 Ga0157374_113207341 146
454 3300013297 Ga0157378_10022746 Ga0157378_100227464 146
455 3300013297 Ga0157378_10095614 Ga0157378_100956143 146
456 3300013297 Ga0157378_10149112 Ga0157378_101491122 146
457 3300013306 Ga0163162_10006149 Ga0163162_100061497 146
458 3300013306 Ga0163162_10117622 Ga0163162_101176222 146
459 3300013306 Ga0163162_10122467 Ga0163162_101224673 146
460 3300013306 Ga0163162_12223522 Ga0163162_122235222 146
461 3300013307 Ga0157372_10025465 Ga0157372_100254652 146
462 3300013307 Ga0157372_11542789 Ga0157372_115427891 146
463 3300013308 Ga0157375_10021653 Ga0157375_100216536 146
464 3300013308 Ga0157375_10304086 Ga0157375_103040862 146
465 3300014325 Ga0163163_10001320 Ga0163163_1000132017 146
466 3300014325 Ga0163163_10032310 Ga0163163_100323105 146
467 3300014325 Ga0163163_12197028 Ga0163163_121970281 146
468 3300014326 Ga0157380_10002744 Ga0157380_100027446 146
469 3300014326 Ga0157380_10047959 Ga0157380_100479593 146
470 3300014745 Ga0157377_10000164 Ga0157377_1000016425 146
471 3300014745 Ga0157377_10100198 Ga0157377_101001982 146
472 3300014968 Ga0157379_10012672 Ga0157379_100126728 146
473 3300014968 Ga0157379_10291614 Ga0157379_102916142 146
474 3300014968 Ga0157379_10374963 Ga0157379_103749632 146
475 3300014969 Ga0157376_10002102 Ga0157376_100021027 146
476 3300014969 Ga0157376_10009727 Ga0157376_100097275 146
477 3300014969 Ga0157376_10079367 Ga0157376_100793671 146
478 3300017792 Ga0163161_10002837 Ga0163161_100028377 146
479 3300021384 Ga0213876_10263921 Ga0213876_102639212 146
480 3300025271 Ga0207666_1000051 Ga0207666_100005118 146
481 3300025271 Ga0207666_1006768 Ga0207666_10067682 146
482 3300025290 Ga0207673_1000958 Ga0207673_10009584 146
483 3300025315 Ga0207697_10000662 Ga0207697_1000066216 146
484 3300025315 Ga0207697_10006653 Ga0207697_100066535 146
485 3300025728 Ga0207655_1070435 Ga0207655_10704352 146
486 3300025885 Ga0207653_10000546 Ga0207653_1000054610 146
487 3300025885 Ga0207653_10013666 Ga0207653_100136662 146
488 3300025893 Ga0207682_10000072 Ga0207682_1000007223 146
489 3300025898 Ga0207692_10027923 Ga0207692_100279232 146
490 3300025899 Ga0207642_10010607 Ga0207642_100106073 146
491 3300025899 Ga0207642_10075738 Ga0207642_100757383 146
492 3300025899 Ga0207642_10208714 Ga0207642_102087142 146
493 3300025900 Ga0207710_10009082 Ga0207710_100090825 146
494 3300025900 Ga0207710_10137418 Ga0207710_101374181 146
495 3300025900 Ga0207710_10223636 Ga0207710_102236362 146
496 3300025900 Ga0207710_10329954 Ga0207710_103299541 146
497 3300025901 Ga0207688_10000229 Ga0207688_1000022923 146
498 3300025901 Ga0207688_10020259 Ga0207688_100202592 146
499 3300025903 Ga0207680_10025714 Ga0207680_100257143 146
500 3300025904 Ga0207647_10003353 Ga0207647_1000335310 146
501 3300025904 Ga0207647_10019233 Ga0207647_100192334 146
502 3300025905 Ga0207685_10039891 Ga0207685_100398912 146
503 3300025907 Ga0207645_10000966 Ga0207645_1000096622 146
504 3300025908 Ga0207643_10000004 Ga0207643_1000000448 146
505 3300025910 Ga0207684_10126441 Ga0207684_101264412 146
506 3300025911 Ga0207654_10001472 Ga0207654_100014726 146
