F482896
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 409 | 827 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0327641|Ga0436363_0327641_81_533 |
| Length | 150 |
| Sequence | MNTETALPEGNLSLVTLGVASLQRSIAFYETLGFKRKAKASDGVGFFKAGACAIAVWPSEELAKDANFANEGMAESFRGVALAWNCRSKGDVDKVIKRAKSAGAVVRKPAQDVFWGGYSGYFADLDGHLWEVAYNPHFPMAEDGRLEIPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 5 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 6 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 7 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 8 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 9 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 10 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 11 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 12 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 14 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 15 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 16 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 17 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 22 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 23 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 24 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 28 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 29 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 30 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 31 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 137 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 139 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 245 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 247 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 259 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 262 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 263 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 264 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 266 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 276 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 281 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 287 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 288 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 289 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 296 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 297 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 298 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 301 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 302 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 303 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 304 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 305 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 306 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 307 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 308 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 309 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 310 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 311 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 312 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 313 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 385 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 391 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 395 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 406 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 408 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 0 |
| Isolates | 1.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.6 |
| Nodule | 0.48 |
| Rhizoplane | 7.42 |
| Rhizosphere | 90.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214748018 | 2209111006 | Bacteria | 3411 |
| 2 | ARSoilYngRDRAFT_c00630 | 3300000042 | Bacteria | 3581 |
| 3 | ARcpr5yngRDRAFT_c000865 | 3300000043 | Bacteria | 3587 |
| 4 | ARSoilOldRDRAFT_c000163 | 3300000044 | Bacteria | 11284 |
| 5 | ARCol0yngRDRAFT_1000023 | 3300000652 | Bacteria | 28722 |
| 6 | JGI24032J14994_102472 | 3300001430 | Unclassified | 658 |
| 7 | JGI24752J21851_1004962 | 3300001976 | Bacteria | 1740 |
| 8 | JGI24746J21847_1001103 | 3300001977 | Bacteria | 4246 |
| 9 | JGI24740J21852_10060130 | 3300001979 | Unclassified | 1051 |
| 10 | JGI24739J22299_10000209 | 3300001989 | Bacteria | 19461 |
| 11 | JGI24737J22298_10000739 | 3300001990 | Bacteria | 11509 |
| 12 | JGI24737J22298_10003173 | 3300001990 | Bacteria | 5839 |
| 13 | JGI24743J22301_10029838 | 3300001991 | Unclassified | 1071 |
| 14 | JGI24750J21931_1004243 | 3300002070 | Bacteria | 1731 |
| 15 | JGI24750J21931_1047560 | 3300002070 | Bacteria | 663 |
| 16 | JGI24745J21846_1000377 | 3300002073 | Bacteria | 3904 |
| 17 | JGI24748J21848_1004941 | 3300002074 | Bacteria | 1538 |
| 18 | JGI24738J21930_10000520 | 3300002075 | Bacteria | 10976 |
| 19 | JGI24749J21850_1000283 | 3300002076 | Bacteria | 7793 |
| 20 | JGI24744J21845_10015850 | 3300002077 | Bacteria | 1503 |
| 21 | JGI24744J21845_10078976 | 3300002077 | Bacteria | 601 |
| 22 | JGI24035J26624_1010270 | 3300002126 | Unclassified | 929 |
| 23 | JGI24034J26672_10012331 | 3300002239 | Bacteria | 1287 |
| 24 | JGI24742J22300_10000279 | 3300002244 | Bacteria | 7687 |
| 25 | JGI25405J52794_10116340 | 3300003911 | Unclassified | 601 |
| 26 | Ga0065714_10231999 | 3300005288 | Bacteria | 814 |
| 27 | Ga0065704_10102335 | 3300005289 | Bacteria | 2209 |
| 28 | Ga0065712_10070789 | 3300005290 | Bacteria | 5705 |
| 29 | Ga0065715_10099305 | 3300005293 | Bacteria | 3429 |
| 30 | Ga0065715_10125489 | 3300005293 | Bacteria | 2129 |
| 31 | Ga0065715_10390111 | 3300005293 | Bacteria | 895 |
| 32 | Ga0070658_10812213 | 3300005327 | Bacteria | 812 |
| 33 | Ga0070676_10002633 | 3300005328 | Bacteria | 9237 |
| 34 | Ga0070683_100010864 | 3300005329 | Bacteria | 7839 |
| 35 | Ga0070690_100012955 | 3300005330 | Bacteria | 4917 |
| 36 | Ga0070690_100844279 | 3300005330 | Bacteria | 713 |
| 37 | Ga0070670_100008185 | 3300005331 | Bacteria | 8903 |
| 38 | Ga0070670_100148297 | 3300005331 | Bacteria | 2030 |
| 39 | Ga0070677_10000109 | 3300005333 | Bacteria | 26990 |
| 40 | Ga0068869_100004148 | 3300005334 | Bacteria | 8986 |
| 41 | Ga0068869_100258341 | 3300005334 | Bacteria | 1394 |
| 42 | Ga0070666_10022824 | 3300005335 | Bacteria | 4067 |
| 43 | Ga0070666_10143141 | 3300005335 | Bacteria | 1666 |
| 44 | Ga0070666_10593102 | 3300005335 | Bacteria | 808 |
| 45 | Ga0070680_100022932 | 3300005336 | Bacteria | 4974 |
| 46 | Ga0070680_100242970 | 3300005336 | Bacteria | 1522 |
| 47 | Ga0070680_101411609 | 3300005336 | Bacteria | 603 |
| 48 | Ga0070682_100000459 | 3300005337 | Bacteria | 25698 |
| 49 | Ga0070682_100493834 | 3300005337 | Bacteria | 947 |
| 50 | Ga0070682_100508390 | 3300005337 | Bacteria | 935 |
| 51 | Ga0068868_100000443 | 3300005338 | Bacteria | 27815 |
| 52 | Ga0070660_100005284 | 3300005339 | Bacteria | 8931 |
| 53 | Ga0070660_100041218 | 3300005339 | Bacteria | 3519 |
| 54 | Ga0070660_100080982 | 3300005339 | Bacteria | 2548 |
| 55 | Ga0070660_100612727 | 3300005339 | Bacteria | 911 |
| 56 | Ga0070689_100000423 | 3300005340 | Bacteria | 24943 |
| 57 | Ga0070689_100023357 | 3300005340 | Bacteria | 4628 |
| 58 | Ga0070691_10001927 | 3300005341 | Bacteria | 9119 |
| 59 | Ga0070691_10006906 | 3300005341 | Bacteria | 5193 |
| 60 | Ga0070691_10120243 | 3300005341 | Bacteria | 1322 |
| 61 | Ga0070687_100008328 | 3300005343 | Bacteria | 4385 |
| 62 | Ga0070661_100003440 | 3300005344 | Bacteria | 10933 |
| 63 | Ga0070661_100004323 | 3300005344 | Bacteria | 9801 |
| 64 | Ga0070661_100088598 | 3300005344 | Bacteria | 2291 |
| 65 | Ga0070661_101084605 | 3300005344 | Bacteria | 667 |
| 66 | Ga0070692_10000262 | 3300005345 | Bacteria | 14685 |
| 67 | Ga0070668_100001027 | 3300005347 | Bacteria | 19571 |
| 68 | Ga0070668_100271025 | 3300005347 | Bacteria | 1415 |
| 69 | Ga0070669_100016848 | 3300005353 | Bacteria | 5216 |
| 70 | Ga0070669_100024237 | 3300005353 | Bacteria | 4350 |
| 71 | Ga0070675_100036920 | 3300005354 | Bacteria | 3978 |
| 72 | Ga0070675_100072259 | 3300005354 | Bacteria | 2864 |
| 73 | Ga0070671_100000889 | 3300005355 | Bacteria | 21815 |
| 74 | Ga0070671_100249224 | 3300005355 | Bacteria | 1508 |
| 75 | Ga0070674_100001251 | 3300005356 | Bacteria | 13361 |
| 76 | Ga0070674_100223967 | 3300005356 | Bacteria | 1464 |
| 77 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 78 | Ga0070673_100295228 | 3300005364 | Bacteria | 1425 |
| 79 | Ga0070673_101110781 | 3300005364 | Bacteria | 739 |
| 80 | Ga0070673_101856597 | 3300005364 | Bacteria | 571 |
| 81 | Ga0070688_100001640 | 3300005365 | Bacteria | 11206 |
| 82 | Ga0070688_100020856 | 3300005365 | Bacteria | 3818 |
| 83 | Ga0070659_100054851 | 3300005366 | Bacteria | 3140 |
| 84 | Ga0070659_100203138 | 3300005366 | Bacteria | 1632 |
| 85 | Ga0070659_101325279 | 3300005366 | Unclassified | 639 |
| 86 | Ga0070667_100010954 | 3300005367 | Bacteria | 7498 |
| 87 | Ga0070667_100069382 | 3300005367 | Bacteria | 2999 |
| 88 | Ga0070667_100406486 | 3300005367 | Bacteria | 1240 |
| 89 | Ga0070667_100439211 | 3300005367 | Bacteria | 1191 |
| 90 | Ga0070667_100593223 | 3300005367 | Bacteria | 1020 |
| 91 | Ga0070703_10002811 | 3300005406 | Bacteria | 4987 |
| 92 | Ga0070703_10028544 | 3300005406 | Bacteria | 1669 |
| 93 | Ga0070709_10015243 | 3300005434 | Bacteria | 4368 |
| 94 | Ga0070709_10081687 | 3300005434 | Bacteria | 2110 |
| 95 | Ga0070714_100179077 | 3300005435 | Bacteria | 1928 |
| 96 | Ga0070713_100000012 | 3300005436 | Bacteria | 137708 |
| 97 | Ga0070710_10709619 | 3300005437 | Unclassified | 710 |
| 98 | Ga0070701_10000093 | 3300005438 | Bacteria | 25004 |
| 99 | Ga0070701_10047371 | 3300005438 | Bacteria | 2214 |
| 100 | Ga0070711_100020995 | 3300005439 | Bacteria | 4218 |
| 101 | Ga0070711_100111375 | 3300005439 | Bacteria | 2010 |
| 102 | Ga0070705_100003661 | 3300005440 | Bacteria | 7526 |
| 103 | Ga0070700_100007763 | 3300005441 | Bacteria | 5812 |
| 104 | Ga0070700_100021519 | 3300005441 | Bacteria | 3749 |
| 105 | Ga0070694_100005185 | 3300005444 | Bacteria | 7865 |
| 106 | Ga0070708_100020666 | 3300005445 | Bacteria | 5558 |
| 107 | Ga0070708_100218825 | 3300005445 | Bacteria | 1786 |
| 108 | Ga0070663_100002633 | 3300005455 | Bacteria | 10158 |
| 109 | Ga0070663_100031761 | 3300005455 | Bacteria | 3632 |
| 110 | Ga0070663_100134592 | 3300005455 | Bacteria | 1881 |
| 111 | Ga0070678_100022908 | 3300005456 | Bacteria | 4151 |
| 112 | Ga0070678_100033305 | 3300005456 | Bacteria | 3576 |
| 113 | Ga0070678_100612588 | 3300005456 | Bacteria | 973 |
| 114 | Ga0070662_100015806 | 3300005457 | Bacteria | 5061 |
| 115 | Ga0070662_101313768 | 3300005457 | Unclassified | 622 |
| 116 | Ga0070681_10001623 | 3300005458 | Bacteria | 20035 |
| 117 | Ga0070681_10069010 | 3300005458 | Bacteria | 3501 |
| 118 | Ga0070681_10705590 | 3300005458 | Bacteria | 925 |
| 119 | Ga0070681_11004549 | 3300005458 | Bacteria | 754 |
| 120 | Ga0068867_100001138 | 3300005459 | Bacteria | 18176 |
| 121 | Ga0068867_100667403 | 3300005459 | Bacteria | 914 |
| 122 | Ga0068867_100793056 | 3300005459 | Bacteria | 844 |
| 123 | Ga0068867_100878849 | 3300005459 | Bacteria | 805 |
| 124 | Ga0070685_10000984 | 3300005466 | Bacteria | 15313 |
| 125 | Ga0070685_10114177 | 3300005466 | Bacteria | 1669 |
| 126 | Ga0070706_100179090 | 3300005467 | Bacteria | 1979 |
| 127 | Ga0070698_101443563 | 3300005471 | Archaea | 639 |
| 128 | Ga0070699_100589986 | 3300005518 | Bacteria | 1013 |
| 129 | Ga0070679_100013850 | 3300005530 | Bacteria | 7727 |
| 130 | Ga0070679_101244613 | 3300005530 | Bacteria | 690 |
| 131 | Ga0070684_100037719 | 3300005535 | Bacteria | 4147 |
| 132 | Ga0070684_100067840 | 3300005535 | Bacteria | 3134 |
| 133 | Ga0070684_100464266 | 3300005535 | Bacteria | 1171 |
| 134 | Ga0070697_100030045 | 3300005536 | Bacteria | 4363 |
| 135 | Ga0070697_100537695 | 3300005536 | Bacteria | 1024 |
| 136 | Ga0070697_101685632 | 3300005536 | Bacteria | 567 |
| 137 | Ga0068853_100002793 | 3300005539 | Bacteria | 13203 |
| 138 | Ga0068853_100002995 | 3300005539 | Bacteria | 12889 |
| 139 | Ga0068853_100013300 | 3300005539 | Bacteria | 6719 |
| 140 | Ga0070672_100003943 | 3300005543 | Bacteria | 9675 |
| 141 | Ga0070672_100041581 | 3300005543 | Bacteria | 3534 |
| 142 | Ga0070686_100008091 | 3300005544 | Bacteria | 5875 |
| 143 | Ga0070686_100082965 | 3300005544 | Bacteria | 2127 |
| 144 | Ga0070695_100000824 | 3300005545 | Bacteria | 16725 |
| 145 | Ga0070695_100032902 | 3300005545 | Bacteria | 3242 |
| 146 | Ga0070695_100050648 | 3300005545 | Bacteria | 2662 |
| 147 | Ga0070696_100012369 | 3300005546 | Bacteria | 5726 |
| 148 | Ga0070696_100028235 | 3300005546 | Bacteria | 3827 |
| 149 | Ga0070696_100583789 | 3300005546 | Bacteria | 899 |
| 150 | Ga0070693_100001975 | 3300005547 | Bacteria | 9380 |
| 151 | Ga0070693_100014668 | 3300005547 | Bacteria | 4021 |
| 152 | Ga0070693_100111912 | 3300005547 | Bacteria | 1681 |
| 153 | Ga0070693_100134965 | 3300005547 | Bacteria | 1547 |
| 154 | Ga0070665_100000157 | 3300005548 | Bacteria | 124344 |
| 155 | Ga0070665_100078063 | 3300005548 | Bacteria | 3318 |
| 156 | Ga0070665_100093184 | 3300005548 | Bacteria | 3017 |
| 157 | Ga0070665_100856036 | 3300005548 | Bacteria | 922 |
| 158 | Ga0070704_100011005 | 3300005549 | Bacteria | 5520 |
| 159 | Ga0068855_100015755 | 3300005563 | Bacteria | 9093 |
| 160 | Ga0068855_100240618 | 3300005563 | Bacteria | 2023 |
| 161 | Ga0068855_101151644 | 3300005563 | Bacteria | 808 |
| 162 | Ga0070664_100059292 | 3300005564 | Bacteria | 3256 |
| 163 | Ga0070664_100086902 | 3300005564 | Bacteria | 2702 |
| 164 | Ga0070664_100220741 | 3300005564 | Bacteria | 1696 |
| 165 | Ga0068857_100008305 | 3300005577 | Bacteria | 8971 |
| 166 | Ga0068857_100026843 | 3300005577 | Bacteria | 5078 |
| 167 | Ga0068854_100022991 | 3300005578 | Bacteria | 4254 |
| 168 | Ga0068854_100097524 | 3300005578 | Bacteria | 2198 |
| 169 | Ga0068856_100001210 | 3300005614 | Bacteria | 27080 |
| 170 | Ga0068856_100003821 | 3300005614 | Bacteria | 15095 |
| 171 | Ga0068856_100041409 | 3300005614 | Bacteria | 4527 |
| 172 | Ga0068856_100078356 | 3300005614 | Bacteria | 3276 |
| 173 | Ga0070702_100000497 | 3300005615 | Bacteria | 14109 |
| 174 | Ga0070702_100228403 | 3300005615 | Bacteria | 1249 |
| 175 | Ga0070702_101626769 | 3300005615 | Bacteria | 535 |
| 176 | Ga0068852_100001222 | 3300005616 | Bacteria | 17091 |
| 177 | Ga0068852_100105348 | 3300005616 | Bacteria | 2555 |
