F482889

General Info

Members Datasets Scaffolds Average Seq Length
836 494 703 293

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10000035|Ga0307517_1000003560
Length 338
Sequence MKGIILAGGTGTRLYPITTVVSKQLLPVFDKPMIYYPLATLMLAGIREILIISTPQDQPLFQRLLGDGSSLGLELSYATQAKARGLADAFIVGRKFVGKDDVALILGDNIFHGHGLSDLMSRAAMRSNEATVFGYVVNSPEQYGVVELDGRGRAISIEEKPSKPKSNVAVTGLYFYDNDVIDIAASLQPSARGELEITDVNRVYLERGDLFVEVLGRGFAWLDTGTHETLVEASHFVQILEQRQGLRIACIEEIALRLRYISLDHFHMLAQRAAKSSYGQYLLSVHHSFVSNSSKAGSESCDMMAPLFASQAARVSLAPSLSDISSTIPAPTLSTSTS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2511231008 Pseudomonas sp. GM21 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
16 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
20 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
23 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
24 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
25 2751185917 Enterobacter sp. HK169 Isolate Unclassified
26 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
27 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
30 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
31 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
32 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
33 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
34 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
35 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
36 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
37 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
38 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
39 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
40 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
41 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
42 2849139964 Bacillus sp. R-71875 Isolate Unclassified
43 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
44 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
45 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
46 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
47 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
48 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
49 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
50 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
51 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
52 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
53 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
54 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
55 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
56 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
57 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
58 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
59 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
60 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
61 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
62 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
63 2904699407
64 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
65 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
66 2906610324
67 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
68 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
69 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
70 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
71 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
72 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
73 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
74 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
75 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
76 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
77 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
78 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
79 2922425934
80 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
81 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
82 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
83 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
84 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
85 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
86 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
87 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
88 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
89 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
90 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
91 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
92 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
93 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
94 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
95 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
96 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
97 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
98 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
99 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
100 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
101 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
102 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
103 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
104 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
105 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
106 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
107 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
108 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
109 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
110 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
111 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
112 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
113 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
114 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
115 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
116 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
117 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
118 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
121 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
122 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
123 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
124 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
125 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
126 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
127 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
128 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
129 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
130 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
131 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
132 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
133 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
134 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
135 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
136 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
137 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
138 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
139 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
140 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
141 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
142 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
143 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
146 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
147 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
148 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
149 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
150 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
151 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
154 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
155 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
156 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
157 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
158 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
159 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
160 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
161 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
162 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
163 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
164 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
165 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
166 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
167 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
168 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
169 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
170 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
171 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
172 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
173 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
174 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
175 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
176 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
177 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
178 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
179 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
180 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
181 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
182 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
183 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
184 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
185 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
186 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
188 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
189 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
190 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
191 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
192 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
193 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
194 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
195 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
196 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
197 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
198 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
199 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
200 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
201 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
202 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
203 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
204 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
205 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
206 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
207 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
208 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
214 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
215 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
216 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
217 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
218 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
219 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
220 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
221 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
223 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
226 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
228 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
274 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
275 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
276 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
277 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
281 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
282 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
285 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
286 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
287 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
292 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
293 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
294 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
295 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
296 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
297 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
298 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
299 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
300 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
301 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
302 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
309 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
315 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
316 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
317 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
318 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
319 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