507 3300025912 Ga0207707_10010417 Ga0207707_100104179 146
508 3300025912 Ga0207707_10026555 Ga0207707_100265554 146
509 3300025913 Ga0207695_10284678 Ga0207695_102846782 146
510 3300025913 Ga0207695_10596992 Ga0207695_105969922 146
511 3300025914 Ga0207671_10026742 Ga0207671_100267424 146
512 3300025915 Ga0207693_10028672 Ga0207693_100286722 146
513 3300025915 Ga0207693_10417378 Ga0207693_104173782 146
514 3300025916 Ga0207663_10093512 Ga0207663_100935122 146
515 3300025916 Ga0207663_10236502 Ga0207663_102365021 146
516 3300025917 Ga0207660_10000648 Ga0207660_100006488 146
517 3300025917 Ga0207660_10083840 Ga0207660_100838402 146
518 3300025917 Ga0207660_10144095 Ga0207660_101440952 146
519 3300025918 Ga0207662_10000317 Ga0207662_1000031718 146
520 3300025918 Ga0207662_10007326 Ga0207662_100073262 146
521 3300025919 Ga0207657_10002047 Ga0207657_1000204718 146
522 3300025919 Ga0207657_10049663 Ga0207657_100496634 146
523 3300025919 Ga0207657_10057207 Ga0207657_100572075 146
524 3300025920 Ga0207649_10000262 Ga0207649_1000026223 146
525 3300025921 Ga0207652_10045204 Ga0207652_100452044 146
526 3300025921 Ga0207652_10391323 Ga0207652_103913232 146
527 3300025922 Ga0207646_10987405 Ga0207646_109874051 146
528 3300025923 Ga0207681_10025833 Ga0207681_100258334 146
529 3300025923 Ga0207681_10042994 Ga0207681_100429943 146
530 3300025924 Ga0207694_10230136 Ga0207694_102301362 146
531 3300025925 Ga0207650_10004313 Ga0207650_100043139 146
532 3300025925 Ga0207650_10141954 Ga0207650_101419542 146
533 3300025926 Ga0207659_10001684 Ga0207659_100016847 146
534 3300025927 Ga0207687_10001501 Ga0207687_1000150110 146
535 3300025931 Ga0207644_10000467 Ga0207644_1000046722 146
536 3300025932 Ga0207690_10001228 Ga0207690_1000122810 146
537 3300025933 Ga0207706_10001679 Ga0207706_100016796 146
538 3300025933 Ga0207706_10009690 Ga0207706_100096905 146
539 3300025933 Ga0207706_10066033 Ga0207706_100660333 146
540 3300025934 Ga0207686_10006089 Ga0207686_100060892 146
541 3300025934 Ga0207686_10325675 Ga0207686_103256752 146
542 3300025935 Ga0207709_10006275 Ga0207709_100062754 146
543 3300025935 Ga0207709_10013556 Ga0207709_100135565 146
544 3300025935 Ga0207709_10026438 Ga0207709_100264383 146
545 3300025936 Ga0207670_10014641 Ga0207670_100146415 146
546 3300025936 Ga0207670_10063548 Ga0207670_100635482 146
547 3300025936 Ga0207670_10175747 Ga0207670_101757472 146
548 3300025937 Ga0207669_10002049 Ga0207669_1000204910 146
549 3300025937 Ga0207669_10341629 Ga0207669_103416292 146
550 3300025937 Ga0207669_10490369 Ga0207669_104903692 146
551 3300025937 Ga0207669_11075571 Ga0207669_110755711 146
552 3300025938 Ga0207704_10003529 Ga0207704_100035295 146
553 3300025939 Ga0207665_10172346 Ga0207665_101723461 146
554 3300025940 Ga0207691_10002874 Ga0207691_100028746 146
555 3300025940 Ga0207691_10061507 Ga0207691_100615072 146
556 3300025940 Ga0207691_10318936 Ga0207691_103189362 146
557 3300025941 Ga0207711_10006776 Ga0207711_100067766 146
558 3300025941 Ga0207711_10025537 Ga0207711_100255372 146
559 3300025941 Ga0207711_10190335 Ga0207711_101903353 146