| 178 | Ga0068852_100211425 | 3300005616 | Bacteria | 1840 |
| 179 | Ga0068852_101060942 | 3300005616 | Unclassified | 830 |
| 180 | Ga0068859_100026376 | 3300005617 | Bacteria | 5826 |
| 181 | Ga0068859_100027984 | 3300005617 | Bacteria | 5651 |
| 182 | Ga0068859_100134641 | 3300005617 | Bacteria | 2543 |
| 183 | Ga0068864_100001074 | 3300005618 | Bacteria | 22938 |
| 184 | Ga0068864_100358925 | 3300005618 | Bacteria | 1377 |
| 185 | Ga0068864_100512744 | 3300005618 | Unclassified | 1155 |
| 186 | Ga0068864_101186828 | 3300005618 | Bacteria | 761 |
| 187 | Ga0068866_10017244 | 3300005718 | Bacteria | 3244 |
| 188 | Ga0068866_10143816 | 3300005718 | Bacteria | 1373 |
| 189 | Ga0068866_10647985 | 3300005718 | Unclassified | 719 |
| 190 | Ga0068861_100001328 | 3300005719 | Bacteria | 15509 |
| 191 | Ga0068870_10000051 | 3300005840 | Bacteria | 36782 |
| 192 | Ga0068863_100008364 | 3300005841 | Bacteria | 10106 |
| 193 | Ga0068863_100076285 | 3300005841 | Bacteria | 3171 |
| 194 | Ga0068863_100485610 | 3300005841 | Bacteria | 1215 |
| 195 | Ga0068858_100005147 | 3300005842 | Bacteria | 12813 |
| 196 | Ga0068858_100108764 | 3300005842 | Bacteria | 2588 |
| 197 | Ga0068858_100330898 | 3300005842 | Bacteria | 1457 |
| 198 | Ga0068860_100001825 | 3300005843 | Bacteria | 22684 |
| 199 | Ga0068860_100021392 | 3300005843 | Bacteria | 6263 |
| 200 | Ga0068860_100560845 | 3300005843 | Bacteria | 1145 |
| 201 | Ga0068862_100017904 | 3300005844 | Bacteria | 5899 |
| 202 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 203 | Ga0075363_100159594 | 3300006048 | Bacteria | 1276 |
| 204 | Ga0070715_10007047 | 3300006163 | Bacteria | 3851 |
| 205 | Ga0070716_100018353 | 3300006173 | Bacteria | 3643 |
| 206 | Ga0070716_100418950 | 3300006173 | Bacteria | 968 |
| 207 | Ga0070712_100016744 | 3300006175 | Bacteria | 4739 |
| 208 | Ga0070712_100032887 | 3300006175 | Bacteria | 3505 |
| 209 | Ga0070712_100927247 | 3300006175 | Unclassified | 752 |
| 210 | Ga0097621_100001496 | 3300006237 | Bacteria | 16030 |
| 211 | Ga0097621_100016302 | 3300006237 | Bacteria | 5613 |
| 212 | Ga0097621_100274900 | 3300006237 | Bacteria | 1481 |
| 213 | Ga0097621_101179577 | 3300006237 | Bacteria | 721 |
| 214 | Ga0068871_100000576 | 3300006358 | Bacteria | 25122 |
| 215 | Ga0068871_100021574 | 3300006358 | Bacteria | 4952 |
| 216 | Ga0068871_100214734 | 3300006358 | Bacteria | 1665 |
| 217 | Ga0075434_100008056 | 3300006871 | Bacteria | 9773 |
| 218 | Ga0075434_100941695 | 3300006871 | Bacteria | 878 |
| 219 | Ga0075429_100029763 | 3300006880 | Bacteria | 4744 |
| 220 | Ga0068865_100003854 | 3300006881 | Bacteria | 8992 |
| 221 | Ga0068865_100010914 | 3300006881 | Bacteria | 5669 |
| 222 | Ga0068865_100322155 | 3300006881 | Bacteria | 1244 |
| 223 | Ga0075436_100000426 | 3300006914 | Bacteria | 27028 |
| 224 | Ga0075436_100028231 | 3300006914 | Bacteria | 3860 |
| 225 | Ga0075436_100271937 | 3300006914 | Bacteria | 1210 |
| 226 | Ga0075436_100465411 | 3300006914 | Bacteria | 922 |
| 227 | Ga0097620_100026376 | 3300006931 | Bacteria | 5826 |
| 228 | Ga0097620_100027983 | 3300006931 | Bacteria | 5651 |
| 229 | Ga0097620_100134638 | 3300006931 | Bacteria | 2543 |
| 230 | Ga0075435_100026536 | 3300007076 | Bacteria | 4521 |
| 231 | Ga0075435_100292029 | 3300007076 | Bacteria | 1393 |
| 232 | Ga0105244_10084313 | 3300009036 | Bacteria | 1570 |
| 233 | Ga0105240_10018775 | 3300009093 | Bacteria | 9264 |
| 234 | Ga0105240_10218962 | 3300009093 | Bacteria | 2219 |
| 235 | Ga0105240_10541878 | 3300009093 | Bacteria | 1288 |
| 236 | Ga0105240_10584149 | 3300009093 | Bacteria | 1232 |
| 237 | Ga0105240_10779198 | 3300009093 | Bacteria | 1037 |
| 238 | Ga0111539_10000757 | 3300009094 | Bacteria | 42016 |
| 239 | Ga0111539_10585087 | 3300009094 | Bacteria | 1300 |
| 240 | Ga0105245_10002488 | 3300009098 | Bacteria | 16638 |
| 241 | Ga0105245_10189127 | 3300009098 | Bacteria | 1971 |
| 242 | Ga0105247_10004963 | 3300009101 | Bacteria | 8458 |
| 243 | Ga0105247_10009138 | 3300009101 | Bacteria | 6032 |
| 244 | Ga0105247_10270153 | 3300009101 | Unclassified | 1169 |
| 245 | Ga0105247_10487898 | 3300009101 | Bacteria | 895 |
| 246 | Ga0105243_10003214 | 3300009148 | Bacteria | 13370 |
| 247 | Ga0105243_10063065 | 3300009148 | Bacteria | 2969 |
| 248 | Ga0105243_10071314 | 3300009148 | Bacteria | 2808 |
| 249 | Ga0105243_10216819 | 3300009148 | Bacteria | 1689 |
| 250 | Ga0105241_10013069 | 3300009174 | Bacteria | 6088 |
| 251 | Ga0105241_10082049 | 3300009174 | Bacteria | 2527 |
| 252 | Ga0105241_10137051 | 3300009174 | Bacteria | 1989 |
| 253 | Ga0105241_12005357 | 3300009174 | Bacteria | 570 |
| 254 | Ga0105242_10002016 | 3300009176 | Bacteria | 15990 |
| 255 | Ga0105248_10003871 | 3300009177 | Bacteria | 16548 |
| 256 | Ga0105248_10018471 | 3300009177 | Bacteria | 7706 |
| 257 | Ga0105248_10148475 | 3300009177 | Bacteria | 2645 |
| 258 | Ga0105248_10296617 | 3300009177 | Bacteria | 1820 |
| 259 | Ga0105248_11623458 | 3300009177 | Bacteria | 733 |
| 260 | Ga0105237_10001801 | 3300009545 | Bacteria | 27675 |
| 261 | Ga0105237_10024783 | 3300009545 | Bacteria | 6138 |
| 262 | Ga0105237_10025451 | 3300009545 | Bacteria | 6052 |
| 263 | Ga0105238_10004248 | 3300009551 | Bacteria | 14237 |
| 264 | Ga0105238_10133598 | 3300009551 | Bacteria | 2459 |
| 265 | Ga0105238_10137144 | 3300009551 | Bacteria | 2424 |
| 266 | Ga0105249_10001193 | 3300009553 | Bacteria | 22912 |
| 267 | Ga0105249_10020158 | 3300009553 | Bacteria | 5958 |
| 268 | Ga0105249_10236960 | 3300009553 | Bacteria | 1802 |
| 269 | Ga0105249_10607224 | 3300009553 | Bacteria | 1149 |
| 270 | Ga0105239_10030616 | 3300010375 | Bacteria | 5919 |
| 271 | Ga0105239_10267471 | 3300010375 | Bacteria | 1922 |
| 272 | Ga0105239_10526121 | 3300010375 | Bacteria | 1345 |
| 273 | Ga0105239_10712648 | 3300010375 | Bacteria | 1148 |
| 274 | Ga0105239_10789373 | 3300010375 | Bacteria | 1088 |
| 275 | Ga0105246_10000231 | 3300011119 | Bacteria | 28580 |
| 276 | Ga0105246_10509445 | 3300011119 | Bacteria | 1024 |
| 277 | Ga0105246_10841000 | 3300011119 | Bacteria | 818 |
| 278 | Ga0157345_1016400 | 3300012498 | Bacteria | 711 |
| 279 | Ga0157342_1000445 | 3300012507 | Bacteria | 2507 |
| 280 | Ga0157326_1003345 | 3300012513 | Bacteria | 1689 |
| 281 | Ga0157338_1000781 | 3300012515 | Bacteria | 2049 |
| 282 | Ga0157373_10011046 | 3300013100 | Bacteria | 6651 |
| 283 | Ga0157371_10013762 | 3300013102 | Bacteria | 6130 |
| 284 | Ga0157371_10215226 | 3300013102 | Bacteria | 1379 |
| 285 | Ga0157371_11538920 | 3300013102 | Bacteria | 519 |
| 286 | Ga0157370_10000832 | 3300013104 | Bacteria | 39082 |
| 287 | Ga0157370_10246046 | 3300013104 | Bacteria | 1654 |
| 288 | Ga0157369_10469673 | 3300013105 | Bacteria | 1302 |
| 289 | Ga0157374_10035420 | 3300013296 | Bacteria | 4567 |
| 290 | Ga0157374_10037940 | 3300013296 | Bacteria | 4426 |
| 291 | Ga0157374_11320734 | 3300013296 | Bacteria | 743 |
| 292 | Ga0157374_12134771 | 3300013296 | Bacteria | 587 |
| 293 | Ga0157378_10022746 | 3300013297 | Bacteria | 5516 |
| 294 | Ga0157378_10095614 | 3300013297 | Bacteria | 2706 |
| 295 | Ga0157378_10149112 | 3300013297 | Bacteria | 2178 |
| 296 | Ga0157378_10336913 | 3300013297 | Bacteria | 1470 |
| 297 | Ga0163162_10006149 | 3300013306 | Bacteria | 11621 |
| 298 | Ga0163162_10117622 | 3300013306 | Bacteria | 2760 |
| 299 | Ga0163162_10122467 | 3300013306 | Bacteria | 2705 |
| 300 | Ga0163162_10416440 | 3300013306 | Bacteria | 1476 |
| 301 | Ga0163162_12223522 | 3300013306 | Bacteria | 630 |
| 302 | Ga0157372_10025465 | 3300013307 | Bacteria | 6433 |
| 303 | Ga0157372_10419050 | 3300013307 | Bacteria | 1560 |
| 304 | Ga0157372_11542789 | 3300013307 | Bacteria | 765 |
| 305 | Ga0157375_10021653 | 3300013308 | Bacteria | 5900 |
| 306 | Ga0157375_10304086 | 3300013308 | Bacteria | 1758 |
| 307 | Ga0163163_10001320 | 3300014325 | Bacteria | 20935 |
| 308 | Ga0163163_10032310 | 3300014325 | Bacteria | 5054 |
| 309 | Ga0163163_10143373 | 3300014325 | Bacteria | 2432 |
| 310 | Ga0163163_10535745 | 3300014325 | Bacteria | 1233 |
| 311 | Ga0163163_12197028 | 3300014325 | Unclassified | 611 |
| 312 | Ga0157380_10002744 | 3300014326 | Bacteria | 11948 |
| 313 | Ga0157380_10019743 | 3300014326 | Bacteria | 5027 |
| 314 | Ga0157380_10047959 | 3300014326 | Bacteria | 3362 |
| 315 | Ga0157377_10000164 | 3300014745 | Bacteria | 39592 |
| 316 | Ga0157377_10100198 | 3300014745 | Bacteria | 1725 |
| 317 | Ga0157377_11046017 | 3300014745 | Bacteria | 621 |
| 318 | Ga0157379_10012672 | 3300014968 | Bacteria | 7369 |
| 319 | Ga0157379_10094726 | 3300014968 | Bacteria | 2679 |
| 320 | Ga0157379_10265766 | 3300014968 | Bacteria | 1559 |
| 321 | Ga0157379_10291614 | 3300014968 | Bacteria | 1486 |
| 322 | Ga0157379_10374963 | 3300014968 | Unclassified | 1305 |
| 323 | Ga0157379_10445141 | 3300014968 | Bacteria | 1195 |
| 324 | Ga0157376_10002102 | 3300014969 | Bacteria | 13394 |
| 325 | Ga0157376_10009727 | 3300014969 | Bacteria | 7000 |
| 326 | Ga0157376_10079367 | 3300014969 | Bacteria | 2813 |
| 327 | Ga0163161_10002837 | 3300017792 | Bacteria | 12295 |
| 328 | Ga0213876_10263921 | 3300021384 | Bacteria | 915 |
| 329 | Ga0207666_1000051 | 3300025271 | Bacteria | 21813 |
| 330 | Ga0207666_1006768 | 3300025271 | Bacteria | 1493 |
| 331 | Ga0207673_1000958 | 3300025290 | Bacteria | 3106 |
| 332 | Ga0207697_10000662 | 3300025315 | Bacteria | 19563 |
| 333 | Ga0207697_10006653 | 3300025315 | Bacteria | 5209 |
| 334 | Ga0207655_1070435 | 3300025728 | Bacteria | 1302 |
| 335 | Ga0207653_10000546 | 3300025885 | Bacteria | 13918 |
| 336 | Ga0207653_10013666 | 3300025885 | Bacteria | 2542 |
| 337 | Ga0207682_10000072 | 3300025893 | Bacteria | 44659 |
| 338 | Ga0207692_10027923 | 3300025898 | Bacteria | 2663 |
| 339 | Ga0207642_10010607 | 3300025899 | Bacteria | 3257 |
| 340 | Ga0207642_10075738 | 3300025899 | Bacteria | 1617 |
| 341 | Ga0207642_10208714 | 3300025899 | Bacteria | 1084 |
| 342 | Ga0207710_10009082 | 3300025900 | Bacteria | 4185 |
| 343 | Ga0207710_10137418 | 3300025900 | Unclassified | 1178 |
| 344 | Ga0207710_10223636 | 3300025900 | Bacteria | 935 |
| 345 | Ga0207710_10329954 | 3300025900 | Bacteria | 775 |
| 346 | Ga0207688_10000229 | 3300025901 | Bacteria | 25389 |
| 347 | Ga0207688_10020259 | 3300025901 | Bacteria | 3630 |
| 348 | Ga0207680_10025714 | 3300025903 | Bacteria | 3250 |
| 349 | Ga0207680_10566024 | 3300025903 | Bacteria | 812 |
| 350 | Ga0207647_10003353 | 3300025904 | Bacteria | 12014 |
| 351 | Ga0207647_10019233 | 3300025904 | Bacteria | 4597 |
| 352 | Ga0207685_10039891 | 3300025905 | Bacteria | 1746 |
| 353 | Ga0207699_10012526 | 3300025906 | Bacteria | 4315 |
| 354 | Ga0207699_10053089 | 3300025906 | Bacteria | 2402 |
| 355 | Ga0207645_10000966 | 3300025907 | Bacteria | 23780 |
| 356 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 357 | Ga0207684_10126441 | 3300025910 | Bacteria | 2194 |
| 358 | Ga0207654_10001472 | 3300025911 | Bacteria | 12448 |
| 359 | Ga0207654_10055190 | 3300025911 | Bacteria | 2299 |
| 360 | Ga0207707_10010417 | 3300025912 | Bacteria | 8067 |
| 361 | Ga0207707_10026555 | 3300025912 | Bacteria | 5061 |
| 362 | Ga0207695_10085826 | 3300025913 | Bacteria | 3176 |
| 363 | Ga0207695_10284678 | 3300025913 | Bacteria | 1546 |
| 364 | Ga0207695_10534683 | 3300025913 | Bacteria | 1054 |
| 365 | Ga0207695_10596992 | 3300025913 | Unclassified | 985 |
| 366 | Ga0207671_10026742 | 3300025914 | Bacteria | 4320 |
| 367 | Ga0207671_10465240 | 3300025914 | Bacteria | 1008 |
| 368 | Ga0207693_10001624 | 3300025915 | Bacteria | 19860 |
| 369 | Ga0207693_10003724 | 3300025915 | Bacteria | 12993 |
| 370 | Ga0207693_10028672 | 3300025915 | Bacteria | 4399 |
| 371 | Ga0207693_10417378 | 3300025915 | Bacteria | 1049 |
| 372 | Ga0207663_10063043 | 3300025916 | Bacteria | 2359 |
| 373 | Ga0207663_10093512 | 3300025916 | Bacteria | 2001 |
| 374 | Ga0207663_10189417 | 3300025916 | Bacteria | 1476 |
| 375 | Ga0207663_10236502 | 3300025916 | Bacteria | 1337 |
| 376 | Ga0207660_10000648 | 3300025917 | Bacteria | 23454 |
| 377 | Ga0207660_10083840 | 3300025917 | Bacteria | 2348 |
| 378 | Ga0207660_10144095 | 3300025917 | Bacteria | 1824 |
| 379 | Ga0207660_10298926 | 3300025917 | Bacteria | 1281 |
| 380 | Ga0207662_10000317 | 3300025918 | Bacteria | 21877 |
| 381 | Ga0207662_10007326 | 3300025918 | Bacteria | 6001 |
| 382 | Ga0207657_10002047 | 3300025919 | Bacteria | 21819 |
| 383 | Ga0207657_10049663 | 3300025919 | Bacteria | 3654 |
| 384 | Ga0207657_10057207 | 3300025919 | Bacteria | 3361 |
| 385 | Ga0207649_10000037 | 3300025920 | Bacteria | 131159 |
| 386 | Ga0207649_10000262 | 3300025920 | Bacteria | 41689 |
| 387 | Ga0207649_10231460 | 3300025920 | Bacteria | 1322 |
| 388 | Ga0207652_10045204 | 3300025921 | Bacteria | 3753 |
| 389 | Ga0207652_10391323 | 3300025921 | Bacteria | 1254 |
| 390 | Ga0207646_10822098 | 3300025922 | Unclassified | 827 |
| 391 | Ga0207646_10987405 | 3300025922 | Unclassified | 744 |
| 392 | Ga0207681_10025833 | 3300025923 | Bacteria | 3782 |
| 393 | Ga0207681_10042994 | 3300025923 | Bacteria | 3021 |
| 394 | Ga0207694_10088416 | 3300025924 | Bacteria | 2442 |
| 395 | Ga0207694_10230136 | 3300025924 | Bacteria | 1513 |
| 396 | Ga0207650_10004313 | 3300025925 | Bacteria | 9709 |
| 397 | Ga0207650_10141954 | 3300025925 | Bacteria | 1889 |
| 398 | Ga0207659_10001684 | 3300025926 | Bacteria | 13118 |
| 399 | Ga0207687_10001501 | 3300025927 | Bacteria | 15981 |
| 400 | Ga0207687_10704318 | 3300025927 | Bacteria | 857 |
| 401 | Ga0207700_10000058 | 3300025928 | Bacteria | 70410 |
| 402 | Ga0207700_10475083 | 3300025928 | Bacteria | 1104 |
| 403 | Ga0207664_10156740 | 3300025929 | Bacteria | 1939 |
| 404 | Ga0207664_11974379 | 3300025929 | Bacteria | 506 |
| 405 | Ga0207644_10000467 | 3300025931 | Bacteria | 26087 |
| 406 | Ga0207644_10230485 | 3300025931 | Bacteria | 1471 |
| 407 | Ga0207690_10001228 | 3300025932 | Bacteria | 16182 |
| 408 | Ga0207706_10001679 | 3300025933 | Bacteria | 21866 |
| 409 | Ga0207706_10009690 | 3300025933 | Bacteria | 8840 |
| 410 | Ga0207706_10066033 | 3300025933 | Bacteria | 3184 |
| 411 | Ga0207686_10006089 | 3300025934 | Bacteria | 6480 |
| 412 | Ga0207686_10325675 | 3300025934 | Bacteria | 1150 |
| 413 | Ga0207709_10006275 | 3300025935 | Bacteria | 6677 |
| 414 | Ga0207709_10013556 | 3300025935 | Bacteria | 4496 |
| 415 | Ga0207709_10026438 | 3300025935 | Bacteria | 3334 |
| 416 | Ga0207670_10014641 | 3300025936 | Bacteria | 4663 |