320 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
321 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
322 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
323 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
324 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
325 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
326 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
327 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
328 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
329 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
330 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
331 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
332 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
333 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
334 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
335 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
336 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
337 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
338 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
339 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
340 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
341 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
342 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
343 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
354 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
355 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
361 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
367 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
368 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
369 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
370 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
371 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
372 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
373 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
374 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
375 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
376 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
384 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
385 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
386 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
387 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
388 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
391 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
392 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
393 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
394 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
395 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
396 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
397 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
398 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
399 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
400 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
420 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
421 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
422 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
423 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
424 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
425 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
426 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
427 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
430 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
433 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
439 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
440 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
441 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
442 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
443 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
444 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
445 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
446 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
452 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
453 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
454 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
455 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
456 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
457 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
458 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
459 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
460 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
461 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
462 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
463 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
464 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
465 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
466 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
467 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
468 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
469 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
470 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
471 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
472 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
480 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
481 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
482 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
483 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
484 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
485 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
486 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
487 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
488 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
489 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
490 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
491 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
492 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
493 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
494 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.55
Metatranscriptomes 0.84
Isolates 15.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 8.37
Nodule 7.18
Rhizoplane 5.98
Rhizosphere 66.15
Stem 0
Stem Tuber 0
Unclassified 12.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_431541 2162886007 Bacteria 23712
2 LJQas_1000313 3300000549 Bacteria 8638
3 LJQas_1000428 3300000549 Bacteria 7004
4 JGI25153J46596_10000502 3300003215 Bacteria 24875
5 JGI25153J46596_10004212 3300003215 Bacteria 7795
6 rootL2_10137330 3300003322 Bacteria 3316
7 JGI25160J50197_1000344 3300003354 Bacteria 31105
8 JGI25160J50197_1004733 3300003354 Bacteria 5822
9 JGI25160J50197_1008646 3300003354 Bacteria 3861
10 Ga0055526_1018034 3300003771 Bacteria 2658
11 Ga0055543_1001128 3300004625 Bacteria 11446
12 Ga0065165_1000054 3300005262 Bacteria 187351
13 Ga0065165_1002041 3300005262 Bacteria 18738
14 Ga0065165_1004508 3300005262 Bacteria 8555
15 Ga0065165_1024806 3300005262 Bacteria 2007
16 Ga0065714_10021260 3300005288 Bacteria 1755
17 Ga0065704_10070449 3300005289 Bacteria 24379
18 Ga0065707_10082876 3300005295 Bacteria 11628
19 Ga0070658_10287331 3300005327 Bacteria 1401
20 Ga0070683_100019205 3300005329 Bacteria 6070
21 Ga0070683_100209810 3300005329 Bacteria 1850
22 Ga0070666_10086031 3300005335 Bacteria 2154
23 Ga0070682_100060944 3300005337 Bacteria 2387
24 Ga0068868_100137522 3300005338 Bacteria 2003
25 Ga0070660_100050701 3300005339 Bacteria 3194
26 Ga0070660_100152652 3300005339 Bacteria 1858
27 Ga0070660_100167111 3300005339 Bacteria 1775
28 Ga0070661_100015251 3300005344 Bacteria 5424
29 Ga0070668_100101282 3300005347 Bacteria 2283
30 Ga0070668_100148176 3300005347 Bacteria 1895
31 Ga0070668_100205306 3300005347 Bacteria 1619
32 Ga0070668_100287471 3300005347 Bacteria 1375
33 Ga0070669_100032156 3300005353 Bacteria 3790
34 Ga0070675_100259033 3300005354 Bacteria 1524
35 Ga0070675_100496291 3300005354 Bacteria 1099
36 Ga0070671_100211219 3300005355 Bacteria 1646
37 Ga0070671_100494467 3300005355 Bacteria 1052
38 Ga0070674_100098058 3300005356 Bacteria 2130
39 Ga0070673_100140182 3300005364 Bacteria 2039
40 Ga0070673_100390300 3300005364 Bacteria 1243
41 Ga0070659_100039289 3300005366 Bacteria 3694
42 Ga0070659_100073436 3300005366 Bacteria 2723
43 Ga0070667_100027985 3300005367 Bacteria 4690
44 Ga0070667_100029259 3300005367 Bacteria 4589
45 Ga0070714_100016833 3300005435 Bacteria 5913
46 Ga0070714_100358870 3300005435 Bacteria 1370
47 Ga0070713_100099432 3300005436 Bacteria 2517
48 Ga0070713_100155674 3300005436 Bacteria 2037
49 Ga0070710_10065829 3300005437 Bacteria 2076
50 Ga0070705_100085280 3300005440 Bacteria 1952
51 Ga0070705_100123621 3300005440 Bacteria 1675
52 Ga0070700_100000016 3300005441 Bacteria 147213
53 Ga0070694_100028742 3300005444 Bacteria 3620
54 Ga0070663_100085322 3300005455 Bacteria 2330
55 Ga0070678_100080939 3300005456 Bacteria 2461
56 Ga0070678_100460312 3300005456 Bacteria 1116
57 Ga0070679_100097641 3300005530 Bacteria 2925
58 Ga0068853_100007053 3300005539 Bacteria 8985
59 Ga0070672_100205158 3300005543 Bacteria 1649
60 Ga0070695_100115921 3300005545 Bacteria 1826
61 Ga0070696_100145516 3300005546 Bacteria 1735
62 Ga0070693_100100600 3300005547 Bacteria 1760
63 Ga0070693_100221020 3300005547 Bacteria 1241
64 Ga0070665_100016709 3300005548 Bacteria 7354
65 Ga0070665_100449742 3300005548 Bacteria 1298
66 Ga0070704_100222740 3300005549 Bacteria 1534
67 Ga0068855_100009183 3300005563 Bacteria 11941
68 Ga0068855_100096811 3300005563 Bacteria 3399
69 Ga0068855_100264546 3300005563 Bacteria 1915
70 Ga0068857_100127798 3300005577 Bacteria 2291
71 Ga0068854_100080249 3300005578 Bacteria 2407
72 Ga0068856_100091113 3300005614 Bacteria 3033
73 Ga0068856_100124021 3300005614 Bacteria 2585
74 Ga0070702_100015741 3300005615 Bacteria 3867
75 Ga0068852_100019657 3300005616 Bacteria 5351
76 Ga0068852_100038874 3300005616 Bacteria 4003
77 Ga0068852_100168992 3300005616 Bacteria 2048
78 Ga0068859_100471540 3300005617 Bacteria 1351
79 Ga0068864_100149334 3300005618 Bacteria 2115
80 Ga0068864_100188988 3300005618 Bacteria 1887
81 Ga0068866_10076377 3300005718 Bacteria 1786
82 Ga0068861_100240165 3300005719 Bacteria 1540
83 Ga0068851_10001626 3300005834 Bacteria 9856
84 Ga0068851_10025378 3300005834 Bacteria 2907
85 Ga0068870_10038027 3300005840 Bacteria 2483
86 Ga0068863_100017642 3300005841 Bacteria 6837
87 Ga0068863_100091260 3300005841 Bacteria 2889
88 Ga0068858_100444736 3300005842 Bacteria 1248
89 Ga0068860_100006638 3300005843 Bacteria 11619
90 Ga0068860_100256874 3300005843 Bacteria 1702
91 Ga0068860_100567825 3300005843 Bacteria 1138
92 Ga0068862_100060247 3300005844 Bacteria 3260
93 Ga0068862_100172395 3300005844 Bacteria 1938
94 Ga0081455_10064438 3300005937 Bacteria 3068
95 Ga0081540_1004075 3300005983 Bacteria 11312
96 Ga0081540_1012922 3300005983 Bacteria 5458
97 Ga0081540_1019967 3300005983 Bacteria 4048
98 Ga0081540_1024743 3300005983 Bacteria 3476
99 Ga0070717_10096889 3300006028 Bacteria 2499
100 Ga0070717_10137831 3300006028 Bacteria 2103
101 Ga0070717_10253942 3300006028 Bacteria 1554
102 Ga0075365_10000758 3300006038 Bacteria 13112
103 Ga0075365_10039057 3300006038 Bacteria 3089
104 Ga0075432_10008863 3300006058 Bacteria 3432
105 Ga0075432_10053983 3300006058 Bacteria 1422
106 Ga0070716_100084534 3300006173 Bacteria 1903
107 Ga0075367_10051748 3300006178 Bacteria 2429
108 Ga0075369_10002752 3300006186 Bacteria 6310
109 Ga0075369_10008001 3300006186 Bacteria 4050
110 Ga0097621_100203510 3300006237 Bacteria 1720
111 Ga0075370_10059787 3300006353 Bacteria 2170
112 Ga0068871_100183992 3300006358 Bacteria 1797
113 Ga0068871_100711108 3300006358 Bacteria 921
114 Ga0075428_100569201 3300006844 Bacteria 1211
115 Ga0075431_100269507 3300006847 Bacteria 1726
116 Ga0075433_10338652 3300006852 Bacteria 1330
117 Ga0075434_100061688 3300006871 Bacteria 3731
118 Ga0068865_100184839 3300006881 Bacteria 1607
119 Ga0097620_100471546 3300006931 Bacteria 1351
120 Ga0099824_1018455 3300006942 Bacteria 5724
121 Ga0075435_100161354 3300007076 Bacteria 1888
122 Ga0105251_10012385 3300009011 Bacteria 4825
123 Ga0105251_10045775 3300009011 Bacteria 2108
124 Ga0105244_10001709 3300009036 Bacteria 17337
125 Ga0105244_10019047 3300009036 Bacteria 3841
126 Ga0105244_10024666 3300009036 Bacteria 3279
127 Ga0105244_10128852 3300009036 Bacteria 1222
128 Ga0105250_10000032 3300009092 Bacteria 159642
129 Ga0105250_10000325 3300009092 Bacteria 36727
130 Ga0105250_10074592 3300009092 Bacteria 1372
131 Ga0105240_10000793 3300009093 Bacteria 57276
132 Ga0105240_10000882 3300009093 Bacteria 53905
133 Ga0105240_10067287 3300009093 Bacteria 4440
134 Ga0105240_10134481 3300009093 Bacteria 2962
135 Ga0111539_10022931 3300009094 Bacteria 7664
136 Ga0111539_10195233 3300009094 Bacteria 2361
137 Ga0111539_11033170 3300009094 Bacteria 955