560 3300025941 Ga0207711_10320427 Ga0207711_103204272 146
561 3300025942 Ga0207689_10000203 Ga0207689_1000020324 146
562 3300025942 Ga0207689_10235266 Ga0207689_102352662 146
563 3300025944 Ga0207661_10012457 Ga0207661_100124572 146
564 3300025944 Ga0207661_10276806 Ga0207661_102768062 146
565 3300025945 Ga0207679_10000157 Ga0207679_1000015732 146
566 3300025945 Ga0207679_10082307 Ga0207679_100823073 146
567 3300025945 Ga0207679_10383000 Ga0207679_103830002 146
568 3300025949 Ga0207667_10815216 Ga0207667_108152162 146
569 3300025960 Ga0207651_10006717 Ga0207651_100067176 146
570 3300025961 Ga0207712_10002224 Ga0207712_100022248 146
571 3300025972 Ga0207668_10003217 Ga0207668_100032174 146
572 3300025972 Ga0207668_10216753 Ga0207668_102167532 146
573 3300025981 Ga0207640_10004454 Ga0207640_100044546 146
574 3300025981 Ga0207640_10309405 Ga0207640_103094052 146
575 3300025986 Ga0207658_10027932 Ga0207658_100279323 146
576 3300025986 Ga0207658_10159306 Ga0207658_101593062 146
577 3300025986 Ga0207658_10531504 Ga0207658_105315042 146
578 3300026023 Ga0207677_10001675 Ga0207677_100016756 146
579 3300026035 Ga0207703_10001852 Ga0207703_1000185219 146
580 3300026035 Ga0207703_10033946 Ga0207703_100339462 146
581 3300026035 Ga0207703_10479003 Ga0207703_104790032 146
582 3300026041 Ga0207639_10084659 Ga0207639_100846592 146
583 3300026041 Ga0207639_10401737 Ga0207639_104017372 146
584 3300026067 Ga0207678_10001809 Ga0207678_1000180916 146
585 3300026067 Ga0207678_10012723 Ga0207678_100127236 146
586 3300026067 Ga0207678_10082363 Ga0207678_100823634 146
587 3300026067 Ga0207678_10598988 Ga0207678_105989882 146
588 3300026075 Ga0207708_10001199 Ga0207708_1000119916 146
589 3300026075 Ga0207708_10003067 Ga0207708_100030678 146
590 3300026078 Ga0207702_10003404 Ga0207702_100034049 146
591 3300026078 Ga0207702_10060437 Ga0207702_100604372 146
592 3300026088 Ga0207641_10023651 Ga0207641_100236513 146
593 3300026088 Ga0207641_10595331 Ga0207641_105953312 146
594 3300026088 Ga0207641_10747655 Ga0207641_107476552 146
595 3300026089 Ga0207648_10002073 Ga0207648_100020736 146
596 3300026089 Ga0207648_10133046 Ga0207648_101330462 146
597 3300026095 Ga0207676_10000990 Ga0207676_1000099015 146
598 3300026095 Ga0207676_10270696 Ga0207676_102706962 146
599 3300026095 Ga0207676_10439308 Ga0207676_104393082 146
600 3300026095 Ga0207676_11557231 Ga0207676_115572311 146
601 3300026116 Ga0207674_10000897 Ga0207674_100008976 146
602 3300026118 Ga0207675_100001726 Ga0207675_10000172618 146
603 3300026118 Ga0207675_100076333 Ga0207675_1000763332 146
604 3300026118 Ga0207675_101458828 Ga0207675_1014588282 146
605 3300026121 Ga0207683_10001176 Ga0207683_100011769 146
606 3300026121 Ga0207683_10020527 Ga0207683_100205274 146
607 3300026121 Ga0207683_10561411 Ga0207683_105614112 146
608 3300026121 Ga0207683_10845913 Ga0207683_108459132 146
609 3300026142 Ga0207698_10003743 Ga0207698_100037438 146
610 3300027364 Ga0209967_1015249 Ga0209967_10152491 146
611 3300027617 Ga0210002_1008815 Ga0210002_10088152 146
612 3300027665 Ga0209983_1005259 Ga0209983_10052592 146
613 3300027682 Ga0209971_1017323 Ga0209971_10173232 146