| 417 | Ga0207670_10063548 | 3300025936 | Bacteria | 2526 |
| 418 | Ga0207670_10175747 | 3300025936 | Bacteria | 1609 |
| 419 | Ga0207669_10002049 | 3300025937 | Bacteria | 8529 |
| 420 | Ga0207669_10341629 | 3300025937 | Bacteria | 1153 |
| 421 | Ga0207669_10490369 | 3300025937 | Bacteria | 981 |
| 422 | Ga0207669_11075571 | 3300025937 | Unclassified | 678 |
| 423 | Ga0207704_10003529 | 3300025938 | Bacteria | 7115 |
| 424 | Ga0207665_10027408 | 3300025939 | Bacteria | 3764 |
| 425 | Ga0207665_10172346 | 3300025939 | Bacteria | 1563 |
| 426 | Ga0207691_10002874 | 3300025940 | Bacteria | 16780 |
| 427 | Ga0207691_10061507 | 3300025940 | Bacteria | 3411 |
| 428 | Ga0207691_10318936 | 3300025940 | Bacteria | 1333 |
| 429 | Ga0207711_10006776 | 3300025941 | Bacteria | 9628 |
| 430 | Ga0207711_10025537 | 3300025941 | Bacteria | 4955 |
| 431 | Ga0207711_10070613 | 3300025941 | Bacteria | 3029 |
| 432 | Ga0207711_10190335 | 3300025941 | Bacteria | 1869 |
| 433 | Ga0207711_10320427 | 3300025941 | Bacteria | 1432 |
| 434 | Ga0207689_10000203 | 3300025942 | Bacteria | 52425 |
| 435 | Ga0207689_10235266 | 3300025942 | Bacteria | 1514 |
| 436 | Ga0207661_10012457 | 3300025944 | Bacteria | 6179 |
| 437 | Ga0207661_10276806 | 3300025944 | Bacteria | 1499 |
| 438 | Ga0207679_10000157 | 3300025945 | Bacteria | 56166 |
| 439 | Ga0207679_10082307 | 3300025945 | Bacteria | 2464 |
| 440 | Ga0207679_10164353 | 3300025945 | Bacteria | 1821 |
| 441 | Ga0207679_10383000 | 3300025945 | Unclassified | 1233 |
| 442 | Ga0207667_10033582 | 3300025949 | Bacteria | 5515 |
| 443 | Ga0207667_10815216 | 3300025949 | Bacteria | 929 |
| 444 | Ga0207651_10006717 | 3300025960 | Bacteria | 6061 |
| 445 | Ga0207651_10675397 | 3300025960 | Bacteria | 908 |
| 446 | Ga0207712_10002224 | 3300025961 | Bacteria | 12622 |
| 447 | Ga0207712_10483484 | 3300025961 | Bacteria | 1056 |
| 448 | Ga0207668_10003217 | 3300025972 | Bacteria | 9570 |
| 449 | Ga0207668_10216753 | 3300025972 | Bacteria | 1534 |
| 450 | Ga0207668_10296384 | 3300025972 | Bacteria | 1333 |
| 451 | Ga0207640_10004454 | 3300025981 | Bacteria | 7591 |
| 452 | Ga0207640_10309405 | 3300025981 | Bacteria | 1253 |
| 453 | Ga0207640_10650680 | 3300025981 | Bacteria | 898 |
| 454 | Ga0207658_10027932 | 3300025986 | Bacteria | 3969 |
| 455 | Ga0207658_10159306 | 3300025986 | Bacteria | 1848 |
| 456 | Ga0207658_10531504 | 3300025986 | Bacteria | 1050 |
| 457 | Ga0207677_10001675 | 3300026023 | Bacteria | 11738 |
| 458 | Ga0207677_10090314 | 3300026023 | Bacteria | 2226 |
| 459 | Ga0207703_10001852 | 3300026035 | Bacteria | 18819 |
| 460 | Ga0207703_10033946 | 3300026035 | Bacteria | 4047 |
| 461 | Ga0207703_10157415 | 3300026035 | Bacteria | 1987 |
| 462 | Ga0207703_10479003 | 3300026035 | Bacteria | 1166 |
| 463 | Ga0207639_10071634 | 3300026041 | Bacteria | 2712 |
| 464 | Ga0207639_10084659 | 3300026041 | Bacteria | 2519 |
| 465 | Ga0207639_10401737 | 3300026041 | Bacteria | 1234 |
| 466 | Ga0207639_11458194 | 3300026041 | Bacteria | 642 |
| 467 | Ga0207678_10001809 | 3300026067 | Bacteria | 19589 |
| 468 | Ga0207678_10012723 | 3300026067 | Bacteria | 7391 |
| 469 | Ga0207678_10082363 | 3300026067 | Bacteria | 2753 |
| 470 | Ga0207678_10598988 | 3300026067 | Bacteria | 966 |
| 471 | Ga0207708_10001199 | 3300026075 | Bacteria | 19559 |
| 472 | Ga0207708_10003067 | 3300026075 | Bacteria | 12308 |
| 473 | Ga0207708_10347840 | 3300026075 | Bacteria | 1215 |
| 474 | Ga0207702_10000045 | 3300026078 | Bacteria | 144714 |
| 475 | Ga0207702_10003404 | 3300026078 | Bacteria | 14557 |
| 476 | Ga0207702_10060437 | 3300026078 | Bacteria | 3231 |
| 477 | Ga0207702_10110858 | 3300026078 | Bacteria | 2439 |
| 478 | Ga0207641_10023651 | 3300026088 | Bacteria | 5062 |
| 479 | Ga0207641_10075722 | 3300026088 | Bacteria | 2907 |
| 480 | Ga0207641_10595331 | 3300026088 | Bacteria | 1082 |
| 481 | Ga0207641_10747655 | 3300026088 | Unclassified | 965 |
| 482 | Ga0207648_10002073 | 3300026089 | Bacteria | 21861 |
| 483 | Ga0207648_10133046 | 3300026089 | Bacteria | 2189 |
| 484 | Ga0207648_11423677 | 3300026089 | Bacteria | 651 |
| 485 | Ga0207676_10000990 | 3300026095 | Bacteria | 21882 |
| 486 | Ga0207676_10024942 | 3300026095 | Bacteria | 4432 |
| 487 | Ga0207676_10270696 | 3300026095 | Bacteria | 1538 |
| 488 | Ga0207676_10439308 | 3300026095 | Unclassified | 1228 |
| 489 | Ga0207676_11557231 | 3300026095 | Unclassified | 658 |
| 490 | Ga0207676_12297969 | 3300026095 | Bacteria | 537 |
| 491 | Ga0207674_10000897 | 3300026116 | Bacteria | 38907 |
| 492 | Ga0207674_10001401 | 3300026116 | Bacteria | 31105 |
| 493 | Ga0207675_100001726 | 3300026118 | Bacteria | 21899 |
| 494 | Ga0207675_100076333 | 3300026118 | Bacteria | 3138 |
| 495 | Ga0207675_101458828 | 3300026118 | Bacteria | 705 |
| 496 | Ga0207683_10001176 | 3300026121 | Bacteria | 23694 |
| 497 | Ga0207683_10020527 | 3300026121 | Bacteria | 5652 |
| 498 | Ga0207683_10561411 | 3300026121 | Bacteria | 1056 |
| 499 | Ga0207683_10845913 | 3300026121 | Bacteria | 849 |
| 500 | Ga0207698_10003743 | 3300026142 | Bacteria | 9193 |
| 501 | Ga0209967_1015249 | 3300027364 | Bacteria | 1099 |
| 502 | Ga0210002_1008815 | 3300027617 | Bacteria | 1538 |
| 503 | Ga0209983_1005259 | 3300027665 | Bacteria | 2686 |
| 504 | Ga0209971_1017323 | 3300027682 | Bacteria | 1708 |
| 505 | Ga0209971_1033085 | 3300027682 | Bacteria | 1242 |
| 506 | Ga0209966_1000247 | 3300027695 | Bacteria | 19895 |
| 507 | Ga0209998_10002233 | 3300027717 | Bacteria | 4484 |
| 508 | Ga0209998_10002778 | 3300027717 | Bacteria | 3953 |
| 509 | Ga0209974_10015951 | 3300027876 | Bacteria | 2494 |
| 510 | Ga0209974_10053834 | 3300027876 | Bacteria | 1356 |
| 511 | Ga0209974_10131583 | 3300027876 | Bacteria | 892 |
| 512 | Ga0207428_10000792 | 3300027907 | Bacteria | 35769 |
| 513 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 514 | Ga0268266_10033993 | 3300028379 | Bacteria | 4334 |
| 515 | Ga0268265_10002187 | 3300028380 | Bacteria | 15094 |
| 516 | Ga0268265_10225652 | 3300028380 | Bacteria | 1642 |
| 517 | Ga0268264_10018562 | 3300028381 | Bacteria | 5688 |
| 518 | Ga0268264_10104372 | 3300028381 | Bacteria | 2470 |
| 519 | Ga0268264_10464861 | 3300028381 | Bacteria | 1228 |
| 520 | Ga0265338_10042419 | 3300028800 | Bacteria | 4237 |
| 521 | Ga0265338_10539643 | 3300028800 | Bacteria | 817 |
| 522 | Ga0265332_10436705 | 3300031238 | Bacteria | 541 |
| 523 | Ga0265325_10000600 | 3300031241 | Bacteria | 26270 |
| 524 | Ga0265340_10025762 | 3300031247 | Bacteria | 2977 |
| 525 | Ga0265339_10401562 | 3300031249 | Bacteria | 640 |
| 526 | Ga0265316_10021352 | 3300031344 | Bacteria | 5484 |
| 527 | Ga0265316_10092697 | 3300031344 | Bacteria | 2303 |
| 528 | Ga0307408_100072949 | 3300031548 | Bacteria | 2542 |
| 529 | Ga0265313_10006817 | 3300031595 | Bacteria | 7977 |
| 530 | Ga0316575_10071072 | 3300031665 | Bacteria | 1398 |
| 531 | Ga0265342_10172281 | 3300031712 | Bacteria | 1190 |
| 532 | Ga0316576_10595996 | 3300031727 | Unclassified | 807 |
| 533 | Ga0316578_10208208 | 3300031728 | Bacteria | 1177 |
| 534 | Ga0316578_10286107 | 3300031728 | Bacteria | 987 |
| 535 | Ga0316578_10342957 | 3300031728 | Bacteria | 890 |
| 536 | Ga0307413_10398590 | 3300031824 | Bacteria | 1077 |
| 537 | Ga0307410_10068033 | 3300031852 | Bacteria | 2458 |
| 538 | Ga0307407_10007668 | 3300031903 | Bacteria | 4900 |
| 539 | Ga0307412_10070809 | 3300031911 | Bacteria | 2378 |
| 540 | Ga0307409_100018694 | 3300031995 | Bacteria | 4668 |
| 541 | Ga0307416_100071314 | 3300032002 | Bacteria | 2885 |
| 542 | Ga0307414_10233760 | 3300032004 | Bacteria | 1517 |
| 543 | Ga0307414_10300698 | 3300032004 | Bacteria | 1357 |
| 544 | Ga0307411_10797125 | 3300032005 | Bacteria | 831 |
| 545 | Ga0307415_100007254 | 3300032126 | Bacteria | 6051 |
| 546 | Ga0373930_0000250 | 3300034816 | Bacteria | 6826 |
| 547 | Ga0373930_0003593 | 3300034816 | Bacteria | 2471 |
| 548 | Ga0373948_0000061 | 3300034817 | Bacteria | 11538 |
| 549 | Ga0373948_0016450 | 3300034817 | Bacteria | 1367 |
| 550 | Ga0373950_0000537 | 3300034818 | Bacteria | 4659 |
| 551 | Ga0373950_0004026 | 3300034818 | Bacteria | 2137 |
| 552 | Ga0373958_0000048 | 3300034819 | Bacteria | 11955 |
| 553 | Ga0373958_0000826 | 3300034819 | Bacteria | 3960 |
| 554 | Ga0373959_0000735 | 3300034820 | Bacteria | 5592 |
| 555 | Ga0373938_0000471 | 3300034957 | Bacteria | 6519 |
| 556 | Ga0373938_0000691 | 3300034957 | Bacteria | 5451 |
| 557 | Ga0373926_0016674 | 3300035083 | Bacteria | 2516 |
| 558 | Ga0373928_0005735 | 3300035084 | Bacteria | 2375 |
| 559 | Ga0373929_0000096 | 3300035085 | Bacteria | 14516 |
| 560 | Ga0373929_0003497 | 3300035085 | Bacteria | 2828 |
| 561 | Ga0373934_0207910 | 3300035086 | Unclassified | 806 |
| 562 | Ga0373940_0000023 | 3300035088 | Bacteria | 16767 |
| 563 | Ga0373940_0043859 | 3300035088 | Bacteria | 1237 |
| 564 | Ga0373944_0028788 | 3300035089 | Bacteria | 1655 |
| 565 | Ga0373949_0001146 | 3300035090 | Bacteria | 7970 |
| 566 | Ga0373949_0001755 | 3300035090 | Bacteria | 5985 |
| 567 | Ga0373951_0000876 | 3300035091 | Bacteria | 8125 |
| 568 | Ga0373951_0012771 | 3300035091 | Bacteria | 1888 |
| 569 | Ga0373951_0034363 | 3300035091 | Bacteria | 1204 |
| 570 | Ga0373952_0000126 | 3300035092 | Bacteria | 10768 |
| 571 | Ga0373952_0004467 | 3300035092 | Bacteria | 2538 |
| 572 | Ga0373923_0033921 | 3300035111 | Bacteria | 2069 |
| 573 | Ga0373923_0066067 | 3300035111 | Bacteria | 1545 |
| 574 | Ga0373923_0372536 | 3300035111 | Bacteria | 684 |
| 575 | Ga0373932_0000553 | 3300035112 | Bacteria | 11476 |
| 576 | Ga0373932_0016039 | 3300035112 | Bacteria | 1907 |
| 577 | Ga0373936_0148732 | 3300035113 | Bacteria | 1014 |
| 578 | Ga0373939_0000419 | 3300035114 | Bacteria | 10659 |
| 579 | Ga0373939_0000663 | 3300035114 | Bacteria | 8540 |
| 580 | Ga0373941_0000309 | 3300035115 | Bacteria | 9451 |
| 581 | Ga0373941_0005456 | 3300035115 | Bacteria | 2994 |
| 582 | Ga0373945_0305703 | 3300035116 | Unclassified | 682 |
| 583 | Ga0373954_0004588 | 3300035118 | Bacteria | 5953 |
| 584 | Ga0373954_0048635 | 3300035118 | Bacteria | 1987 |
| 585 | Ga0373956_0060571 | 3300035119 | Bacteria | 1714 |
| 586 | Ga0373956_0359398 | 3300035119 | Bacteria | 694 |
| 587 | Ga0373957_0130326 | 3300035120 | Unclassified | 1023 |
| 588 | Ga0373960_0002985 | 3300035121 | Bacteria | 3828 |
| 589 | Ga0373960_0017748 | 3300035121 | Bacteria | 1847 |
| 590 | Ga0373943_0064807 | 3300035170 | Bacteria | 1835 |
| 591 | Ga0373943_0129399 | 3300035170 | Bacteria | 1350 |
| 592 | Ga0373955_0017482 | 3300035172 | Bacteria | 3551 |
| 593 | Ga0373955_0018792 | 3300035172 | Bacteria | 3444 |
| 594 | Ga0373955_0242846 | 3300035172 | Unclassified | 1079 |
| 595 | Ga0373955_0799976 | 3300035172 | Bacteria | 580 |
| 596 | Ga0373942_0000081 | 3300035207 | Bacteria | 20661 |
| 597 | Ga0373942_0005488 | 3300035207 | Bacteria | 2941 |
| 598 | Ga0373942_0284926 | 3300035207 | Unclassified | 570 |
| 599 | Ga0373961_0010016 | 3300035241 | Bacteria | 2330 |
| 600 | Ga0373962_0000194 | 3300035242 | Bacteria | 12882 |
| 601 | Ga0373962_0001329 | 3300035242 | Bacteria | 5825 |
| 602 | Ga0373962_0279718 | 3300035242 | Bacteria | 587 |
| 603 | Ga0316574_0057469 | 3300035398 | Bacteria | 2435 |
| 604 | Ga0373924_0043119 | 3300035410 | Bacteria | 1852 |
| 605 | Ga0373931_0001008 | 3300035691 | Bacteria | 11924 |
| 606 | Ga0373931_0160221 | 3300035691 | Bacteria | 1319 |
| 607 | Ga0373935_0077953 | 3300035692 | Bacteria | 2148 |
| 608 | Ga0373935_0102433 | 3300035692 | Bacteria | 1889 |
| 609 | Ga0373935_0736019 | 3300035692 | Bacteria | 726 |
| 610 | Ga0373927_0300442 | 3300035695 | Unclassified | 1056 |
| 611 | Ga0373933_0000753 | 3300035724 | Bacteria | 19821 |
| 612 | Ga0373933_0004608 | 3300035724 | Bacteria | 7550 |
| 613 | Ga0373933_0058259 | 3300035724 | Bacteria | 2323 |
| 614 | Ga0373933_0361474 | 3300035724 | Bacteria | 944 |
| 615 | Ga0373933_0380565 | 3300035724 | Bacteria | 919 |
| 616 | Ga0373937_0000655 | 3300036401 | Bacteria | 30381 |
| 617 | Ga0373937_0005483 | 3300036401 | Bacteria | 10870 |
| 618 | Ga0373937_0011937 | 3300036401 | Bacteria | 7624 |
| 619 | Ga0373937_0012043 | 3300036401 | Bacteria | 7589 |
| 620 | Ga0373925_0649210 | 3300037068 | Unclassified | 869 |
| 621 | Ga0373925_0759213 | 3300037068 | Bacteria | 799 |
| 622 | Ga0373925_1046371 | 3300037068 | Bacteria | 672 |
| 623 | Ga0373925_1589956 | 3300037068 | Bacteria | 534 |
| 624 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 625 | Ga0395898_0030042 | 3300037466 | Bacteria | 5440 |
| 626 | Ga0395905_0019957 | 3300037471 | Bacteria | 6351 |
| 627 | Ga0436364_0567052 | 3300037853 | Unclassified | 1674 |
| 628 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 629 | Ga0400489_13735 | 3300039093 | Bacteria | 1694 |
| 630 | Ga0400489_56277 | 3300039093 | Bacteria | 2585 |
| 631 | Ga0436365_0144344 | 3300039437 | Bacteria | 9268 |
| 632 | Ga0436365_0691718 | 3300039437 | Unclassified | 581 |
| 633 | Ga0436365_1657697 | 3300039437 | Bacteria | 665 |
| 634 | Ga0436361_0621516 | 3300039447 | Bacteria | 650 |
| 635 | Ga0436363_0327641 | 3300039450 | Bacteria | 1130 |
| 636 | Ga0439448_0181842 | 3300042005 | Bacteria | 735 |
| 637 | Ga0439455_0011926 | 3300042012 | Bacteria | 1942 |
| 638 | Ga0439463_015735 | 3300042016 | Bacteria | 1871 |
| 639 | Ga0439458_0113433 | 3300042157 | Bacteria | 710 |
| 640 | Ga0439444_0144195 | 3300042437 | Bacteria | 571 |
| 641 | Ga0439464_0045011 | 3300042439 | Bacteria | 1265 |
| 642 | Ga0451577_0120856 | 3300042876 | Bacteria | 2346 |
| 643 | Ga0466972_0453199 | 3300044658 | Bacteria | 603 |
| 644 | Ga0453684_0223027 | 3300044712 | Bacteria | 2182 |
| 645 | Ga0466960_0104697 | 3300044901 | Bacteria | 1462 |
| 646 | Ga0466959_0693512 | 3300045049 | Bacteria | 683 |
| 647 | Ga0451576_0006650 | 3300045051 | Bacteria | 14107 |
| 648 | Ga0466967_0632186 | 3300045976 | Bacteria | 1058 |
| 649 | Ga0495592_0067596 | 3300046454 | Bacteria | 2610 |
| 650 | Ga0495603_0028204 | 3300046455 | Bacteria | 3386 |
| 651 | Ga0495638_0453726 | 3300046460 | Bacteria | 654 |
| 652 | Ga0495641_0041535 | 3300046461 | Bacteria | 2136 |
| 653 | Ga0495651_0048616 | 3300046462 | Bacteria | 3275 |
| 654 | Ga0495651_0133324 | 3300046462 | Bacteria | 1811 |
| 655 | Ga0495653_0003231 | 3300046463 | Bacteria | 13066 |
| 656 | Ga0495653_0108077 | 3300046463 | Bacteria | 2004 |
| 657 | Ga0495653_0225385 | 3300046463 | Bacteria | 1257 |
| 658 | Ga0495650_0082801 | 3300046471 | Bacteria | 1234 |