138 Ga0105247_10328233 3300009101 Bacteria 1070
139 Ga0114129_10052715 3300009147 Bacteria 5709
140 Ga0114129_10086467 3300009147 Bacteria 4349
141 Ga0105243_10014716 3300009148 Bacteria 5918
142 Ga0105243_10014820 3300009148 Bacteria 5899
143 Ga0105243_10047630 3300009148 Bacteria 3376
144 Ga0105242_10000988 3300009176 Bacteria 22235
145 Ga0105242_10063793 3300009176 Bacteria 3034
146 Ga0105242_10159112 3300009176 Bacteria 1975
147 Ga0105248_10040375 3300009177 Bacteria 5230
148 Ga0105248_10065945 3300009177 Bacteria 4065
149 Ga0105248_10220185 3300009177 Bacteria 2137
150 Ga0105248_10239757 3300009177 Bacteria 2041
151 Ga0105237_10000153 3300009545 Bacteria 96552
152 Ga0105237_10005366 3300009545 Bacteria 14497
153 Ga0105237_10017760 3300009545 Bacteria 7376
154 Ga0105237_10312323 3300009545 Bacteria 1575
155 Ga0105238_10000004 3300009551 Bacteria 390514
156 Ga0105238_10006993 3300009551 Bacteria 11282
157 Ga0105238_10032169 3300009551 Bacteria 5338
158 Ga0105238_10076245 3300009551 Bacteria 3344
159 Ga0105238_10096288 3300009551 Bacteria 2946
160 Ga0105249_10142757 3300009553 Bacteria 2297
161 Ga0105249_10193096 3300009553 Bacteria 1988
162 Ga0105239_10021850 3300010375 Bacteria 7054
163 Ga0105239_10407256 3300010375 Bacteria 1539
164 Ga0105239_10523652 3300010375 Bacteria 1349
165 Ga0105246_10042715 3300011119 Bacteria 3071
166 Ga0105246_10099564 3300011119 Bacteria 2113
167 Ga0105246_10149623 3300011119 Bacteria 1765
168 Ga0105246_10180824 3300011119 Bacteria 1624
169 Ga0105246_10408763 3300011119 Bacteria 1129
170 Ga0157373_10374820 3300013100 Bacteria 1017
171 Ga0157371_10053550 3300013102 Bacteria 2865
172 Ga0157371_10082265 3300013102 Bacteria 2280
173 Ga0157370_10073595 3300013104 Bacteria 3224
174 Ga0157370_10145296 3300013104 Bacteria 2209
175 Ga0157370_10210979 3300013104 Bacteria 1800
176 Ga0157369_10284252 3300013105 Bacteria 1723
177 Ga0157374_10077895 3300013296 Bacteria 3139
178 Ga0157374_10093981 3300013296 Bacteria 2864
179 Ga0157378_10059697 3300013297 Bacteria 3403
180 Ga0163162_10115450 3300013306 Bacteria 2785
181 Ga0163162_10341159 3300013306 Bacteria 1631
182 Ga0157372_10100451 3300013307 Bacteria 3301
183 Ga0157372_10253465 3300013307 Bacteria 2043
184 Ga0157375_10220641 3300013308 Bacteria 2054
185 Ga0157375_10257244 3300013308 Bacteria 1907
186 Ga0163163_10009451 3300014325 Bacteria 8706
187 Ga0163163_10222323 3300014325 Bacteria 1937
188 Ga0163163_10490980 3300014325 Bacteria 1289
189 Ga0157380_10073722 3300014326 Bacteria 2769
190 Ga0157380_10507600 3300014326 Bacteria 1173
191 Ga0157379_10000004 3300014968 Bacteria 173351
192 Ga0157376_10089440 3300014969 Bacteria 2662
193 Ga0157376_10245586 3300014969 Bacteria 1669
194 Ga0157376_10391266 3300014969 Bacteria 1342
195 Ga0182006_1000572 3300015261 Bacteria 27217
196 Ga0163161_10125641 3300017792 Bacteria 1931
197 Ga0163161_10360097 3300017792 Bacteria 1158
198 Ga0213873_10000002 3300021358 Bacteria 1164195
199 Ga0213876_10000001 3300021384 Bacteria 1186326
200 Ga0209148_1000239 3300025254 Bacteria 87710
201 Ga0209233_1000600 3300025261 Bacteria 18662
202 Ga0209233_1001306 3300025261 Bacteria 9945
203 Ga0209233_1025181 3300025261 Bacteria 1476
204 Ga0209455_1002439 3300025272 Bacteria 7203
205 Ga0209564_1015835 3300025295 Bacteria 3044
206 Ga0209758_1000806 3300025297 Bacteria 44157
207 Ga0209758_1001068 3300025297 Bacteria 35664
208 Ga0209758_1018079 3300025297 Bacteria 3474
209 Ga0209758_1035507 3300025297 Bacteria 1964
210 Ga0209758_1061677 3300025297 Bacteria 1233
211 Ga0209256_1003643 3300025299 Bacteria 10552
212 Ga0209256_1029787 3300025299 Bacteria 1515
213 Ga0207426_1000375 3300025302 Bacteria 78261
214 Ga0207426_1000467 3300025302 Bacteria 62488
215 Ga0207426_1000527 3300025302 Bacteria 55514
216 Ga0207426_1015512 3300025302 Bacteria 2760
217 Ga0209051_1001715 3300025303 Bacteria 17497
218 Ga0209051_1007303 3300025303 Bacteria 6064
219 Ga0207697_10022679 3300025315 Bacteria 2571
220 Ga0207656_10011584 3300025321 Bacteria 3336
221 Ga0207696_1000198 3300025711 Bacteria 92750
222 Ga0207696_1000386 3300025711 Bacteria 42561
223 Ga0207655_1000733 3300025728 Bacteria 37019
224 Ga0207655_1003206 3300025728 Bacteria 12308
225 Ga0207655_1017212 3300025728 Bacteria 3907
226 Ga0207655_1029710 3300025728 Bacteria 2553
227 Ga0207710_10140486 3300025900 Bacteria 1166
228 Ga0207688_10115997 3300025901 Bacteria 1559
229 Ga0207680_10027568 3300025903 Bacteria 3165
230 Ga0207680_10028171 3300025903 Bacteria 3139
231 Ga0207680_10161871 3300025903 Bacteria 1501
232 Ga0207645_10027311 3300025907 Bacteria 3687
233 Ga0207654_10052793 3300025911 Bacteria 2344
234 Ga0207654_10115232 3300025911 Bacteria 1679
235 Ga0207707_10001050 3300025912 Bacteria 26502
236 Ga0207695_10000797 3300025913 Bacteria 59086
237 Ga0207695_10000830 3300025913 Bacteria 57286
238 Ga0207695_10001008 3300025913 Bacteria 49740
239 Ga0207695_10002445 3300025913 Bacteria 27456
240 Ga0207671_10001174 3300025914 Bacteria 31189
241 Ga0207671_10011775 3300025914 Bacteria 7082
242 Ga0207671_10030463 3300025914 Bacteria 4024
243 Ga0207671_10137330 3300025914 Bacteria 1881
244 Ga0207693_10002666 3300025915 Bacteria 15499
245 Ga0207662_10013430 3300025918 Bacteria 4582
246 Ga0207657_10043220 3300025919 Bacteria 3971
247 Ga0207657_10107777 3300025919 Bacteria 2304
248 Ga0207657_10282420 3300025919 Bacteria 1318
249 Ga0207649_10015204 3300025920 Bacteria 4323
250 Ga0207652_10004838 3300025921 Bacteria 10909
251 Ga0207681_10027831 3300025923 Bacteria 3659
252 Ga0207681_10175551 3300025923 Bacteria 1628
253 Ga0207694_10000021 3300025924 Bacteria 300246
254 Ga0207694_10041435 3300025924 Bacteria 3548
255 Ga0207694_10046291 3300025924 Bacteria 3362
256 Ga0207694_10180683 3300025924 Bacteria 1711
257 Ga0207650_10000202 3300025925 Bacteria 68952
258 Ga0207659_10450718 3300025926 Bacteria 1084
259 Ga0207700_10063470 3300025928 Bacteria 2809
260 Ga0207700_10119228 3300025928 Bacteria 2136
261 Ga0207700_10126608 3300025928 Bacteria 2079
262 Ga0207664_10083510 3300025929 Bacteria 2604
263 Ga0207664_10416411 3300025929 Bacteria 1196
264 Ga0207706_10225770 3300025933 Bacteria 1639
265 Ga0207686_10020400 3300025934 Bacteria 3786
266 Ga0207686_10048677 3300025934 Bacteria 2627
267 Ga0207686_10258963 3300025934 Bacteria 1274
268 Ga0207709_10018228 3300025935 Bacteria 3928
269 Ga0207665_10042604 3300025939 Bacteria 3034
270 Ga0207691_10001922 3300025940 Bacteria 20273
271 Ga0207691_10471127 3300025940 Bacteria 1068
272 Ga0207711_10027057 3300025941 Bacteria 4815
273 Ga0207711_10366058 3300025941 Bacteria 1336
274 Ga0207711_10539029 3300025941 Bacteria 1088
275 Ga0207689_10073517 3300025942 Bacteria 2808
276 Ga0207661_10279658 3300025944 Bacteria 1491
277 Ga0207667_10052624 3300025949 Bacteria 4287
278 Ga0207667_10277639 3300025949 Bacteria 1712
279 Ga0207668_10125623 3300025972 Bacteria 1950
280 Ga0207668_10205870 3300025972 Bacteria 1570
281 Ga0207658_10116657 3300025986 Bacteria 2121
282 Ga0207703_10177578 3300026035 Bacteria 1877
283 Ga0207639_10043105 3300026041 Bacteria 3386
284 Ga0207678_10121583 3300026067 Bacteria 2228
285 Ga0207708_10000005 3300026075 Bacteria 284735
286 Ga0207702_10119209 3300026078 Bacteria 2359
287 Ga0207641_10000412 3300026088 Bacteria 49926
288 Ga0207641_10064763 3300026088 Bacteria 3125
289 Ga0207676_10040599 3300026095 Bacteria 3567
290 Ga0207676_10231511 3300026095 Bacteria 1652
291 Ga0207674_10024355 3300026116 Bacteria 6470
292 Ga0207675_100158547 3300026118 Bacteria 2157
293 Ga0207683_10000852 3300026121 Bacteria 27982
294 Ga0207683_10130079 3300026121 Bacteria 2264
295 Ga0207683_10280099 3300026121 Bacteria 1524
296 Ga0209589_1000014 3300027357 Bacteria 227996
297 Ga0209489_100014 3300027361 Bacteria 227996
298 Ga0209700_100024 3300027363 Bacteria 227996
299 Ga0207428_10202160 3300027907 Bacteria 1495
300 Ga0268266_10027915 3300028379 Bacteria 4800
301 Ga0268266_10277060 3300028379 Bacteria 1559
302 Ga0268265_10319470 3300028380 Bacteria 1405
303 Ga0268264_10000689 3300028381 Bacteria 39297
304 Ga0268264_10117019 3300028381 Bacteria 2344
305 Ga0307517_10000035 3300028786 Bacteria 172762
306 Ga0307517_10000100 3300028786 Bacteria 125762
307 Ga0307515_10013216 3300028794 Bacteria 15444
308 Ga0307515_10021109 3300028794 Bacteria 11563
309 Ga0307515_10103093 3300028794 Bacteria 3424
310 Ga0265320_10025982 3300031240 Bacteria 3072
311 Ga0265325_10000922 3300031241 Bacteria 21220
312 Ga0265340_10003444 3300031247 Bacteria 8928
313 Ga0265339_10007897 3300031249 Bacteria 6828
314 Ga0265316_10052652 3300031344 Bacteria 3192
315 Ga0307408_100010563 3300031548 Bacteria 6089
316 Ga0307408_100034220 3300031548 Bacteria 3557
317 Ga0307408_100043912 3300031548 Bacteria 3182
318 Ga0307408_100080643 3300031548 Bacteria 2431
319 Ga0307408_100090973 3300031548 Bacteria 2304
320 Ga0307408_100215937 3300031548 Bacteria 1562
321 Ga0307508_10010223 3300031616 Bacteria 8584
322 Ga0307508_10035220 3300031616 Bacteria 4512
323 Ga0307508_10201320 3300031616 Bacteria 1592
324 Ga0265314_10082348 3300031711 Bacteria 2117
325 Ga0265314_10108673 3300031711 Bacteria 1766
326 Ga0307405_10006319 3300031731 Bacteria 5817
327 Ga0307405_10027366 3300031731 Bacteria 3305
328 Ga0307405_10091519 3300031731 Bacteria 2015
329 Ga0307405_10095174 3300031731 Bacteria 1982
330 Ga0307405_10317371 3300031731 Bacteria 1189
331 Ga0316577_10014346 3300031733 Bacteria 4349
332 Ga0307413_10002237 3300031824 Bacteria 7803
333 Ga0307413_10013413 3300031824 Bacteria 4119
334 Ga0307413_10406443 3300031824 Bacteria 1068
335 Ga0307410_10000589 3300031852 Bacteria 14976
336 Ga0307410_10003037 3300031852 Bacteria 8297
337 Ga0307410_10074763 3300031852 Bacteria 2361
338 Ga0307407_10091485 3300031903 Bacteria 1865
339 Ga0307412_10001061 3300031911 Bacteria 15719
340 Ga0307412_10006661 3300031911 Bacteria 6548
341 Ga0307412_10041803 3300031911 Bacteria 2973
342 Ga0307412_10047393 3300031911 Bacteria 2823
343 Ga0307412_10059824 3300031911 Bacteria 2555
344 Ga0307412_10147085 3300031911 Bacteria 1733
345 Ga0307409_100241533 3300031995 Bacteria 1645
346 Ga0307409_100254933 3300031995 Bacteria 1606
347 Ga0307416_100005468 3300032002 Bacteria 7801
348 Ga0307416_100234091 3300032002 Bacteria 1773
349 Ga0307416_100283804 3300032002 Bacteria 1634
350 Ga0307416_100871623 3300032002 Bacteria 999
351 Ga0307416_101031055 3300032002 Bacteria 926
352 Ga0307414_10040700 3300032004 Bacteria 3141
353 Ga0307411_10004613 3300032005 Bacteria 6632
354 Ga0307510_10007284 3300033180 Bacteria 13179
355 Ga0307510_10064141 3300033180 Bacteria 3733
356 Ga0315911_1000002 3300033442 Bacteria 926833
357 Ga0373949_0025947 3300035090 Bacteria 1371
358 Ga0373931_0089515 3300035691 Bacteria 1712
359 Ga0373927_0107006 3300035695 Bacteria 1821
360 Ga0373937_0047334 3300036401 Bacteria 3935
361 Ga0373937_0198760 3300036401 Bacteria 1884
362 Ga0316582_0383352 3300036647 Bacteria 968
363 Ga0373925_0118157 3300037068 Bacteria 2056
364 Ga0373925_0224643 3300037068 Bacteria 1500
365 Ga0395899_0005680 3300037312 Bacteria 9687
366 Ga0395899_0010822 3300037312 Bacteria 6992
367 Ga0395900_0002292 3300037418 Bacteria 21261
368 Ga0395900_0010130 3300037418 Bacteria 9640
369 Ga0395900_0026944 3300037418 Bacteria 5883
370 Ga0395900_0068511 3300037418 Bacteria 3646
371 Ga0395900_0124116 3300037418 Bacteria 2648
372 Ga0395900_0175868 3300037418 Bacteria 2177
373 Ga0395900_0642842 3300037418 Bacteria 998
374 Ga0395898_0002013 3300037466 Bacteria 25494
375 Ga0395898_0006115 3300037466 Bacteria 12905
376 Ga0395898_0014129 3300037466 Bacteria 8207
377 Ga0395898_0083624 3300037466 Bacteria 3076
378 Ga0395898_0171930 3300037466 Bacteria 2071
379 Ga0395898_0173885 3300037466 Bacteria 2058
380 Ga0395905_0015639 3300037471 Bacteria 7209
381 Ga0395905_0026671 3300037471 Bacteria 5448
382 Ga0395905_0498624 3300037471 Bacteria 1118
383 Ga0436364_0681592 3300037853 Bacteria 2757
384 Ga0436364_0826744 3300037853 Bacteria 2070
385 Ga0436364_1461962 3300037853 Bacteria 1732
386 Ga0395901_0004737 3300038443 Bacteria 13731
387 Ga0395901_0036353 3300038443 Bacteria 5090
388 Ga0395901_0054286 3300038443 Bacteria 4164
389 Ga0395901_0168100 3300038443 Bacteria 2301
390 Ga0395901_0186833 3300038443 Bacteria 2173
391 Ga0395901_0705622 3300038443 Bacteria 1006
392 Ga0395901_0774068 3300038443 Bacteria 951
393 Ga0400490_14049 3300038726 Bacteria 7683
394 Ga0400489_04907 3300039093 Bacteria 9378
395 Ga0436365_0332720 3300039437 Bacteria 227622
396 Ga0436365_1326044 3300039437 Bacteria 3011
397 Ga0436360_1043296 3300039438 Bacteria 2210
398 Ga0436360_1309131 3300039438 Bacteria 7974
399 Ga0436361_0340447 3300039447 Bacteria 2519
400 Ga0436361_0614516 3300039447 Bacteria 1144
401 Ga0436361_0648521 3300039447 Bacteria 3766
402 Ga0436363_0411896 3300039450 Bacteria 1217
403 Ga0436362_0660519 3300039453 Bacteria 832172
404 Ga0439436_0000550 3300041404 Bacteria 9879
405 Ga0439436_0007527 3300041404 Bacteria 3351
406 Ga0439438_000449 3300041405 Bacteria 18620
407 Ga0439439_0000054 3300041406 Bacteria 14510
408 Ga0439447_027295 3300041407 Bacteria 1457