614 3300027682 Ga0209971_1033085 Ga0209971_10330852 146
615 3300027695 Ga0209966_1000247 Ga0209966_100024715 146
616 3300027717 Ga0209998_10002233 Ga0209998_100022333 146
617 3300027717 Ga0209998_10002778 Ga0209998_100027782 146
618 3300027876 Ga0209974_10015951 Ga0209974_100159512 146
619 3300027876 Ga0209974_10053834 Ga0209974_100538342 146
620 3300027876 Ga0209974_10131583 Ga0209974_101315831 146
621 3300027907 Ga0207428_10000792 Ga0207428_1000079230 146
622 3300028379 Ga0268266_10033993 Ga0268266_100339933 146
623 3300028380 Ga0268265_10002187 Ga0268265_100021872 146
624 3300028380 Ga0268265_10225652 Ga0268265_102256523 146
625 3300028381 Ga0268264_10018562 Ga0268264_100185626 146
626 3300028381 Ga0268264_10104372 Ga0268264_101043722 146
627 3300028381 Ga0268264_10464861 Ga0268264_104648612 146
628 3300031247 Ga0265340_10025762 Ga0265340_100257623 146
629 3300034816 Ga0373930_0000250 Ga0373930_0000250_6249_6689 146
630 3300034816 Ga0373930_0003593 Ga0373930_0003593_1188_1628 146
631 3300034817 Ga0373948_0000061 Ga0373948_0000061_5264_5704 146
632 3300034817 Ga0373948_0016450 Ga0373948_0016450_542_982 146
633 3300034818 Ga0373950_0000537 Ga0373950_0000537_2584_3024 146
634 3300034818 Ga0373950_0004026 Ga0373950_0004026_775_1215 146
635 3300034819 Ga0373958_0000048 Ga0373958_0000048_1913_2353 146
636 3300034819 Ga0373958_0000826 Ga0373958_0000826_248_688 146
637 3300034820 Ga0373959_0000735 Ga0373959_0000735_3159_3599 146
638 3300034957 Ga0373938_0000471 Ga0373938_0000471_1930_2370 146
639 3300034957 Ga0373938_0000691 Ga0373938_0000691_4588_5028 146
640 3300035083 Ga0373926_0016674 Ga0373926_0016674_844_1284 146
641 3300035084 Ga0373928_0005735 Ga0373928_0005735_1910_2350 146
642 3300035085 Ga0373929_0000096 Ga0373929_0000096_2412_2852 146
643 3300035085 Ga0373929_0003497 Ga0373929_0003497_1543_1983 146
644 3300035086 Ga0373934_0207910 Ga0373934_0207910_256_696 146
645 3300035088 Ga0373940_0000023 Ga0373940_0000023_10475_10915 146
646 3300035088 Ga0373940_0043859 Ga0373940_0043859_303_743 146
647 3300035089 Ga0373944_0028788 Ga0373944_0028788_166_606 146
648 3300035090 Ga0373949_0001146 Ga0373949_0001146_1371_1811 146
649 3300035090 Ga0373949_0001755 Ga0373949_0001755_3596_4036 146
650 3300035091 Ga0373951_0000876 Ga0373951_0000876_2050_2490 146
651 3300035091 Ga0373951_0012771 Ga0373951_0012771_792_1232 146
652 3300035091 Ga0373951_0034363 Ga0373951_0034363_228_668 146
653 3300035092 Ga0373952_0000126 Ga0373952_0000126_6189_6629 146
654 3300035092 Ga0373952_0004467 Ga0373952_0004467_1476_1916 146
655 3300035111 Ga0373923_0033921 Ga0373923_0033921_1333_1773 146
656 3300035111 Ga0373923_0066067 Ga0373923_0066067_103_543 146
657 3300035112 Ga0373932_0000553 Ga0373932_0000553_8585_9025 146
658 3300035112 Ga0373932_0016039 Ga0373932_0016039_867_1307 146
659 3300035113 Ga0373936_0148732 Ga0373936_0148732_157_597 146
660 3300035114 Ga0373939_0000419 Ga0373939_0000419_4210_4650 146
661 3300035114 Ga0373939_0000663 Ga0373939_0000663_1372_1812 146
662 3300035115 Ga0373941_0000309 Ga0373941_0000309_3126_3566 146
663 3300035115 Ga0373941_0005456 Ga0373941_0005456_668_1108 146