| 659 | Ga0495580_0151887 | 3300046472 | Bacteria | 1604 |
| 660 | Ga0495582_0539890 | 3300046473 | Unclassified | 674 |
| 661 | Ga0495639_0011384 | 3300046475 | Bacteria | 3835 |
| 662 | Ga0495662_0029637 | 3300046476 | Bacteria | 2642 |
| 663 | Ga0495664_0002327 | 3300046477 | Bacteria | 10184 |
| 664 | Ga0495664_0052695 | 3300046477 | Bacteria | 2419 |
| 665 | Ga0495584_0198216 | 3300046491 | Bacteria | 1021 |
| 666 | Ga0495594_0050759 | 3300046499 | Bacteria | 2282 |
| 667 | Ga0495608_0000428 | 3300046511 | Bacteria | 29274 |
| 668 | Ga0495608_0056952 | 3300046511 | Bacteria | 2580 |
| 669 | Ga0495618_0022993 | 3300046514 | Bacteria | 3851 |
| 670 | Ga0495628_0065732 | 3300046516 | Bacteria | 2835 |
| 671 | Ga0495631_0289900 | 3300046518 | Bacteria | 697 |
| 672 | Ga0495642_0017498 | 3300046528 | Bacteria | 2800 |
| 673 | Ga0495652_0110912 | 3300046529 | Bacteria | 2206 |
| 674 | Ga0495652_0113198 | 3300046529 | Bacteria | 2178 |
| 675 | Ga0495665_0344311 | 3300046531 | Unclassified | 760 |
| 676 | Ga0495640_0028613 | 3300046533 | Bacteria | 4010 |
| 677 | Ga0495640_0167247 | 3300046533 | Bacteria | 1406 |
| 678 | Ga0495586_0013401 | 3300046535 | Bacteria | 4347 |
| 679 | Ga0495586_0038131 | 3300046535 | Bacteria | 2580 |
| 680 | Ga0495587_0001490 | 3300046536 | Bacteria | 15605 |
| 681 | Ga0495587_0038051 | 3300046536 | Bacteria | 2886 |
| 682 | Ga0495645_0046734 | 3300046543 | Bacteria | 3154 |
| 683 | Ga0495667_0034314 | 3300046559 | Bacteria | 3393 |
| 684 | Ga0495667_0163059 | 3300046559 | Bacteria | 1433 |
| 685 | Ga0495656_0293316 | 3300046615 | Bacteria | 832 |
| 686 | Ga0495668_0255064 | 3300046616 | Bacteria | 960 |
| 687 | Ga0495634_0141103 | 3300046642 | Bacteria | 1529 |
| 688 | Ga0495634_0309440 | 3300046642 | Bacteria | 953 |
| 689 | Ga0495625_0200083 | 3300046660 | Bacteria | 1319 |
| 690 | Ga0495625_0381465 | 3300046660 | Bacteria | 884 |
| 691 | Ga0495635_0004055 | 3300046663 | Bacteria | 10163 |
| 692 | Ga0495657_0008984 | 3300046675 | Bacteria | 7603 |
| 693 | Ga0495657_0068961 | 3300046675 | Bacteria | 2315 |
| 694 | Ga0495599_0062738 | 3300046678 | Bacteria | 2321 |
| 695 | Ga0495599_0220644 | 3300046678 | Bacteria | 1160 |
| 696 | Ga0495623_0003897 | 3300046679 | Bacteria | 9840 |
| 697 | Ga0495623_0162577 | 3300046679 | Bacteria | 1311 |
| 698 | Ga0495646_0003693 | 3300046680 | Bacteria | 9553 |
| 699 | Ga0495658_0147172 | 3300046683 | Bacteria | 1444 |
| 700 | Ga0495658_0767441 | 3300046683 | Bacteria | 617 |
| 701 | Ga0495669_0060091 | 3300046684 | Bacteria | 1718 |
| 702 | Ga0495669_0386925 | 3300046684 | Bacteria | 677 |
| 703 | Ga0495613_0050547 | 3300046689 | Bacteria | 3065 |
| 704 | Ga0495624_0158258 | 3300046690 | Bacteria | 1384 |
| 705 | Ga0495600_0000742 | 3300046809 | Bacteria | 17174 |
| 706 | Ga0495600_0052886 | 3300046809 | Bacteria | 2652 |
| 707 | Ga0495600_0424839 | 3300046809 | Bacteria | 824 |
| 708 | Ga0495581_0038862 | 3300047315 | Bacteria | 2755 |
| 709 | Ga0495604_0014112 | 3300047317 | Bacteria | 6370 |
| 710 | Ga0495674_0020069 | 3300047319 | Bacteria | 6193 |
| 711 | Ga0495676_0556255 | 3300047321 | Bacteria | 749 |
| 712 | Ga0495680_0010686 | 3300047322 | Bacteria | 8187 |
| 713 | Ga0495680_0018350 | 3300047322 | Bacteria | 5942 |
| 714 | Ga0495680_0051288 | 3300047322 | Bacteria | 3222 |
| 715 | Ga0495675_0047852 | 3300047444 | Bacteria | 2720 |
| 716 | Ga0495675_0312852 | 3300047444 | Bacteria | 930 |
| 717 | Ga0495677_0056502 | 3300047445 | Bacteria | 1450 |
| 718 | Ga0495684_0147712 | 3300047471 | Bacteria | 1759 |
| 719 | Ga0495593_0046887 | 3300047673 | Bacteria | 2302 |
| 720 | Ga0495593_0127246 | 3300047673 | Bacteria | 1294 |
| 721 | Ga0495602_0002995 | 3300048088 | Bacteria | 17317 |
| 722 | Ga0495602_0205776 | 3300048088 | Bacteria | 1498 |
| 723 | Ga0495602_1138817 | 3300048088 | Bacteria | 510 |
| 724 | Ga0495614_0258948 | 3300048089 | Bacteria | 797 |
| 725 | Ga0496100_0004611 | 3300048903 | Bacteria | 7325 |
| 726 | Ga0496100_0015132 | 3300048903 | Bacteria | 4500 |
| 727 | Ga0496100_0127627 | 3300048903 | Bacteria | 1787 |
| 728 | Ga0496101_0002976 | 3300048904 | Bacteria | 10437 |
| 729 | Ga0496101_0005327 | 3300048904 | Bacteria | 8192 |
| 730 | Ga0496101_0814917 | 3300048904 | Unclassified | 736 |
| 731 | Ga0496101_0816426 | 3300048904 | Bacteria | 735 |
| 732 | Ga0496102_0013825 | 3300048905 | Bacteria | 7005 |
| 733 | Ga0496102_0044088 | 3300048905 | Bacteria | 4047 |
| 734 | Ga0496102_0085720 | 3300048905 | Bacteria | 2909 |
| 735 | Ga0496102_0092433 | 3300048905 | Bacteria | 2801 |
| 736 | Ga0496102_1521630 | 3300048905 | Bacteria | 588 |
| 737 | Ga0496103_0005922 | 3300048906 | Bacteria | 7307 |
| 738 | Ga0496103_0054581 | 3300048906 | Bacteria | 2477 |
| 739 | Ga0496103_0129366 | 3300048906 | Bacteria | 1612 |
| 740 | Ga0496103_0268591 | 3300048906 | Bacteria | 1097 |
| 741 | Ga0496103_0445005 | 3300048906 | Unclassified | 831 |
| 742 | Ga0496104_0004402 | 3300048907 | Bacteria | 12265 |
| 743 | Ga0496104_0082923 | 3300048907 | Bacteria | 3058 |
| 744 | Ga0496105_0018185 | 3300048908 | Bacteria | 5643 |
| 745 | Ga0496105_0433909 | 3300048908 | Bacteria | 1039 |
| 746 | Ga0496106_0007498 | 3300048909 | Bacteria | 8065 |
| 747 | Ga0496106_0008091 | 3300048909 | Bacteria | 7767 |
| 748 | Ga0496106_0129614 | 3300048909 | Bacteria | 1977 |
| 749 | Ga0496106_0161071 | 3300048909 | Bacteria | 1774 |
| 750 | Ga0496107_0016877 | 3300048910 | Bacteria | 5132 |
| 751 | Ga0496107_0036310 | 3300048910 | Bacteria | 3534 |
| 752 | Ga0496107_0042376 | 3300048910 | Bacteria | 3269 |
| 753 | Ga0496107_1088131 | 3300048910 | Bacteria | 578 |
| 754 | Ga0496108_0005285 | 3300048911 | Bacteria | 10421 |
| 755 | Ga0496108_0040061 | 3300048911 | Bacteria | 3904 |
| 756 | Ga0496108_0319815 | 3300048911 | Bacteria | 1353 |
| 757 | Ga0496108_0634468 | 3300048911 | Bacteria | 929 |
| 758 | Ga0496109_0000543 | 3300048912 | Bacteria | 31945 |
| 759 | Ga0496109_0008460 | 3300048912 | Bacteria | 8746 |
| 760 | Ga0496109_0039413 | 3300048912 | Bacteria | 4276 |
| 761 | Ga0496110_0016819 | 3300048913 | Bacteria | 6111 |
| 762 | Ga0496110_0072140 | 3300048913 | Bacteria | 3063 |
| 763 | Ga0496110_0085742 | 3300048913 | Bacteria | 2811 |
| 764 | Ga0496110_0139452 | 3300048913 | Bacteria | 2192 |
| 765 | Ga0496110_0200388 | 3300048913 | Bacteria | 1813 |
| 766 | Ga0496111_0025574 | 3300048914 | Bacteria | 4166 |
| 767 | Ga0496111_0029448 | 3300048914 | Bacteria | 3900 |
| 768 | Ga0496111_0162303 | 3300048914 | Bacteria | 1659 |
| 769 | Ga0496111_0485367 | 3300048914 | Bacteria | 910 |
| 770 | Ga0496112_0003072 | 3300048915 | Bacteria | 13667 |
| 771 | Ga0496112_0083032 | 3300048915 | Bacteria | 3168 |
| 772 | Ga0496112_0140244 | 3300048915 | Bacteria | 2387 |
| 773 | Ga0496112_0355101 | 3300048915 | Bacteria | 1408 |
| 774 | Ga0496112_0542833 | 3300048915 | Bacteria | 1097 |
| 775 | Ga0496113_0021252 | 3300048916 | Bacteria | 4575 |
| 776 | Ga0496113_0030289 | 3300048916 | Bacteria | 3917 |
| 777 | Ga0496113_0118905 | 3300048916 | Bacteria | 2064 |
| 778 | Ga0496113_0183715 | 3300048916 | Bacteria | 1658 |
| 779 | Ga0496113_0753123 | 3300048916 | Unclassified | 775 |
| 780 | Ga0496114_0510968 | 3300048917 | Bacteria | 1063 |
| 781 | Ga0496115_0005720 | 3300048918 | Bacteria | 9050 |
| 782 | Ga0496115_0009604 | 3300048918 | Bacteria | 7193 |
| 783 | Ga0496115_0013470 | 3300048918 | Bacteria | 6187 |
| 784 | Ga0496115_0035764 | 3300048918 | Bacteria | 3931 |
| 785 | Ga0496115_0095238 | 3300048918 | Bacteria | 2436 |
| 786 | Ga0496115_0802427 | 3300048918 | Unclassified | 732 |
| 787 | Ga0501290_023607 | 3300049513 | Bacteria | 854 |
| 788 | Ga0501046_0207514 | 3300049580 | Bacteria | 1455 |
| 789 | Ga0501070_0667855 | 3300049586 | Bacteria | 824 |
| 790 | Ga0501070_1009724 | 3300049586 | Bacteria | 645 |
| 791 | Ga0501074_0058699 | 3300049590 | Bacteria | 2772 |
| 792 | Ga0501075_0057288 | 3300049591 | Bacteria | 2934 |
| 793 | Ga0501077_0077381 | 3300049593 | Bacteria | 2107 |
| 794 | Ga0501077_0330782 | 3300049593 | Bacteria | 972 |
| 795 | Ga0501238_061117 | 3300049671 | Bacteria | 575 |
| 796 | Ga0501252_007217 | 3300049682 | Bacteria | 1254 |
| 797 | Ga0501079_1403568 | 3300049741 | Bacteria | 549 |
| 798 | Ga0501080_0119890 | 3300049742 | Unclassified | 2438 |
| 799 | nmdc:mga03n38_376267_c1 | 3300050490 | Bacteria | 777 |
| 800 | nmdc:mga09592_150274_c1 | 3300050508 | Bacteria | 2009 |
| 801 | nmdc:mga09592_1574989_c1 | 3300050508 | Bacteria | 533 |
| 802 | nmdc:mga06r32_445947_c1 | 3300050510 | Bacteria | 1274 |
| 803 | nmdc:mga08y16_4145_c1 | 3300050511 | Bacteria | 15133 |
| 804 | nmdc:mga0n895_115692_c1 | 3300050512 | Bacteria | 2700 |
| 805 | nmdc:mga0n895_266438_c1 | 3300050512 | Unclassified | 1738 |
| 806 | nmdc:mga0n895_4751_c1 | 3300050512 | Bacteria | 11226 |
| 807 | nmdc:mga0n895_764754_c1 | 3300050512 | Bacteria | 958 |
| 808 | nmdc:mga0rr50_17230_c1 | 3300050513 | Bacteria | 4817 |
| 809 | nmdc:mga0rr50_42416_c1 | 3300050513 | Bacteria | 3322 |
| 810 | nmdc:mga08x19_283728_c1 | 3300050514 | Bacteria | 1148 |
| 811 | nmdc:mga08x19_647588_c1 | 3300050514 | Bacteria | 749 |
| 812 | nmdc:mga08x19_836_c1 | 3300050514 | Bacteria | 19545 |
| 813 | Ga0495601_0002457 | 3300053077 | Bacteria | 10527 |
| 814 | Ga0495601_0006047 | 3300053077 | Bacteria | 7061 |
| 815 | Ga0495612_0004300 | 3300053078 | Bacteria | 5912 |
| 816 | Ga0495612_0012791 | 3300053078 | Bacteria | 3383 |
| 817 | Ga0495595_0002370 | 3300053084 | Bacteria | 7343 |
| 818 | Ga0495595_0004884 | 3300053084 | Bacteria | 5408 |
| 819 | Ga0495619_0003606 | 3300053085 | Bacteria | 9972 |
| 820 | Ga0495619_0004476 | 3300053085 | Bacteria | 8923 |
| 821 | Ga0495619_0039955 | 3300053085 | Bacteria | 3064 |
| 822 | Ga0500643_015533 | 3300053087 | Bacteria | 2607 |
| 823 | Ga0500618_050808 | 3300053125 | Bacteria | 939 |
| 824 | Ga0500616_0157618 | 3300053153 | Bacteria | 1044 |
| 825 | Ga0501084_0256551 | 3300054114 | Bacteria | 1476 |
| 826 | Ga0501084_0609379 | 3300054114 | Bacteria | 922 |
| 827 | Ga0501082_0195408 | 3300060353 | Bacteria | 1760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037068 | Ga0373925_1046371 | Ga0373925_1046371_52_456 | 119 |
| 2 | 3300035119 | Ga0373956_0359398 | Ga0373956_0359398_96_485 | 126 |
| 3 | 3300035172 | Ga0373955_0799976 | Ga0373955_0799976_96_485 | 126 |
| 4 | 3300036401 | Ga0373937_0011937 | Ga0373937_0011937_1079_1468 | 126 |
| 5 | 3300046679 | Ga0495623_0162577 | Ga0495623_0162577_90_479 | 126 |
| 6 | 3300035724 | Ga0373933_0058259 | Ga0373933_0058259_1013_1399 | 127 |
| 7 | 3300039437 | Ga0436365_1657697 | Ga0436365_1657697_99_500 | 129 |
| 8 | 3300049513 | Ga0501290_023607 | Ga0501290_023607_188_592 | 129 |
| 9 | 3300005293 | Ga0065715_10390111 | Ga0065715_103901112 | 131 |
| 10 | 3300005327 | Ga0070658_10812213 | Ga0070658_108122131 | 131 |
| 11 | 3300005335 | Ga0070666_10593102 | Ga0070666_105931021 | 131 |
| 12 | 3300005336 | Ga0070680_101411609 | Ga0070680_1014116091 | 131 |
| 13 | 3300005339 | Ga0070660_100080982 | Ga0070660_1000809822 | 131 |
| 14 | 3300005344 | Ga0070661_100004323 | Ga0070661_10000432312 | 131 |
| 15 | 3300005344 | Ga0070661_101084605 | Ga0070661_1010846051 | 131 |
| 16 | 3300005355 | Ga0070671_100249224 | Ga0070671_1002492242 | 131 |
| 17 | 3300005364 | Ga0070673_101110781 | Ga0070673_1011107812 | 131 |
| 18 | 3300005364 | Ga0070673_101856597 | Ga0070673_1018565971 | 131 |
| 19 | 3300005367 | Ga0070667_100593223 | Ga0070667_1005932231 | 131 |
| 20 | 3300005434 | Ga0070709_10015243 | Ga0070709_100152434 | 131 |
| 21 | 3300005434 | Ga0070709_10081687 | Ga0070709_100816871 | 131 |
| 22 | 3300005435 | Ga0070714_100179077 | Ga0070714_1001790772 | 131 |
| 23 | 3300005436 | Ga0070713_100000012 | Ga0070713_10000001251 | 131 |
| 24 | 3300005439 | Ga0070711_100111375 | Ga0070711_1001113751 | 131 |
| 25 | 3300005471 | Ga0070698_101443563 | Ga0070698_1014435631 | 131 |
| 26 | 3300005518 | Ga0070699_100589986 | Ga0070699_1005899861 | 131 |
| 27 | 3300005535 | Ga0070684_100464266 | Ga0070684_1004642662 | 131 |
| 28 | 3300005539 | Ga0068853_100002793 | Ga0068853_10000279315 | 131 |
| 29 | 3300005545 | Ga0070695_100032902 | Ga0070695_1000329022 | 131 |
| 30 | 3300005546 | Ga0070696_100583789 | Ga0070696_1005837892 | 131 |
| 31 | 3300005547 | Ga0070693_100014668 | Ga0070693_1000146683 | 131 |
| 32 | 3300005548 | Ga0070665_100000157 | Ga0070665_100000157104 | 131 |
| 33 | 3300005548 | Ga0070665_100078063 | Ga0070665_1000780632 | 131 |
| 34 | 3300005563 | Ga0068855_101151644 | Ga0068855_1011516442 | 131 |
| 35 | 3300005564 | Ga0070664_100086902 | Ga0070664_1000869021 | 131 |
| 36 | 3300005577 | Ga0068857_100026843 | Ga0068857_1000268432 | 131 |
| 37 | 3300005614 | Ga0068856_100001210 | Ga0068856_10000121022 | 131 |
| 38 | 3300005614 | Ga0068856_100078356 | Ga0068856_1000783563 | 131 |
| 39 | 3300005615 | Ga0070702_101626769 | Ga0070702_1016267691 | 131 |
| 40 | 3300005616 | Ga0068852_100211425 | Ga0068852_1002114252 | 131 |
| 41 | 3300005618 | Ga0068864_101186828 | Ga0068864_1011868281 | 131 |
| 42 | 3300005841 | Ga0068863_100076285 | Ga0068863_1000762852 | 131 |
| 43 | 3300005841 | Ga0068863_100485610 | Ga0068863_1004856102 | 131 |
| 44 | 3300005842 | Ga0068858_100330898 | Ga0068858_1003308982 | 131 |
| 45 | 3300006173 | Ga0070716_100018353 | Ga0070716_1000183534 | 131 |
| 46 | 3300006173 | Ga0070716_100418950 | Ga0070716_1004189502 | 131 |
| 47 | 3300006175 | Ga0070712_100016744 | Ga0070712_1000167443 | 131 |
| 48 | 3300006175 | Ga0070712_100032887 | Ga0070712_1000328875 | 131 |
| 49 | 3300006237 | Ga0097621_100274900 | Ga0097621_1002749002 | 131 |
| 50 | 3300006237 | Ga0097621_101179577 | Ga0097621_1011795771 | 131 |
| 51 | 3300006358 | Ga0068871_100214734 | Ga0068871_1002147342 | 131 |
| 52 | 3300006914 | Ga0075436_100000426 | Ga0075436_10000042622 | 131 |
| 53 | 3300006914 | Ga0075436_100028231 | Ga0075436_1000282312 | 131 |
| 54 | 3300006914 | Ga0075436_100465411 | Ga0075436_1004654112 | 131 |
| 55 | 3300007076 | Ga0075435_100026536 | Ga0075435_1000265364 | 131 |
| 56 | 3300009093 | Ga0105240_10018775 | Ga0105240_100187754 | 131 |
| 57 | 3300009093 | Ga0105240_10541878 | Ga0105240_105418783 | 131 |
| 58 | 3300009093 | Ga0105240_10779198 | Ga0105240_107791982 | 131 |
| 59 | 3300009174 | Ga0105241_12005357 | Ga0105241_120053571 | 131 |
| 60 | 3300009177 | Ga0105248_11623458 | Ga0105248_116234581 | 131 |
| 61 | 3300009545 | Ga0105237_10001801 | Ga0105237_100018014 | 131 |
| 62 | 3300009551 | Ga0105238_10004248 | Ga0105238_100042488 | 131 |