409 Ga0439461_0007338 3300041410 Bacteria 1949
410 Ga0439466_0001366 3300041411 Bacteria 9481
411 Ga0439466_0096429 3300041411 Bacteria 924
412 Ga0439433_0000004 3300041999 Bacteria 39895
413 Ga0439433_0000065 3300041999 Bacteria 13231
414 Ga0439433_0000455 3300041999 Bacteria 7539
415 Ga0439442_000001 3300042002 Bacteria 161142
416 Ga0439442_000592 3300042002 Bacteria 7838
417 Ga0439442_001300 3300042002 Bacteria 4962
418 Ga0439442_003782 3300042002 Bacteria 2996
419 Ga0439432_000310 3300042006 Bacteria 17587
420 Ga0439449_0000405 3300042007 Bacteria 15992
421 Ga0439449_0021569 3300042007 Bacteria 2411
422 Ga0439449_0034103 3300042007 Bacteria 1895
423 Ga0439449_0045071 3300042007 Bacteria 1635
424 Ga0439452_001352 3300042010 Bacteria 10189
425 Ga0439457_000956 3300042014 Bacteria 8682
426 Ga0439462_0000546 3300042015 Bacteria 7447
427 Ga0450919_006490 3300042121 Bacteria 1382
428 Ga0450920_000059 3300042122 Bacteria 14165
429 Ga0450920_000088 3300042122 Bacteria 12116
430 Ga0450907_000288 3300042146 Bacteria 17027
431 Ga0450907_000303 3300042146 Bacteria 16503
432 Ga0450908_007264 3300042184 Bacteria 2092
433 Ga0450909_005045 3300042185 Bacteria 1895
434 Ga0439434_0001912 3300042435 Bacteria 6043
435 Ga0439434_0007612 3300042435 Bacteria 3174
436 Ga0439434_0065692 3300042435 Bacteria 1138
437 Ga0450918_000190 3300042531 Bacteria 13717
438 Ga0450918_000276 3300042531 Bacteria 11660
439 Ga0451577_0115465 3300042876 Bacteria 2404
440 Ga0466961_0000031 3300044693 Bacteria 85869
441 Ga0466961_0144592 3300044693 Bacteria 1487
442 Ga0453684_0681262 3300044712 Bacteria 1119
443 Ga0466957_0148265 3300044842 Bacteria 1516
444 Ga0466959_0006857 3300045049 Bacteria 7942
445 Ga0466967_0455037 3300045976 Bacteria 1251
446 Ga0495629_0105839 3300046459 Bacteria 1962
447 Ga0495629_0146459 3300046459 Bacteria 1642
448 Ga0495651_0033707 3300046462 Bacteria 3994
449 Ga0495651_0133506 3300046462 Bacteria 1809
450 Ga0495651_0310705 3300046462 Bacteria 1054
451 Ga0495653_0100887 3300046463 Bacteria 2092
452 Ga0495653_0253518 3300046463 Bacteria 1167
453 Ga0495580_0007029 3300046472 Bacteria 9077
454 Ga0495582_0035328 3300046473 Bacteria 2749
455 Ga0495639_0001561 3300046475 Bacteria 10237
456 Ga0495664_0017458 3300046477 Bacteria 4103
457 Ga0495606_0133539 3300046507 Bacteria 1473
458 Ga0495610_0070992 3300046512 Bacteria 1625
459 Ga0495618_0052436 3300046514 Bacteria 2579
460 Ga0495648_0003275 3300046524 Bacteria 14331
461 Ga0495648_0038782 3300046524 Bacteria 3041
462 Ga0495648_0125354 3300046524 Bacteria 1374
463 Ga0495642_0058314 3300046528 Bacteria 1598
464 Ga0495654_0003598 3300046530 Bacteria 9433
465 Ga0495586_0001724 3300046535 Bacteria 11939
466 Ga0495609_0049608 3300046538 Bacteria 1873
467 Ga0495622_0045200 3300046557 Bacteria 2046
468 Ga0495633_0103906 3300046558 Bacteria 1318
469 Ga0495667_0012988 3300046559 Bacteria 5645
470 Ga0495667_0118475 3300046559 Bacteria 1710
471 Ga0495656_0006245 3300046615 Bacteria 4170
472 Ga0495611_0038951 3300046648 Bacteria 2116
473 Ga0495635_0014160 3300046663 Bacteria 5581
474 Ga0495635_0334997 3300046663 Bacteria 1011
475 Ga0495659_0094487 3300046664 Bacteria 1152
476 Ga0495588_0007529 3300046674 Bacteria 4959
477 Ga0495657_0022744 3300046675 Bacteria 4486
478 Ga0495657_0114570 3300046675 Bacteria 1704
479 Ga0495657_0144167 3300046675 Bacteria 1483
480 Ga0495624_0100078 3300046690 Bacteria 1785
481 Ga0495670_0019653 3300046691 Bacteria 3329
482 Ga0495670_0042156 3300046691 Bacteria 2277
483 Ga0495649_0159730 3300046694 Bacteria 1182
484 Ga0495600_0028073 3300046809 Bacteria 3640
485 Ga0495581_0001814 3300047315 Bacteria 11948
486 Ga0495581_0332188 3300047315 Bacteria 887
487 Ga0495604_0067253 3300047317 Bacteria 2723
488 Ga0495672_0042930 3300047320 Bacteria 2722
489 Ga0495676_0025479 3300047321 Bacteria 5107
490 Ga0495676_0116560 3300047321 Bacteria 1950
491 Ga0495687_067024 3300047443 Bacteria 1455
492 Ga0495686_0024664 3300047472 Bacteria 3948
493 Ga0495593_0043612 3300047673 Bacteria 2402
494 Ga0495593_0135443 3300047673 Bacteria 1249
495 Ga0495602_0114844 3300048088 Bacteria 2179
496 Ga0496100_0165962 3300048903 Bacteria 1586
497 Ga0496101_0088606 3300048904 Bacteria 2299
498 Ga0496101_0164366 3300048904 Bacteria 1703
499 Ga0496101_0246232 3300048904 Bacteria 1392
500 Ga0496102_0087221 3300048905 Bacteria 2883
501 Ga0496104_0001655 3300048907 Bacteria 19236
502 Ga0496104_0089347 3300048907 Bacteria 2943
503 Ga0496104_0103020 3300048907 Bacteria 2734
504 Ga0496104_0222781 3300048907 Bacteria 1798
505 Ga0496104_0233637 3300048907 Bacteria 1750
506 Ga0496104_0302389 3300048907 Bacteria 1512
507 Ga0496105_0005515 3300048908 Bacteria 9603
508 Ga0496105_0005541 3300048908 Bacteria 9584
509 Ga0496105_0006734 3300048908 Bacteria 8836
510 Ga0496105_0148645 3300048908 Bacteria 1926
511 Ga0496105_0173597 3300048908 Bacteria 1766
512 Ga0496106_0106773 3300048909 Bacteria 2177
513 Ga0496106_0260229 3300048909 Bacteria 1388
514 Ga0496106_0295160 3300048909 Bacteria 1299
515 Ga0496107_0160607 3300048910 Bacteria 1665
516 Ga0496108_0016877 3300048911 Bacteria 5967
517 Ga0496108_0098954 3300048911 Bacteria 2485
518 Ga0496108_0257780 3300048911 Bacteria 1517
519 Ga0496109_0000839 3300048912 Bacteria 25665
520 Ga0496109_0030558 3300048912 Bacteria 4828
521 Ga0496109_0188663 3300048912 Bacteria 1937
522 Ga0496110_0062499 3300048913 Bacteria 3288
523 Ga0496110_0163753 3300048913 Bacteria 2016
524 Ga0496110_0251492 3300048913 Bacteria 1608
525 Ga0496110_0280051 3300048913 Bacteria 1518
526 Ga0496111_0002183 3300048914 Bacteria 11720
527 Ga0496111_0250255 3300048914 Bacteria 1315
528 Ga0496112_0006565 3300048915 Bacteria 10236
529 Ga0496112_0008387 3300048915 Bacteria 9255
530 Ga0496112_0028066 3300048915 Bacteria 5430
531 Ga0496112_0132501 3300048915 Bacteria 2463
532 Ga0496112_0310113 3300048915 Bacteria 1523
533 Ga0496112_0489848 3300048915 Bacteria 1165
534 Ga0496112_0677012 3300048915 Bacteria 960
535 Ga0496113_0127257 3300048916 Bacteria 1996
536 Ga0496113_0330406 3300048916 Bacteria 1222
537 Ga0496114_0012738 3300048917 Bacteria 6735
538 Ga0496114_0152926 3300048917 Bacteria 2002
539 Ga0496114_0209195 3300048917 Bacteria 1711
540 Ga0496115_0008711 3300048918 Bacteria 7518
541 Ga0496115_0116043 3300048918 Bacteria 2202
542 Ga0496115_0215468 3300048918 Bacteria 1585
543 Ga0496115_0227311 3300048918 Bacteria 1539
544 Ga0496115_0413961 3300048918 Bacteria 1093
545 Ga0496117_0002279 3300048920 Bacteria 24781
546 Ga0496117_0009546 3300048920 Bacteria 9004
547 Ga0496118_0001768 3300048921 Bacteria 31276
548 Ga0496118_0029332 3300048921 Bacteria 4615
549 Ga0496118_0157744 3300048921 Bacteria 1409
550 Ga0496120_0015101 3300048923 Bacteria 5110
551 Ga0496120_0040477 3300048923 Bacteria 2738
552 Ga0496120_0057834 3300048923 Bacteria 2180
553 Ga0496121_0001894 3300048924 Bacteria 33517
554 Ga0496121_0051754 3300048924 Bacteria 3456
555 Ga0496121_0149050 3300048924 Bacteria 1724
556 Ga0496122_0116193 3300048925 Bacteria 1741
557 Ga0496122_0134845 3300048925 Bacteria 1559
558 Ga0496123_0140427 3300048926 Bacteria 1322
559 Ga0496124_0002163 3300048927 Bacteria 26352
560 Ga0496124_0082047 3300048927 Bacteria 2648
561 Ga0496124_0145976 3300048927 Bacteria 1861
562 Ga0496124_0229791 3300048927 Bacteria 1388
563 Ga0496125_0001616 3300048928 Bacteria 31818
564 Ga0496125_0006808 3300048928 Bacteria 12270
565 Ga0496125_0026490 3300048928 Bacteria 5280
566 Ga0496126_0002472 3300048929 Bacteria 24884
567 Ga0496126_0006015 3300048929 Bacteria 13627
568 Ga0496126_0029998 3300048929 Bacteria 5160
569 Ga0496126_0046400 3300048929 Bacteria 3985
570 Ga0496126_0049326 3300048929 Bacteria 3844
571 Ga0496126_0051188 3300048929 Bacteria 3760
572 Ga0496126_0080635 3300048929 Bacteria 2879
573 Ga0496126_0133829 3300048929 Bacteria 2140
574 Ga0496126_0182643 3300048929 Bacteria 1781
575 Ga0496126_0226543 3300048929 Bacteria 1568
576 Ga0496126_0361984 3300048929 Bacteria 1184
577 Ga0496126_0577606 3300048929 Bacteria 888
578 Ga0501031_0070033 3300049568 Bacteria 2284
579 Ga0501031_0080584 3300049568 Bacteria 2121
580 Ga0501032_0000942 3300049569 Bacteria 23547
581 Ga0501032_0032322 3300049569 Bacteria 3586
582 Ga0501032_0103963 3300049569 Bacteria 1881
583 Ga0501033_0000674 3300049570 Bacteria 31495
584 Ga0501034_0000016 3300049571 Bacteria 289751
585 Ga0501034_0188961 3300049571 Bacteria 2023
586 Ga0501034_0221677 3300049571 Bacteria 1843
587 Ga0501036_0183904 3300049572 Bacteria 1759
588 Ga0501036_0306332 3300049572 Bacteria 1328
589 Ga0501036_0501051 3300049572 Bacteria 1010
590 Ga0501036_0547516 3300049572 Bacteria 962
591 Ga0501037_0028995 3300049573 Bacteria 4088
592 Ga0501037_0085794 3300049573 Bacteria 2279
593 Ga0501037_0086799 3300049573 Bacteria 2264
594 Ga0501037_0320393 3300049573 Bacteria 1073
595 Ga0501038_0000734 3300049574 Bacteria 29279
596 Ga0501038_0001529 3300049574 Bacteria 21336
597 Ga0501038_0002689 3300049574 Bacteria 16566
598 Ga0501038_0007103 3300049574 Bacteria 10341
599 Ga0501038_0009897 3300049574 Bacteria 8728
600 Ga0501038_0071307 3300049574 Bacteria 2947
601 Ga0501039_0005049 3300049575 Bacteria 10005
602 Ga0501039_0048339 3300049575 Bacteria 3288
603 Ga0501039_0093328 3300049575 Bacteria 2345
604 Ga0501039_0116890 3300049575 Bacteria 2088
605 Ga0501040_0005957 3300049576 Bacteria 7885
606 Ga0501043_0002923 3300049579 Bacteria 14261
607 Ga0501043_0005412 3300049579 Bacteria 10317
608 Ga0501043_0009885 3300049579 Bacteria 7479
609 Ga0501043_0021212 3300049579 Bacteria 5092
610 Ga0501043_0068354 3300049579 Bacteria 2789
611 Ga0501043_0085405 3300049579 Bacteria 2480
612 Ga0501043_0090913 3300049579 Bacteria 2400
613 Ga0501043_0233365 3300049579 Bacteria 1420
614 Ga0501046_0015018 3300049580 Bacteria 6514
615 Ga0501046_0123177 3300049580 Bacteria 1971
616 Ga0501047_0125601 3300049581 Bacteria 2446
617 Ga0501047_0168088 3300049581 Bacteria 2063
618 Ga0501047_0220179 3300049581 Bacteria 1754
619 Ga0501067_0028783 3300049583 Bacteria 3079
620 Ga0501068_0095443 3300049584 Bacteria 1839
621 Ga0501068_0143952 3300049584 Bacteria 1495
622 Ga0501069_0150479 3300049585 Bacteria 1337
623 Ga0501070_0056862 3300049586 Bacteria 3243
624 Ga0501070_0124978 3300049586 Bacteria 2126
625 Ga0501070_0186148 3300049586 Bacteria 1708
626 Ga0501071_0397088 3300049587 Bacteria 1053
627 Ga0501073_0055431 3300049589 Bacteria 2774
628 Ga0501073_0314435 3300049589 Bacteria 1081
629 Ga0501074_0006081 3300049590 Bacteria 8717
630 Ga0501074_0177916 3300049590 Bacteria 1518
631 Ga0501076_0137759 3300049592 Bacteria 1982
632 Ga0501077_0045550 3300049593 Bacteria 2787
633 Ga0501080_0090592 3300049742 Bacteria 2841
634 Ga0501080_0382764 3300049742 Bacteria 1267
635 Ga0501241_001816 3300049758 Bacteria 4212
636 Ga0501035_0000923 3300049822 Bacteria 31113
637 Ga0501035_0001334 3300049822 Bacteria 25468
638 Ga0501035_0068669 3300049822 Bacteria 3142
639 Ga0501035_0084849 3300049822 Bacteria 2793
640 Ga0501035_0089026 3300049822 Bacteria 2719
641 Ga0501035_0189732 3300049822 Bacteria 1767
642 Ga0501044_0004565 3300049823 Bacteria 15488
643 Ga0501044_0009412 3300049823 Bacteria 10643
644 Ga0501044_0040327 3300049823 Bacteria 4866
645 Ga0501044_0046543 3300049823 Bacteria 4490
646 Ga0501044_0059545 3300049823 Bacteria 3912
647 Ga0501044_0563983 3300049823 Bacteria 1035
648 Ga0501045_0006283 3300049824 Bacteria 8214
649 nmdc:mga03683_91143_c1 3300050489 Bacteria 1329
650 nmdc:mga03n38_106558_c1 3300050490 Bacteria 1359
651 nmdc:mga00v17_77369_c1 3300050491 Bacteria 2071
652 nmdc:mga0yw44_21036_c1 3300050492 Bacteria 3633
653 nmdc:mga0yw44_2394_c1 3300050492 Bacteria 7979
654 nmdc:mga06z11_39335_c1 3300050494 Bacteria 2353
655 nmdc:mga07m45_15067_c1 3300050496 Bacteria 4129
656 nmdc:mga05p37_200732_c1 3300050507 Bacteria 2416
657 nmdc:mga05p37_61463_c1 3300050507 Bacteria 4624
658 nmdc:mga06r32_353259_c1 3300050510 Bacteria 1454
659 nmdc:mga08y16_366531_c1 3300050511 Bacteria 1478
660 nmdc:mga08y16_421001_c1 3300050511 Bacteria 1365
661 nmdc:mga0n895_324180_c1 3300050512 Bacteria 1561
662 nmdc:mga0sz30_3128_c1 3300050516 Bacteria 4552
663 nmdc:mga0sz30_5801_c1 3300050516 Bacteria 4548
664 nmdc:mga0sz30_72902_c1 3300050516 Bacteria 1480
665 Ga0495601_0036166 3300053077 Bacteria 3083
666 Ga0495601_0105267 3300053077 Bacteria 1824
667 Ga0495612_0008841 3300053078 Bacteria 4080
668 Ga0495612_0035130 3300053078 Bacteria 2031
669 Ga0500610_0076759 3300053079 Bacteria 1742
670 Ga0495595_0002902 3300053084 Bacteria 6760
671 Ga0495595_0043060 3300053084 Bacteria 2070
672 Ga0495619_0117982 3300053085 Bacteria 1818
673 Ga0500578_0079887 3300053086 Bacteria 2081
674 Ga0500643_000095 3300053087 Bacteria 92535
675 Ga0500583_0052936 3300053092 Bacteria 1890
676 Ga0500651_0035325 3300053093 Bacteria 3150
677 Ga0500641_0008907 3300053096 Bacteria 3597
678 Ga0500555_017169 3300053103 Bacteria 2086
679 Ga0500595_012476 3300053119 Bacteria 3286
680 Ga0500607_058153 3300053121 Bacteria 2035
681 Ga0500608_115434 3300053122 Bacteria 1225