664 3300035116 Ga0373945_0305703 Ga0373945_0305703_188_628 146
665 3300035118 Ga0373954_0004588 Ga0373954_0004588_4222_4662 146
666 3300035118 Ga0373954_0048635 Ga0373954_0048635_1010_1450 146
667 3300035119 Ga0373956_0060571 Ga0373956_0060571_1096_1536 146
668 3300035120 Ga0373957_0130326 Ga0373957_0130326_306_746 146
669 3300035121 Ga0373960_0002985 Ga0373960_0002985_876_1316 146
670 3300035121 Ga0373960_0017748 Ga0373960_0017748_99_539 146
671 3300035170 Ga0373943_0064807 Ga0373943_0064807_1217_1657 146
672 3300035172 Ga0373955_0017482 Ga0373955_0017482_1196_1636 146
673 3300035172 Ga0373955_0018792 Ga0373955_0018792_1767_2207 146
674 3300035172 Ga0373955_0242846 Ga0373955_0242846_196_636 146
675 3300035207 Ga0373942_0000081 Ga0373942_0000081_13974_14414 146
676 3300035207 Ga0373942_0005488 Ga0373942_0005488_21_461 146
677 3300035207 Ga0373942_0284926 Ga0373942_0284926_41_481 146
678 3300035241 Ga0373961_0010016 Ga0373961_0010016_970_1410 146
679 3300035242 Ga0373962_0000194 Ga0373962_0000194_7810_8250 146
680 3300035242 Ga0373962_0001329 Ga0373962_0001329_1344_1784 146
681 3300035242 Ga0373962_0279718 Ga0373962_0279718_15_455 146
682 3300035410 Ga0373924_0043119 Ga0373924_0043119_299_739 146
683 3300035691 Ga0373931_0001008 Ga0373931_0001008_9078_9518 146
684 3300035691 Ga0373931_0160221 Ga0373931_0160221_515_955 146
685 3300035692 Ga0373935_0077953 Ga0373935_0077953_116_556 146
686 3300035692 Ga0373935_0102433 Ga0373935_0102433_691_1131 146
687 3300035695 Ga0373927_0300442 Ga0373927_0300442_188_628 146
688 3300035724 Ga0373933_0000753 Ga0373933_0000753_11301_11741 146
689 3300035724 Ga0373933_0004608 Ga0373933_0004608_798_1238 146
690 3300036401 Ga0373937_0000655 Ga0373937_0000655_52_492 146
691 3300036401 Ga0373937_0012043 Ga0373937_0012043_2387_2827 146
692 3300037068 Ga0373925_0649210 Ga0373925_0649210_304_744 146
693 3300037068 Ga0373925_0759213 Ga0373925_0759213_89_529 146
694 3300039437 Ga0436365_0144344 Ga0436365_0144344_7096_7536 146
695 3300039450 Ga0436363_0327641 Ga0436363_0327641_81_533 146
696 3300042005 Ga0439448_0181842 Ga0439448_0181842_232_672 146
697 3300042012 Ga0439455_0011926 Ga0439455_0011926_412_852 146
698 3300042016 Ga0439463_015735 Ga0439463_015735_1358_1798 146
699 3300042157 Ga0439458_0113433 Ga0439458_0113433_203_643 146
700 3300042437 Ga0439444_0144195 Ga0439444_0144195_17_457 146
701 3300042439 Ga0439464_0045011 Ga0439464_0045011_239_679 146
702 3300042876 Ga0451577_0120856 Ga0451577_0120856_851_1291 146
703 3300044712 Ga0453684_0223027 Ga0453684_0223027_1663_2103 146
704 3300045051 Ga0451576_0006650 Ga0451576_0006650_7086_7526 146
705 3300046454 Ga0495592_0067596 Ga0495592_0067596_1885_2325 146
706 3300046455 Ga0495603_0028204 Ga0495603_0028204_2004_2444 146
707 3300046461 Ga0495641_0041535 Ga0495641_0041535_1069_1509 146
708 3300046462 Ga0495651_0048616 Ga0495651_0048616_1926_2366 146
709 3300046462 Ga0495651_0133324 Ga0495651_0133324_285_725 146
710 3300046463 Ga0495653_0003231 Ga0495653_0003231_7567_8007 146
711 3300046463 Ga0495653_0108077 Ga0495653_0108077_392_832 146