| 63 | 3300010375 | Ga0105239_10267471 | Ga0105239_102674712 | 131 |
| 64 | 3300010375 | Ga0105239_10526121 | Ga0105239_105261212 | 131 |
| 65 | 3300013100 | Ga0157373_10011046 | Ga0157373_100110464 | 131 |
| 66 | 3300013104 | Ga0157370_10000832 | Ga0157370_100008327 | 131 |
| 67 | 3300013296 | Ga0157374_12134771 | Ga0157374_121347712 | 131 |
| 68 | 3300013297 | Ga0157378_10336913 | Ga0157378_103369132 | 131 |
| 69 | 3300013306 | Ga0163162_10416440 | Ga0163162_104164402 | 131 |
| 70 | 3300013307 | Ga0157372_10419050 | Ga0157372_104190502 | 131 |
| 71 | 3300014325 | Ga0163163_10143373 | Ga0163163_101433732 | 131 |
| 72 | 3300014325 | Ga0163163_10535745 | Ga0163163_105357452 | 131 |
| 73 | 3300014968 | Ga0157379_10094726 | Ga0157379_100947263 | 131 |
| 74 | 3300014968 | Ga0157379_10265766 | Ga0157379_102657663 | 131 |
| 75 | 3300014968 | Ga0157379_10445141 | Ga0157379_104451412 | 131 |
| 76 | 3300025903 | Ga0207680_10566024 | Ga0207680_105660242 | 131 |
| 77 | 3300025906 | Ga0207699_10012526 | Ga0207699_100125263 | 131 |
| 78 | 3300025906 | Ga0207699_10053089 | Ga0207699_100530893 | 131 |
| 79 | 3300025911 | Ga0207654_10055190 | Ga0207654_100551902 | 131 |
| 80 | 3300025913 | Ga0207695_10085826 | Ga0207695_100858265 | 131 |
| 81 | 3300025913 | Ga0207695_10534683 | Ga0207695_105346832 | 131 |
| 82 | 3300025914 | Ga0207671_10465240 | Ga0207671_104652401 | 131 |
| 83 | 3300025915 | Ga0207693_10001624 | Ga0207693_1000162419 | 131 |
| 84 | 3300025915 | Ga0207693_10003724 | Ga0207693_100037243 | 131 |
| 85 | 3300025916 | Ga0207663_10063043 | Ga0207663_100630434 | 131 |
| 86 | 3300025916 | Ga0207663_10189417 | Ga0207663_101894172 | 131 |
| 87 | 3300025917 | Ga0207660_10298926 | Ga0207660_102989261 | 131 |
| 88 | 3300025920 | Ga0207649_10000037 | Ga0207649_1000003796 | 131 |
| 89 | 3300025920 | Ga0207649_10231460 | Ga0207649_102314602 | 131 |
| 90 | 3300025922 | Ga0207646_10822098 | Ga0207646_108220981 | 131 |
| 91 | 3300025924 | Ga0207694_10088416 | Ga0207694_100884162 | 131 |
| 92 | 3300025928 | Ga0207700_10000058 | Ga0207700_1000005837 | 131 |
| 93 | 3300025928 | Ga0207700_10475083 | Ga0207700_104750832 | 131 |
| 94 | 3300025929 | Ga0207664_10156740 | Ga0207664_101567402 | 131 |
| 95 | 3300025929 | Ga0207664_11974379 | Ga0207664_119743791 | 131 |
| 96 | 3300025931 | Ga0207644_10230485 | Ga0207644_102304852 | 131 |
| 97 | 3300025939 | Ga0207665_10027408 | Ga0207665_100274084 | 131 |
| 98 | 3300025941 | Ga0207711_10070613 | Ga0207711_100706132 | 131 |
| 99 | 3300025945 | Ga0207679_10164353 | Ga0207679_101643533 | 131 |
| 100 | 3300025960 | Ga0207651_10675397 | Ga0207651_106753972 | 131 |
| 101 | 3300026023 | Ga0207677_10090314 | Ga0207677_100903142 | 131 |
| 102 | 3300026035 | Ga0207703_10157415 | Ga0207703_101574152 | 131 |
| 103 | 3300026041 | Ga0207639_10071634 | Ga0207639_100716343 | 131 |
| 104 | 3300026041 | Ga0207639_11458194 | Ga0207639_114581941 | 131 |
| 105 | 3300026078 | Ga0207702_10000045 | Ga0207702_1000004532 | 131 |
| 106 | 3300026078 | Ga0207702_10110858 | Ga0207702_101108582 | 131 |
| 107 | 3300026088 | Ga0207641_10075722 | Ga0207641_100757222 | 131 |
| 108 | 3300026095 | Ga0207676_10024942 | Ga0207676_100249422 | 131 |
| 109 | 3300026095 | Ga0207676_12297969 | Ga0207676_122979692 | 131 |
| 110 | 3300026116 | Ga0207674_10001401 | Ga0207674_1000140111 | 131 |
| 111 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031687 | 131 |
| 112 | 3300028800 | Ga0265338_10042419 | Ga0265338_100424193 | 131 |
| 113 | 3300028800 | Ga0265338_10539643 | Ga0265338_105396432 | 131 |
| 114 | 3300031238 | Ga0265332_10436705 | Ga0265332_104367051 | 131 |
| 115 | 3300031241 | Ga0265325_10000600 | Ga0265325_1000060027 | 131 |
| 116 | 3300031249 | Ga0265339_10401562 | Ga0265339_104015621 | 131 |
| 117 | 3300031344 | Ga0265316_10021352 | Ga0265316_100213527 | 131 |
| 118 | 3300031344 | Ga0265316_10092697 | Ga0265316_100926972 | 131 |
| 119 | 3300031595 | Ga0265313_10006817 | Ga0265313_100068171 | 131 |
| 120 | 3300031712 | Ga0265342_10172281 | Ga0265342_101722812 | 131 |
| 121 | 3300031824 | Ga0307413_10398590 | Ga0307413_103985902 | 131 |
| 122 | 3300032004 | Ga0307414_10300698 | Ga0307414_103006983 | 131 |
| 123 | 3300035111 | Ga0373923_0372536 | Ga0373923_0372536_166_570 | 131 |
| 124 | 3300035170 | Ga0373943_0129399 | Ga0373943_0129399_355_759 | 131 |
| 125 | 3300035692 | Ga0373935_0736019 | Ga0373935_0736019_273_677 | 131 |
| 126 | 3300035724 | Ga0373933_0361474 | Ga0373933_0361474_34_438 | 131 |
| 127 | 3300035724 | Ga0373933_0380565 | Ga0373933_0380565_98_502 | 131 |
| 128 | 3300036401 | Ga0373937_0005483 | Ga0373937_0005483_208_612 | 131 |
| 129 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_552507_552911 | 131 |
| 130 | 3300037466 | Ga0395898_0030042 | Ga0395898_0030042_3409_3813 | 131 |
| 131 | 3300037471 | Ga0395905_0019957 | Ga0395905_0019957_3271_3675 | 131 |
| 132 | 3300037853 | Ga0436364_0567052 | Ga0436364_0567052_232_636 | 131 |
| 133 | 3300038443 | Ga0395901_0000013 | Ga0395901_0000013_150874_151278 | 131 |
| 134 | 3300039447 | Ga0436361_0621516 | Ga0436361_0621516_17_421 | 131 |
| 135 | 3300046460 | Ga0495638_0453726 | Ga0495638_0453726_185_589 | 131 |
| 136 | 3300046471 | Ga0495650_0082801 | Ga0495650_0082801_325_729 | 131 |
| 137 | 3300046528 | Ga0495642_0017498 | Ga0495642_0017498_1960_2364 | 131 |
| 138 | 3300046616 | Ga0495668_0255064 | Ga0495668_0255064_336_740 | 131 |
| 139 | 3300046660 | Ga0495625_0200083 | Ga0495625_0200083_418_822 | 131 |
| 140 | 3300046660 | Ga0495625_0381465 | Ga0495625_0381465_97_501 | 131 |
| 141 | 3300046683 | Ga0495658_0767441 | Ga0495658_0767441_66_470 | 131 |
| 142 | 3300046684 | Ga0495669_0386925 | Ga0495669_0386925_217_621 | 131 |
| 143 | 3300048088 | Ga0495602_1138817 | Ga0495602_1138817_40_444 | 131 |
| 144 | 3300048903 | Ga0496100_0127627 | Ga0496100_0127627_884_1288 | 131 |
| 145 | 3300048904 | Ga0496101_0816426 | Ga0496101_0816426_32_436 | 131 |
| 146 | 3300048905 | Ga0496102_0044088 | Ga0496102_0044088_2937_3341 | 131 |
| 147 | 3300048905 | Ga0496102_1521630 | Ga0496102_1521630_83_487 | 131 |
| 148 | 3300048906 | Ga0496103_0129366 | Ga0496103_0129366_521_925 | 131 |
| 149 | 3300048907 | Ga0496104_0082923 | Ga0496104_0082923_1703_2107 | 131 |
| 150 | 3300048911 | Ga0496108_0634468 | Ga0496108_0634468_106_510 | 131 |
| 151 | 3300048912 | Ga0496109_0039413 | Ga0496109_0039413_1036_1440 | 131 |
| 152 | 3300048913 | Ga0496110_0200388 | Ga0496110_0200388_920_1324 | 131 |
| 153 | 3300048914 | Ga0496111_0485367 | Ga0496111_0485367_121_525 | 131 |
| 154 | 3300048915 | Ga0496112_0083032 | Ga0496112_0083032_1708_2112 | 131 |
| 155 | 3300048915 | Ga0496112_0542833 | Ga0496112_0542833_129_533 | 131 |
| 156 | 3300048916 | Ga0496113_0118905 | Ga0496113_0118905_1414_1818 | 131 |
| 157 | 3300048918 | Ga0496115_0005720 | Ga0496115_0005720_1721_2125 | 131 |
| 158 | 3300049580 | Ga0501046_0207514 | Ga0501046_0207514_818_1222 | 131 |
| 159 | 3300050490 | nmdc:mga03n38_376267_c1 | nmdc:mga03n38_376267_c1_221_625 | 131 |
| 160 | 3300050512 | nmdc:mga0n895_115692_c1 | nmdc:mga0n895_115692_c1_370_774 | 131 |
| 161 | 3300050512 | nmdc:mga0n895_266438_c1 | nmdc:mga0n895_266438_c1_309_713 | 131 |
| 162 | 3300050513 | nmdc:mga0rr50_17230_c1 | nmdc:mga0rr50_17230_c1_1679_2083 | 131 |
| 163 | 3300050513 | nmdc:mga0rr50_42416_c1 | nmdc:mga0rr50_42416_c1_2868_3272 | 131 |
| 164 | 3300050514 | nmdc:mga08x19_283728_c1 | nmdc:mga08x19_283728_c1_42_446 | 131 |
| 165 | 3300050514 | nmdc:mga08x19_836_c1 | nmdc:mga08x19_836_c1_14293_14697 | 131 |
| 166 | iso_pu_bacteria | 2508501050 | 2508727677 | 136 |
| 167 | iso_pu_bacteria | 2508501114 | 2509079881 | 136 |
| 168 | iso_pu_bacteria | 2773857925 | 2774869136 | 136 |
| 169 | iso_pu_bacteria | 2775506901 | 2776258406 | 136 |
| 170 | iso_pu_bacteria | 2835312727 | 2835319673 | 136 |
| 171 | iso_pu_bacteria | 2882456835 | 2882457635 | 136 |
| 172 | iso_pu_bacteria | 2884298095 | 2884301199 | 136 |
| 173 | iso_pu_bacteria | 2894232714 | 2894236143 | 136 |
| 174 | 3300031727 | Ga0316576_10595996 | Ga0316576_105959962 | 137 |
| 175 | 3300037068 | Ga0373925_1589956 | Ga0373925_1589956_35_454 | 137 |
| 176 | 3300039093 | Ga0400489_56277 | Ga0400489_56277_1728_2153 | 137 |
| 177 | 3300050514 | nmdc:mga08x19_647588_c1 | nmdc:mga08x19_647588_c1_92_514 | 138 |
| 178 | 3300005356 | Ga0070674_100223967 | Ga0070674_1002239672 | 139 |
| 179 | 3300005459 | Ga0068867_100793056 | Ga0068867_1007930562 | 139 |
| 180 | 3300005536 | Ga0070697_101685632 | Ga0070697_1016856322 | 139 |
| 181 | 3300005548 | Ga0070665_100856036 | Ga0070665_1008560362 | 139 |
| 182 | 3300006880 | Ga0075429_100029763 | Ga0075429_1000297632 | 139 |
| 183 | 3300009094 | Ga0111539_10585087 | Ga0111539_105850871 | 139 |
| 184 | 3300009148 | Ga0105243_10216819 | Ga0105243_102168192 | 139 |
| 185 | 3300009553 | Ga0105249_10607224 | Ga0105249_106072242 | 139 |
| 186 | 3300011119 | Ga0105246_10841000 | Ga0105246_108410002 | 139 |
| 187 | 3300014326 | Ga0157380_10019743 | Ga0157380_100197434 | 139 |
| 188 | 3300014745 | Ga0157377_11046017 | Ga0157377_110460172 | 139 |
| 189 | 3300025927 | Ga0207687_10704318 | Ga0207687_107043182 | 139 |
| 190 | 3300025961 | Ga0207712_10483484 | Ga0207712_104834842 | 139 |
| 191 | 3300025972 | Ga0207668_10296384 | Ga0207668_102963842 | 139 |
| 192 | 3300025981 | Ga0207640_10650680 | Ga0207640_106506802 | 139 |
| 193 | 3300026075 | Ga0207708_10347840 | Ga0207708_103478402 | 139 |
| 194 | 3300026089 | Ga0207648_11423677 | Ga0207648_114236771 | 139 |
| 195 | 3300031548 | Ga0307408_100072949 | Ga0307408_1000729492 | 139 |
| 196 | 3300031665 | Ga0316575_10071072 | Ga0316575_100710722 | 139 |
| 197 | 3300031728 | Ga0316578_10208208 | Ga0316578_102082082 | 139 |
| 198 | 3300031728 | Ga0316578_10286107 | Ga0316578_102861071 | 139 |
| 199 | 3300031728 | Ga0316578_10342957 | Ga0316578_103429572 | 139 |
| 200 | 3300031852 | Ga0307410_10068033 | Ga0307410_100680332 | 139 |
| 201 | 3300031903 | Ga0307407_10007668 | Ga0307407_100076682 | 139 |
| 202 | 3300031911 | Ga0307412_10070809 | Ga0307412_100708093 | 139 |
| 203 | 3300031995 | Ga0307409_100018694 | Ga0307409_1000186945 | 139 |
| 204 | 3300032002 | Ga0307416_100071314 | Ga0307416_1000713143 | 139 |
| 205 | 3300032004 | Ga0307414_10233760 | Ga0307414_102337602 | 139 |
| 206 | 3300032005 | Ga0307411_10797125 | Ga0307411_107971251 | 139 |
| 207 | 3300032126 | Ga0307415_100007254 | Ga0307415_1000072543 | 139 |
| 208 | 3300035398 | Ga0316574_0057469 | Ga0316574_0057469_1133_1564 | 139 |
| 209 | 3300039093 | Ga0400489_13735 | Ga0400489_13735_615_1043 | 139 |
| 210 | 3300044658 | Ga0466972_0453199 | Ga0466972_0453199_102_539 | 139 |
| 211 | 3300044901 | Ga0466960_0104697 | Ga0466960_0104697_555_989 | 139 |
| 212 | 3300045049 | Ga0466959_0693512 | Ga0466959_0693512_95_529 | 139 |
| 213 | 3300045976 | Ga0466967_0632186 | Ga0466967_0632186_336_764 | 139 |
| 214 | 3300046615 | Ga0495656_0293316 | Ga0495656_0293316_338_772 | 139 |
| 215 | 3300049671 | Ga0501238_061117 | Ga0501238_061117_41_475 | 139 |
| 216 | 3300049682 | Ga0501252_007217 | Ga0501252_007217_490_924 | 139 |
| 217 | 3300049741 | Ga0501079_1403568 | Ga0501079_1403568_104_526 | 139 |
| 218 | 3300050508 | nmdc:mga09592_150274_c1 | nmdc:mga09592_150274_c1_298_729 | 139 |
| 219 | 3300050510 | nmdc:mga06r32_445947_c1 | nmdc:mga06r32_445947_c1_549_980 | 139 |
| 220 | 3300053087 | Ga0500643_015533 | Ga0500643_015533_1553_1981 | 139 |
| 221 | 3300053153 | Ga0500616_0157618 | Ga0500616_0157618_338_772 | 139 |
| 222 | iso_pu_bacteria | 2897803580 | 2897806683 | 139 |
| 223 | 3300048910 | Ga0496107_1088131 | Ga0496107_1088131_98_529 | 140 |
| 224 | 3300048917 | Ga0496114_0510968 | Ga0496114_0510968_609_1037 | 140 |
| 225 | 3300049590 | Ga0501074_0058699 | Ga0501074_0058699_2314_2742 | 140 |
| 226 | 3300049742 | Ga0501080_0119890 | Ga0501080_0119890_868_1296 | 140 |
| 227 | 3300054114 | Ga0501084_0609379 | Ga0501084_0609379_231_659 | 140 |
| 228 | 3300025949 | Ga0207667_10033582 | Ga0207667_100335825 | 145 |
| 229 | 3300039437 | Ga0436365_0691718 | Ga0436365_0691718_71_511 | 145 |
| 230 | 2209111006 | 2214748018 | 2213758855 | 146 |
| 231 | 3300000042 | ARSoilYngRDRAFT_c00630 | ARSoilYngRDRAFT_006302 | 146 |
| 232 | 3300000043 | ARcpr5yngRDRAFT_c000865 | ARcpr5yngRDRAFT_0008652 | 146 |
| 233 | 3300000044 | ARSoilOldRDRAFT_c000163 | ARSoilOldRDRAFT_0001633 | 146 |
| 234 | 3300000652 | ARCol0yngRDRAFT_1000023 | ARCol0yngRDRAFT_100002330 | 146 |
| 235 | 3300001430 | JGI24032J14994_102472 | JGI24032J14994_1024721 | 146 |
| 236 | 3300001976 | JGI24752J21851_1004962 | JGI24752J21851_10049621 | 146 |
| 237 | 3300001977 | JGI24746J21847_1001103 | JGI24746J21847_10011032 | 146 |
| 238 | 3300001979 | JGI24740J21852_10060130 | JGI24740J21852_100601301 | 146 |
| 239 | 3300001989 | JGI24739J22299_10000209 | JGI24739J22299_1000020916 | 146 |
| 240 | 3300001990 | JGI24737J22298_10000739 | JGI24737J22298_100007397 | 146 |
| 241 | 3300001990 | JGI24737J22298_10003173 | JGI24737J22298_100031732 | 146 |
| 242 | 3300001991 | JGI24743J22301_10029838 | JGI24743J22301_100298382 | 146 |
| 243 | 3300002070 | JGI24750J21931_1004243 | JGI24750J21931_10042432 | 146 |
| 244 | 3300002070 | JGI24750J21931_1047560 | JGI24750J21931_10475601 | 146 |
| 245 | 3300002073 | JGI24745J21846_1000377 | JGI24745J21846_10003772 | 146 |
| 246 | 3300002074 | JGI24748J21848_1004941 | JGI24748J21848_10049411 | 146 |
| 247 | 3300002075 | JGI24738J21930_10000520 | JGI24738J21930_100005202 | 146 |
| 248 | 3300002076 | JGI24749J21850_1000283 | JGI24749J21850_10002833 | 146 |
| 249 | 3300002077 | JGI24744J21845_10015850 | JGI24744J21845_100158501 | 146 |
| 250 | 3300002077 | JGI24744J21845_10078976 | JGI24744J21845_100789761 | 146 |
| 251 | 3300002126 | JGI24035J26624_1010270 | JGI24035J26624_10102702 | 146 |
| 252 | 3300002239 | JGI24034J26672_10012331 | JGI24034J26672_100123312 | 146 |
| 253 | 3300002244 | JGI24742J22300_10000279 | JGI24742J22300_100002797 | 146 |
| 254 | 3300003911 | JGI25405J52794_10116340 | JGI25405J52794_101163401 | 146 |
| 255 | 3300005288 | Ga0065714_10231999 | Ga0065714_102319992 | 146 |
| 256 | 3300005289 | Ga0065704_10102335 | Ga0065704_101023352 | 146 |
| 257 | 3300005290 | Ga0065712_10070789 | Ga0065712_100707892 | 146 |
| 258 | 3300005293 | Ga0065715_10099305 | Ga0065715_100993052 | 146 |
| 259 | 3300005293 | Ga0065715_10125489 | Ga0065715_101254893 | 146 |
| 260 | 3300005328 | Ga0070676_10002633 | Ga0070676_100026337 | 146 |
| 261 | 3300005329 | Ga0070683_100010864 | Ga0070683_1000108643 | 146 |