682 Ga0500614_008701 3300053123 Bacteria 2155
683 Ga0500614_034190 3300053123 Bacteria 1260
684 Ga0500642_0010458 3300053130 Bacteria 3272
685 Ga0500559_0012469 3300053136 Bacteria 3612
686 Ga0500564_082438 3300053138 Bacteria 1440
687 Ga0500568_0023347 3300053139 Bacteria 2631
688 Ga0500573_0030414 3300053140 Bacteria 3116
689 Ga0500604_0061893 3300053151 Bacteria 1177
690 Ga0500619_004398 3300053154 Bacteria 3020
691 Ga0500627_0001129 3300053158 Bacteria 7306
692 Ga0500638_042127 3300053162 Bacteria 2217
693 Ga0500636_0000807 3300053177 Bacteria 16914
694 Ga0500567_134688 3300053723 Bacteria 959
695 Ga0500601_000088 3300053737 Bacteria 19062
696 Ga0501084_0178750 3300054114 Bacteria 1791
697 Ga0587084_010320 3300059477 Bacteria 1222
698 Ga0587070_015401 3300059491 Bacteria 1210
699 Ga0587073_0022347 3300059492 Bacteria 1227
700 Ga0587090_012339 3300059510 Bacteria 1218
701 Ga0587106_001284 3300059605 Bacteria 2173
702 Ga0587128_022202 3300059630 Bacteria 985
703 Ga0587079_018512 3300059647 Bacteria 1222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0124116 Ga0395900_0124116_1218_1961 246
2 3300038443 Ga0395901_0186833 Ga0395901_0186833_724_1467 246
3 iso_pu_bacteria 2919059106 2919059740 251
4 3300038443 Ga0395901_0774068 Ga0395901_0774068_175_939 253
5 3300041411 Ga0439466_0096429 Ga0439466_0096429_30_797 254
6 3300047315 Ga0495581_0332188 Ga0495581_0332188_39_806 254
7 3300025303 Ga0209051_1007303 Ga0209051_10073033 255
8 3300025315 Ga0207697_10022679 Ga0207697_100226792 255
9 3300025728 Ga0207655_1003206 Ga0207655_10032065 255
10 3300025728 Ga0207655_1029710 Ga0207655_10297102 255
11 3300031548 Ga0307408_100034220 Ga0307408_1000342203 255
12 3300031911 Ga0307412_10047393 Ga0307412_100473932 255
13 iso_pu_bacteria 2919538618 2919540382 256
14 3300009147 Ga0114129_10052715 Ga0114129_100527154 257
15 3300050507 nmdc:mga05p37_200732_c1 nmdc:mga05p37_200732_c1_1422_2195 257
16 3300047443 Ga0495687_067024 Ga0495687_067024_12_902 258
17 3300037418 Ga0395900_0642842 Ga0395900_0642842_176_976 265
18 3300049572 Ga0501036_0547516 Ga0501036_0547516_28_834 267
19 3300009036 Ga0105244_10128852 Ga0105244_101288521 270
20 iso_pu_bacteria 2889033259 2889036563 272
21 3300048929 Ga0496126_0577606 Ga0496126_0577606_37_864 273
22 3300037418 Ga0395900_0002292 Ga0395900_0002292_13978_14805 275
23 3300037466 Ga0395898_0002013 Ga0395898_0002013_23824_24651 275
24 3300048929 Ga0496126_0051188 Ga0496126_0051188_19_846 275
25 3300048929 Ga0496126_0080635 Ga0496126_0080635_19_846 275
26 3300049571 Ga0501034_0188961 Ga0501034_0188961_1185_2012 275
27 3300049573 Ga0501037_0320393 Ga0501037_0320393_11_838 275
28 3300049589 Ga0501073_0314435 Ga0501073_0314435_32_859 275
29 iso_pu_bacteria 3001889506 3001890798 281
30 iso_pu_bacteria 2919051321 2919052206 282
31 iso_pu_bacteria 2946059875 2946062179 282
32 iso_pu_bacteria 2775506735 2775655114 283
33 iso_pu_bacteria 2808606366 2808878483 283
34 iso_pu_bacteria 2811994871 2812320577 283
35 iso_pu_bacteria 2857740372 2857742076 283
36 iso_pu_bacteria 2904497146 2904498188 283
37 iso_pu_bacteria 2904776348 2904777546 283
38 iso_pu_bacteria 2910809715 2910810086 283
39 iso_pu_bacteria 2919034639 2919034919 283
40 iso_pu_bacteria 2933418574 2933421072 283
41 iso_pu_bacteria 2939647034 2939648637 283
42 iso_pu_bacteria 2808606360 2808853013 284
43 iso_pu_bacteria 2808606371 2808896996 284
44 iso_pu_bacteria 2849139964 2849142129 284
45 iso_pu_bacteria 2928093941 2928099520 284
46 iso_pu_bacteria 2939598168 2939598633 284
47 iso_pu_bacteria 2984580707 2984582101 284
48 3300037312 Ga0395899_0005680 Ga0395899_0005680_8671_9540 285
49 3300037418 Ga0395900_0026944 Ga0395900_0026944_3538_4407 285
50 3300037466 Ga0395898_0014129 Ga0395898_0014129_3723_4592 285
51 3300037466 Ga0395898_0171930 Ga0395898_0171930_480_1349 285
52 3300037466 Ga0395898_0173885 Ga0395898_0173885_83_952 285
53 3300037471 Ga0395905_0015639 Ga0395905_0015639_593_1462 285
54 3300038443 Ga0395901_0036353 Ga0395901_0036353_3534_4403 285
55 3300044693 Ga0466961_0144592 Ga0466961_0144592_597_1466 285
56 iso_pu_bacteria 2681812866 2681996400 285
57 iso_pu_bacteria 2751185917 2753856736 285
58 iso_pu_bacteria 2905926851 2905929160 285
59 iso_pu_bacteria 2927833300 2927833380 285
60 iso_pu_bacteria 2974302888 2974306368 285
61 3300000549 LJQas_1000313 LJQas_10003132 286
62 3300005335 Ga0070666_10086031 Ga0070666_100860312 286
63 3300005353 Ga0070669_100032156 Ga0070669_1000321562 286
64 3300005354 Ga0070675_100496291 Ga0070675_1004962911 286
65 3300005355 Ga0070671_100494467 Ga0070671_1004944672 286
66 3300005364 Ga0070673_100390300 Ga0070673_1003903001 286
67 3300005367 Ga0070667_100027985 Ga0070667_1000279857 286
68 3300005548 Ga0070665_100449742 Ga0070665_1004497422 286
69 3300006058 Ga0075432_10008863 Ga0075432_100088632 286
70 3300006358 Ga0068871_100711108 Ga0068871_1007111081 286
71 3300009011 Ga0105251_10012385 Ga0105251_100123853 286
72 3300009101 Ga0105247_10328233 Ga0105247_103282331 286
73 3300009148 Ga0105243_10014820 Ga0105243_100148202 286
74 3300009177 Ga0105248_10220185 Ga0105248_102201852 286
75 3300009553 Ga0105249_10193096 Ga0105249_101930962 286
76 3300011119 Ga0105246_10180824 Ga0105246_101808242 286
77 3300013100 Ga0157373_10374820 Ga0157373_103748201 286
78 3300013102 Ga0157371_10053550 Ga0157371_100535502 286
79 3300013296 Ga0157374_10077895 Ga0157374_100778951 286
80 3300025903 Ga0207680_10161871 Ga0207680_101618712 286
81 3300025907 Ga0207645_10027311 Ga0207645_100273112 286
82 3300025923 Ga0207681_10027831 Ga0207681_100278312 286
83 3300025926 Ga0207659_10450718 Ga0207659_104507182 286
84 3300025940 Ga0207691_10001922 Ga0207691_1000192213 286
85 3300025986 Ga0207658_10116657 Ga0207658_101166571 286
86 3300026121 Ga0207683_10000852 Ga0207683_100008526 286
87 3300027907 Ga0207428_10202160 Ga0207428_102021602 286
88 3300028379 Ga0268266_10277060 Ga0268266_102770602 286
89 3300031548 Ga0307408_100010563 Ga0307408_1000105633 286
90 3300031548 Ga0307408_100043912 Ga0307408_1000439122 286
91 3300031548 Ga0307408_100080643 Ga0307408_1000806432 286
92 3300031731 Ga0307405_10006319 Ga0307405_100063192 286
93 3300031731 Ga0307405_10027366 Ga0307405_100273662 286
94 3300031731 Ga0307405_10095174 Ga0307405_100951742 286
95 3300031824 Ga0307413_10002237 Ga0307413_100022377 286
96 3300031824 Ga0307413_10013413 Ga0307413_100134132 286
97 3300031824 Ga0307413_10406443 Ga0307413_104064431 286
98 3300031852 Ga0307410_10000589 Ga0307410_100005899 286
99 3300031852 Ga0307410_10003037 Ga0307410_100030373 286
100 3300031852 Ga0307410_10074763 Ga0307410_100747632 286
101 3300031903 Ga0307407_10091485 Ga0307407_100914852 286
102 3300031911 Ga0307412_10001061 Ga0307412_1000106113 286
103 3300031911 Ga0307412_10006661 Ga0307412_100066614 286
104 3300031911 Ga0307412_10041803 Ga0307412_100418032 286
105 3300032002 Ga0307416_100005468 Ga0307416_1000054682 286
106 3300032002 Ga0307416_100283804 Ga0307416_1002838042 286
107 3300032004 Ga0307414_10040700 Ga0307414_100407002 286
108 3300032005 Ga0307411_10004613 Ga0307411_100046132 286
109 3300036647 Ga0316582_0383352 Ga0316582_0383352_77_946 286
110 3300037312 Ga0395899_0010822 Ga0395899_0010822_5031_5894 286
111 3300037418 Ga0395900_0068511 Ga0395900_0068511_2567_3430 286
112 3300037466 Ga0395898_0083624 Ga0395898_0083624_1942_2817 286
113 3300037471 Ga0395905_0026671 Ga0395905_0026671_1687_2550 286
114 3300038443 Ga0395901_0168100 Ga0395901_0168100_1326_2189 286
115 3300041404 Ga0439436_0007527 Ga0439436_0007527_1546_2409 286
116 3300041999 Ga0439433_0000065 Ga0439433_0000065_3206_4069 286
117 3300042002 Ga0439442_000001 Ga0439442_000001_56148_57011 286
118 3300042007 Ga0439449_0021569 Ga0439449_0021569_1116_1991 286
119 3300042007 Ga0439449_0034103 Ga0439449_0034103_371_1234 286
120 3300042121 Ga0450919_006490 Ga0450919_006490_340_1203 286
121 3300042122 Ga0450920_000059 Ga0450920_000059_7831_8694 286
122 3300042146 Ga0450907_000303 Ga0450907_000303_12435_13298 286
123 3300042435 Ga0439434_0007612 Ga0439434_0007612_2247_3110 286
124 3300042435 Ga0439434_0065692 Ga0439434_0065692_116_991 286
125 3300042531 Ga0450918_000276 Ga0450918_000276_7591_8454 286
126 3300044842 Ga0466957_0148265 Ga0466957_0148265_28_891 286
127 3300046512 Ga0495610_0070992 Ga0495610_0070992_116_988 286
128 3300046528 Ga0495642_0058314 Ga0495642_0058314_79_942 286
129 3300046558 Ga0495633_0103906 Ga0495633_0103906_167_1039 286
130 3300046615 Ga0495656_0006245 Ga0495656_0006245_985_1857 286
131 3300046664 Ga0495659_0094487 Ga0495659_0094487_191_1054 286
132 3300046691 Ga0495670_0042156 Ga0495670_0042156_126_998 286
133 3300048907 Ga0496104_0233637 Ga0496104_0233637_408_1280 286
134 3300048908 Ga0496105_0173597 Ga0496105_0173597_458_1330 286
135 3300048909 Ga0496106_0295160 Ga0496106_0295160_29_892 286
136 3300048911 Ga0496108_0016877 Ga0496108_0016877_1663_2535 286
137 3300048911 Ga0496108_0098954 Ga0496108_0098954_1206_2078 286
138 3300048913 Ga0496110_0280051 Ga0496110_0280051_573_1445 286
139 3300048915 Ga0496112_0006565 Ga0496112_0006565_3654_4529 286
140 3300048915 Ga0496112_0028066 Ga0496112_0028066_2123_2998 286
141 3300048917 Ga0496114_0209195 Ga0496114_0209195_599_1471 286
142 3300048927 Ga0496124_0229791 Ga0496124_0229791_108_980 286
143 3300049573 Ga0501037_0085794 Ga0501037_0085794_1256_2131 286
144 3300049574 Ga0501038_0001529 Ga0501038_0001529_2850_3713 286
145 3300049574 Ga0501038_0009897 Ga0501038_0009897_6028_6903 286
146 3300049575 Ga0501039_0005049 Ga0501039_0005049_2531_3394 286
147 3300059477 Ga0587084_010320 Ga0587084_010320_317_1192 286
148 3300059491 Ga0587070_015401 Ga0587070_015401_197_1072 286
149 3300059492 Ga0587073_0022347 Ga0587073_0022347_316_1191 286
150 3300059510 Ga0587090_012339 Ga0587090_012339_316_1191 286
151 3300059605 Ga0587106_001284 Ga0587106_001284_215_1078 286
152 3300059630 Ga0587128_022202 Ga0587128_022202_53_928 286
153 3300059647 Ga0587079_018512 Ga0587079_018512_317_1192 286
154 iso_pu_bacteria 2690315906 2691514560 286
155 iso_pu_bacteria 2784132109 2784471651 286
156 iso_pu_bacteria 2808606357 2808827658 286
157 iso_pu_bacteria 2857740372 2857744596 286
158 iso_pu_bacteria 2893684298 2893686893 286
159 iso_pu_bacteria 2904776348 2904777083 286
160 iso_pu_bacteria 3001119090 3001120388 286
161 3300009036 Ga0105244_10001709 Ga0105244_100017094 287
162 3300009036 Ga0105244_10024666 Ga0105244_100246663 287
163 3300025728 Ga0207655_1000733 Ga0207655_100073311 287
164 3300037418 Ga0395900_0175868 Ga0395900_0175868_109_975 287
165 3300038443 Ga0395901_0054286 Ga0395901_0054286_1329_2195 287
166 3300049569 Ga0501032_0000942 Ga0501032_0000942_5635_6501 287
167 3300049571 Ga0501034_0000016 Ga0501034_0000016_135391_136260 287
168 3300049573 Ga0501037_0028995 Ga0501037_0028995_2563_3429 287
169 3300049579 Ga0501043_0090913 Ga0501043_0090913_726_1592 287
170 3300050491 nmdc:mga00v17_77369_c1 nmdc:mga00v17_77369_c1_92_958 287
171 iso_pu_bacteria 2508501009 2508541012 287
172 iso_pu_bacteria 2511231008 2511280734 287
173 iso_pu_bacteria 2513237098 2513674563 287
174 iso_pu_bacteria 2513237098 2513679857 287
175 iso_pu_bacteria 2513237101 2513692964 287
176 iso_pu_bacteria 2524023210 2524463711 287
177 iso_pu_bacteria 2524023210 2524471089 287
178 iso_pu_bacteria 2617270735 2617349927 287
179 iso_pu_bacteria 2738541265 2738674403 287
180 iso_pu_bacteria 2738541282 2738752796 287
181 iso_pu_bacteria 2738541303 2738861837 287
182 iso_pu_bacteria 2806310737 2807410759 287
183 iso_pu_bacteria 2806310745 2807459100 287
184 iso_pu_bacteria 2808606382 2808955699 287
185 iso_pu_bacteria 2874604998 2874612288 287
186 iso_pu_bacteria 2885383462 2885383463 287
187 iso_pu_bacteria 2885383462 2885392600 287
188 iso_pu_bacteria 2903727486 2903734205 287
189 iso_pu_bacteria 2903768456 2903769341 287
190 iso_pu_bacteria 2903768456 2903775564 287
191 iso_pu_bacteria 2908775508 2908782334 287
192 iso_pu_bacteria 2932426870 2932428234 287
193 iso_pu_bacteria 2935801545 2935804870 287
194 iso_pu_bacteria 2939674588 2939675309 287
195 iso_pu_bacteria 3005483717 3005485246 287
196 iso_pu_bacteria 8006926726 8006929577 287
197 iso_pu_bacteria 8006994254 8006997275 287
198 iso_pu_bacteria 8019576017 8019580386 287
199 iso_pu_bacteria 8019586578 8019588111 287
200 iso_pu_bacteria 8019608314 8019615302 287
201 iso_pu_bacteria 8056120720 8056125666 287
202 iso_pu_bacteria 8056673599 8056676803 287
203 iso_pu_bacteria 8056681323 8056685695 287
204 iso_pu_bacteria 8056967851 8056973353 287
205 3300000549 LJQas_1000428 LJQas_10004285 288
206 3300005295 Ga0065707_10082876 Ga0065707_100828766 288
207 3300006847 Ga0075431_100269507 Ga0075431_1002695072 288
208 3300009092 Ga0105250_10000032 Ga0105250_1000003284 288
209 3300011119 Ga0105246_10042715 Ga0105246_100427152 288
210 3300013308 Ga0157375_10220641 Ga0157375_102206411 288
211 3300014968 Ga0157379_10000004 Ga0157379_1000000485 288
212 3300025711 Ga0207696_1000198 Ga0207696_100019812 288
213 3300031240 Ga0265320_10025982 Ga0265320_100259823 288
214 3300031241 Ga0265325_10000922 Ga0265325_1000092221 288
215 3300031247 Ga0265340_10003444 Ga0265340_100034446 288
216 3300031249 Ga0265339_10007897 Ga0265339_100078974 288
217 3300031344 Ga0265316_10052652 Ga0265316_100526524 288
218 3300031548 Ga0307408_100090973 Ga0307408_1000909733 288
219 3300031548 Ga0307408_100215937 Ga0307408_1002159372 288
220 3300031711 Ga0265314_10082348 Ga0265314_100823482 288
221 3300031731 Ga0307405_10091519 Ga0307405_100915192 288
222 3300031731 Ga0307405_10317371 Ga0307405_103173711 288
223 3300031911 Ga0307412_10059824 Ga0307412_100598242 288
224 3300031911 Ga0307412_10147085 Ga0307412_101470852 288
225 3300031995 Ga0307409_100241533 Ga0307409_1002415332 288
226 3300031995 Ga0307409_100254933 Ga0307409_1002549332 288
227 3300032002 Ga0307416_100234091 Ga0307416_1002340912 288
228 3300032002 Ga0307416_100871623 Ga0307416_1008716231 288
229 3300032002 Ga0307416_101031055 Ga0307416_1010310551 288
230 3300037418 Ga0395900_0010130 Ga0395900_0010130_6850_7719 288
231 3300037466 Ga0395898_0006115 Ga0395898_0006115_6192_7061 288
232 3300038443 Ga0395901_0004737 Ga0395901_0004737_4952_5821 288
233 3300038726 Ga0400490_14049 Ga0400490_14049_5077_5943 288
234 3300041404 Ga0439436_0000550 Ga0439436_0000550_6503_7381 288
235 3300041405 Ga0439438_000449 Ga0439438_000449_13950_14828 288
236 3300041406 Ga0439439_0000054 Ga0439439_0000054_5036_5905 288
237 3300041407 Ga0439447_027295 Ga0439447_027295_436_1314 288
238 3300041410 Ga0439461_0007338 Ga0439461_0007338_1055_1933 288
239 3300041411 Ga0439466_0001366 Ga0439466_0001366_1259_2137 288
240 3300041999 Ga0439433_0000004 Ga0439433_0000004_6137_7015 288
241 3300041999 Ga0439433_0000455 Ga0439433_0000455_172_1074 288
242 3300042002 Ga0439442_000592 Ga0439442_000592_5375_6253 288
243 3300042002 Ga0439442_001300 Ga0439442_001300_422_1291 288
244 3300042002 Ga0439442_003782 Ga0439442_003782_1181_2080 288
245 3300042006 Ga0439432_000310 Ga0439432_000310_13761_14639 288
246 3300042007 Ga0439449_0000405 Ga0439449_0000405_7900_8778 288
247 3300042007 Ga0439449_0045071 Ga0439449_0045071_244_1146 288
248 3300042010 Ga0439452_001352 Ga0439452_001352_3292_4170 288
249 3300042014 Ga0439457_000956 Ga0439457_000956_6583_7461 288
250 3300042015 Ga0439462_0000546 Ga0439462_0000546_4856_5734 288
251 3300042122 Ga0450920_000088 Ga0450920_000088_6159_7037 288
252 3300042146 Ga0450907_000288 Ga0450907_000288_6159_7037 288
253 3300042184 Ga0450908_007264 Ga0450908_007264_763_1641 288
254 3300042185 Ga0450909_005045 Ga0450909_005045_822_1700 288
255 3300042435 Ga0439434_0001912 Ga0439434_0001912_4412_5290 288
256 3300042531 Ga0450918_000190 Ga0450918_000190_4096_4974 288
257 3300046459 Ga0495629_0146459 Ga0495629_0146459_549_1418 288
258 3300046472 Ga0495580_0007029 Ga0495580_0007029_619_1488 288
259 3300046473 Ga0495582_0035328 Ga0495582_0035328_485_1354 288
260 3300046475 Ga0495639_0001561 Ga0495639_0001561_8174_9043 288
261 3300046535 Ga0495586_0001724 Ga0495586_0001724_3891_4760 288
262 3300046674 Ga0495588_0007529 Ga0495588_0007529_1524_2393 288
263 3300046809 Ga0495600_0028073 Ga0495600_0028073_1755_2624 288
264 3300047315 Ga0495581_0001814 Ga0495581_0001814_3356_4225 288
265 3300047673 Ga0495593_0043612 Ga0495593_0043612_592_1461 288
266 3300048917 Ga0496114_0012738 Ga0496114_0012738_2005_2883 288
267 3300053140 Ga0500573_0030414 Ga0500573_0030414_1807_2709 288
268 iso_pu_bacteria 2511231028 2511399978 288
269 iso_pu_bacteria 2513237094 2513641537 288
270 iso_pu_bacteria 2513237096 2513653891 288
271 iso_pu_bacteria 2513237102 2513704000 288
272 iso_pu_bacteria 2513237137 2513856325 288
273 iso_pu_bacteria 2513237141 2513890118 288
274 iso_pu_bacteria 2513237145 2513918231 288
275 iso_pu_bacteria 2513237161 2514014923 288
276 iso_pu_bacteria 2517572143 2517891539 288
277 iso_pu_bacteria 2524023228 2524538696 288
278 iso_pu_bacteria 2528768022 2528857566 288
279 iso_pu_bacteria 2728368998 2728754874 288
280 iso_pu_bacteria 2791355197 2793066902 288
281 iso_pu_bacteria 2838122688 2838126685 288
282 iso_pu_bacteria 2840764183 2840764458 288
283 iso_pu_bacteria 2841941048 2841949136 288
284 iso_pu_bacteria 2841966195 2841974096 288
285 iso_pu_bacteria 2874628541 2874630716 288
286 iso_pu_bacteria 2885366525 2885371648 288
287 iso_pu_bacteria 2885374607 2885380394 288
288 iso_pu_bacteria 2885409591 2885418387 288
289 iso_pu_bacteria 2891395885 2891400055 288
290 iso_pu_bacteria 2894652903 2894653177 288
291 iso_pu_bacteria 2904690495 2904691354 288
292 iso_pu_bacteria 2904699407 2904704754 288
293 iso_pu_bacteria 2906610324 2906616714 288
294 iso_pu_bacteria 2906626472 2906628655 288
295 iso_pu_bacteria 2906635258 2906639828 288
296 iso_pu_bacteria 2906660503 2906667042 288
297 iso_pu_bacteria 2908739725 2908741882 288
298 iso_pu_bacteria 2908756301 2908759534 288
299 iso_pu_bacteria 2922425934 2922431256 288
300 iso_pu_bacteria 2932794094 2932798617 288
301 iso_pu_bacteria 2932801729 2932806489 288
302 iso_pu_bacteria 2932818245 2932824517 288
303 iso_pu_bacteria 2935630451 2935633854 288
304 iso_pu_bacteria 2935675223 2935684392 288
305 iso_pu_bacteria 2935883170 2935888672 288
306 iso_pu_bacteria 2935959822 2935964860 288
307 iso_pu_bacteria 2941507105 2941510843 288
308 iso_pu_bacteria 2941515067 2941518227 288
309 iso_pu_bacteria 2941523033 2941526902 288
310 iso_pu_bacteria 2941531003 2941536532 288
311 iso_pu_bacteria 2945920336 2945921375 288
312 iso_pu_bacteria 2945941187 2945942436 288
313 iso_pu_bacteria 2946037020 2946038381 288
314 iso_pu_bacteria 2990044586 2990046252 288
315 iso_pu_bacteria 3002141150 3002142754 288
316 iso_pu_bacteria 3005474847 3005481053 288
317 iso_pu_bacteria 3005594810 3005601021 288
318 iso_pu_bacteria 3005718088 3005723789 288
319 iso_pu_bacteria 8006933436 8006939658 288
320 iso_pu_bacteria 8006973647 8006979407 288
321 iso_pu_bacteria 8019555841 8019565550 288
322 iso_pu_bacteria 8019565922 8019575646 288
323 iso_pu_bacteria 8019638758 8019647930 288
324 iso_pu_bacteria 8056131705 8056135155 288
325 iso_pu_bacteria 8056689827 8056693848 288
326 3300009094 Ga0111539_11033170 Ga0111539_110331701 289
327 3300009176 Ga0105242_10000988 Ga0105242_1000098816 289
328 3300021358 Ga0213873_10000002 Ga0213873_10000002183 289
329 3300021384 Ga0213876_10000001 Ga0213876_10000001266 289
330 3300025934 Ga0207686_10048677 Ga0207686_100486772 289
331 3300028794 Ga0307515_10013216 Ga0307515_1001321616 289
332 3300039437 Ga0436365_0332720 Ga0436365_0332720_222663_223535 289
333 3300039453 Ga0436362_0660519 Ga0436362_0660519_765484_766356 289
334 3300044712 Ga0453684_0681262 Ga0453684_0681262_230_1108 289
335 3300049579 Ga0501043_0005412 Ga0501043_0005412_6267_7148 289
336 3300050510 nmdc:mga06r32_353259_c1 nmdc:mga06r32_353259_c1_229_1119 289
337 3300005288 Ga0065714_10021260 Ga0065714_100212602 290
338 3300005347 Ga0070668_100148176 Ga0070668_1001481762 290
339 3300005440 Ga0070705_100123621 Ga0070705_1001236212 290
340 3300005441 Ga0070700_100000016 Ga0070700_10000001654 290
341 3300005456 Ga0070678_100080939 Ga0070678_1000809393 290
342 3300005615 Ga0070702_100015741 Ga0070702_1000157412 290
343 3300005718 Ga0068866_10076377 Ga0068866_100763772 290
344 3300005840 Ga0068870_10038027 Ga0068870_100380273 290
345 3300006058 Ga0075432_10053983 Ga0075432_100539832 290
346 3300009036 Ga0105244_10019047 Ga0105244_100190473 290
347 3300009092 Ga0105250_10000325 Ga0105250_1000032536 290
348 3300009148 Ga0105243_10014716 Ga0105243_100147163 290
349 3300009176 Ga0105242_10063793 Ga0105242_100637932 290
350 3300009177 Ga0105248_10040375 Ga0105248_100403755 290
351 3300009551 Ga0105238_10096288 Ga0105238_100962882 290
352 3300011119 Ga0105246_10099564 Ga0105246_100995642 290
353 3300013297 Ga0157378_10059697 Ga0157378_100596972 290
354 3300013306 Ga0163162_10341159 Ga0163162_103411592 290
355 3300014326 Ga0157380_10507600 Ga0157380_105076002 290
356 3300014969 Ga0157376_10245586 Ga0157376_102455862 290
357 3300025261 Ga0209233_1001306 Ga0209233_100130611 290
358 3300025303 Ga0209051_1001715 Ga0209051_100171513 290
359 3300025711 Ga0207696_1000386 Ga0207696_100038637 290
360 3300025728 Ga0207655_1017212 Ga0207655_10172123 290
361 3300025934 Ga0207686_10020400 Ga0207686_100204004 290
362 3300025935 Ga0207709_10018228 Ga0207709_100182283 290
363 3300025941 Ga0207711_10366058 Ga0207711_103660582 290
364 3300026075 Ga0207708_10000005 Ga0207708_1000000554 290
365 3300026088 Ga0207641_10064763 Ga0207641_100647632 290
366 3300046524 Ga0495648_0038782 Ga0495648_0038782_1375_2250 290
367 3300046530 Ga0495654_0003598 Ga0495654_0003598_2951_3826 290
368 3300046691 Ga0495670_0019653 Ga0495670_0019653_1543_2418 290
369 3300048920 Ga0496117_0009546 Ga0496117_0009546_3233_4108 290
370 3300048921 Ga0496118_0029332 Ga0496118_0029332_2698_3573 290
371 3300048923 Ga0496120_0040477 Ga0496120_0040477_59_934 290
372 3300048926 Ga0496123_0140427 Ga0496123_0140427_376_1251 290
373 3300048927 Ga0496124_0002163 Ga0496124_0002163_21871_22746 290
374 3300048927 Ga0496124_0145976 Ga0496124_0145976_296_1171 290
375 3300048928 Ga0496125_0026490 Ga0496125_0026490_547_1422 290
376 3300048929 Ga0496126_0029998 Ga0496126_0029998_2311_3186 290
377 3300048929 Ga0496126_0049326 Ga0496126_0049326_2791_3666 290
378 3300049586 Ga0501070_0186148 Ga0501070_0186148_401_1321 290
379 3300049758 Ga0501241_001816 Ga0501241_001816_2627_3499 290
380 3300003354 JGI25160J50197_1008646 JGI25160J50197_10086462 291
381 3300003771 Ga0055526_1018034 Ga0055526_10180342 291
382 3300005262 Ga0065165_1002041 Ga0065165_100204112 291
383 3300005262 Ga0065165_1004508 Ga0065165_10045086 291
384 3300005327 Ga0070658_10287331 Ga0070658_102873311 291
385 3300005338 Ga0068868_100137522 Ga0068868_1001375222 291
386 3300005339 Ga0070660_100152652 Ga0070660_1001526523 291
387 3300005347 Ga0070668_100101282 Ga0070668_1001012822 291
388 3300005354 Ga0070675_100259033 Ga0070675_1002590331 291
389 3300005356 Ga0070674_100098058 Ga0070674_1000980582 291
390 3300005364 Ga0070673_100140182 Ga0070673_1001401822 291
391 3300005366 Ga0070659_100073436 Ga0070659_1000734362 291
392 3300005367 Ga0070667_100029259 Ga0070667_1000292593 291
393 3300005436 Ga0070713_100155674 Ga0070713_1001556742 291
394 3300005437 Ga0070710_10065829 Ga0070710_100658292 291
395 3300005440 Ga0070705_100085280 Ga0070705_1000852802 291
396 3300005444 Ga0070694_100028742 Ga0070694_1000287422 291
397 3300005455 Ga0070663_100085322 Ga0070663_1000853223 291
398 3300005545 Ga0070695_100115921 Ga0070695_1001159212 291
399 3300005546 Ga0070696_100145516 Ga0070696_1001455163 291
400 3300005547 Ga0070693_100100600 Ga0070693_1001006002 291
401 3300005547 Ga0070693_100221020 Ga0070693_1002210202 291
402 3300005549 Ga0070704_100222740 Ga0070704_1002227401 291
403 3300005563 Ga0068855_100009183 Ga0068855_1000091832 291
404 3300005563 Ga0068855_100264546 Ga0068855_1002645463 291
405 3300005577 Ga0068857_100127798 Ga0068857_1001277982 291
406 3300005578 Ga0068854_100080249 Ga0068854_1000802492 291
407 3300005614 Ga0068856_100124021 Ga0068856_1001240213 291
408 3300005617 Ga0068859_100471540 Ga0068859_1004715402 291
409 3300005618 Ga0068864_100149334 Ga0068864_1001493342 291
410 3300005719 Ga0068861_100240165 Ga0068861_1002401652 291
411 3300005834 Ga0068851_10025378 Ga0068851_100253783 291
412 3300005841 Ga0068863_100017642 Ga0068863_1000176422 291
413 3300005842 Ga0068858_100444736 Ga0068858_1004447361 291
414 3300005843 Ga0068860_100006638 Ga0068860_1000066382 291
415 3300005843 Ga0068860_100256874 Ga0068860_1002568741 291
416 3300005983 Ga0081540_1004075 Ga0081540_100407512 291
417 3300005983 Ga0081540_1012922 Ga0081540_10129227 291
418 3300005983 Ga0081540_1019967 Ga0081540_10199673 291
419 3300005983 Ga0081540_1024743 Ga0081540_10247432 291
420 3300006028 Ga0070717_10137831 Ga0070717_101378312 291
421 3300006173 Ga0070716_100084534 Ga0070716_1000845342 291
422 3300006186 Ga0075369_10008001 Ga0075369_100080012 291
423 3300006237 Ga0097621_100203510 Ga0097621_1002035103 291
424 3300006358 Ga0068871_100183992 Ga0068871_1001839922 291
425 3300006844 Ga0075428_100569201 Ga0075428_1005692011 291
426 3300006852 Ga0075433_10338652 Ga0075433_103386522 291
427 3300006871 Ga0075434_100061688 Ga0075434_1000616884 291
428 3300006881 Ga0068865_100184839 Ga0068865_1001848392 291
429 3300006931 Ga0097620_100471546 Ga0097620_1004715462 291
430 3300007076 Ga0075435_100161354 Ga0075435_1001613542 291
431 3300009011 Ga0105251_10045775 Ga0105251_100457753 291
432 3300009092 Ga0105250_10074592 Ga0105250_100745922 291
433 3300009093 Ga0105240_10067287 Ga0105240_100672874 291
434 3300009093 Ga0105240_10134481 Ga0105240_101344813 291
435 3300009094 Ga0111539_10022931 Ga0111539_100229315 291
436 3300009148 Ga0105243_10047630 Ga0105243_100476304 291
437 3300009176 Ga0105242_10159112 Ga0105242_101591123 291
438 3300009177 Ga0105248_10065945 Ga0105248_100659452 291
439 3300009177 Ga0105248_10239757 Ga0105248_102397572 291
440 3300009545 Ga0105237_10005366 Ga0105237_100053664 291
441 3300009551 Ga0105238_10000004 Ga0105238_10000004191 291
442 3300009553 Ga0105249_10142757 Ga0105249_101427572 291
443 3300010375 Ga0105239_10021850 Ga0105239_100218503 291
444 3300010375 Ga0105239_10523652 Ga0105239_105236522 291
445 3300011119 Ga0105246_10149623 Ga0105246_101496232 291
446 3300011119 Ga0105246_10408763 Ga0105246_104087631 291
447 3300013102 Ga0157371_10082265 Ga0157371_100822652 291
448 3300013104 Ga0157370_10073595 Ga0157370_100735953 291
449 3300013104 Ga0157370_10210979 Ga0157370_102109792 291
450 3300013105 Ga0157369_10284252 Ga0157369_102842522 291
451 3300013296 Ga0157374_10093981 Ga0157374_100939813 291
452 3300013306 Ga0163162_10115450 Ga0163162_101154503 291
453 3300013307 Ga0157372_10253465 Ga0157372_102534652 291
454 3300014325 Ga0163163_10490980 Ga0163163_104909802 291
455 3300014326 Ga0157380_10073722 Ga0157380_100737223 291
456 3300014969 Ga0157376_10391266 Ga0157376_103912662 291
457 3300015261 Ga0182006_1000572 Ga0182006_100057223 291
458 3300017792 Ga0163161_10125641 Ga0163161_101256412 291
459 3300025254 Ga0209148_1000239 Ga0209148_100023934 291
460 3300025272 Ga0209455_1002439 Ga0209455_10024396 291
461 3300025297 Ga0209758_1035507 Ga0209758_10355072 291
462 3300025299 Ga0209256_1003643 Ga0209256_10036431 291
463 3300025302 Ga0207426_1000527 Ga0207426_10005273 291
464 3300025302 Ga0207426_1015512 Ga0207426_10155122 291
465 3300025900 Ga0207710_10140486 Ga0207710_101404861 291
466 3300025901 Ga0207688_10115997 Ga0207688_101159972 291
467 3300025903 Ga0207680_10027568 Ga0207680_100275682 291
468 3300025903 Ga0207680_10028171 Ga0207680_100281713 291
469 3300025911 Ga0207654_10052793 Ga0207654_100527932 291
470 3300025911 Ga0207654_10115232 Ga0207654_101152322 291
471 3300025913 Ga0207695_10001008 Ga0207695_1000100822 291
472 3300025913 Ga0207695_10002445 Ga0207695_100024454 291
473 3300025914 Ga0207671_10030463 Ga0207671_100304634 291
474 3300025915 Ga0207693_10002666 Ga0207693_100026663 291
475 3300025918 Ga0207662_10013430 Ga0207662_100134306 291
476 3300025919 Ga0207657_10282420 Ga0207657_102824202 291
477 3300025923 Ga0207681_10175551 Ga0207681_101755513 291
478 3300025924 Ga0207694_10000021 Ga0207694_10000021109 291
479 3300025928 Ga0207700_10126608 Ga0207700_101266082 291
480 3300025929 Ga0207664_10416411 Ga0207664_104164112 291
481 3300025933 Ga0207706_10225770 Ga0207706_102257701 291
482 3300025934 Ga0207686_10258963 Ga0207686_102589632 291
483 3300025939 Ga0207665_10042604 Ga0207665_100426043 291
484 3300025942 Ga0207689_10073517 Ga0207689_100735172 291
485 3300025949 Ga0207667_10052624 Ga0207667_100526245 291
486 3300025949 Ga0207667_10277639 Ga0207667_102776392 291
487 3300025972 Ga0207668_10125623 Ga0207668_101256232 291
488 3300026035 Ga0207703_10177578 Ga0207703_101775782 291
489 3300026067 Ga0207678_10121583 Ga0207678_101215832 291
490 3300026088 Ga0207641_10000412 Ga0207641_1000041220 291
491 3300026095 Ga0207676_10040599 Ga0207676_100405992 291
492 3300026118 Ga0207675_100158547 Ga0207675_1001585472 291
493 3300026121 Ga0207683_10130079 Ga0207683_101300793 291
494 3300028381 Ga0268264_10000689 Ga0268264_1000068912 291
495 3300031733 Ga0316577_10014346 Ga0316577_100143462 291
496 3300035090 Ga0373949_0025947 Ga0373949_0025947_134_1009 291
497 3300035691 Ga0373931_0089515 Ga0373931_0089515_21_896 291
498 3300037853 Ga0436364_0681592 Ga0436364_0681592_1020_1895 291
499 3300038443 Ga0395901_0705622 Ga0395901_0705622_59_934 291
500 3300039437 Ga0436365_1326044 Ga0436365_1326044_1654_2529 291
501 3300039438 Ga0436360_1309131 Ga0436360_1309131_1822_2697 291
502 3300039447 Ga0436361_0340447 Ga0436361_0340447_571_1446 291
503 3300039447 Ga0436361_0648521 Ga0436361_0648521_902_1777 291
504 3300045976 Ga0466967_0455037 Ga0466967_0455037_227_1102 291
505 3300046462 Ga0495651_0133506 Ga0495651_0133506_210_1085 291
506 3300046477 Ga0495664_0017458 Ga0495664_0017458_2108_2983 291
507 3300046675 Ga0495657_0114570 Ga0495657_0114570_703_1578 291
508 3300047320 Ga0495672_0042930 Ga0495672_0042930_622_1497 291
509 3300048088 Ga0495602_0114844 Ga0495602_0114844_1232_2107 291
510 3300048903 Ga0496100_0165962 Ga0496100_0165962_666_1541 291
511 3300048904 Ga0496101_0246232 Ga0496101_0246232_499_1374 291
512 3300048907 Ga0496104_0103020 Ga0496104_0103020_66_941 291
513 3300048908 Ga0496105_0005541 Ga0496105_0005541_2678_3553 291
514 3300048908 Ga0496105_0148645 Ga0496105_0148645_914_1789 291
515 3300048909 Ga0496106_0260229 Ga0496106_0260229_485_1360 291
516 3300048913 Ga0496110_0163753 Ga0496110_0163753_847_1722 291
517 3300048914 Ga0496111_0250255 Ga0496111_0250255_266_1141 291
518 3300048915 Ga0496112_0489848 Ga0496112_0489848_279_1154 291
519 3300048917 Ga0496114_0152926 Ga0496114_0152926_758_1633 291
520 3300048918 Ga0496115_0116043 Ga0496115_0116043_595_1470 291
521 3300048918 Ga0496115_0215468 Ga0496115_0215468_467_1342 291
522 3300048925 Ga0496122_0134845 Ga0496122_0134845_592_1467 291
523 3300048929 Ga0496126_0006015 Ga0496126_0006015_9863_10738 291
524 3300048929 Ga0496126_0046400 Ga0496126_0046400_2989_3864 291
525 3300048929 Ga0496126_0133829 Ga0496126_0133829_455_1330 291
526 3300049568 Ga0501031_0070033 Ga0501031_0070033_364_1239 291
527 3300049568 Ga0501031_0080584 Ga0501031_0080584_260_1135 291
528 3300049569 Ga0501032_0103963 Ga0501032_0103963_796_1671 291
529 3300049570 Ga0501033_0000674 Ga0501033_0000674_24656_25531 291
530 3300049572 Ga0501036_0501051 Ga0501036_0501051_113_988 291
531 3300049573 Ga0501037_0086799 Ga0501037_0086799_491_1366 291
532 3300049574 Ga0501038_0000734 Ga0501038_0000734_16336_17211 291
533 3300049575 Ga0501039_0093328 Ga0501039_0093328_56_931 291
534 3300049576 Ga0501040_0005957 Ga0501040_0005957_6909_7784 291
535 3300049579 Ga0501043_0002923 Ga0501043_0002923_4363_5238 291
536 3300049579 Ga0501043_0009885 Ga0501043_0009885_1796_2671 291
537 3300049579 Ga0501043_0085405 Ga0501043_0085405_1393_2274 291
538 3300049579 Ga0501043_0233365 Ga0501043_0233365_237_1112 291
539 3300049580 Ga0501046_0015018 Ga0501046_0015018_5216_6091 291
540 3300049580 Ga0501046_0123177 Ga0501046_0123177_656_1531 291
541 3300049581 Ga0501047_0220179 Ga0501047_0220179_682_1620 291
542 3300049583 Ga0501067_0028783 Ga0501067_0028783_959_1834 291
543 3300049584 Ga0501068_0095443 Ga0501068_0095443_502_1377 291
544 3300049584 Ga0501068_0143952 Ga0501068_0143952_283_1158 291
545 3300049585 Ga0501069_0150479 Ga0501069_0150479_10_885 291
546 3300049586 Ga0501070_0056862 Ga0501070_0056862_1263_2138 291
547 3300049586 Ga0501070_0124978 Ga0501070_0124978_355_1236 291
548 3300049587 Ga0501071_0397088 Ga0501071_0397088_101_976 291
549 3300049589 Ga0501073_0055431 Ga0501073_0055431_284_1159 291
550 3300049590 Ga0501074_0006081 Ga0501074_0006081_4582_5457 291
551 3300049592 Ga0501076_0137759 Ga0501076_0137759_77_952 291
552 3300049593 Ga0501077_0045550 Ga0501077_0045550_1498_2373 291
553 3300049742 Ga0501080_0090592 Ga0501080_0090592_1952_2827 291
554 3300049742 Ga0501080_0382764 Ga0501080_0382764_21_896 291
555 3300049822 Ga0501035_0001334 Ga0501035_0001334_23567_24442 291
556 3300049822 Ga0501035_0089026 Ga0501035_0089026_362_1237 291
557 3300049823 Ga0501044_0040327 Ga0501044_0040327_1817_2692 291
558 3300049823 Ga0501044_0059545 Ga0501044_0059545_1097_1972 291
559 3300049824 Ga0501045_0006283 Ga0501045_0006283_1184_2059 291
560 3300050489 nmdc:mga03683_91143_c1 nmdc:mga03683_91143_c1_176_1051 291
561 3300050511 nmdc:mga08y16_366531_c1 nmdc:mga08y16_366531_c1_34_909 291
562 3300050512 nmdc:mga0n895_324180_c1 nmdc:mga0n895_324180_c1_178_1053 291
563 3300050516 nmdc:mga0sz30_5801_c1 nmdc:mga0sz30_5801_c1_3606_4481 291
564 3300053077 Ga0495601_0036166 Ga0495601_0036166_413_1288 291
565 3300053078 Ga0495612_0008841 Ga0495612_0008841_1370_2245 291
566 3300053123 Ga0500614_034190 Ga0500614_034190_216_1205 291
567 3300054114 Ga0501084_0178750 Ga0501084_0178750_881_1756 291
568 iso_pu_bacteria 2904439833 2904442152 291
569 iso_pu_bacteria 2904530477 2904533442 291
570 iso_pu_bacteria 2904584206 2904586394 291
571 iso_pu_bacteria 2904589729 2904591793 291
572 iso_pu_bacteria 2904601388 2904602048 291
573 iso_pu_bacteria 2919079590 2919083608 291
574 2162886007 SwRhRL2b_contig_431541 SwRhRL2b_0488.00000890 292
575 3300003215 JGI25153J46596_10000502 JGI25153J46596_100005023 292
576 3300003215 JGI25153J46596_10004212 JGI25153J46596_100042123 292
577 3300003322 rootL2_10137330 rootL2_101373302 292
578 3300003354 JGI25160J50197_1000344 JGI25160J50197_100034422 292
579 3300003354 JGI25160J50197_1004733 JGI25160J50197_10047333 292
580 3300004625 Ga0055543_1001128 Ga0055543_100112812 292
581 3300005262 Ga0065165_1000054 Ga0065165_1000054129 292
582 3300005262 Ga0065165_1024806 Ga0065165_10248062 292
583 3300005289 Ga0065704_10070449 Ga0065704_1007044910 292
584 3300005329 Ga0070683_100019205 Ga0070683_1000192055 292
585 3300005329 Ga0070683_100209810 Ga0070683_1002098101 292
586 3300005337 Ga0070682_100060944 Ga0070682_1000609441 292
587 3300005339 Ga0070660_100050701 Ga0070660_1000507013 292
588 3300005339 Ga0070660_100167111 Ga0070660_1001671112 292
589 3300005344 Ga0070661_100015251 Ga0070661_1000152512 292
590 3300005347 Ga0070668_100205306 Ga0070668_1002053062 292
591 3300005347 Ga0070668_100287471 Ga0070668_1002874712 292
592 3300005355 Ga0070671_100211219 Ga0070671_1002112192 292
593 3300005366 Ga0070659_100039289 Ga0070659_1000392892 292
594 3300005435 Ga0070714_100016833 Ga0070714_1000168332 292
595 3300005435 Ga0070714_100358870 Ga0070714_1003588701 292
596 3300005436 Ga0070713_100099432 Ga0070713_1000994322 292
597 3300005456 Ga0070678_100460312 Ga0070678_1004603122 292
598 3300005530 Ga0070679_100097641 Ga0070679_1000976412 292
599 3300005539 Ga0068853_100007053 Ga0068853_1000070533 292
600 3300005543 Ga0070672_100205158 Ga0070672_1002051582 292
601 3300005548 Ga0070665_100016709 Ga0070665_1000167094 292
602 3300005563 Ga0068855_100096811 Ga0068855_1000968112 292
603 3300005614 Ga0068856_100091113 Ga0068856_1000911133 292
604 3300005616 Ga0068852_100019657 Ga0068852_1000196575 292
605 3300005616 Ga0068852_100038874 Ga0068852_1000388742 292
606 3300005616 Ga0068852_100168992 Ga0068852_1001689922 292
607 3300005618 Ga0068864_100188988 Ga0068864_1001889882 292
608 3300005834 Ga0068851_10001626 Ga0068851_100016265 292
609 3300005841 Ga0068863_100091260 Ga0068863_1000912603 292
610 3300005843 Ga0068860_100567825 Ga0068860_1005678252 292
611 3300005844 Ga0068862_100060247 Ga0068862_1000602473 292
612 3300005844 Ga0068862_100172395 Ga0068862_1001723952 292
613 3300005937 Ga0081455_10064438 Ga0081455_100644382 292
614 3300006028 Ga0070717_10096889 Ga0070717_100968893 292
615 3300006028 Ga0070717_10253942 Ga0070717_102539421 292
616 3300006038 Ga0075365_10000758 Ga0075365_100007587 292
617 3300006038 Ga0075365_10039057 Ga0075365_100390575 292
618 3300006178 Ga0075367_10051748 Ga0075367_100517483 292
619 3300006186 Ga0075369_10002752 Ga0075369_100027522 292
620 3300006353 Ga0075370_10059787 Ga0075370_100597872 292
621 3300006942 Ga0099824_1018455 Ga0099824_10184554 292
622 3300009093 Ga0105240_10000793 Ga0105240_1000079339 292
623 3300009093 Ga0105240_10000882 Ga0105240_1000088243 292
624 3300009094 Ga0111539_10195233 Ga0111539_101952331 292
625 3300009147 Ga0114129_10086467 Ga0114129_100864674 292
626 3300009545 Ga0105237_10000153 Ga0105237_1000015324 292
627 3300009545 Ga0105237_10017760 Ga0105237_100177603 292
628 3300009545 Ga0105237_10312323 Ga0105237_103123231 292
629 3300009551 Ga0105238_10006993 Ga0105238_100069937 292
630 3300009551 Ga0105238_10032169 Ga0105238_100321693 292
631 3300009551 Ga0105238_10076245 Ga0105238_100762453 292
632 3300010375 Ga0105239_10407256 Ga0105239_104072562 292
633 3300013104 Ga0157370_10145296 Ga0157370_101452961 292
634 3300013307 Ga0157372_10100451 Ga0157372_101004513 292
635 3300013308 Ga0157375_10257244 Ga0157375_102572442 292
636 3300014325 Ga0163163_10009451 Ga0163163_100094513 292
637 3300014325 Ga0163163_10222323 Ga0163163_102223232 292
638 3300014969 Ga0157376_10089440 Ga0157376_100894402 292
639 3300017792 Ga0163161_10360097 Ga0163161_103600971 292
640 3300025261 Ga0209233_1000600 Ga0209233_100060014 292
641 3300025261 Ga0209233_1025181 Ga0209233_10251811 292
642 3300025295 Ga0209564_1015835 Ga0209564_10158352 292
643 3300025297 Ga0209758_1000806 Ga0209758_10008066 292
644 3300025297 Ga0209758_1001068 Ga0209758_100106833 292
645 3300025297 Ga0209758_1018079 Ga0209758_10180794 292
646 3300025297 Ga0209758_1061677 Ga0209758_10616771 292
647 3300025299 Ga0209256_1029787 Ga0209256_10297872 292
648 3300025302 Ga0207426_1000375 Ga0207426_100037521 292
649 3300025302 Ga0207426_1000467 Ga0207426_100046733 292
650 3300025321 Ga0207656_10011584 Ga0207656_100115842 292
651 3300025912 Ga0207707_10001050 Ga0207707_1000105013 292
652 3300025913 Ga0207695_10000797 Ga0207695_1000079712 292
653 3300025913 Ga0207695_10000830 Ga0207695_1000083021 292
654 3300025914 Ga0207671_10001174 Ga0207671_1000117426 292
655 3300025914 Ga0207671_10011775 Ga0207671_100117757 292
656 3300025914 Ga0207671_10137330 Ga0207671_101373302 292
657 3300025919 Ga0207657_10043220 Ga0207657_100432202 292
658 3300025919 Ga0207657_10107777 Ga0207657_101077773 292
659 3300025920 Ga0207649_10015204 Ga0207649_100152042 292
660 3300025921 Ga0207652_10004838 Ga0207652_100048382 292
661 3300025924 Ga0207694_10041435 Ga0207694_100414352 292
662 3300025924 Ga0207694_10046291 Ga0207694_100462913 292
663 3300025924 Ga0207694_10180683 Ga0207694_101806833 292
664 3300025925 Ga0207650_10000202 Ga0207650_1000020254 292
665 3300025928 Ga0207700_10063470 Ga0207700_100634701 292
666 3300025928 Ga0207700_10119228 Ga0207700_101192282 292
667 3300025929 Ga0207664_10083510 Ga0207664_100835102 292
668 3300025940 Ga0207691_10471127 Ga0207691_104711272 292
669 3300025941 Ga0207711_10027057 Ga0207711_100270573 292
670 3300025941 Ga0207711_10539029 Ga0207711_105390292 292
671 3300025944 Ga0207661_10279658 Ga0207661_102796582 292
672 3300025972 Ga0207668_10205870 Ga0207668_102058702 292
673 3300026041 Ga0207639_10043105 Ga0207639_100431052 292
674 3300026078 Ga0207702_10119209 Ga0207702_101192092 292
675 3300026095 Ga0207676_10231511 Ga0207676_102315112 292
676 3300026116 Ga0207674_10024355 Ga0207674_100243554 292
677 3300026121 Ga0207683_10280099 Ga0207683_102800992 292
678 3300027357 Ga0209589_1000014 Ga0209589_100001450 292
679 3300027361 Ga0209489_100014 Ga0209489_10001450 292
680 3300027363 Ga0209700_100024 Ga0209700_10002450 292
681 3300028379 Ga0268266_10027915 Ga0268266_100279156 292
682 3300028380 Ga0268265_10319470 Ga0268265_103194702 292
683 3300028381 Ga0268264_10117019 Ga0268264_101170192 292
684 3300028786 Ga0307517_10000035 Ga0307517_1000003560 292
685 3300028786 Ga0307517_10000100 Ga0307517_1000010024 292
686 3300028794 Ga0307515_10021109 Ga0307515_100211096 292
687 3300028794 Ga0307515_10103093 Ga0307515_101030932 292
688 3300031616 Ga0307508_10010223 Ga0307508_100102236 292
689 3300031616 Ga0307508_10035220 Ga0307508_100352206 292
690 3300031616 Ga0307508_10201320 Ga0307508_102013202 292
691 3300031711 Ga0265314_10108673 Ga0265314_101086731 292
692 3300033180 Ga0307510_10007284 Ga0307510_100072843 292
693 3300033180 Ga0307510_10064141 Ga0307510_100641413 292
694 3300033442 Ga0315911_1000002 Ga0315911_1000002335 292
695 3300035695 Ga0373927_0107006 Ga0373927_0107006_481_1368 292
696 3300036401 Ga0373937_0047334 Ga0373937_0047334_2539_3432 292
697 3300036401 Ga0373937_0198760 Ga0373937_0198760_492_1373 292
698 3300037068 Ga0373925_0118157 Ga0373925_0118157_1066_1974 292
699 3300037068 Ga0373925_0224643 Ga0373925_0224643_32_919 292
700 3300037471 Ga0395905_0498624 Ga0395905_0498624_87_971 292
701 3300037853 Ga0436364_0826744 Ga0436364_0826744_1133_2014 292
702 3300037853 Ga0436364_1461962 Ga0436364_1461962_239_1120 292
703 3300039093 Ga0400489_04907 Ga0400489_04907_6629_7510 292
704 3300039438 Ga0436360_1043296 Ga0436360_1043296_231_1133 292
705 3300039447 Ga0436361_0614516 Ga0436361_0614516_69_971 292
706 3300039450 Ga0436363_0411896 Ga0436363_0411896_214_1122 292
707 3300042876 Ga0451577_0115465 Ga0451577_0115465_669_1568 292
708 3300044693 Ga0466961_0000031 Ga0466961_0000031_53596_54480 292
709 3300045049 Ga0466959_0006857 Ga0466959_0006857_4957_5841 292
710 3300046459 Ga0495629_0105839 Ga0495629_0105839_892_1773 292
711 3300046462 Ga0495651_0033707 Ga0495651_0033707_1010_1894 292
712 3300046462 Ga0495651_0310705 Ga0495651_0310705_51_998 292
713 3300046463 Ga0495653_0100887 Ga0495653_0100887_527_1411 292
714 3300046463 Ga0495653_0253518 Ga0495653_0253518_167_1048 292
715 3300046507 Ga0495606_0133539 Ga0495606_0133539_225_1115 292
716 3300046514 Ga0495618_0052436 Ga0495618_0052436_908_1792 292
717 3300046524 Ga0495648_0003275 Ga0495648_0003275_10044_10973 292
718 3300046524 Ga0495648_0125354 Ga0495648_0125354_250_1131 292
719 3300046538 Ga0495609_0049608 Ga0495609_0049608_908_1789 292
720 3300046557 Ga0495622_0045200 Ga0495622_0045200_569_1450 292
721 3300046559 Ga0495667_0012988 Ga0495667_0012988_2467_3414 292
722 3300046559 Ga0495667_0118475 Ga0495667_0118475_431_1315 292
723 3300046648 Ga0495611_0038951 Ga0495611_0038951_915_1805 292
724 3300046663 Ga0495635_0014160 Ga0495635_0014160_2797_3678 292
725 3300046663 Ga0495635_0334997 Ga0495635_0334997_76_963 292
726 3300046675 Ga0495657_0022744 Ga0495657_0022744_3547_4428 292
727 3300046675 Ga0495657_0144167 Ga0495657_0144167_72_1019 292
728 3300046690 Ga0495624_0100078 Ga0495624_0100078_594_1475 292
729 3300046694 Ga0495649_0159730 Ga0495649_0159730_248_1129 292
730 3300047317 Ga0495604_0067253 Ga0495604_0067253_266_1147 292
731 3300047321 Ga0495676_0025479 Ga0495676_0025479_2476_3357 292
732 3300047321 Ga0495676_0116560 Ga0495676_0116560_756_1664 292
733 3300047472 Ga0495686_0024664 Ga0495686_0024664_494_1375 292
734 3300047673 Ga0495593_0135443 Ga0495593_0135443_211_1092 292
735 3300048904 Ga0496101_0088606 Ga0496101_0088606_91_999 292
736 3300048904 Ga0496101_0164366 Ga0496101_0164366_133_1026 292
737 3300048905 Ga0496102_0087221 Ga0496102_0087221_62_946 292
738 3300048907 Ga0496104_0001655 Ga0496104_0001655_17576_18457 292
739 3300048907 Ga0496104_0089347 Ga0496104_0089347_1232_2125 292
740 3300048907 Ga0496104_0222781 Ga0496104_0222781_598_1506 292
741 3300048907 Ga0496104_0302389 Ga0496104_0302389_246_1142 292
742 3300048908 Ga0496105_0005515 Ga0496105_0005515_5915_6823 292
743 3300048908 Ga0496105_0006734 Ga0496105_0006734_2574_3455 292
744 3300048909 Ga0496106_0106773 Ga0496106_0106773_659_1567 292
745 3300048910 Ga0496107_0160607 Ga0496107_0160607_271_1164 292
746 3300048911 Ga0496108_0257780 Ga0496108_0257780_317_1225 292
747 3300048912 Ga0496109_0000839 Ga0496109_0000839_9457_10365 292
748 3300048912 Ga0496109_0030558 Ga0496109_0030558_1233_2126 292
749 3300048912 Ga0496109_0188663 Ga0496109_0188663_1021_1908 292
750 3300048913 Ga0496110_0062499 Ga0496110_0062499_129_1037 292
751 3300048913 Ga0496110_0251492 Ga0496110_0251492_479_1387 292
752 3300048914 Ga0496111_0002183 Ga0496111_0002183_2958_3866 292
753 3300048915 Ga0496112_0008387 Ga0496112_0008387_4019_4912 292
754 3300048915 Ga0496112_0132501 Ga0496112_0132501_774_1658 292
755 3300048915 Ga0496112_0310113 Ga0496112_0310113_367_1260 292
756 3300048915 Ga0496112_0677012 Ga0496112_0677012_40_924 292
757 3300048916 Ga0496113_0127257 Ga0496113_0127257_148_1041 292
758 3300048916 Ga0496113_0330406 Ga0496113_0330406_238_1119 292
759 3300048918 Ga0496115_0008711 Ga0496115_0008711_640_1548 292
760 3300048918 Ga0496115_0227311 Ga0496115_0227311_519_1412 292
761 3300048918 Ga0496115_0413961 Ga0496115_0413961_52_936 292
762 3300048920 Ga0496117_0002279 Ga0496117_0002279_16225_17103 292
763 3300048921 Ga0496118_0001768 Ga0496118_0001768_17791_18669 292
764 3300048921 Ga0496118_0157744 Ga0496118_0157744_61_942 292
765 3300048923 Ga0496120_0015101 Ga0496120_0015101_2285_3166 292
766 3300048923 Ga0496120_0057834 Ga0496120_0057834_1172_2062 292
767 3300048924 Ga0496121_0001894 Ga0496121_0001894_14888_15766 292
768 3300048924 Ga0496121_0051754 Ga0496121_0051754_196_1086 292
769 3300048924 Ga0496121_0149050 Ga0496121_0149050_810_1694 292
770 3300048925 Ga0496122_0116193 Ga0496122_0116193_476_1357 292
771 3300048927 Ga0496124_0082047 Ga0496124_0082047_461_1342 292
772 3300048928 Ga0496125_0001616 Ga0496125_0001616_13346_14224 292
773 3300048928 Ga0496125_0006808 Ga0496125_0006808_10598_11593 292
774 3300048929 Ga0496126_0002472 Ga0496126_0002472_13519_14454 292
775 3300048929 Ga0496126_0182643 Ga0496126_0182643_701_1594 292
776 3300048929 Ga0496126_0226543 Ga0496126_0226543_650_1540 292
777 3300048929 Ga0496126_0361984 Ga0496126_0361984_205_1086 292
778 3300049569 Ga0501032_0032322 Ga0501032_0032322_1838_2722 292
779 3300049571 Ga0501034_0221677 Ga0501034_0221677_343_1227 292
780 3300049572 Ga0501036_0183904 Ga0501036_0183904_409_1293 292
781 3300049572 Ga0501036_0306332 Ga0501036_0306332_53_937 292
782 3300049574 Ga0501038_0002689 Ga0501038_0002689_11012_11896 292
783 3300049574 Ga0501038_0007103 Ga0501038_0007103_2575_3459 292
784 3300049574 Ga0501038_0071307 Ga0501038_0071307_368_1252 292
785 3300049575 Ga0501039_0048339 Ga0501039_0048339_1776_2660 292
786 3300049575 Ga0501039_0116890 Ga0501039_0116890_605_1489 292
787 3300049579 Ga0501043_0021212 Ga0501043_0021212_1524_2408 292
788 3300049579 Ga0501043_0068354 Ga0501043_0068354_1345_2229 292
789 3300049581 Ga0501047_0125601 Ga0501047_0125601_1282_2166 292
790 3300049581 Ga0501047_0168088 Ga0501047_0168088_405_1289 292
791 3300049590 Ga0501074_0177916 Ga0501074_0177916_189_1082 292
792 3300049822 Ga0501035_0000923 Ga0501035_0000923_12391_13275 292
793 3300049822 Ga0501035_0068669 Ga0501035_0068669_877_1761 292
794 3300049822 Ga0501035_0084849 Ga0501035_0084849_38_922 292
795 3300049822 Ga0501035_0189732 Ga0501035_0189732_563_1447 292
796 3300049823 Ga0501044_0004565 Ga0501044_0004565_954_1838 292
797 3300049823 Ga0501044_0009412 Ga0501044_0009412_570_1454 292
798 3300049823 Ga0501044_0046543 Ga0501044_0046543_1955_2854 292
799 3300049823 Ga0501044_0563983 Ga0501044_0563983_13_897 292
800 3300050490 nmdc:mga03n38_106558_c1 nmdc:mga03n38_106558_c1_380_1267 292
801 3300050492 nmdc:mga0yw44_21036_c1 nmdc:mga0yw44_21036_c1_208_1203 292
802 3300050492 nmdc:mga0yw44_2394_c1 nmdc:mga0yw44_2394_c1_5030_5923 292
803 3300050494 nmdc:mga06z11_39335_c1 nmdc:mga06z11_39335_c1_757_1752 292
804 3300050496 nmdc:mga07m45_15067_c1 nmdc:mga07m45_15067_c1_917_1912 292
805 3300050507 nmdc:mga05p37_61463_c1 nmdc:mga05p37_61463_c1_3072_3953 292
806 3300050511 nmdc:mga08y16_421001_c1 nmdc:mga08y16_421001_c1_60_941 292
807 3300050516 nmdc:mga0sz30_3128_c1 nmdc:mga0sz30_3128_c1_1270_2265 292
808 3300050516 nmdc:mga0sz30_72902_c1 nmdc:mga0sz30_72902_c1_335_1216 292
809 3300053077 Ga0495601_0105267 Ga0495601_0105267_696_1580 292
810 3300053078 Ga0495612_0035130 Ga0495612_0035130_285_1169 292
811 3300053079 Ga0500610_0076759 Ga0500610_0076759_394_1284 292
812 3300053084 Ga0495595_0002902 Ga0495595_0002902_1676_2560 292
813 3300053084 Ga0495595_0043060 Ga0495595_0043060_538_1431 292
814 3300053085 Ga0495619_0117982 Ga0495619_0117982_286_1179 292
815 3300053086 Ga0500578_0079887 Ga0500578_0079887_561_1451 292
816 3300053087 Ga0500643_000095 Ga0500643_000095_38093_38983 292
817 3300053092 Ga0500583_0052936 Ga0500583_0052936_73_963 292
818 3300053093 Ga0500651_0035325 Ga0500651_0035325_1984_2874 292
819 3300053096 Ga0500641_0008907 Ga0500641_0008907_1108_1998 292
820 3300053103 Ga0500555_017169 Ga0500555_017169_145_1035 292
821 3300053119 Ga0500595_012476 Ga0500595_012476_2040_2921 292
822 3300053121 Ga0500607_058153 Ga0500607_058153_310_1200 292
823 3300053122 Ga0500608_115434 Ga0500608_115434_265_1155 292
824 3300053123 Ga0500614_008701 Ga0500614_008701_34_924 292
825 3300053130 Ga0500642_0010458 Ga0500642_0010458_1704_2594 292
826 3300053136 Ga0500559_0012469 Ga0500559_0012469_321_1211 292
827 3300053138 Ga0500564_082438 Ga0500564_082438_519_1409 292
828 3300053139 Ga0500568_0023347 Ga0500568_0023347_290_1183 292
829 3300053151 Ga0500604_0061893 Ga0500604_0061893_156_1046 292
830 3300053154 Ga0500619_004398 Ga0500619_004398_1769_2659 292
831 3300053158 Ga0500627_0001129 Ga0500627_0001129_4586_5476 292
832 3300053162 Ga0500638_042127 Ga0500638_042127_12_902 292
833 3300053177 Ga0500636_0000807 Ga0500636_0000807_2814_3704 292
834 3300053723 Ga0500567_134688 Ga0500567_134688_11_901 292
835 3300053737 Ga0500601_000088 Ga0500601_000088_6198_7088 292
836 iso_pu_bacteria 2842377471 2842380087 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

239

0.98

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

149

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tqg-assembly1.cif.gz_D pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9938 1 289
1mp3-assembly1.cif.gz_A l89t variant of s. enterica rmla 0.9926 2 285
1iim-assembly1.cif.gz_A thymidylyltransferase complexed with ttp 0.9925 2 284
6tqg-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9922 2 289
6tqg-assembly1.cif.gz_B pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9921 2 289
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.991 2 289 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9742 2 289 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.966 1 238 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9199 1 238 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9088 1 223 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A5K1ISM2-F1-model_v4 Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) (dTDP-glucose pyrophosphorylase) (dTDP-glucose synthase) 1.006 1 80 GO:0008879
GO:0045226
AF-A0A351VA12-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.004 1 112 GO:0008879
GO:0045226
AF-K1TIU2-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.004 1 98 GO:0008879
GO:0045226
AF-A0A561DDF8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.003 1 138 GO:0008879
GO:0045226
AF-A0A3D6A514-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.003 2 102 GO:0008879
GO:0045226

Feature Viewer

pLDDT pTM Quality
95.13 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map