712 3300046463 Ga0495653_0225385 Ga0495653_0225385_104_544 146
713 3300046472 Ga0495580_0151887 Ga0495580_0151887_822_1262 146
714 3300046473 Ga0495582_0539890 Ga0495582_0539890_50_490 146
715 3300046475 Ga0495639_0011384 Ga0495639_0011384_1180_1620 146
716 3300046476 Ga0495662_0029637 Ga0495662_0029637_535_975 146
717 3300046477 Ga0495664_0002327 Ga0495664_0002327_5761_6201 146
718 3300046477 Ga0495664_0052695 Ga0495664_0052695_761_1201 146
719 3300046491 Ga0495584_0198216 Ga0495584_0198216_526_966 146
720 3300046499 Ga0495594_0050759 Ga0495594_0050759_1389_1829 146
721 3300046511 Ga0495608_0000428 Ga0495608_0000428_4301_4741 146
722 3300046511 Ga0495608_0056952 Ga0495608_0056952_827_1267 146
723 3300046514 Ga0495618_0022993 Ga0495618_0022993_912_1352 146
724 3300046516 Ga0495628_0065732 Ga0495628_0065732_1154_1594 146
725 3300046518 Ga0495631_0289900 Ga0495631_0289900_180_620 146
726 3300046529 Ga0495652_0110912 Ga0495652_0110912_957_1397 146
727 3300046529 Ga0495652_0113198 Ga0495652_0113198_1242_1682 146
728 3300046531 Ga0495665_0344311 Ga0495665_0344311_273_713 146
729 3300046533 Ga0495640_0028613 Ga0495640_0028613_2693_3133 146
730 3300046533 Ga0495640_0167247 Ga0495640_0167247_453_893 146
731 3300046535 Ga0495586_0013401 Ga0495586_0013401_3204_3644 146
732 3300046535 Ga0495586_0038131 Ga0495586_0038131_2050_2490 146
733 3300046536 Ga0495587_0001490 Ga0495587_0001490_6068_6508 146
734 3300046536 Ga0495587_0038051 Ga0495587_0038051_1404_1844 146
735 3300046543 Ga0495645_0046734 Ga0495645_0046734_1561_2001 146
736 3300046559 Ga0495667_0034314 Ga0495667_0034314_1150_1590 146
737 3300046559 Ga0495667_0163059 Ga0495667_0163059_209_649 146
738 3300046642 Ga0495634_0141103 Ga0495634_0141103_993_1433 146
739 3300046642 Ga0495634_0309440 Ga0495634_0309440_212_652 146
740 3300046663 Ga0495635_0004055 Ga0495635_0004055_2534_2974 146
741 3300046675 Ga0495657_0008984 Ga0495657_0008984_2626_3066 146
742 3300046675 Ga0495657_0068961 Ga0495657_0068961_583_1023 146
743 3300046678 Ga0495599_0062738 Ga0495599_0062738_1513_1953 146
744 3300046678 Ga0495599_0220644 Ga0495599_0220644_16_456 146
745 3300046679 Ga0495623_0003897 Ga0495623_0003897_5443_5883 146
746 3300046680 Ga0495646_0003693 Ga0495646_0003693_469_909 146
747 3300046683 Ga0495658_0147172 Ga0495658_0147172_781_1221 146
748 3300046684 Ga0495669_0060091 Ga0495669_0060091_397_837 146
749 3300046689 Ga0495613_0050547 Ga0495613_0050547_453_893 146
750 3300046690 Ga0495624_0158258 Ga0495624_0158258_265_705 146
751 3300046809 Ga0495600_0000742 Ga0495600_0000742_686_1126 146
752 3300046809 Ga0495600_0052886 Ga0495600_0052886_1643_2083 146
753 3300046809 Ga0495600_0424839 Ga0495600_0424839_55_495 146
754 3300047315 Ga0495581_0038862 Ga0495581_0038862_673_1113 146
755 3300047317 Ga0495604_0014112 Ga0495604_0014112_3880_4320 146
756 3300047319 Ga0495674_0020069 Ga0495674_0020069_4654_5094 146
757 3300047321 Ga0495676_0556255 Ga0495676_0556255_299_739 146
758 3300047322 Ga0495680_0010686 Ga0495680_0010686_7029_7469 146
759 3300047322 Ga0495680_0018350 Ga0495680_0018350_148_588 146
760 3300047322 Ga0495680_0051288 Ga0495680_0051288_1700_2140 146