| 262 | 3300005330 | Ga0070690_100012955 | Ga0070690_1000129554 | 146 |
| 263 | 3300005330 | Ga0070690_100844279 | Ga0070690_1008442792 | 146 |
| 264 | 3300005331 | Ga0070670_100008185 | Ga0070670_1000081853 | 146 |
| 265 | 3300005331 | Ga0070670_100148297 | Ga0070670_1001482972 | 146 |
| 266 | 3300005333 | Ga0070677_10000109 | Ga0070677_1000010915 | 146 |
| 267 | 3300005334 | Ga0068869_100004148 | Ga0068869_1000041487 | 146 |
| 268 | 3300005334 | Ga0068869_100258341 | Ga0068869_1002583412 | 146 |
| 269 | 3300005335 | Ga0070666_10022824 | Ga0070666_100228242 | 146 |
| 270 | 3300005335 | Ga0070666_10143141 | Ga0070666_101431412 | 146 |
| 271 | 3300005336 | Ga0070680_100022932 | Ga0070680_1000229323 | 146 |
| 272 | 3300005336 | Ga0070680_100242970 | Ga0070680_1002429702 | 146 |
| 273 | 3300005337 | Ga0070682_100000459 | Ga0070682_10000045918 | 146 |
| 274 | 3300005337 | Ga0070682_100493834 | Ga0070682_1004938342 | 146 |
| 275 | 3300005337 | Ga0070682_100508390 | Ga0070682_1005083902 | 146 |
| 276 | 3300005338 | Ga0068868_100000443 | Ga0068868_10000044323 | 146 |
| 277 | 3300005339 | Ga0070660_100005284 | Ga0070660_1000052843 | 146 |
| 278 | 3300005339 | Ga0070660_100041218 | Ga0070660_1000412184 | 146 |
| 279 | 3300005339 | Ga0070660_100612727 | Ga0070660_1006127271 | 146 |
| 280 | 3300005340 | Ga0070689_100000423 | Ga0070689_10000042311 | 146 |
| 281 | 3300005340 | Ga0070689_100023357 | Ga0070689_1000233574 | 146 |
| 282 | 3300005341 | Ga0070691_10001927 | Ga0070691_100019273 | 146 |
| 283 | 3300005341 | Ga0070691_10006906 | Ga0070691_100069065 | 146 |
| 284 | 3300005341 | Ga0070691_10120243 | Ga0070691_101202432 | 146 |
| 285 | 3300005343 | Ga0070687_100008328 | Ga0070687_1000083283 | 146 |
| 286 | 3300005344 | Ga0070661_100003440 | Ga0070661_1000034403 | 146 |
| 287 | 3300005344 | Ga0070661_100088598 | Ga0070661_1000885981 | 146 |
| 288 | 3300005345 | Ga0070692_10000262 | Ga0070692_100002626 | 146 |
| 289 | 3300005347 | Ga0070668_100001027 | Ga0070668_10000102715 | 146 |
| 290 | 3300005347 | Ga0070668_100271025 | Ga0070668_1002710252 | 146 |
| 291 | 3300005353 | Ga0070669_100016848 | Ga0070669_1000168483 | 146 |
| 292 | 3300005353 | Ga0070669_100024237 | Ga0070669_1000242374 | 146 |
| 293 | 3300005354 | Ga0070675_100036920 | Ga0070675_1000369203 | 146 |
| 294 | 3300005354 | Ga0070675_100072259 | Ga0070675_1000722592 | 146 |
| 295 | 3300005355 | Ga0070671_100000889 | Ga0070671_1000008894 | 146 |
| 296 | 3300005356 | Ga0070674_100001251 | Ga0070674_1000012519 | 146 |
| 297 | 3300005364 | Ga0070673_100000050 | Ga0070673_10000005041 | 146 |
| 298 | 3300005364 | Ga0070673_100295228 | Ga0070673_1002952282 | 146 |
| 299 | 3300005365 | Ga0070688_100001640 | Ga0070688_1000016405 | 146 |
| 300 | 3300005365 | Ga0070688_100020856 | Ga0070688_1000208563 | 146 |
| 301 | 3300005366 | Ga0070659_100054851 | Ga0070659_1000548513 | 146 |
| 302 | 3300005366 | Ga0070659_100203138 | Ga0070659_1002031382 | 146 |
| 303 | 3300005366 | Ga0070659_101325279 | Ga0070659_1013252791 | 146 |
| 304 | 3300005367 | Ga0070667_100010954 | Ga0070667_1000109546 | 146 |
| 305 | 3300005367 | Ga0070667_100069382 | Ga0070667_1000693822 | 146 |
| 306 | 3300005367 | Ga0070667_100406486 | Ga0070667_1004064862 | 146 |
| 307 | 3300005367 | Ga0070667_100439211 | Ga0070667_1004392112 | 146 |
| 308 | 3300005406 | Ga0070703_10002811 | Ga0070703_100028116 | 146 |
| 309 | 3300005406 | Ga0070703_10028544 | Ga0070703_100285442 | 146 |
| 310 | 3300005437 | Ga0070710_10709619 | Ga0070710_107096191 | 146 |
| 311 | 3300005438 | Ga0070701_10000093 | Ga0070701_100000939 | 146 |
| 312 | 3300005438 | Ga0070701_10047371 | Ga0070701_100473712 | 146 |
| 313 | 3300005439 | Ga0070711_100020995 | Ga0070711_1000209955 | 146 |
| 314 | 3300005440 | Ga0070705_100003661 | Ga0070705_1000036618 | 146 |
| 315 | 3300005441 | Ga0070700_100007763 | Ga0070700_1000077637 | 146 |
| 316 | 3300005441 | Ga0070700_100021519 | Ga0070700_1000215192 | 146 |
| 317 | 3300005444 | Ga0070694_100005185 | Ga0070694_1000051857 | 146 |
| 318 | 3300005445 | Ga0070708_100020666 | Ga0070708_1000206664 | 146 |
| 319 | 3300005445 | Ga0070708_100218825 | Ga0070708_1002188252 | 146 |
| 320 | 3300005455 | Ga0070663_100002633 | Ga0070663_1000026332 | 146 |
| 321 | 3300005455 | Ga0070663_100031761 | Ga0070663_1000317613 | 146 |
| 322 | 3300005455 | Ga0070663_100134592 | Ga0070663_1001345922 | 146 |
| 323 | 3300005456 | Ga0070678_100022908 | Ga0070678_1000229083 | 146 |
| 324 | 3300005456 | Ga0070678_100033305 | Ga0070678_1000333053 | 146 |
| 325 | 3300005456 | Ga0070678_100612588 | Ga0070678_1006125882 | 146 |
| 326 | 3300005457 | Ga0070662_100015806 | Ga0070662_1000158066 | 146 |
| 327 | 3300005457 | Ga0070662_101313768 | Ga0070662_1013137681 | 146 |
| 328 | 3300005458 | Ga0070681_10001623 | Ga0070681_1000162311 | 146 |
| 329 | 3300005458 | Ga0070681_10069010 | Ga0070681_100690102 | 146 |
| 330 | 3300005458 | Ga0070681_10705590 | Ga0070681_107055901 | 146 |
| 331 | 3300005458 | Ga0070681_11004549 | Ga0070681_110045492 | 146 |
| 332 | 3300005459 | Ga0068867_100001138 | Ga0068867_1000011389 | 146 |
| 333 | 3300005459 | Ga0068867_100667403 | Ga0068867_1006674032 | 146 |
| 334 | 3300005459 | Ga0068867_100878849 | Ga0068867_1008788492 | 146 |
| 335 | 3300005466 | Ga0070685_10000984 | Ga0070685_100009844 | 146 |
| 336 | 3300005466 | Ga0070685_10114177 | Ga0070685_101141772 | 146 |
| 337 | 3300005467 | Ga0070706_100179090 | Ga0070706_1001790902 | 146 |
| 338 | 3300005530 | Ga0070679_100013850 | Ga0070679_1000138504 | 146 |
| 339 | 3300005530 | Ga0070679_101244613 | Ga0070679_1012446131 | 146 |
| 340 | 3300005535 | Ga0070684_100037719 | Ga0070684_1000377193 | 146 |
| 341 | 3300005535 | Ga0070684_100067840 | Ga0070684_1000678401 | 146 |
| 342 | 3300005536 | Ga0070697_100030045 | Ga0070697_1000300455 | 146 |
| 343 | 3300005536 | Ga0070697_100537695 | Ga0070697_1005376952 | 146 |
| 344 | 3300005539 | Ga0068853_100002995 | Ga0068853_10000299510 | 146 |
| 345 | 3300005539 | Ga0068853_100013300 | Ga0068853_1000133005 | 146 |
| 346 | 3300005543 | Ga0070672_100003943 | Ga0070672_1000039438 | 146 |
| 347 | 3300005543 | Ga0070672_100041581 | Ga0070672_1000415813 | 146 |
| 348 | 3300005544 | Ga0070686_100008091 | Ga0070686_1000080912 | 146 |
| 349 | 3300005544 | Ga0070686_100082965 | Ga0070686_1000829652 | 146 |
| 350 | 3300005545 | Ga0070695_100000824 | Ga0070695_1000008243 | 146 |
| 351 | 3300005545 | Ga0070695_100050648 | Ga0070695_1000506482 | 146 |
| 352 | 3300005546 | Ga0070696_100012369 | Ga0070696_1000123696 | 146 |
| 353 | 3300005546 | Ga0070696_100028235 | Ga0070696_1000282353 | 146 |
| 354 | 3300005547 | Ga0070693_100001975 | Ga0070693_1000019757 | 146 |
| 355 | 3300005547 | Ga0070693_100111912 | Ga0070693_1001119121 | 146 |
| 356 | 3300005547 | Ga0070693_100134965 | Ga0070693_1001349652 | 146 |
| 357 | 3300005548 | Ga0070665_100093184 | Ga0070665_1000931842 | 146 |
| 358 | 3300005549 | Ga0070704_100011005 | Ga0070704_1000110057 | 146 |
| 359 | 3300005563 | Ga0068855_100015755 | Ga0068855_1000157556 | 146 |
| 360 | 3300005563 | Ga0068855_100240618 | Ga0068855_1002406182 | 146 |
| 361 | 3300005564 | Ga0070664_100059292 | Ga0070664_1000592923 | 146 |
| 362 | 3300005564 | Ga0070664_100220741 | Ga0070664_1002207412 | 146 |
| 363 | 3300005577 | Ga0068857_100008305 | Ga0068857_1000083056 | 146 |
| 364 | 3300005578 | Ga0068854_100022991 | Ga0068854_1000229913 | 146 |
| 365 | 3300005578 | Ga0068854_100097524 | Ga0068854_1000975242 | 146 |
| 366 | 3300005614 | Ga0068856_100003821 | Ga0068856_10000382112 | 146 |
| 367 | 3300005614 | Ga0068856_100041409 | Ga0068856_1000414091 | 146 |
| 368 | 3300005615 | Ga0070702_100000497 | Ga0070702_1000004978 | 146 |
| 369 | 3300005615 | Ga0070702_100228403 | Ga0070702_1002284032 | 146 |
| 370 | 3300005616 | Ga0068852_100001222 | Ga0068852_1000012228 | 146 |
| 371 | 3300005616 | Ga0068852_100105348 | Ga0068852_1001053482 | 146 |
| 372 | 3300005616 | Ga0068852_101060942 | Ga0068852_1010609422 | 146 |
| 373 | 3300005617 | Ga0068859_100026376 | Ga0068859_1000263762 | 146 |
| 374 | 3300005617 | Ga0068859_100027984 | Ga0068859_1000279846 | 146 |
| 375 | 3300005617 | Ga0068859_100134641 | Ga0068859_1001346413 | 146 |
| 376 | 3300005618 | Ga0068864_100001074 | Ga0068864_1000010747 | 146 |
| 377 | 3300005618 | Ga0068864_100358925 | Ga0068864_1003589251 | 146 |
| 378 | 3300005618 | Ga0068864_100512744 | Ga0068864_1005127442 | 146 |
| 379 | 3300005718 | Ga0068866_10017244 | Ga0068866_100172443 | 146 |
| 380 | 3300005718 | Ga0068866_10143816 | Ga0068866_101438162 | 146 |
| 381 | 3300005718 | Ga0068866_10647985 | Ga0068866_106479852 | 146 |
| 382 | 3300005719 | Ga0068861_100001328 | Ga0068861_10000132810 | 146 |
| 383 | 3300005840 | Ga0068870_10000051 | Ga0068870_1000005124 | 146 |
| 384 | 3300005841 | Ga0068863_100008364 | Ga0068863_1000083644 | 146 |
| 385 | 3300005842 | Ga0068858_100005147 | Ga0068858_1000051478 | 146 |
| 386 | 3300005842 | Ga0068858_100108764 | Ga0068858_1001087643 | 146 |
| 387 | 3300005843 | Ga0068860_100001825 | Ga0068860_10000182521 | 146 |
| 388 | 3300005843 | Ga0068860_100021392 | Ga0068860_1000213926 | 146 |
| 389 | 3300005843 | Ga0068860_100560845 | Ga0068860_1005608452 | 146 |
| 390 | 3300005844 | Ga0068862_100017904 | Ga0068862_1000179047 | 146 |
| 391 | 3300005937 | Ga0081455_10000081 | Ga0081455_1000008126 | 146 |
| 392 | 3300006048 | Ga0075363_100159594 | Ga0075363_1001595942 | 146 |
| 393 | 3300006163 | Ga0070715_10007047 | Ga0070715_100070474 | 146 |
| 394 | 3300006175 | Ga0070712_100927247 | Ga0070712_1009272471 | 146 |
| 395 | 3300006237 | Ga0097621_100001496 | Ga0097621_1000014967 | 146 |
| 396 | 3300006237 | Ga0097621_100016302 | Ga0097621_1000163024 | 146 |
| 397 | 3300006358 | Ga0068871_100000576 | Ga0068871_10000057626 | 146 |
| 398 | 3300006358 | Ga0068871_100021574 | Ga0068871_1000215744 | 146 |
| 399 | 3300006871 | Ga0075434_100008056 | Ga0075434_1000080567 | 146 |
| 400 | 3300006871 | Ga0075434_100941695 | Ga0075434_1009416951 | 146 |
| 401 | 3300006881 | Ga0068865_100003854 | Ga0068865_1000038547 | 146 |
| 402 | 3300006881 | Ga0068865_100010914 | Ga0068865_1000109145 | 146 |
| 403 | 3300006881 | Ga0068865_100322155 | Ga0068865_1003221552 | 146 |
| 404 | 3300006914 | Ga0075436_100271937 | Ga0075436_1002719372 | 146 |
| 405 | 3300006931 | Ga0097620_100026376 | Ga0097620_1000263762 | 146 |
| 406 | 3300006931 | Ga0097620_100027983 | Ga0097620_1000279832 | 146 |
| 407 | 3300006931 | Ga0097620_100134638 | Ga0097620_1001346383 | 146 |
| 408 | 3300007076 | Ga0075435_100292029 | Ga0075435_1002920292 | 146 |
| 409 | 3300009036 | Ga0105244_10084313 | Ga0105244_100843132 | 146 |
| 410 | 3300009093 | Ga0105240_10218962 | Ga0105240_102189622 | 146 |
| 411 | 3300009093 | Ga0105240_10584149 | Ga0105240_105841492 | 146 |
| 412 | 3300009094 | Ga0111539_10000757 | Ga0111539_1000075725 | 146 |
| 413 | 3300009098 | Ga0105245_10002488 | Ga0105245_100024888 | 146 |
| 414 | 3300009098 | Ga0105245_10189127 | Ga0105245_101891272 | 146 |
| 415 | 3300009101 | Ga0105247_10004963 | Ga0105247_100049633 | 146 |
| 416 | 3300009101 | Ga0105247_10009138 | Ga0105247_100091382 | 146 |
| 417 | 3300009101 | Ga0105247_10270153 | Ga0105247_102701531 | 146 |
| 418 | 3300009101 | Ga0105247_10487898 | Ga0105247_104878982 | 146 |
| 419 | 3300009148 | Ga0105243_10003214 | Ga0105243_100032147 | 146 |
| 420 | 3300009148 | Ga0105243_10063065 | Ga0105243_100630652 | 146 |
| 421 | 3300009148 | Ga0105243_10071314 | Ga0105243_100713142 | 146 |
| 422 | 3300009174 | Ga0105241_10013069 | Ga0105241_100130696 | 146 |
| 423 | 3300009174 | Ga0105241_10082049 | Ga0105241_100820493 | 146 |
| 424 | 3300009174 | Ga0105241_10137051 | Ga0105241_101370512 | 146 |
| 425 | 3300009176 | Ga0105242_10002016 | Ga0105242_100020162 | 146 |
| 426 | 3300009177 | Ga0105248_10003871 | Ga0105248_100038717 | 146 |
| 427 | 3300009177 | Ga0105248_10018471 | Ga0105248_100184715 | 146 |
| 428 | 3300009177 | Ga0105248_10148475 | Ga0105248_101484752 | 146 |
| 429 | 3300009177 | Ga0105248_10296617 | Ga0105248_102966172 | 146 |
| 430 | 3300009545 | Ga0105237_10024783 | Ga0105237_100247833 | 146 |
| 431 | 3300009545 | Ga0105237_10025451 | Ga0105237_100254516 | 146 |
| 432 | 3300009551 | Ga0105238_10133598 | Ga0105238_101335982 | 146 |
| 433 | 3300009551 | Ga0105238_10137144 | Ga0105238_101371442 | 146 |
| 434 | 3300009553 | Ga0105249_10001193 | Ga0105249_100011936 | 146 |
| 435 | 3300009553 | Ga0105249_10020158 | Ga0105249_100201586 | 146 |
| 436 | 3300009553 | Ga0105249_10236960 | Ga0105249_102369602 | 146 |
| 437 | 3300010375 | Ga0105239_10030616 | Ga0105239_100306162 | 146 |
| 438 | 3300010375 | Ga0105239_10712648 | Ga0105239_107126482 | 146 |
| 439 | 3300010375 | Ga0105239_10789373 | Ga0105239_107893732 | 146 |
| 440 | 3300011119 | Ga0105246_10000231 | Ga0105246_100002317 | 146 |
| 441 | 3300011119 | Ga0105246_10509445 | Ga0105246_105094452 | 146 |
| 442 | 3300012498 | Ga0157345_1016400 | Ga0157345_10164001 | 146 |
| 443 | 3300012507 | Ga0157342_1000445 | Ga0157342_10004453 | 146 |
| 444 | 3300012513 | Ga0157326_1003345 | Ga0157326_10033452 | 146 |
| 445 | 3300012515 | Ga0157338_1000781 | Ga0157338_10007812 | 146 |
| 446 | 3300013102 | Ga0157371_10013762 | Ga0157371_100137626 | 146 |
| 447 | 3300013102 | Ga0157371_10215226 | Ga0157371_102152262 | 146 |
| 448 | 3300013102 | Ga0157371_11538920 | Ga0157371_115389201 | 146 |
| 449 | 3300013104 | Ga0157370_10246046 | Ga0157370_102460462 | 146 |
| 450 | 3300013105 | Ga0157369_10469673 | Ga0157369_104696732 | 146 |
| 451 | 3300013296 | Ga0157374_10035420 | Ga0157374_100354202 | 146 |
| 452 | 3300013296 | Ga0157374_10037940 | Ga0157374_100379405 | 146 |
| 453 | 3300013296 | Ga0157374_11320734 | Ga0157374_113207341 | 146 |
| 454 | 3300013297 | Ga0157378_10022746 | Ga0157378_100227464 | 146 |
| 455 | 3300013297 | Ga0157378_10095614 | Ga0157378_100956143 | 146 |
| 456 | 3300013297 | Ga0157378_10149112 | Ga0157378_101491122 | 146 |
| 457 | 3300013306 | Ga0163162_10006149 | Ga0163162_100061497 | 146 |
| 458 | 3300013306 | Ga0163162_10117622 | Ga0163162_101176222 | 146 |
| 459 | 3300013306 | Ga0163162_10122467 | Ga0163162_101224673 | 146 |
| 460 | 3300013306 | Ga0163162_12223522 | Ga0163162_122235222 | 146 |
| 461 | 3300013307 | Ga0157372_10025465 | Ga0157372_100254652 | 146 |
| 462 | 3300013307 | Ga0157372_11542789 | Ga0157372_115427891 | 146 |
| 463 | 3300013308 | Ga0157375_10021653 | Ga0157375_100216536 | 146 |