761 3300047444 Ga0495675_0047852 Ga0495675_0047852_912_1352 146
762 3300047444 Ga0495675_0312852 Ga0495675_0312852_360_800 146
763 3300047445 Ga0495677_0056502 Ga0495677_0056502_78_518 146
764 3300047471 Ga0495684_0147712 Ga0495684_0147712_292_732 146
765 3300047673 Ga0495593_0046887 Ga0495593_0046887_673_1113 146
766 3300047673 Ga0495593_0127246 Ga0495593_0127246_377_817 146
767 3300048088 Ga0495602_0002995 Ga0495602_0002995_5597_6037 146
768 3300048088 Ga0495602_0205776 Ga0495602_0205776_871_1311 146
769 3300048089 Ga0495614_0258948 Ga0495614_0258948_63_503 146
770 3300048903 Ga0496100_0004611 Ga0496100_0004611_6333_6773 146
771 3300048903 Ga0496100_0015132 Ga0496100_0015132_1112_1552 146
772 3300048904 Ga0496101_0002976 Ga0496101_0002976_5106_5546 146
773 3300048904 Ga0496101_0005327 Ga0496101_0005327_7355_7795 146
774 3300048904 Ga0496101_0814917 Ga0496101_0814917_196_636 146
775 3300048905 Ga0496102_0013825 Ga0496102_0013825_3746_4186 146
776 3300048905 Ga0496102_0085720 Ga0496102_0085720_1824_2264 146
777 3300048905 Ga0496102_0092433 Ga0496102_0092433_1416_1856 146
778 3300048906 Ga0496103_0005922 Ga0496103_0005922_6128_6568 146
779 3300048906 Ga0496103_0054581 Ga0496103_0054581_1795_2235 146
780 3300048906 Ga0496103_0268591 Ga0496103_0268591_93_533 146
781 3300048906 Ga0496103_0445005 Ga0496103_0445005_203_643 146
782 3300048907 Ga0496104_0004402 Ga0496104_0004402_9452_9892 146
783 3300048908 Ga0496105_0018185 Ga0496105_0018185_2629_3069 146
784 3300048908 Ga0496105_0433909 Ga0496105_0433909_348_788 146
785 3300048909 Ga0496106_0007498 Ga0496106_0007498_2913_3353 146
786 3300048909 Ga0496106_0008091 Ga0496106_0008091_4176_4616 146
787 3300048909 Ga0496106_0129614 Ga0496106_0129614_1001_1441 146
788 3300048909 Ga0496106_0161071 Ga0496106_0161071_1073_1513 146
789 3300048910 Ga0496107_0016877 Ga0496107_0016877_2937_3377 146
790 3300048910 Ga0496107_0036310 Ga0496107_0036310_2803_3243 146
791 3300048910 Ga0496107_0042376 Ga0496107_0042376_2586_3026 146
792 3300048911 Ga0496108_0005285 Ga0496108_0005285_5327_5767 146
793 3300048911 Ga0496108_0040061 Ga0496108_0040061_2153_2593 146
794 3300048911 Ga0496108_0319815 Ga0496108_0319815_528_968 146
795 3300048912 Ga0496109_0000543 Ga0496109_0000543_13963_14403 146
796 3300048912 Ga0496109_0008460 Ga0496109_0008460_7450_7890 146
797 3300048913 Ga0496110_0016819 Ga0496110_0016819_3696_4136 146
798 3300048913 Ga0496110_0072140 Ga0496110_0072140_827_1267 146
799 3300048913 Ga0496110_0085742 Ga0496110_0085742_1167_1607 146
800 3300048913 Ga0496110_0139452 Ga0496110_0139452_230_670 146
801 3300048914 Ga0496111_0025574 Ga0496111_0025574_1587_2027 146
802 3300048914 Ga0496111_0029448 Ga0496111_0029448_2486_2926 146
803 3300048914 Ga0496111_0162303 Ga0496111_0162303_1169_1609 146
804 3300048915 Ga0496112_0003072 Ga0496112_0003072_10466_10906 146
805 3300048915 Ga0496112_0140244 Ga0496112_0140244_1159_1599 146
806 3300048915 Ga0496112_0355101 Ga0496112_0355101_303_743 146
807 3300048916 Ga0496113_0021252 Ga0496113_0021252_2577_3017 146
808 3300048916 Ga0496113_0030289 Ga0496113_0030289_3446_3886 146