| 464 | 3300013308 | Ga0157375_10304086 | Ga0157375_103040862 | 146 |
| 465 | 3300014325 | Ga0163163_10001320 | Ga0163163_1000132017 | 146 |
| 466 | 3300014325 | Ga0163163_10032310 | Ga0163163_100323105 | 146 |
| 467 | 3300014325 | Ga0163163_12197028 | Ga0163163_121970281 | 146 |
| 468 | 3300014326 | Ga0157380_10002744 | Ga0157380_100027446 | 146 |
| 469 | 3300014326 | Ga0157380_10047959 | Ga0157380_100479593 | 146 |
| 470 | 3300014745 | Ga0157377_10000164 | Ga0157377_1000016425 | 146 |
| 471 | 3300014745 | Ga0157377_10100198 | Ga0157377_101001982 | 146 |
| 472 | 3300014968 | Ga0157379_10012672 | Ga0157379_100126728 | 146 |
| 473 | 3300014968 | Ga0157379_10291614 | Ga0157379_102916142 | 146 |
| 474 | 3300014968 | Ga0157379_10374963 | Ga0157379_103749632 | 146 |
| 475 | 3300014969 | Ga0157376_10002102 | Ga0157376_100021027 | 146 |
| 476 | 3300014969 | Ga0157376_10009727 | Ga0157376_100097275 | 146 |
| 477 | 3300014969 | Ga0157376_10079367 | Ga0157376_100793671 | 146 |
| 478 | 3300017792 | Ga0163161_10002837 | Ga0163161_100028377 | 146 |
| 479 | 3300021384 | Ga0213876_10263921 | Ga0213876_102639212 | 146 |
| 480 | 3300025271 | Ga0207666_1000051 | Ga0207666_100005118 | 146 |
| 481 | 3300025271 | Ga0207666_1006768 | Ga0207666_10067682 | 146 |
| 482 | 3300025290 | Ga0207673_1000958 | Ga0207673_10009584 | 146 |
| 483 | 3300025315 | Ga0207697_10000662 | Ga0207697_1000066216 | 146 |
| 484 | 3300025315 | Ga0207697_10006653 | Ga0207697_100066535 | 146 |
| 485 | 3300025728 | Ga0207655_1070435 | Ga0207655_10704352 | 146 |
| 486 | 3300025885 | Ga0207653_10000546 | Ga0207653_1000054610 | 146 |
| 487 | 3300025885 | Ga0207653_10013666 | Ga0207653_100136662 | 146 |
| 488 | 3300025893 | Ga0207682_10000072 | Ga0207682_1000007223 | 146 |
| 489 | 3300025898 | Ga0207692_10027923 | Ga0207692_100279232 | 146 |
| 490 | 3300025899 | Ga0207642_10010607 | Ga0207642_100106073 | 146 |
| 491 | 3300025899 | Ga0207642_10075738 | Ga0207642_100757383 | 146 |
| 492 | 3300025899 | Ga0207642_10208714 | Ga0207642_102087142 | 146 |
| 493 | 3300025900 | Ga0207710_10009082 | Ga0207710_100090825 | 146 |
| 494 | 3300025900 | Ga0207710_10137418 | Ga0207710_101374181 | 146 |
| 495 | 3300025900 | Ga0207710_10223636 | Ga0207710_102236362 | 146 |
| 496 | 3300025900 | Ga0207710_10329954 | Ga0207710_103299541 | 146 |
| 497 | 3300025901 | Ga0207688_10000229 | Ga0207688_1000022923 | 146 |
| 498 | 3300025901 | Ga0207688_10020259 | Ga0207688_100202592 | 146 |
| 499 | 3300025903 | Ga0207680_10025714 | Ga0207680_100257143 | 146 |
| 500 | 3300025904 | Ga0207647_10003353 | Ga0207647_1000335310 | 146 |
| 501 | 3300025904 | Ga0207647_10019233 | Ga0207647_100192334 | 146 |
| 502 | 3300025905 | Ga0207685_10039891 | Ga0207685_100398912 | 146 |
| 503 | 3300025907 | Ga0207645_10000966 | Ga0207645_1000096622 | 146 |
| 504 | 3300025908 | Ga0207643_10000004 | Ga0207643_1000000448 | 146 |
| 505 | 3300025910 | Ga0207684_10126441 | Ga0207684_101264412 | 146 |
| 506 | 3300025911 | Ga0207654_10001472 | Ga0207654_100014726 | 146 |
| 507 | 3300025912 | Ga0207707_10010417 | Ga0207707_100104179 | 146 |
| 508 | 3300025912 | Ga0207707_10026555 | Ga0207707_100265554 | 146 |
| 509 | 3300025913 | Ga0207695_10284678 | Ga0207695_102846782 | 146 |
| 510 | 3300025913 | Ga0207695_10596992 | Ga0207695_105969922 | 146 |
| 511 | 3300025914 | Ga0207671_10026742 | Ga0207671_100267424 | 146 |
| 512 | 3300025915 | Ga0207693_10028672 | Ga0207693_100286722 | 146 |
| 513 | 3300025915 | Ga0207693_10417378 | Ga0207693_104173782 | 146 |
| 514 | 3300025916 | Ga0207663_10093512 | Ga0207663_100935122 | 146 |
| 515 | 3300025916 | Ga0207663_10236502 | Ga0207663_102365021 | 146 |
| 516 | 3300025917 | Ga0207660_10000648 | Ga0207660_100006488 | 146 |
| 517 | 3300025917 | Ga0207660_10083840 | Ga0207660_100838402 | 146 |
| 518 | 3300025917 | Ga0207660_10144095 | Ga0207660_101440952 | 146 |
| 519 | 3300025918 | Ga0207662_10000317 | Ga0207662_1000031718 | 146 |
| 520 | 3300025918 | Ga0207662_10007326 | Ga0207662_100073262 | 146 |
| 521 | 3300025919 | Ga0207657_10002047 | Ga0207657_1000204718 | 146 |
| 522 | 3300025919 | Ga0207657_10049663 | Ga0207657_100496634 | 146 |
| 523 | 3300025919 | Ga0207657_10057207 | Ga0207657_100572075 | 146 |
| 524 | 3300025920 | Ga0207649_10000262 | Ga0207649_1000026223 | 146 |
| 525 | 3300025921 | Ga0207652_10045204 | Ga0207652_100452044 | 146 |
| 526 | 3300025921 | Ga0207652_10391323 | Ga0207652_103913232 | 146 |
| 527 | 3300025922 | Ga0207646_10987405 | Ga0207646_109874051 | 146 |
| 528 | 3300025923 | Ga0207681_10025833 | Ga0207681_100258334 | 146 |
| 529 | 3300025923 | Ga0207681_10042994 | Ga0207681_100429943 | 146 |
| 530 | 3300025924 | Ga0207694_10230136 | Ga0207694_102301362 | 146 |
| 531 | 3300025925 | Ga0207650_10004313 | Ga0207650_100043139 | 146 |
| 532 | 3300025925 | Ga0207650_10141954 | Ga0207650_101419542 | 146 |
| 533 | 3300025926 | Ga0207659_10001684 | Ga0207659_100016847 | 146 |
| 534 | 3300025927 | Ga0207687_10001501 | Ga0207687_1000150110 | 146 |
| 535 | 3300025931 | Ga0207644_10000467 | Ga0207644_1000046722 | 146 |
| 536 | 3300025932 | Ga0207690_10001228 | Ga0207690_1000122810 | 146 |
| 537 | 3300025933 | Ga0207706_10001679 | Ga0207706_100016796 | 146 |
| 538 | 3300025933 | Ga0207706_10009690 | Ga0207706_100096905 | 146 |
| 539 | 3300025933 | Ga0207706_10066033 | Ga0207706_100660333 | 146 |
| 540 | 3300025934 | Ga0207686_10006089 | Ga0207686_100060892 | 146 |
| 541 | 3300025934 | Ga0207686_10325675 | Ga0207686_103256752 | 146 |
| 542 | 3300025935 | Ga0207709_10006275 | Ga0207709_100062754 | 146 |
| 543 | 3300025935 | Ga0207709_10013556 | Ga0207709_100135565 | 146 |
| 544 | 3300025935 | Ga0207709_10026438 | Ga0207709_100264383 | 146 |
| 545 | 3300025936 | Ga0207670_10014641 | Ga0207670_100146415 | 146 |
| 546 | 3300025936 | Ga0207670_10063548 | Ga0207670_100635482 | 146 |
| 547 | 3300025936 | Ga0207670_10175747 | Ga0207670_101757472 | 146 |
| 548 | 3300025937 | Ga0207669_10002049 | Ga0207669_1000204910 | 146 |
| 549 | 3300025937 | Ga0207669_10341629 | Ga0207669_103416292 | 146 |
| 550 | 3300025937 | Ga0207669_10490369 | Ga0207669_104903692 | 146 |
| 551 | 3300025937 | Ga0207669_11075571 | Ga0207669_110755711 | 146 |
| 552 | 3300025938 | Ga0207704_10003529 | Ga0207704_100035295 | 146 |
| 553 | 3300025939 | Ga0207665_10172346 | Ga0207665_101723461 | 146 |
| 554 | 3300025940 | Ga0207691_10002874 | Ga0207691_100028746 | 146 |
| 555 | 3300025940 | Ga0207691_10061507 | Ga0207691_100615072 | 146 |
| 556 | 3300025940 | Ga0207691_10318936 | Ga0207691_103189362 | 146 |
| 557 | 3300025941 | Ga0207711_10006776 | Ga0207711_100067766 | 146 |
| 558 | 3300025941 | Ga0207711_10025537 | Ga0207711_100255372 | 146 |
| 559 | 3300025941 | Ga0207711_10190335 | Ga0207711_101903353 | 146 |
| 560 | 3300025941 | Ga0207711_10320427 | Ga0207711_103204272 | 146 |
| 561 | 3300025942 | Ga0207689_10000203 | Ga0207689_1000020324 | 146 |
| 562 | 3300025942 | Ga0207689_10235266 | Ga0207689_102352662 | 146 |
| 563 | 3300025944 | Ga0207661_10012457 | Ga0207661_100124572 | 146 |
| 564 | 3300025944 | Ga0207661_10276806 | Ga0207661_102768062 | 146 |
| 565 | 3300025945 | Ga0207679_10000157 | Ga0207679_1000015732 | 146 |
| 566 | 3300025945 | Ga0207679_10082307 | Ga0207679_100823073 | 146 |
| 567 | 3300025945 | Ga0207679_10383000 | Ga0207679_103830002 | 146 |
| 568 | 3300025949 | Ga0207667_10815216 | Ga0207667_108152162 | 146 |
| 569 | 3300025960 | Ga0207651_10006717 | Ga0207651_100067176 | 146 |
| 570 | 3300025961 | Ga0207712_10002224 | Ga0207712_100022248 | 146 |
| 571 | 3300025972 | Ga0207668_10003217 | Ga0207668_100032174 | 146 |
| 572 | 3300025972 | Ga0207668_10216753 | Ga0207668_102167532 | 146 |
| 573 | 3300025981 | Ga0207640_10004454 | Ga0207640_100044546 | 146 |
| 574 | 3300025981 | Ga0207640_10309405 | Ga0207640_103094052 | 146 |
| 575 | 3300025986 | Ga0207658_10027932 | Ga0207658_100279323 | 146 |
| 576 | 3300025986 | Ga0207658_10159306 | Ga0207658_101593062 | 146 |
| 577 | 3300025986 | Ga0207658_10531504 | Ga0207658_105315042 | 146 |
| 578 | 3300026023 | Ga0207677_10001675 | Ga0207677_100016756 | 146 |
| 579 | 3300026035 | Ga0207703_10001852 | Ga0207703_1000185219 | 146 |
| 580 | 3300026035 | Ga0207703_10033946 | Ga0207703_100339462 | 146 |
| 581 | 3300026035 | Ga0207703_10479003 | Ga0207703_104790032 | 146 |
| 582 | 3300026041 | Ga0207639_10084659 | Ga0207639_100846592 | 146 |
| 583 | 3300026041 | Ga0207639_10401737 | Ga0207639_104017372 | 146 |
| 584 | 3300026067 | Ga0207678_10001809 | Ga0207678_1000180916 | 146 |
| 585 | 3300026067 | Ga0207678_10012723 | Ga0207678_100127236 | 146 |
| 586 | 3300026067 | Ga0207678_10082363 | Ga0207678_100823634 | 146 |
| 587 | 3300026067 | Ga0207678_10598988 | Ga0207678_105989882 | 146 |
| 588 | 3300026075 | Ga0207708_10001199 | Ga0207708_1000119916 | 146 |
| 589 | 3300026075 | Ga0207708_10003067 | Ga0207708_100030678 | 146 |
| 590 | 3300026078 | Ga0207702_10003404 | Ga0207702_100034049 | 146 |
| 591 | 3300026078 | Ga0207702_10060437 | Ga0207702_100604372 | 146 |
| 592 | 3300026088 | Ga0207641_10023651 | Ga0207641_100236513 | 146 |
| 593 | 3300026088 | Ga0207641_10595331 | Ga0207641_105953312 | 146 |
| 594 | 3300026088 | Ga0207641_10747655 | Ga0207641_107476552 | 146 |
| 595 | 3300026089 | Ga0207648_10002073 | Ga0207648_100020736 | 146 |
| 596 | 3300026089 | Ga0207648_10133046 | Ga0207648_101330462 | 146 |
| 597 | 3300026095 | Ga0207676_10000990 | Ga0207676_1000099015 | 146 |
| 598 | 3300026095 | Ga0207676_10270696 | Ga0207676_102706962 | 146 |
| 599 | 3300026095 | Ga0207676_10439308 | Ga0207676_104393082 | 146 |
| 600 | 3300026095 | Ga0207676_11557231 | Ga0207676_115572311 | 146 |
| 601 | 3300026116 | Ga0207674_10000897 | Ga0207674_100008976 | 146 |
| 602 | 3300026118 | Ga0207675_100001726 | Ga0207675_10000172618 | 146 |
| 603 | 3300026118 | Ga0207675_100076333 | Ga0207675_1000763332 | 146 |
| 604 | 3300026118 | Ga0207675_101458828 | Ga0207675_1014588282 | 146 |
| 605 | 3300026121 | Ga0207683_10001176 | Ga0207683_100011769 | 146 |
| 606 | 3300026121 | Ga0207683_10020527 | Ga0207683_100205274 | 146 |
| 607 | 3300026121 | Ga0207683_10561411 | Ga0207683_105614112 | 146 |
| 608 | 3300026121 | Ga0207683_10845913 | Ga0207683_108459132 | 146 |
| 609 | 3300026142 | Ga0207698_10003743 | Ga0207698_100037438 | 146 |
| 610 | 3300027364 | Ga0209967_1015249 | Ga0209967_10152491 | 146 |
| 611 | 3300027617 | Ga0210002_1008815 | Ga0210002_10088152 | 146 |
| 612 | 3300027665 | Ga0209983_1005259 | Ga0209983_10052592 | 146 |
| 613 | 3300027682 | Ga0209971_1017323 | Ga0209971_10173232 | 146 |
| 614 | 3300027682 | Ga0209971_1033085 | Ga0209971_10330852 | 146 |
| 615 | 3300027695 | Ga0209966_1000247 | Ga0209966_100024715 | 146 |
| 616 | 3300027717 | Ga0209998_10002233 | Ga0209998_100022333 | 146 |
| 617 | 3300027717 | Ga0209998_10002778 | Ga0209998_100027782 | 146 |
| 618 | 3300027876 | Ga0209974_10015951 | Ga0209974_100159512 | 146 |
| 619 | 3300027876 | Ga0209974_10053834 | Ga0209974_100538342 | 146 |
| 620 | 3300027876 | Ga0209974_10131583 | Ga0209974_101315831 | 146 |
| 621 | 3300027907 | Ga0207428_10000792 | Ga0207428_1000079230 | 146 |
| 622 | 3300028379 | Ga0268266_10033993 | Ga0268266_100339933 | 146 |
| 623 | 3300028380 | Ga0268265_10002187 | Ga0268265_100021872 | 146 |
| 624 | 3300028380 | Ga0268265_10225652 | Ga0268265_102256523 | 146 |
| 625 | 3300028381 | Ga0268264_10018562 | Ga0268264_100185626 | 146 |
| 626 | 3300028381 | Ga0268264_10104372 | Ga0268264_101043722 | 146 |
| 627 | 3300028381 | Ga0268264_10464861 | Ga0268264_104648612 | 146 |
| 628 | 3300031247 | Ga0265340_10025762 | Ga0265340_100257623 | 146 |
| 629 | 3300034816 | Ga0373930_0000250 | Ga0373930_0000250_6249_6689 | 146 |
| 630 | 3300034816 | Ga0373930_0003593 | Ga0373930_0003593_1188_1628 | 146 |
| 631 | 3300034817 | Ga0373948_0000061 | Ga0373948_0000061_5264_5704 | 146 |
| 632 | 3300034817 | Ga0373948_0016450 | Ga0373948_0016450_542_982 | 146 |
| 633 | 3300034818 | Ga0373950_0000537 | Ga0373950_0000537_2584_3024 | 146 |
| 634 | 3300034818 | Ga0373950_0004026 | Ga0373950_0004026_775_1215 | 146 |
| 635 | 3300034819 | Ga0373958_0000048 | Ga0373958_0000048_1913_2353 | 146 |
| 636 | 3300034819 | Ga0373958_0000826 | Ga0373958_0000826_248_688 | 146 |
| 637 | 3300034820 | Ga0373959_0000735 | Ga0373959_0000735_3159_3599 | 146 |
| 638 | 3300034957 | Ga0373938_0000471 | Ga0373938_0000471_1930_2370 | 146 |
| 639 | 3300034957 | Ga0373938_0000691 | Ga0373938_0000691_4588_5028 | 146 |
| 640 | 3300035083 | Ga0373926_0016674 | Ga0373926_0016674_844_1284 | 146 |
| 641 | 3300035084 | Ga0373928_0005735 | Ga0373928_0005735_1910_2350 | 146 |
| 642 | 3300035085 | Ga0373929_0000096 | Ga0373929_0000096_2412_2852 | 146 |
| 643 | 3300035085 | Ga0373929_0003497 | Ga0373929_0003497_1543_1983 | 146 |
| 644 | 3300035086 | Ga0373934_0207910 | Ga0373934_0207910_256_696 | 146 |
| 645 | 3300035088 | Ga0373940_0000023 | Ga0373940_0000023_10475_10915 | 146 |
| 646 | 3300035088 | Ga0373940_0043859 | Ga0373940_0043859_303_743 | 146 |
| 647 | 3300035089 | Ga0373944_0028788 | Ga0373944_0028788_166_606 | 146 |
| 648 | 3300035090 | Ga0373949_0001146 | Ga0373949_0001146_1371_1811 | 146 |
| 649 | 3300035090 | Ga0373949_0001755 | Ga0373949_0001755_3596_4036 | 146 |
| 650 | 3300035091 | Ga0373951_0000876 | Ga0373951_0000876_2050_2490 | 146 |
| 651 | 3300035091 | Ga0373951_0012771 | Ga0373951_0012771_792_1232 | 146 |
| 652 | 3300035091 | Ga0373951_0034363 | Ga0373951_0034363_228_668 | 146 |
| 653 | 3300035092 | Ga0373952_0000126 | Ga0373952_0000126_6189_6629 | 146 |
| 654 | 3300035092 | Ga0373952_0004467 | Ga0373952_0004467_1476_1916 | 146 |
| 655 | 3300035111 | Ga0373923_0033921 | Ga0373923_0033921_1333_1773 | 146 |
| 656 | 3300035111 | Ga0373923_0066067 | Ga0373923_0066067_103_543 | 146 |
| 657 | 3300035112 | Ga0373932_0000553 | Ga0373932_0000553_8585_9025 | 146 |
| 658 | 3300035112 | Ga0373932_0016039 | Ga0373932_0016039_867_1307 | 146 |
| 659 | 3300035113 | Ga0373936_0148732 | Ga0373936_0148732_157_597 | 146 |
| 660 | 3300035114 | Ga0373939_0000419 | Ga0373939_0000419_4210_4650 | 146 |
| 661 | 3300035114 | Ga0373939_0000663 | Ga0373939_0000663_1372_1812 | 146 |
| 662 | 3300035115 | Ga0373941_0000309 | Ga0373941_0000309_3126_3566 | 146 |
| 663 | 3300035115 | Ga0373941_0005456 | Ga0373941_0005456_668_1108 | 146 |
| 664 | 3300035116 | Ga0373945_0305703 | Ga0373945_0305703_188_628 | 146 |
| 665 | 3300035118 | Ga0373954_0004588 | Ga0373954_0004588_4222_4662 | 146 |
| 666 | 3300035118 | Ga0373954_0048635 | Ga0373954_0048635_1010_1450 | 146 |