809 3300048916 Ga0496113_0183715 Ga0496113_0183715_1098_1538 146
810 3300048916 Ga0496113_0753123 Ga0496113_0753123_258_698 146
811 3300048918 Ga0496115_0009604 Ga0496115_0009604_1347_1787 146
812 3300048918 Ga0496115_0013470 Ga0496115_0013470_985_1425 146
813 3300048918 Ga0496115_0035764 Ga0496115_0035764_997_1437 146
814 3300048918 Ga0496115_0095238 Ga0496115_0095238_673_1113 146
815 3300048918 Ga0496115_0802427 Ga0496115_0802427_73_513 146
816 3300049586 Ga0501070_0667855 Ga0501070_0667855_142_594 146
817 3300049586 Ga0501070_1009724 Ga0501070_1009724_69_509 146
818 3300049591 Ga0501075_0057288 Ga0501075_0057288_709_1149 146
819 3300049593 Ga0501077_0077381 Ga0501077_0077381_910_1350 146
820 3300049593 Ga0501077_0330782 Ga0501077_0330782_487_927 146
821 3300050508 nmdc:mga09592_1574989_c1 nmdc:mga09592_1574989_c1_36_476 146
822 3300050511 nmdc:mga08y16_4145_c1 nmdc:mga08y16_4145_c1_11147_11587 146
823 3300050512 nmdc:mga0n895_4751_c1 nmdc:mga0n895_4751_c1_7363_7803 146
824 3300050512 nmdc:mga0n895_764754_c1 nmdc:mga0n895_764754_c1_25_465 146
825 3300053077 Ga0495601_0002457 Ga0495601_0002457_3917_4357 146
826 3300053077 Ga0495601_0006047 Ga0495601_0006047_5871_6311 146
827 3300053078 Ga0495612_0004300 Ga0495612_0004300_3130_3570 146
828 3300053078 Ga0495612_0012791 Ga0495612_0012791_2664_3104 146
829 3300053084 Ga0495595_0002370 Ga0495595_0002370_4160_4600 146
830 3300053084 Ga0495595_0004884 Ga0495595_0004884_4608_5048 146
831 3300053085 Ga0495619_0003606 Ga0495619_0003606_307_747 146
832 3300053085 Ga0495619_0004476 Ga0495619_0004476_1725_2165 146
833 3300053085 Ga0495619_0039955 Ga0495619_0039955_895_1335 146
834 3300053125 Ga0500618_050808 Ga0500618_050808_237_677 146
835 3300054114 Ga0501084_0256551 Ga0501084_0256551_768_1208 146
836 3300060353 Ga0501082_0195408 Ga0501082_0195408_429_869 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

132

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8202 10 130
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8135 6 130
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7904 6 130
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.7876 10 130
2pjs-assembly1.cif.gz_B crystal structure of atu1953, protein of unknown function 0.7402 79 129
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8533 77 130 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8441 77 128 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.817 77 139 3.30.720.110
3rheA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8125 10 130 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8055 77 131 3.30.720.110
ID Description Score Start End GO Terms
AF-K2AJS8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9949 77 146 GO:0051213
AF-A0A653AYW7-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9926 77 132 GO:0051213
AF-N9MQE2-F1-model_v4 VOC domain-containing protein 0.988 79 132
AF-A0A7W0G7P7-F1-model_v4 VOC family protein 0.9859 81 144
AF-A0A3C0FM12-F1-model_v4 Glyoxalase 0.9841 80 145

Feature Viewer

pLDDT pTM Quality
92.87 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map