| 667 | 3300035119 | Ga0373956_0060571 | Ga0373956_0060571_1096_1536 | 146 |
| 668 | 3300035120 | Ga0373957_0130326 | Ga0373957_0130326_306_746 | 146 |
| 669 | 3300035121 | Ga0373960_0002985 | Ga0373960_0002985_876_1316 | 146 |
| 670 | 3300035121 | Ga0373960_0017748 | Ga0373960_0017748_99_539 | 146 |
| 671 | 3300035170 | Ga0373943_0064807 | Ga0373943_0064807_1217_1657 | 146 |
| 672 | 3300035172 | Ga0373955_0017482 | Ga0373955_0017482_1196_1636 | 146 |
| 673 | 3300035172 | Ga0373955_0018792 | Ga0373955_0018792_1767_2207 | 146 |
| 674 | 3300035172 | Ga0373955_0242846 | Ga0373955_0242846_196_636 | 146 |
| 675 | 3300035207 | Ga0373942_0000081 | Ga0373942_0000081_13974_14414 | 146 |
| 676 | 3300035207 | Ga0373942_0005488 | Ga0373942_0005488_21_461 | 146 |
| 677 | 3300035207 | Ga0373942_0284926 | Ga0373942_0284926_41_481 | 146 |
| 678 | 3300035241 | Ga0373961_0010016 | Ga0373961_0010016_970_1410 | 146 |
| 679 | 3300035242 | Ga0373962_0000194 | Ga0373962_0000194_7810_8250 | 146 |
| 680 | 3300035242 | Ga0373962_0001329 | Ga0373962_0001329_1344_1784 | 146 |
| 681 | 3300035242 | Ga0373962_0279718 | Ga0373962_0279718_15_455 | 146 |
| 682 | 3300035410 | Ga0373924_0043119 | Ga0373924_0043119_299_739 | 146 |
| 683 | 3300035691 | Ga0373931_0001008 | Ga0373931_0001008_9078_9518 | 146 |
| 684 | 3300035691 | Ga0373931_0160221 | Ga0373931_0160221_515_955 | 146 |
| 685 | 3300035692 | Ga0373935_0077953 | Ga0373935_0077953_116_556 | 146 |
| 686 | 3300035692 | Ga0373935_0102433 | Ga0373935_0102433_691_1131 | 146 |
| 687 | 3300035695 | Ga0373927_0300442 | Ga0373927_0300442_188_628 | 146 |
| 688 | 3300035724 | Ga0373933_0000753 | Ga0373933_0000753_11301_11741 | 146 |
| 689 | 3300035724 | Ga0373933_0004608 | Ga0373933_0004608_798_1238 | 146 |
| 690 | 3300036401 | Ga0373937_0000655 | Ga0373937_0000655_52_492 | 146 |
| 691 | 3300036401 | Ga0373937_0012043 | Ga0373937_0012043_2387_2827 | 146 |
| 692 | 3300037068 | Ga0373925_0649210 | Ga0373925_0649210_304_744 | 146 |
| 693 | 3300037068 | Ga0373925_0759213 | Ga0373925_0759213_89_529 | 146 |
| 694 | 3300039437 | Ga0436365_0144344 | Ga0436365_0144344_7096_7536 | 146 |
| 695 | 3300039450 | Ga0436363_0327641 | Ga0436363_0327641_81_533 | 146 |
| 696 | 3300042005 | Ga0439448_0181842 | Ga0439448_0181842_232_672 | 146 |
| 697 | 3300042012 | Ga0439455_0011926 | Ga0439455_0011926_412_852 | 146 |
| 698 | 3300042016 | Ga0439463_015735 | Ga0439463_015735_1358_1798 | 146 |
| 699 | 3300042157 | Ga0439458_0113433 | Ga0439458_0113433_203_643 | 146 |
| 700 | 3300042437 | Ga0439444_0144195 | Ga0439444_0144195_17_457 | 146 |
| 701 | 3300042439 | Ga0439464_0045011 | Ga0439464_0045011_239_679 | 146 |
| 702 | 3300042876 | Ga0451577_0120856 | Ga0451577_0120856_851_1291 | 146 |
| 703 | 3300044712 | Ga0453684_0223027 | Ga0453684_0223027_1663_2103 | 146 |
| 704 | 3300045051 | Ga0451576_0006650 | Ga0451576_0006650_7086_7526 | 146 |
| 705 | 3300046454 | Ga0495592_0067596 | Ga0495592_0067596_1885_2325 | 146 |
| 706 | 3300046455 | Ga0495603_0028204 | Ga0495603_0028204_2004_2444 | 146 |
| 707 | 3300046461 | Ga0495641_0041535 | Ga0495641_0041535_1069_1509 | 146 |
| 708 | 3300046462 | Ga0495651_0048616 | Ga0495651_0048616_1926_2366 | 146 |
| 709 | 3300046462 | Ga0495651_0133324 | Ga0495651_0133324_285_725 | 146 |
| 710 | 3300046463 | Ga0495653_0003231 | Ga0495653_0003231_7567_8007 | 146 |
| 711 | 3300046463 | Ga0495653_0108077 | Ga0495653_0108077_392_832 | 146 |
| 712 | 3300046463 | Ga0495653_0225385 | Ga0495653_0225385_104_544 | 146 |
| 713 | 3300046472 | Ga0495580_0151887 | Ga0495580_0151887_822_1262 | 146 |
| 714 | 3300046473 | Ga0495582_0539890 | Ga0495582_0539890_50_490 | 146 |
| 715 | 3300046475 | Ga0495639_0011384 | Ga0495639_0011384_1180_1620 | 146 |
| 716 | 3300046476 | Ga0495662_0029637 | Ga0495662_0029637_535_975 | 146 |
| 717 | 3300046477 | Ga0495664_0002327 | Ga0495664_0002327_5761_6201 | 146 |
| 718 | 3300046477 | Ga0495664_0052695 | Ga0495664_0052695_761_1201 | 146 |
| 719 | 3300046491 | Ga0495584_0198216 | Ga0495584_0198216_526_966 | 146 |
| 720 | 3300046499 | Ga0495594_0050759 | Ga0495594_0050759_1389_1829 | 146 |
| 721 | 3300046511 | Ga0495608_0000428 | Ga0495608_0000428_4301_4741 | 146 |
| 722 | 3300046511 | Ga0495608_0056952 | Ga0495608_0056952_827_1267 | 146 |
| 723 | 3300046514 | Ga0495618_0022993 | Ga0495618_0022993_912_1352 | 146 |
| 724 | 3300046516 | Ga0495628_0065732 | Ga0495628_0065732_1154_1594 | 146 |
| 725 | 3300046518 | Ga0495631_0289900 | Ga0495631_0289900_180_620 | 146 |
| 726 | 3300046529 | Ga0495652_0110912 | Ga0495652_0110912_957_1397 | 146 |
| 727 | 3300046529 | Ga0495652_0113198 | Ga0495652_0113198_1242_1682 | 146 |
| 728 | 3300046531 | Ga0495665_0344311 | Ga0495665_0344311_273_713 | 146 |
| 729 | 3300046533 | Ga0495640_0028613 | Ga0495640_0028613_2693_3133 | 146 |
| 730 | 3300046533 | Ga0495640_0167247 | Ga0495640_0167247_453_893 | 146 |
| 731 | 3300046535 | Ga0495586_0013401 | Ga0495586_0013401_3204_3644 | 146 |
| 732 | 3300046535 | Ga0495586_0038131 | Ga0495586_0038131_2050_2490 | 146 |
| 733 | 3300046536 | Ga0495587_0001490 | Ga0495587_0001490_6068_6508 | 146 |
| 734 | 3300046536 | Ga0495587_0038051 | Ga0495587_0038051_1404_1844 | 146 |
| 735 | 3300046543 | Ga0495645_0046734 | Ga0495645_0046734_1561_2001 | 146 |
| 736 | 3300046559 | Ga0495667_0034314 | Ga0495667_0034314_1150_1590 | 146 |
| 737 | 3300046559 | Ga0495667_0163059 | Ga0495667_0163059_209_649 | 146 |
| 738 | 3300046642 | Ga0495634_0141103 | Ga0495634_0141103_993_1433 | 146 |
| 739 | 3300046642 | Ga0495634_0309440 | Ga0495634_0309440_212_652 | 146 |
| 740 | 3300046663 | Ga0495635_0004055 | Ga0495635_0004055_2534_2974 | 146 |
| 741 | 3300046675 | Ga0495657_0008984 | Ga0495657_0008984_2626_3066 | 146 |
| 742 | 3300046675 | Ga0495657_0068961 | Ga0495657_0068961_583_1023 | 146 |
| 743 | 3300046678 | Ga0495599_0062738 | Ga0495599_0062738_1513_1953 | 146 |
| 744 | 3300046678 | Ga0495599_0220644 | Ga0495599_0220644_16_456 | 146 |
| 745 | 3300046679 | Ga0495623_0003897 | Ga0495623_0003897_5443_5883 | 146 |
| 746 | 3300046680 | Ga0495646_0003693 | Ga0495646_0003693_469_909 | 146 |
| 747 | 3300046683 | Ga0495658_0147172 | Ga0495658_0147172_781_1221 | 146 |
| 748 | 3300046684 | Ga0495669_0060091 | Ga0495669_0060091_397_837 | 146 |
| 749 | 3300046689 | Ga0495613_0050547 | Ga0495613_0050547_453_893 | 146 |
| 750 | 3300046690 | Ga0495624_0158258 | Ga0495624_0158258_265_705 | 146 |
| 751 | 3300046809 | Ga0495600_0000742 | Ga0495600_0000742_686_1126 | 146 |
| 752 | 3300046809 | Ga0495600_0052886 | Ga0495600_0052886_1643_2083 | 146 |
| 753 | 3300046809 | Ga0495600_0424839 | Ga0495600_0424839_55_495 | 146 |
| 754 | 3300047315 | Ga0495581_0038862 | Ga0495581_0038862_673_1113 | 146 |
| 755 | 3300047317 | Ga0495604_0014112 | Ga0495604_0014112_3880_4320 | 146 |
| 756 | 3300047319 | Ga0495674_0020069 | Ga0495674_0020069_4654_5094 | 146 |
| 757 | 3300047321 | Ga0495676_0556255 | Ga0495676_0556255_299_739 | 146 |
| 758 | 3300047322 | Ga0495680_0010686 | Ga0495680_0010686_7029_7469 | 146 |
| 759 | 3300047322 | Ga0495680_0018350 | Ga0495680_0018350_148_588 | 146 |
| 760 | 3300047322 | Ga0495680_0051288 | Ga0495680_0051288_1700_2140 | 146 |
| 761 | 3300047444 | Ga0495675_0047852 | Ga0495675_0047852_912_1352 | 146 |
| 762 | 3300047444 | Ga0495675_0312852 | Ga0495675_0312852_360_800 | 146 |
| 763 | 3300047445 | Ga0495677_0056502 | Ga0495677_0056502_78_518 | 146 |
| 764 | 3300047471 | Ga0495684_0147712 | Ga0495684_0147712_292_732 | 146 |
| 765 | 3300047673 | Ga0495593_0046887 | Ga0495593_0046887_673_1113 | 146 |
| 766 | 3300047673 | Ga0495593_0127246 | Ga0495593_0127246_377_817 | 146 |
| 767 | 3300048088 | Ga0495602_0002995 | Ga0495602_0002995_5597_6037 | 146 |
| 768 | 3300048088 | Ga0495602_0205776 | Ga0495602_0205776_871_1311 | 146 |
| 769 | 3300048089 | Ga0495614_0258948 | Ga0495614_0258948_63_503 | 146 |
| 770 | 3300048903 | Ga0496100_0004611 | Ga0496100_0004611_6333_6773 | 146 |
| 771 | 3300048903 | Ga0496100_0015132 | Ga0496100_0015132_1112_1552 | 146 |
| 772 | 3300048904 | Ga0496101_0002976 | Ga0496101_0002976_5106_5546 | 146 |
| 773 | 3300048904 | Ga0496101_0005327 | Ga0496101_0005327_7355_7795 | 146 |
| 774 | 3300048904 | Ga0496101_0814917 | Ga0496101_0814917_196_636 | 146 |
| 775 | 3300048905 | Ga0496102_0013825 | Ga0496102_0013825_3746_4186 | 146 |
| 776 | 3300048905 | Ga0496102_0085720 | Ga0496102_0085720_1824_2264 | 146 |
| 777 | 3300048905 | Ga0496102_0092433 | Ga0496102_0092433_1416_1856 | 146 |
| 778 | 3300048906 | Ga0496103_0005922 | Ga0496103_0005922_6128_6568 | 146 |
| 779 | 3300048906 | Ga0496103_0054581 | Ga0496103_0054581_1795_2235 | 146 |
| 780 | 3300048906 | Ga0496103_0268591 | Ga0496103_0268591_93_533 | 146 |
| 781 | 3300048906 | Ga0496103_0445005 | Ga0496103_0445005_203_643 | 146 |
| 782 | 3300048907 | Ga0496104_0004402 | Ga0496104_0004402_9452_9892 | 146 |
| 783 | 3300048908 | Ga0496105_0018185 | Ga0496105_0018185_2629_3069 | 146 |
| 784 | 3300048908 | Ga0496105_0433909 | Ga0496105_0433909_348_788 | 146 |
| 785 | 3300048909 | Ga0496106_0007498 | Ga0496106_0007498_2913_3353 | 146 |
| 786 | 3300048909 | Ga0496106_0008091 | Ga0496106_0008091_4176_4616 | 146 |
| 787 | 3300048909 | Ga0496106_0129614 | Ga0496106_0129614_1001_1441 | 146 |
| 788 | 3300048909 | Ga0496106_0161071 | Ga0496106_0161071_1073_1513 | 146 |
| 789 | 3300048910 | Ga0496107_0016877 | Ga0496107_0016877_2937_3377 | 146 |
| 790 | 3300048910 | Ga0496107_0036310 | Ga0496107_0036310_2803_3243 | 146 |
| 791 | 3300048910 | Ga0496107_0042376 | Ga0496107_0042376_2586_3026 | 146 |
| 792 | 3300048911 | Ga0496108_0005285 | Ga0496108_0005285_5327_5767 | 146 |
| 793 | 3300048911 | Ga0496108_0040061 | Ga0496108_0040061_2153_2593 | 146 |
| 794 | 3300048911 | Ga0496108_0319815 | Ga0496108_0319815_528_968 | 146 |
| 795 | 3300048912 | Ga0496109_0000543 | Ga0496109_0000543_13963_14403 | 146 |
| 796 | 3300048912 | Ga0496109_0008460 | Ga0496109_0008460_7450_7890 | 146 |
| 797 | 3300048913 | Ga0496110_0016819 | Ga0496110_0016819_3696_4136 | 146 |
| 798 | 3300048913 | Ga0496110_0072140 | Ga0496110_0072140_827_1267 | 146 |
| 799 | 3300048913 | Ga0496110_0085742 | Ga0496110_0085742_1167_1607 | 146 |
| 800 | 3300048913 | Ga0496110_0139452 | Ga0496110_0139452_230_670 | 146 |
| 801 | 3300048914 | Ga0496111_0025574 | Ga0496111_0025574_1587_2027 | 146 |
| 802 | 3300048914 | Ga0496111_0029448 | Ga0496111_0029448_2486_2926 | 146 |
| 803 | 3300048914 | Ga0496111_0162303 | Ga0496111_0162303_1169_1609 | 146 |
| 804 | 3300048915 | Ga0496112_0003072 | Ga0496112_0003072_10466_10906 | 146 |
| 805 | 3300048915 | Ga0496112_0140244 | Ga0496112_0140244_1159_1599 | 146 |
| 806 | 3300048915 | Ga0496112_0355101 | Ga0496112_0355101_303_743 | 146 |
| 807 | 3300048916 | Ga0496113_0021252 | Ga0496113_0021252_2577_3017 | 146 |
| 808 | 3300048916 | Ga0496113_0030289 | Ga0496113_0030289_3446_3886 | 146 |
| 809 | 3300048916 | Ga0496113_0183715 | Ga0496113_0183715_1098_1538 | 146 |
| 810 | 3300048916 | Ga0496113_0753123 | Ga0496113_0753123_258_698 | 146 |
| 811 | 3300048918 | Ga0496115_0009604 | Ga0496115_0009604_1347_1787 | 146 |
| 812 | 3300048918 | Ga0496115_0013470 | Ga0496115_0013470_985_1425 | 146 |
| 813 | 3300048918 | Ga0496115_0035764 | Ga0496115_0035764_997_1437 | 146 |
| 814 | 3300048918 | Ga0496115_0095238 | Ga0496115_0095238_673_1113 | 146 |
| 815 | 3300048918 | Ga0496115_0802427 | Ga0496115_0802427_73_513 | 146 |
| 816 | 3300049586 | Ga0501070_0667855 | Ga0501070_0667855_142_594 | 146 |
| 817 | 3300049586 | Ga0501070_1009724 | Ga0501070_1009724_69_509 | 146 |
| 818 | 3300049591 | Ga0501075_0057288 | Ga0501075_0057288_709_1149 | 146 |
| 819 | 3300049593 | Ga0501077_0077381 | Ga0501077_0077381_910_1350 | 146 |
| 820 | 3300049593 | Ga0501077_0330782 | Ga0501077_0330782_487_927 | 146 |
| 821 | 3300050508 | nmdc:mga09592_1574989_c1 | nmdc:mga09592_1574989_c1_36_476 | 146 |
| 822 | 3300050511 | nmdc:mga08y16_4145_c1 | nmdc:mga08y16_4145_c1_11147_11587 | 146 |
| 823 | 3300050512 | nmdc:mga0n895_4751_c1 | nmdc:mga0n895_4751_c1_7363_7803 | 146 |
| 824 | 3300050512 | nmdc:mga0n895_764754_c1 | nmdc:mga0n895_764754_c1_25_465 | 146 |
| 825 | 3300053077 | Ga0495601_0002457 | Ga0495601_0002457_3917_4357 | 146 |
| 826 | 3300053077 | Ga0495601_0006047 | Ga0495601_0006047_5871_6311 | 146 |
| 827 | 3300053078 | Ga0495612_0004300 | Ga0495612_0004300_3130_3570 | 146 |
| 828 | 3300053078 | Ga0495612_0012791 | Ga0495612_0012791_2664_3104 | 146 |
| 829 | 3300053084 | Ga0495595_0002370 | Ga0495595_0002370_4160_4600 | 146 |
| 830 | 3300053084 | Ga0495595_0004884 | Ga0495595_0004884_4608_5048 | 146 |
| 831 | 3300053085 | Ga0495619_0003606 | Ga0495619_0003606_307_747 | 146 |
| 832 | 3300053085 | Ga0495619_0004476 | Ga0495619_0004476_1725_2165 | 146 |
| 833 | 3300053085 | Ga0495619_0039955 | Ga0495619_0039955_895_1335 | 146 |
| 834 | 3300053125 | Ga0500618_050808 | Ga0500618_050808_237_677 | 146 |
| 835 | 3300054114 | Ga0501084_0256551 | Ga0501084_0256551_768_1208 | 146 |
| 836 | 3300060353 | Ga0501082_0195408 | Ga0501082_0195408_429_869 | 146 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rhe-assembly1.cif.gz_A | the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila | 0.8202 | 10 | 130 |
| 1kmz-assembly1.cif.gz_A | molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative | 0.8135 | 6 | 130 |
| 1kmz-assembly1.cif.gz_A | molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative | 0.7904 | 6 | 130 |
| 3rhe-assembly1.cif.gz_A | the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila | 0.7876 | 10 | 130 |
| 2pjs-assembly1.cif.gz_B | crystal structure of atu1953, protein of unknown function | 0.7402 | 79 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8533 | 77 | 130 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8441 | 77 | 128 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.817 | 77 | 139 | 3.30.720.110 |
| 3rheA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8125 | 10 | 130 | 3.10.180.10 |
| 3omsA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8055 | 77 | 131 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K2AJS8-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9949 | 77 | 146 |
GO:0051213
|
| AF-A0A653AYW7-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9926 | 77 | 132 |
GO:0051213
|
| AF-N9MQE2-F1-model_v4 | VOC domain-containing protein | 0.988 | 79 | 132 |
|
| AF-A0A7W0G7P7-F1-model_v4 | VOC family protein | 0.9859 | 81 | 144 |
|
| AF-A0A3C0FM12-F1-model_v4 | Glyoxalase | 0.9841 | 80 | 145 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar