F482887

General Info

Members Datasets Scaffolds Average Seq Length
836 400 824 200

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10004368|Ga0207694_100043682
Length 226
Sequence LNPLLPDMPSPNPSRKREGDFQKECEMTKVLVLYYSSYGHLEQMADAVAEGARSAGAEVDIRRVPETAPAEVAIAAGFKVDTAHPTIGGVAELANYDAIIVGAPTRFGRMPSQMASFLDQAGGLWFTGALNGKVGGAFTSTATQHGGQETTLFSIITNLLHFGLTIVGLDYGFAGQSGVKEVHGNSPYGATTIADSDGSRQPSSVELDGARYQGRRIAEVAGKLAA

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
3 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
4 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
5 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
6 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
9 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
10 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
11 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
93 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
213 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
221 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
222 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
340 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
349 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
371 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
374 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
378 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
379 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
380 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
381 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
382 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
383 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
384 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
385 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
386 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
387 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
388 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.29
Metatranscriptomes 2.27
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.43
Nodule 0.48
Rhizoplane 4.78
Rhizosphere 69.02
Stem 0
Stem Tuber 0
Unclassified 10.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004560 3300001915 Bacteria 3044
2 JGI24740J21852_10015017 3300001979 Bacteria 2839
3 JGI24740J21852_10058307 3300001979 Bacteria 1074
4 JGI24739J22299_10001701 3300001989 Bacteria 8365
5 JGI24737J22298_10006194 3300001990 Bacteria 4096
6 JGI24737J22298_10028777 3300001990 Bacteria 1745
7 JGI24735J21928_10005514 3300002067 Bacteria 4195
8 JGI24742J22300_10007013 3300002244 Bacteria 1856
9 JGI25159J45721_1001111 3300002987 Bacteria 11488
10 JGI25165J46597_1000095 3300003214 Bacteria 163883
11 JGI25165J46597_1033269 3300003214 Bacteria 665
12 JGI25153J46596_10000070 3300003215 Bacteria 117125
13 Ga0055532_1008694 3300003758 Bacteria 1257
14 Ga0055525_1000203 3300003759 Bacteria 68926
15 Ga0055542_1000040 3300003762 Bacteria 214035
16 Ga0055542_1024935 3300003762 Bacteria 820
17 Ga0055529_1000037 3300003763 Bacteria 237307
18 Ga0055529_1008275 3300003763 Bacteria 1387
19 Ga0055536_1010073 3300003781 Bacteria 3807
20 Ga0055536_1011254 3300003781 Bacteria 3451
21 Ga0055536_1011520 3300003781 Bacteria 3381
22 Ga0055530_10005838 3300003791 Bacteria 5707
23 Ga0055530_10009279 3300003791 Bacteria 3807
24 Ga0055530_10017340 3300003791 Bacteria 2261
25 Ga0055531_10008976 3300003794 Bacteria 5173
26 Ga0055543_1001755 3300004625 Bacteria 8103
27 Ga0065165_1000034 3300005262 Bacteria 214644
28 Ga0065165_1000201 3300005262 Bacteria 103327
29 Ga0065165_1019972 3300005262 Bacteria 2375
30 Ga0065704_10002132 3300005289 Bacteria 5808
31 Ga0065704_10103203 3300005289 Bacteria 2179
32 Ga0070658_10000493 3300005327 Bacteria 34309
33 Ga0070658_10214969 3300005327 Bacteria 1625
34 Ga0070683_100003434 3300005329 Bacteria 12861
35 Ga0070683_100129620 3300005329 Bacteria 2386
36 Ga0070670_100222087 3300005331 Bacteria 1644
37 Ga0070666_10012958 3300005335 Bacteria 5277
38 Ga0070680_100101269 3300005336 Bacteria 2391
39 Ga0070682_100557312 3300005337 Bacteria 898
40 Ga0070660_100018126 3300005339 Bacteria 5138
41 Ga0070661_100007029 3300005344 Bacteria 7766
42 Ga0070661_100732717 3300005344 Bacteria 807
43 Ga0070668_100029073 3300005347 Bacteria 4196
44 Ga0070668_100051660 3300005347 Bacteria 3168
45 Ga0070668_100146008 3300005347 Bacteria 1910
46 Ga0070669_100108785 3300005353 Bacteria 2101
47 Ga0070669_100792781 3300005353 Bacteria 805
48 Ga0070675_100902593 3300005354 Bacteria 810
49 Ga0070671_100077914 3300005355 Bacteria 2770
50 Ga0070671_100867727 3300005355 Bacteria 788
51 Ga0070674_100094329 3300005356 Bacteria 2167
52 Ga0070673_100065542 3300005364 Bacteria 2898
53 Ga0070667_100000641 3300005367 Bacteria 33965
54 Ga0070667_100443740 3300005367 Bacteria 1185
55 Ga0070711_100518536 3300005439 Bacteria 985
56 Ga0070663_100061428 3300005455 Bacteria 2706
57 Ga0070663_100150234 3300005455 Bacteria 1786
58 Ga0070678_100000151 3300005456 Bacteria 28884
59 Ga0070662_100107064 3300005457 Bacteria 2125
60 Ga0070681_10088271 3300005458 Bacteria 3053
61 Ga0070681_10531691 3300005458 Bacteria 1089
62 Ga0068867_100125191 3300005459 Bacteria 1991
63 Ga0070706_100167714 3300005467 Bacteria 2050
64 Ga0070679_100171386 3300005530 Bacteria 2143
65 Ga0070684_100019470 3300005535 Bacteria 5614
66 Ga0068853_100059993 3300005539 Bacteria 3286
67 Ga0068853_100486010 3300005539 Bacteria 1164
68 Ga0070665_100000023 3300005548 Bacteria 375278
69 Ga0070665_100070111 3300005548 Bacteria 3512
70 Ga0070665_100126039 3300005548 Bacteria 2563
71 Ga0070665_100136898 3300005548 Bacteria 2452
72 Ga0070665_100386040 3300005548 Bacteria 1408
73 Ga0068855_100000578 3300005563 Bacteria 44980
74 Ga0068855_100006609 3300005563 Bacteria 14087
75 Ga0068855_100212232 3300005563 Bacteria 2175
76 Ga0068855_100284476 3300005563 Bacteria 1835
77 Ga0068855_101195589 3300005563 Bacteria 791
78 Ga0070664_100079939 3300005564 Bacteria 2815
79 Ga0068857_100507882 3300005577 Bacteria 1132
80 Ga0068854_100065040 3300005578 Bacteria 2650
81 Ga0068856_100005054 3300005614 Bacteria 13058
82 Ga0068856_100614898 3300005614 Bacteria 1107
83 Ga0068852_100028904 3300005616 Bacteria 4545
84 Ga0068859_100442449 3300005617 Bacteria 1396
85 Ga0068864_100043363 3300005618 Bacteria 3852
86 Ga0068861_100119692 3300005719 Bacteria 2122
87 Ga0068861_100241584 3300005719 Bacteria 1536
88 Ga0068851_10006331 3300005834 Bacteria 5401
89 Ga0068863_100000047 3300005841 Bacteria 140249
90 Ga0068858_100001609 3300005842 Bacteria 23039
91 Ga0068860_100000083 3300005843 Bacteria 168189
92 Ga0068860_100033785 3300005843 Bacteria 4908
93 Ga0068862_100031630 3300005844 Bacteria 4469
94 Ga0075365_10483784 3300006038 Bacteria 875
95 Ga0075368_10004678 3300006042 Bacteria 4654
96 Ga0075363_100074975 3300006048 Bacteria 1843
97 Ga0075364_10062738 3300006051 Bacteria 2439
98 Ga0075367_10000432 3300006178 Bacteria 15550
99 Ga0075369_10184509 3300006186 Bacteria 960
100 Ga0075369_10286418 3300006186 Bacteria 768
101 Ga0075366_10057177 3300006195 Bacteria 2318
102 Ga0075366_10515073 3300006195 Bacteria 740
103 Ga0097621_100308053 3300006237 Bacteria 1400
104 Ga0075370_10024908 3300006353 Bacteria 3308
105 Ga0068871_100424830 3300006358 Bacteria 1187
106 Ga0075431_100146462 3300006847 Bacteria 2434
107 Ga0075429_100766057 3300006880 Bacteria 845
108 Ga0097620_100442457 3300006931 Bacteria 1396
109 Ga0079104_1000233 3300006946 Bacteria 75184
110 Ga0099794_10076257 3300007265 Bacteria 1648
111 Ga0105240_10001958 3300009093 Bacteria 34069
112 Ga0105240_10008326 3300009093 Bacteria 14839
113 Ga0105240_10339483 3300009093 Bacteria 1707
114 Ga0105240_11744777 3300009093 Bacteria 649
115 Ga0105245_10002151 3300009098 Bacteria 17853
116 Ga0105247_10108411 3300009101 Bacteria 1784
117 Ga0105243_10000847 3300009148 Bacteria 29024
118 Ga0105243_10009064 3300009148 Bacteria 7601
119 Ga0105237_10042893 3300009545 Bacteria 4559
120 Ga0105237_10168162 3300009545 Bacteria 2192
121 Ga0105237_10473179 3300009545 Bacteria 1259
122 Ga0105237_10497327 3300009545 Bacteria 1226
123 Ga0105238_10006093 3300009551 Bacteria 11960
124 Ga0105238_10008522 3300009551 Bacteria 10261
125 Ga0105238_10028456 3300009551 Bacteria 5693
126 Ga0105238_10128901 3300009551 Bacteria 2508
127 Ga0105238_10301227 3300009551 Bacteria 1587
128 Ga0105238_10414726 3300009551 Bacteria 1341
129 Ga0105148_100126 3300009978 Bacteria 11756
130 Ga0105028_101109 3300009993 Bacteria 2848
131 Ga0105239_10033754 3300010375 Bacteria 5618
132 Ga0105239_10100056 3300010375 Bacteria 3206
133 Ga0105239_10819860 3300010375 Bacteria 1066
134 Ga0157373_10343162 3300013100 Bacteria 1065
135 Ga0157371_10000029 3300013102 Bacteria 252131
136 Ga0157371_10000149 3300013102 Bacteria 101593
137 Ga0157370_10000127 3300013104 Bacteria 90772
138 Ga0157370_10157576 3300013104 Bacteria 2112
139 Ga0157370_10494962 3300013104 Bacteria 1123
140 Ga0157369_10097084 3300013105 Unclassified 3143
141 Ga0157369_10979721 3300013105 Bacteria 866
142 Ga0157374_10413154 3300013296 Bacteria 1347
143 Ga0157378_10107733 3300013297 Bacteria 2550
144 Ga0157378_10377941 3300013297 Bacteria 1391
145 Ga0157372_10021887 3300013307 Bacteria 6911
146 Ga0182008_10010811 3300014497 Bacteria 4874
147 Ga0182008_10081456 3300014497 Unclassified 1593
148 Ga0182008_10282673 3300014497 Bacteria 864
149 Ga0182006_1000066 3300015261 Bacteria 151095
150 Ga0182006_1008015 3300015261 Bacteria 4800
151 Ga0182007_10026530 3300015262 Unclassified 2006
152 Ga0182007_10028669 3300015262 Bacteria 1911
153 Ga0182007_10039739 3300015262 Bacteria 1573
154 Ga0182005_1000045 3300015265 Bacteria 138175
155 Ga0182005_1015093 3300015265 Unclassified 2156
156 Ga0183365_10004 3300015684 Bacteria 333304
157 Ga0163161_10018355 3300017792 Bacteria 4903
158 Ga0163161_10175512 3300017792 Bacteria 1640
159 Ga0163161_10549019 3300017792 Bacteria 947
160 Ga0206355_1722878 3300020076 Bacteria 793
161 Ga0213876_10013112 3300021384 Bacteria 4404
162 Ga0209674_100408 3300025226 Bacteria 21338
163 Ga0209672_105007 3300025228 Bacteria 2345
164 Ga0209147_101509 3300025229 Bacteria 8174
165 Ga0209563_100147 3300025230 Bacteria 69021
166 Ga0209437_101033 3300025233 Bacteria 9416
167 Ga0209437_102846 3300025233 Bacteria 3247
168 Ga0209646_1019045 3300025246 Bacteria 1001
169 Ga0209026_1017308 3300025250 Bacteria 1155
170 Ga0209677_109799 3300025253 Bacteria 1674
171 Ga0209148_1000011 3300025254 Bacteria 1196503
172 Ga0209148_1001708 3300025254 Bacteria 9684
173 Ga0209233_1000052 3300025261 Bacteria 445813
174 Ga0209233_1021386 3300025261 Bacteria 1676
175 Ga0209233_1040117 3300025261 Bacteria 1021
176 Ga0209455_1000006 3300025272 Bacteria 1196503
177 Ga0209455_1000528 3300025272 Bacteria 26777
178 Ga0209455_1005748 3300025272 Bacteria 3774
179 Ga0209130_1000016 3300025284 Bacteria 395540
180 Ga0209676_1000031 3300025292 Bacteria 478976
181 Ga0209676_1000057 3300025292 Bacteria 361061
182 Ga0209676_1009299 3300025292 Bacteria 4255
183 Ga0209564_1025690 3300025295 Bacteria 1972
184 Ga0209758_1000023 3300025297 Bacteria 612453
185 Ga0209050_1000135 3300025298 Bacteria 184020
186 Ga0209050_1000522 3300025298 Bacteria 63985
187 Ga0209050_1001148 3300025298 Bacteria 31730
188 Ga0209256_1015077 3300025299 Bacteria 2728
189 Ga0209256_1015450 3300025299 Bacteria 2669
190 Ga0209051_1000720 3300025303 Bacteria 36140
191 Ga0209051_1001452 3300025303 Bacteria 20096
192 Ga0209051_1022249 3300025303 Bacteria 2673
193 Ga0209257_1000050 3300025304 Bacteria 439325
194 Ga0209257_1015126 3300025304 Bacteria 3243
195 Ga0207656_10008808 3300025321 Bacteria 3731
196 Ga0207710_10092745 3300025900 Bacteria 1416
197 Ga0207688_10028488 3300025901 Bacteria 3072
198 Ga0207680_10011782 3300025903 Bacteria 4431
199 Ga0207647_10005180 3300025904 Bacteria 9593
200 Ga0207647_10020030 3300025904 Bacteria 4491
201 Ga0207699_10347450 3300025906 Bacteria 1046
202 Ga0207645_10028085 3300025907 Bacteria 3633
203 Ga0207645_10039222 3300025907 Bacteria 3035
204 Ga0207705_10001210 3300025909 Bacteria 20932
205 Ga0207684_10629550 3300025910 Bacteria 915
206 Ga0207707_10028648 3300025912 Bacteria 4867
207 Ga0207695_10011982 3300025913 Bacteria 10433
208 Ga0207695_10034335 3300025913 Bacteria 5517
209 Ga0207695_10467702 3300025913 Bacteria 1143
210 Ga0207695_10533118 3300025913 Bacteria 1056
211 Ga0207671_10017854 3300025914 Bacteria 5458
212 Ga0207671_10021399 3300025914 Bacteria 4907
213 Ga0207671_10026997 3300025914 Bacteria 4295
214 Ga0207671_10246904 3300025914 Bacteria 1403
215 Ga0207663_10392401 3300025916 Bacteria 1060
216 Ga0207660_10085410 3300025917 Bacteria 2328
217 Ga0207657_10019604 3300025919 Bacteria 6415
218 Ga0207649_10000710 3300025920 Bacteria 21878
219 Ga0207649_10027081 3300025920 Bacteria 3361
220 Ga0207649_10097031 3300025920 Bacteria 1943
221 Ga0207649_10642154 3300025920 Bacteria 819
222 Ga0207652_10172685 3300025921 Bacteria 1940
223 Ga0207681_10157779 3300025923 Bacteria 1707
224 Ga0207694_10004368 3300025924 Bacteria 11042
225 Ga0207694_10018654 3300025924 Bacteria 5245
226 Ga0207694_10072771 3300025924 Bacteria 2688
227 Ga0207694_10084123 3300025924 Bacteria 2502
228 Ga0207694_10288462 3300025924 Bacteria 1349
229 Ga0207694_10487408 3300025924 Bacteria 1032
230 Ga0207650_10234968 3300025925 Bacteria 1480
231 Ga0207687_10000798 3300025927 Bacteria 21269
232 Ga0207706_10105523 3300025933 Bacteria 2479
233 Ga0207706_10169919 3300025933 Bacteria 1916
234 Ga0207709_10000039 3300025935 Bacteria 260127
235 Ga0207669_10000117 3300025937 Bacteria 39781
236 Ga0207669_10000382 3300025937 Bacteria 19815
237 Ga0207711_10578814 3300025941 Bacteria 1047
238 Ga0207661_10002953 3300025944 Bacteria 11757
239 Ga0207679_10947931 3300025945 Bacteria 788
240 Ga0207667_10000002 3300025949 Bacteria 895662
241 Ga0207667_10003995 3300025949 Bacteria 18117
242 Ga0207667_10033611 3300025949 Bacteria 5512
243 Ga0207651_10360248 3300025960 Bacteria 1227
244 Ga0207668_10000459 3300025972 Bacteria 25616
245 Ga0207668_10101088 3300025972 Bacteria 2142
246 Ga0207668_10744655 3300025972 Bacteria 864
247 Ga0207640_10151241 3300025981 Bacteria 1705
248 Ga0207658_10000539 3300025986 Bacteria 34304
249 Ga0207658_10073092 3300025986 Bacteria 2602
250 Ga0207703_10000847 3300026035 Bacteria 30021
251 Ga0207639_10017056 3300026041 Bacteria 5146
252 Ga0207639_10030241 3300026041 Bacteria 3971
253 Ga0207639_10172214 3300026041 Bacteria 1834
254 Ga0207639_10407957 3300026041 Bacteria 1225
255 Ga0207678_10016640 3300026067 Bacteria 6460
256 Ga0207678_10036071 3300026067 Bacteria 4304
257 Ga0207678_10078493 3300026067 Bacteria 2828
258 Ga0207702_10024157 3300026078 Bacteria 5042
259 Ga0207702_10034995 3300026078 Bacteria 4200
260 Ga0207641_10000079 3300026088 Bacteria 141110
261 Ga0207648_10047537 3300026089 Bacteria 3761
262 Ga0207676_10102002 3300026095 Bacteria 2381
263 Ga0207674_10024940 3300026116 Bacteria 6382
264 Ga0207674_10034505 3300026116 Bacteria 5287
265 Ga0207683_10000496 3300026121 Bacteria 36404
266 Ga0207683_10021185 3300026121 Bacteria 5562
267 Ga0207698_10004357 3300026142 Bacteria 8617
268 Ga0207698_10080544 3300026142 Bacteria 2624
269 Ga0209281_1000076 3300027111 Bacteria 263350
270 Ga0209179_1014034 3300027512 Bacteria 1465
271 Ga0209813_10000193 3300027866 Bacteria 19061
272 Ga0268266_10000002 3300028379 Bacteria 3059047
273 Ga0268266_10098802 3300028379 Bacteria 2569
274 Ga0268266_10144375 3300028379 Bacteria 2138
275 Ga0268266_10312702 3300028379 Bacteria 1468
276 Ga0268266_10393901 3300028379 Bacteria 1308
277 Ga0268265_10000441 3300028380 Bacteria 43786
278 Ga0268264_10000055 3300028381 Bacteria 314947
279 Ga0268264_10022045 3300028381 Bacteria 5198
280 Ga0268264_11507938 3300028381 Bacteria 683
281 Ga0265334_10108569 3300028573 Bacteria 999
282 Ga0307517_10055671 3300028786 Bacteria 3878
283 Ga0307515_10048081 3300028794 Bacteria 6460
284 Ga0307515_10105375 3300028794 Bacteria 3358
285 Ga0307515_10373205 3300028794 Bacteria 1062
286 Ga0265338_10069689 3300028800 Bacteria 3019
287 Ga0307511_10004068 3300030521 Bacteria 14953
288 Ga0265330_10000281 3300031235 Bacteria 37503
289 Ga0265332_10000008 3300031238 Bacteria 301609
290 Ga0265320_10001142 3300031240 Bacteria 19529
291 Ga0265320_10025201 3300031240 Bacteria 3131
292 Ga0265325_10002464 3300031241 Bacteria 12475
293 Ga0265325_10003681 3300031241 Bacteria 9926
294 Ga0265325_10014671 3300031241 Bacteria 4421
295 Ga0265340_10014774 3300031247 Bacteria 4070
296 Ga0265340_10026996 3300031247 Bacteria 2897
297 Ga0265340_10223790 3300031247 Bacteria 843
298 Ga0265339_10013193 3300031249 Bacteria 5012
299 Ga0265331_10009489 3300031250 Bacteria 5460
300 Ga0265327_10000039 3300031251 Bacteria 292334
301 Ga0265327_10042551 3300031251 Bacteria 2437
302 Ga0265316_10043352 3300031344 Bacteria 3587
303 Ga0307513_10024144 3300031456 Bacteria 7079
304 Ga0307509_10000034 3300031507 Bacteria 193380
305 Ga0307509_10310343 3300031507 Bacteria 1320
306 Ga0307408_100029072 3300031548 Bacteria 3826
307 Ga0265313_10075898 3300031595 Bacteria 1537
308 Ga0307508_10000317 3300031616 Bacteria 58176
309 Ga0307514_10001251 3300031649 Bacteria 33354
310 Ga0265314_10000065 3300031711 Bacteria 158383
311 Ga0265314_10087721 3300031711 Bacteria 2034
312 Ga0265342_10099855 3300031712 Bacteria 1655
313 Ga0307516_10000001 3300031730 Bacteria 510338
314 Ga0307516_10000405 3300031730 Bacteria 56495
315 Ga0307405_10204646 3300031731 Bacteria 1436
316 Ga0307413_10085428 3300031824 Bacteria 2037
317 Ga0307413_10754999 3300031824 Bacteria 813
318 Ga0307412_10083948 3300031911 Bacteria 2210
319 Ga0307409_100288371 3300031995 Bacteria 1521
320 Ga0315911_1000005 3300033442 Bacteria 426255
321 Ga0373935_0015118 3300035692 Bacteria 4661
322 Ga0373937_0018626 3300036401 Bacteria 6203
323 Ga0310109_017351 3300036534 Bacteria 973
324 Ga0373925_0690309 3300037068 Bacteria 842
325 Ga0395899_0211793 3300037312 Bacteria 1346
326 Ga0395900_0013472 3300037418 Bacteria 8355
327 Ga0395900_0144077 3300037418 Bacteria 2438
328 Ga0395900_0625948 3300037418 Bacteria 1015
329 Ga0395901_0085564 3300038443 Bacteria 3296
330 Ga0395901_0221211 3300038443 Bacteria 1979
331 Ga0395901_1170714 3300038443 Bacteria 736
332 Ga0237819_01183 3300038705 Bacteria 7350
333 Ga0237816_00202 3300039145 Bacteria 4847
334 Ga0436365_0604521 3300039437 Bacteria 1010
335 Ga0436365_0743078 3300039437 Bacteria 30672
336 Ga0436365_1106902 3300039437 Bacteria 1086
337 Ga0436362_0543628 3300039453 Bacteria 2137
338 Ga0439461_0028876 3300041410 Bacteria 1145
339 Ga0451795_0975754 3300041456 Bacteria 802
340 Ga0451795_1434403 3300041456 Bacteria 1124
341 Ga0451800_1633068 3300041459 Bacteria 1017
342 Ga0451804_1057260 3300041463 Bacteria 657
343 Ga0439443_014595 3300042003 Bacteria 1185
344 Ga0450911_000005 3300042115 Bacteria 233469
345 Ga0450902_014459 3300042137 Bacteria 1277
346 Ga0439446_0046748 3300042156 Bacteria 1286
347 Ga0450908_000048 3300042184 Bacteria 24178
348 Ga0453684_0622467 3300044712 Bacteria 1181
349 Ga0466959_0012635 3300045049 Bacteria 6107
350 Ga0466967_1002745 3300045976 Bacteria 831
351 Ga0495617_000024 3300046452 Bacteria 174402
352 Ga0495617_000296 3300046452 Bacteria 28300
353 Ga0495617_024660 3300046452 Bacteria 2029
354 Ga0495617_140271 3300046452 Bacteria 772
355 Ga0495617_144857 3300046452 Bacteria 757
356 Ga0495627_000478 3300046453 Bacteria 33914
357 Ga0495592_0059295 3300046454 Bacteria 2819
358 Ga0495592_0088409 3300046454 Bacteria 2227
359 Ga0495603_0354853 3300046455 Bacteria 841
360 Ga0495590_0018331 3300046457 Bacteria 2506
361 Ga0495590_0029296 3300046457 Bacteria 1930
362 Ga0495629_0000027 3300046459 Bacteria 129244
363 Ga0495629_0000130 3300046459 Bacteria 65355
364 Ga0495629_0000281 3300046459 Bacteria 44035
365 Ga0495629_0041152 3300046459 Bacteria 3252
366 Ga0495638_0000128 3300046460 Bacteria 123567
367 Ga0495638_0000363 3300046460 Bacteria 56118
368 Ga0495638_0006293 3300046460 Bacteria 8657
369 Ga0495638_0006659 3300046460 Bacteria 8384
370 Ga0495638_0057822 3300046460 Bacteria 2404
371 Ga0495638_0078605 3300046460 Bacteria 2007
372 Ga0495638_0275069 3300046460 Bacteria 917
373 Ga0495641_0108463 3300046461 Bacteria 1239
374 Ga0495651_0007550 3300046462 Bacteria 8318
375 Ga0495653_0000449 3300046463 Bacteria 32095
376 Ga0495653_0000885 3300046463 Bacteria 23146
377 Ga0495653_0033105 3300046463 Bacteria 4097
378 Ga0495650_0000226 3300046471 Bacteria 115930
379 Ga0495650_0000470 3300046471 Bacteria 62114
380 Ga0495650_0001371 3300046471 Bacteria 24045
381 Ga0495650_0005382 3300046471 Bacteria 8328
382 Ga0495650_0006744 3300046471 Bacteria 7102
383 Ga0495650_0033401 3300046471 Bacteria 2290
384 Ga0495650_0159613 3300046471 Bacteria 805
385 Ga0495580_0003983 3300046472 Bacteria 12464
386 Ga0495580_0005607 3300046472 Bacteria 10338
387 Ga0495580_0005620 3300046472 Bacteria 10326
388 Ga0495580_0006044 3300046472 Bacteria 9911
389 Ga0495580_0007400 3300046472 Bacteria 8831
390 Ga0495580_0021463 3300046472 Bacteria 4764
391 Ga0495580_0027966 3300046472 Bacteria 4101
392 Ga0495580_0097802 3300046472 Bacteria 2041
393 Ga0495582_0032237 3300046473 Bacteria 2883
394 Ga0495605_0013142 3300046474 Bacteria 4574
395 Ga0495605_0044778 3300046474 Bacteria 2185
396 Ga0495664_0010704 3300046477 Bacteria 5152
397 Ga0495664_0067107 3300046477 Bacteria 2140
398 Ga0495584_0004592 3300046491 Bacteria 7400
399 Ga0495584_0165160 3300046491 Bacteria 1125
400 Ga0495584_0199762 3300046491 Bacteria 1016
401 Ga0495584_0393420 3300046491 Bacteria 704
402 Ga0495585_0000143 3300046492 Bacteria 78365
403 Ga0495585_0000360 3300046492 Bacteria 44156
404 Ga0495585_0003270 3300046492 Bacteria 11027
405 Ga0495585_0032133 3300046492 Bacteria 2975
406 Ga0495585_0064674 3300046492 Bacteria 2005
407 Ga0495585_0174619 3300046492 Bacteria 1108
408 Ga0495596_0104288 3300046500 Bacteria 1101
409 Ga0495596_0180383 3300046500 Bacteria 821
410 Ga0495607_0000083 3300046501 Bacteria 96690
411 Ga0495607_0000460 3300046501 Bacteria 40825
412 Ga0495607_0003621 3300046501 Bacteria 11730
413 Ga0495607_0045245 3300046501 Bacteria 2590
414 Ga0495607_0108152 3300046501 Bacteria 1478
415 Ga0495583_0001366 3300046506 Bacteria 25162
416 Ga0495583_0002817 3300046506 Bacteria 14221
417 Ga0495583_0002869 3300046506 Bacteria 14011
418 Ga0495583_0021304 3300046506 Bacteria 3338
419 Ga0495583_0034073 3300046506 Bacteria 2443
420 Ga0495583_0036880 3300046506 Bacteria 2321
421 Ga0495583_0065054 3300046506 Bacteria 1616
422 Ga0495583_0179260 3300046506 Bacteria 868
423 Ga0495606_0000066 3300046507 Bacteria 181028
424 Ga0495606_0000092 3300046507 Bacteria 152369
425 Ga0495606_0000136 3300046507 Bacteria 125611
426 Ga0495606_0001286 3300046507 Bacteria 34779
427 Ga0495606_0010585 3300046507 Bacteria 7634
428 Ga0495606_0023113 3300046507 Bacteria 4514
429 Ga0495606_0084167 3300046507 Bacteria 1970
430 Ga0495606_0112148 3300046507 Bacteria 1643
431 Ga0495606_0115834 3300046507 Bacteria 1610
432 Ga0495606_0343390 3300046507 Bacteria 794
433 Ga0495610_0000356 3300046512 Bacteria 47959
434 Ga0495610_0005518 3300046512 Bacteria 8963
435 Ga0495610_0214499 3300046512 Bacteria 780
436 Ga0495616_0000003 3300046513 Bacteria 290178
437 Ga0495616_0000018 3300046513 Bacteria 167281
438 Ga0495616_0025623 3300046513 Bacteria 3148
439 Ga0495616_0151260 3300046513 Bacteria 1050
440 Ga0495620_0000102 3300046515 Bacteria 68028
441 Ga0495620_0027224 3300046515 Bacteria 2678
442 Ga0495620_0038233 3300046515 Bacteria 2131
443 Ga0495620_0110997 3300046515 Bacteria 1087
444 Ga0495628_0007163 3300046516 Bacteria 9658
445 Ga0495628_0047361 3300046516 Bacteria 3411
446 Ga0495628_0052696 3300046516 Bacteria 3213
447 Ga0495628_0080520 3300046516 Bacteria 2531
448 Ga0495628_0110409 3300046516 Bacteria 2116
449 Ga0495631_0000022 3300046518 Bacteria 91377
450 Ga0495631_0000267 3300046518 Bacteria 36464
451 Ga0495631_0002903 3300046518 Bacteria 9494
452 Ga0495631_0173186 3300046518 Bacteria 925
453 Ga0495632_0000008 3300046519 Bacteria 294056
454 Ga0495632_0000042 3300046519 Bacteria 145186
455 Ga0495632_0002853 3300046519 Bacteria 12755
456 Ga0495632_0006266 3300046519 Bacteria 7688
457 Ga0495637_0008748 3300046520 Bacteria 4961
458 Ga0495637_0012500 3300046520 Bacteria 4059
459 Ga0495637_0044545 3300046520 Bacteria 1888
460 Ga0495637_0202655 3300046520 Bacteria 728
461 Ga0495643_0000005 3300046522 Bacteria 443135
462 Ga0495643_0000530 3300046522 Bacteria 47567
463 Ga0495643_0009416 3300046522 Bacteria 6073
464 Ga0495643_0019650 3300046522 Bacteria 3904
465 Ga0495643_0065152 3300046522 Bacteria 1924
466 Ga0495644_0014817 3300046523 Bacteria 2985
467 Ga0495648_0000146 3300046524 Bacteria 84443
468 Ga0495648_0000363 3300046524 Bacteria 50055
469 Ga0495648_0001155 3300046524 Bacteria 26690
470 Ga0495648_0001362 3300046524 Bacteria 24150
471 Ga0495648_0004160 3300046524 Bacteria 12442
472 Ga0495648_0012133 3300046524 Bacteria 6449
473 Ga0495648_0025432 3300046524 Bacteria 4008
474 Ga0495648_0052312 3300046524 Bacteria 2481
475 Ga0495648_0068302 3300046524 Bacteria 2074
476 Ga0495648_0081807 3300046524 Bacteria 1836
477 Ga0495648_0089274 3300046524 Bacteria 1730
478 Ga0495648_0100208 3300046524 Bacteria 1601
479 Ga0495663_0000015 3300046525 Bacteria 145185
480 Ga0495663_0001818 3300046525 Bacteria 6592
481 Ga0495666_0240105 3300046526 Bacteria 827
482 Ga0495642_0002091 3300046528 Bacteria 8263
483 Ga0495642_0054429 3300046528 Bacteria 1650
484 Ga0495665_0043904 3300046531 Bacteria 2376
485 Ga0495665_0229958 3300046531 Bacteria 957
486 Ga0495640_0192125 3300046533 Bacteria 1297
487 Ga0495586_0228330 3300046535 Bacteria 1059
488 Ga0495609_0013558 3300046538 Bacteria 3847
489 Ga0495609_0014939 3300046538 Bacteria 3642
490 Ga0495609_0027977 3300046538 Bacteria 2574
491 Ga0495609_0178062 3300046538 Bacteria 896
492 Ga0495597_0011589 3300046542 Bacteria 4271
493 Ga0495597_0091236 3300046542 Bacteria 1293
494 Ga0495645_0007813 3300046543 Bacteria 7439
495 Ga0495645_0303663 3300046543 Bacteria 1042
496 Ga0495622_0000811 3300046557 Bacteria 17289
497 Ga0495622_0218024 3300046557 Bacteria 846
498 Ga0495633_0000197 3300046558 Bacteria 76903
499 Ga0495633_0000222 3300046558 Bacteria 70418
500 Ga0495633_0000371 3300046558 Bacteria 48203
501 Ga0495633_0000842 3300046558 Bacteria 27022
502 Ga0495633_0067556 3300046558 Bacteria 1669
503 Ga0495633_0131657 3300046558 Bacteria 1157
504 Ga0495633_0249159 3300046558 Bacteria 811
505 Ga0495656_0391587 3300046615 Bacteria 726
506 Ga0495668_0000019 3300046616 Bacteria 416042
507 Ga0495668_0000056 3300046616 Bacteria 197862
508 Ga0495668_0000061 3300046616 Bacteria 192499
509 Ga0495668_0000066 3300046616 Bacteria 178533
510 Ga0495668_0020487 3300046616 Bacteria 3804
511 Ga0495668_0123686 3300046616 Bacteria 1415
512 Ga0495634_0090030 3300046642 Bacteria 1994
513 Ga0495634_0181821 3300046642 Bacteria 1316
514 Ga0495611_0000004 3300046648 Bacteria 308149
515 Ga0495611_0000113 3300046648 Bacteria 56814
516 Ga0495611_0011961 3300046648 Bacteria 3686
517 Ga0495611_0015996 3300046648 Bacteria 3207
518 Ga0495611_0155574 3300046648 Bacteria 1067
519 Ga0495625_0000024 3300046660 Bacteria 271126
520 Ga0495625_0000255 3300046660 Bacteria 82750
521 Ga0495625_0008595 3300046660 Bacteria 8690
522 Ga0495625_0009405 3300046660 Bacteria 8179
523 Ga0495625_0016404 3300046660 Bacteria 5832
524 Ga0495625_0264849 3300046660 Bacteria 1111
525 Ga0495625_0265681 3300046660 Bacteria 1109
526 Ga0495625_0273380 3300046660 Bacteria 1089
527 Ga0495659_0046350 3300046664 Bacteria 1569
528 Ga0495661_0023232 3300046665 Bacteria 4025
529 Ga0495661_0147719 3300046665 Bacteria 1272
530 Ga0495599_0175318 3300046678 Bacteria 1322
531 Ga0495646_0002861 3300046680 Bacteria 10686
532 Ga0495646_0006551 3300046680 Bacteria 7388
533 Ga0495646_0056805 3300046680 Bacteria 2345
534 Ga0495669_0000155 3300046684 Bacteria 43475
535 Ga0495613_0056868 3300046689 Bacteria 2873
536 Ga0495613_0077881 3300046689 Bacteria 2412
537 Ga0495613_0101505 3300046689 Bacteria 2078
538 Ga0495613_0774563 3300046689 Bacteria 627
539 Ga0495624_0004752 3300046690 Bacteria 9880
540 Ga0495624_0005955 3300046690 Bacteria 8714
541 Ga0495624_0006209 3300046690 Bacteria 8493
542 Ga0495624_0022978 3300046690 Bacteria 4115
543 Ga0495670_0001381 3300046691 Bacteria 11876
544 Ga0495670_0002072 3300046691 Bacteria 9885
545 Ga0495670_0040453 3300046691 Bacteria 2324
546 Ga0495670_0364507 3300046691 Bacteria 778
547 Ga0495671_0000007 3300046692 Bacteria 443069
548 Ga0495671_0001491 3300046692 Bacteria 15677
549 Ga0495671_0061148 3300046692 Bacteria 1858
550 Ga0495671_0065703 3300046692 Bacteria 1785
551 Ga0495671_0193287 3300046692 Bacteria 988
552 Ga0495649_0021687 3300046694 Bacteria 3598
553 Ga0495649_0085604 3300046694 Bacteria 1682
554 Ga0495649_0263956 3300046694 Bacteria 882
555 Ga0495589_0000367 3300046794 Bacteria 35022
556 Ga0495600_0005075 3300046809 Bacteria 7912
557 Ga0495660_0000052 3300046810 Bacteria 137821
558 Ga0495660_0000064 3300046810 Bacteria 124968
559 Ga0495660_0030727 3300046810 Bacteria 3025
560 Ga0495604_0488753 3300047317 Bacteria 800
561 Ga0495674_0001399 3300047319 Bacteria 23591
562 Ga0495674_0001405 3300047319 Bacteria 23564
563 Ga0495674_0005169 3300047319 Bacteria 12533
564 Ga0495674_0192671 3300047319 Bacteria 1693
565 Ga0495672_0001207 3300047320 Bacteria 26064
566 Ga0495672_0025394 3300047320 Bacteria 3793
567 Ga0495672_0078132 3300047320 Bacteria 1852
568 Ga0495672_0162524 3300047320 Bacteria 1146
569 Ga0495676_0053985 3300047321 Bacteria 3198
570 Ga0495676_0054767 3300047321 Bacteria 3168
571 Ga0495680_0315834 3300047322 Bacteria 1094
572 Ga0495683_0006619 3300047323 Bacteria 6318
573 Ga0495683_0012572 3300047323 Bacteria 4444
574 Ga0495687_000077 3300047443 Bacteria 148889
575 Ga0495687_000353 3300047443 Bacteria 58833
576 Ga0495687_112000 3300047443 Bacteria 1001
577 Ga0495675_0374154 3300047444 Bacteria 834
578 Ga0495679_000009 3300047446 Bacteria 343637
579 Ga0495679_000011 3300047446 Bacteria 324498
580 Ga0495679_000102 3300047446 Bacteria 76337
581 Ga0495679_012887 3300047446 Bacteria 3162
582 Ga0495673_0000028 3300047469 Bacteria 473418
583 Ga0495673_0000036 3300047469 Bacteria 311035
584 Ga0495673_0000101 3300047469 Bacteria 173409
585 Ga0495673_0003573 3300047469 Bacteria 10216
586 Ga0495673_0086782 3300047469 Bacteria 1285
587 Ga0495681_0000032 3300047470 Bacteria 127415
588 Ga0495681_0010146 3300047470 Bacteria 5727
589 Ga0495681_0033770 3300047470 Bacteria 2557
590 Ga0495681_0055878 3300047470 Bacteria 1839
591 Ga0495681_0175854 3300047470 Bacteria 882
592 Ga0495686_0000033 3300047472 Bacteria 342031
593 Ga0495686_0000180 3300047472 Bacteria 121204
594 Ga0495686_0000190 3300047472 Bacteria 115114
595 Ga0495686_0001592 3300047472 Bacteria 23973
596 Ga0495686_0002384 3300047472 Bacteria 17849
597 Ga0495686_0024922 3300047472 Bacteria 3925
598 Ga0495686_0070152 3300047472 Bacteria 2159
599 Ga0495686_0100699 3300047472 Bacteria 1743
600 Ga0495686_0155947 3300047472 Bacteria 1337
601 Ga0495686_0224032 3300047472 Bacteria 1068
602 Ga0495593_0004348 3300047673 Bacteria 8431
603 Ga0495593_0014869 3300047673 Bacteria 4421
604 Ga0495593_0223157 3300047673 Bacteria 945
605 Ga0495593_0373848 3300047673 Bacteria 712
606 Ga0495626_0004650 3300048091 Bacteria 8338
607 Ga0495626_0005244 3300048091 Bacteria 7667
608 Ga0495626_0030318 3300048091 Bacteria 2609
609 Ga0495626_0040568 3300048091 Bacteria 2198
610 Ga0496100_0056714 3300048903 Bacteria 2564
611 Ga0496100_0208709 3300048903 Bacteria 1427
612 Ga0496101_0000999 3300048904 Bacteria 16755
613 Ga0496101_0168706 3300048904 Bacteria 1681
614 Ga0496102_0000163 3300048905 Bacteria 89673
615 Ga0496102_0027920 3300048905 Bacteria 5042
616 Ga0496102_0126223 3300048905 Bacteria 2392
617 Ga0496102_0627485 3300048905 Bacteria 998
618 Ga0496102_0927401 3300048905 Bacteria 792
619 Ga0496103_0000052 3300048906 Bacteria 149437
620 Ga0496103_0205226 3300048906 Bacteria 1267
621 Ga0496104_0008489 3300048907 Bacteria 9135
622 Ga0496105_0001302 3300048908 Bacteria 17462
623 Ga0496105_0002897 3300048908 Bacteria 12589
624 Ga0496106_0474159 3300048909 Bacteria 1005
625 Ga0496107_0175449 3300048910 Bacteria 1591
626 Ga0496108_0203733 3300048911 Bacteria 1717
627 Ga0496109_0083486 3300048912 Bacteria 2946
628 Ga0496109_0206942 3300048912 Bacteria 1845
629 Ga0496110_0058192 3300048913 Bacteria 3404
630 Ga0496110_0145791 3300048913 Bacteria 2141
631 Ga0496110_0245520 3300048913 Bacteria 1629
632 Ga0496111_0002111 3300048914 Bacteria 11868
633 Ga0496111_0016400 3300048914 Bacteria 5103
634 Ga0496112_0000052 3300048915 Bacteria 81285
635 Ga0496112_0304667 3300048915 Bacteria 1538
636 Ga0496113_0028812 3300048916 Bacteria 3999
637 Ga0496113_0885374 3300048916 Bacteria 707
638 Ga0496114_0342325 3300048917 Bacteria 1322
639 Ga0496115_0000078 3300048918 Bacteria 89817
640 Ga0496115_0027713 3300048918 Bacteria 4434
641 Ga0496115_0283942 3300048918 Bacteria 1359
642 Ga0496115_0369101 3300048918 Bacteria 1168
643 Ga0496115_0436424 3300048918 Bacteria 1059
644 Ga0496115_0496133 3300048918 Bacteria 982
645 Ga0496115_0826663 3300048918 Bacteria 719
646 Ga0496116_0015207 3300048919 Bacteria 6095
647 Ga0496116_0081560 3300048919 Bacteria 2005
648 Ga0496116_0088333 3300048919 Bacteria 1894
649 Ga0496117_0000102 3300048920 Bacteria 189959
650 Ga0496117_0000141 3300048920 Bacteria 158041
651 Ga0496117_0012119 3300048920 Bacteria 7645
652 Ga0496117_0109260 3300048920 Bacteria 1727
653 Ga0496117_0207727 3300048920 Bacteria 1100
654 Ga0496118_0000038 3300048921 Bacteria 315464
655 Ga0496118_0000103 3300048921 Bacteria 158099
656 Ga0496118_0000696 3300048921 Bacteria 54619
657 Ga0496118_0005851 3300048921 Bacteria 13787
658 Ga0496118_0060180 3300048921 Bacteria 2822
659 Ga0496118_0188363 3300048921 Bacteria 1237
660 Ga0496118_0287098 3300048921 Bacteria 912
661 Ga0496119_0003348 3300048922 Bacteria 16702
662 Ga0496119_0009712 3300048922 Bacteria 8194
663 Ga0496119_0024539 3300048922 Bacteria 4238
664 Ga0496120_0030390 3300048923 Bacteria 3284
665 Ga0496120_0062358 3300048923 Bacteria 2077
666 Ga0496120_0108714 3300048923 Bacteria 1452
667 Ga0496121_0000156 3300048924 Bacteria 149376
668 Ga0496121_0000208 3300048924 Bacteria 129753
669 Ga0496121_0000782 3300048924 Bacteria 58365
670 Ga0496121_0001227 3300048924 Bacteria 44616
671 Ga0496121_0028584 3300048924 Bacteria 5187
672 Ga0496121_0057869 3300048924 Bacteria 3209
673 Ga0496121_0059804 3300048924 Bacteria 3139
674 Ga0496121_0066519 3300048924 Bacteria 2926
675 Ga0496121_0075697 3300048924 Bacteria 2688
676 Ga0496121_0232510 3300048924 Bacteria 1290
677 Ga0496121_0317860 3300048924 Bacteria 1049
678 Ga0496121_0402299 3300048924 Bacteria 896
679 Ga0496122_0002015 3300048925 Bacteria 30205
680 Ga0496122_0010032 3300048925 Bacteria 9853
681 Ga0496122_0011694 3300048925 Bacteria 8847
682 Ga0496122_0045690 3300048925 Bacteria 3401
683 Ga0496122_0051420 3300048925 Bacteria 3131
684 Ga0496123_0000539 3300048926 Bacteria 65166
685 Ga0496123_0004774 3300048926 Bacteria 14014
686 Ga0496123_0007053 3300048926 Bacteria 10693
687 Ga0496123_0022976 3300048926 Bacteria 4788
688 Ga0496124_0000041 3300048927 Bacteria 303887
689 Ga0496124_0019294 3300048927 Bacteria 6351
690 Ga0496124_0024928 3300048927 Bacteria 5427
691 Ga0496124_0075331 3300048927 Bacteria 2788
692 Ga0496124_0120736 3300048927 Bacteria 2095
693 Ga0496124_0249998 3300048927 Bacteria 1312
694 Ga0496124_0289547 3300048927 Bacteria 1189
695 Ga0496125_0000238 3300048928 Bacteria 113252
696 Ga0496125_0005247 3300048928 Bacteria 14519
697 Ga0496125_0078684 3300048928 Bacteria 2533
698 Ga0496125_0145693 3300048928 Bacteria 1637
699 Ga0496125_0480177 3300048928 Bacteria 704
700 Ga0496126_0000155 3300048929 Bacteria 158816
701 Ga0496126_0000817 3300048929 Bacteria 55573
702 Ga0496126_0054808 3300048929 Bacteria 3609
703 Ga0496126_0084486 3300048929 Bacteria 2800
704 Ga0496126_0094153 3300048929 Bacteria 2629
705 Ga0496126_0285009 3300048929 Bacteria 1367
706 Ga0495678_000067 3300049459 Bacteria 132540
707 Ga0495678_001527 3300049459 Bacteria 17887
708 Ga0495678_030533 3300049459 Bacteria 2254
709 Ga0495678_035460 3300049459 Bacteria 2045
710 Ga0495678_053007 3300049459 Bacteria 1559
711 Ga0495682_0009921 3300049460 Bacteria 3704
712 Ga0495682_0039341 3300049460 Bacteria 1736
713 Ga0495682_0102406 3300049460 Bacteria 1027
714 Ga0501335_001954 3300049551 Bacteria 1637
715 Ga0501033_0361177 3300049570 Bacteria 1016
716 Ga0501034_0008945 3300049571 Bacteria 10528
717 Ga0501034_0043506 3300049571 Bacteria 4545
718 Ga0501034_0074510 3300049571 Bacteria 3402
719 Ga0501034_0278855 3300049571 Bacteria 1611
720 Ga0501034_0667521 3300049571 Bacteria 940
721 Ga0501037_0015498 3300049573 Bacteria 5609
722 Ga0501039_0477245 3300049575 Bacteria 979
723 Ga0501043_0114352 3300049579 Bacteria 2119
724 Ga0501047_0157204 3300049581 Bacteria 2147
725 Ga0501047_0258557 3300049581 Bacteria 1589
726 Ga0501073_0676047 3300049589 Bacteria 712
727 Ga0501249_000057 3300049679 Bacteria 40985
728 Ga0501225_0005256 3300049705 Bacteria 3812
729 Ga0501225_0008501 3300049705 Bacteria 2944
730 Ga0501035_0012166 3300049822 Bacteria 7958
731 Ga0501035_0049902 3300049822 Bacteria 3751
732 Ga0501035_0653511 3300049822 Bacteria 852
733 Ga0501044_0000515 3300049823 Bacteria 47051
734 Ga0501044_0092841 3300049823 Bacteria 3044
735 Ga0501044_0208817 3300049823 Bacteria 1908
736 Ga0501044_0838402 3300049823 Bacteria 797
737 Ga0501204_007499 3300049850 Bacteria 1229
738 nmdc:mga00v17_11948_c1 3300050491 Bacteria 4781
739 nmdc:mga00v17_703184_c1 3300050491 Bacteria 648
740 nmdc:mga0yw44_266370_c1 3300050492 Bacteria 1143
741 nmdc:mga0k408_316310_c1 3300050493 Bacteria 932
742 nmdc:mga0k408_469216_c1 3300050493 Bacteria 747
743 nmdc:mga06z11_27_c1 3300050494 Bacteria 64010
744 nmdc:mga04h51_2074_c1 3300050495 Bacteria 4707
745 nmdc:mga07m45_45066_c1 3300050496 Bacteria 2476
746 nmdc:mga09592_67153_c1 3300050508 Bacteria 3040
747 Ga0495601_0192739 3300053077 Bacteria 1332
748 Ga0495601_0215168 3300053077 Bacteria 1255
749 Ga0500610_0000144 3300053079 Bacteria 21374
750 Ga0495595_0184311 3300053084 Bacteria 1036
751 Ga0495619_0277068 3300053085 Bacteria 1162
752 Ga0500578_0000005 3300053086 Bacteria 243789
753 Ga0500643_000012 3300053087 Bacteria 369839
754 Ga0500643_000199 3300053087 Bacteria 57141
755 Ga0500643_000466 3300053087 Bacteria 29832
756 Ga0500643_000848 3300053087 Bacteria 19517
757 Ga0500643_023732 3300053087 Bacteria 1957
758 Ga0500646_0017402 3300053090 Bacteria 1885
759 Ga0500647_0076062 3300053091 Bacteria 1611
760 Ga0500583_0136685 3300053092 Bacteria 1217
761 Ga0500651_0368218 3300053093 Bacteria 813
762 Ga0500641_0000152 3300053096 Bacteria 25722
763 Ga0500641_0020030 3300053096 Bacteria 2535
764 Ga0500555_000594 3300053103 Bacteria 14125
765 Ga0500562_001900 3300053108 Bacteria 5241
766 Ga0500562_036021 3300053108 Bacteria 1311
767 Ga0500562_044569 3300053108 Bacteria 1181
768 Ga0500594_0000079 3300053118 Bacteria 29754
769 Ga0500595_016627 3300053119 Bacteria 2735
770 Ga0500595_147439 3300053119 Bacteria 658
771 Ga0500608_000039 3300053122 Bacteria 59428
772 Ga0500608_000151 3300053122 Bacteria 28926
773 Ga0500608_000351 3300053122 Bacteria 17772
774 Ga0500608_000636 3300053122 Bacteria 12933
775 Ga0500642_0096758 3300053130 Bacteria 1369
776 Ga0500658_0002778 3300053134 Bacteria 6718
777 Ga0500559_0000190 3300053136 Bacteria 49263
778 Ga0500559_0001426 3300053136 Bacteria 13564
779 Ga0500559_0011010 3300053136 Bacteria 3872
780 Ga0500559_0014015 3300053136 Bacteria 3389
781 Ga0500559_0039778 3300053136 Bacteria 2046
782 Ga0500561_0010843 3300053137 Bacteria 1898
783 Ga0500564_018193 3300053138 Bacteria 3200
784 Ga0500568_0007024 3300053139 Bacteria 5569
785 Ga0500568_0015017 3300053139 Bacteria 3475
786 Ga0500573_0000271 3300053140 Bacteria 21909
787 Ga0500573_0061486 3300053140 Bacteria 2151
788 Ga0500573_0181186 3300053140 Bacteria 1132
789 Ga0500588_0184032 3300053146 Bacteria 769
790 Ga0500604_0106670 3300053151 Bacteria 927
791 Ga0500616_0044966 3300053153 Bacteria 2355
792 Ga0500619_000886 3300053154 Bacteria 5108
793 Ga0500622_0001545 3300053156 Bacteria 18217
794 Ga0500622_0002329 3300053156 Bacteria 13867
795 Ga0500622_0008683 3300053156 Bacteria 5669
796 Ga0500622_0024452 3300053156 Bacteria 3193
797 Ga0500622_0055833 3300053156 Bacteria 2022
798 Ga0500624_000053 3300053157 Bacteria 74086
799 Ga0500627_0091911 3300053158 Bacteria 1358
800 Ga0500633_0031530 3300053160 Bacteria 1714
801 Ga0500636_0003608 3300053177 Bacteria 8724
802 Ga0500637_0102461 3300053178 Bacteria 1660
803 Ga0500567_038725 3300053723 Bacteria 2230
804 Ga0500625_000002 3300053729 Bacteria 371909
805 Ga0500645_000001 3300053730 Bacteria 455558
806 Ga0500645_000566 3300053730 Bacteria 24221
807 Ga0500645_010918 3300053730 Bacteria 2984
808 Ga0500661_046605 3300055283 Bacteria 771
809 Ga0587084_003395 3300059477 Bacteria 1748
810 Ga0587088_004364 3300059508 Bacteria 1786
811 Ga0587090_003778 3300059510 Bacteria 1786
812 Ga0587094_002775 3300059513 Bacteria 1839
813 Ga0587128_005805 3300059630 Bacteria 1495
814 Ga0587069_005954 3300059642 Bacteria 1444
815 Ga0587078_002342 3300059646 Bacteria 1830
816 Ga0587079_005621 3300059647 Bacteria 1784
817 Ga0587102_000884 3300059649 Bacteria 1902
818 Ga0587096_00527 3300060247 Bacteria 1081
819 Ga0587071_006951 3300060344 Bacteria 1788
820 Ga0587071_038487 3300060344 Bacteria 950
821 Ga0587111_0006342 3300060346 Bacteria 1872
822 Ga0587111_0014016 3300060346 Bacteria 1443
823 Ga0587111_0015291 3300060346 Bacteria 1401
824 Ga0587111_0047376 3300060346 Bacteria 937

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0090030 Ga0495634_0090030_17_562 169
2 3300046557 Ga0495622_0218024 Ga0495622_0218024_272_823 171
3 3300013296 Ga0157374_10413154 Ga0157374_104131542 174
4 3300041459 Ga0451800_1633068 Ga0451800_1633068_434_994 174
5 3300046515 Ga0495620_0110997 Ga0495620_0110997_492_1052 174
6 3300046520 Ga0495637_0202655 Ga0495637_0202655_21_581 174
7 3300046689 Ga0495613_0774563 Ga0495613_0774563_37_597 174
8 3300046694 Ga0495649_0263956 Ga0495649_0263956_299_859 174
9 3300048917 Ga0496114_0342325 Ga0496114_0342325_27_587 174
10 3300046471 Ga0495650_0159613 Ga0495650_0159613_67_726 176
11 3300046507 Ga0495606_0084167 Ga0495606_0084167_447_1109 180
12 3300046524 Ga0495648_0000363 Ga0495648_0000363_24819_25481 180
13 iso_pu_bacteria 2582581867 2585400558 182
14 iso_pu_bacteria 2585427590 2585819880 182
15 iso_pu_bacteria 2511231221 2512035364 183
16 iso_pu_bacteria 2615840626 2616310858 183
17 iso_pu_bacteria 2842914999 2842918434 183
18 iso_pu_bacteria 2928972540 2928974838 183
19 iso_pu_bacteria 2939631187 2939634858 183
20 iso_pu_bacteria 2977240413 2977242118 183
21 iso_pu_bacteria 2989776772 2989780942 183
22 iso_pu_bacteria 8045864390 8045865643 183
23 iso_pu_bacteria 2830075706 2830078984 184
24 iso_pu_bacteria 2885429604 2885431589 184
25 3300049460 Ga0495682_0039341 Ga0495682_0039341_587_1216 185
26 3300046454 Ga0495592_0088409 Ga0495592_0088409_476_1129 186
27 3300053077 Ga0495601_0215168 Ga0495601_0215168_346_999 186
28 3300001979 JGI24740J21852_10058307 JGI24740J21852_100583071 187
29 3300001989 JGI24739J22299_10001701 JGI24739J22299_100017016 187
30 3300001990 JGI24737J22298_10006194 JGI24737J22298_100061945 187
31 3300002067 JGI24735J21928_10005514 JGI24735J21928_100055145 187
32 3300002987 JGI25159J45721_1001111 JGI25159J45721_10011115 187
33 3300003758 Ga0055532_1008694 Ga0055532_10086941 187
34 3300003759 Ga0055525_1000203 Ga0055525_100020327 187
35 3300003762 Ga0055542_1024935 Ga0055542_10249351 187
36 3300003763 Ga0055529_1008275 Ga0055529_10082751 187
37 3300003781 Ga0055536_1010073 Ga0055536_10100733 187
38 3300003781 Ga0055536_1011254 Ga0055536_10112542 187
39 3300003781 Ga0055536_1011520 Ga0055536_10115202 187
40 3300003791 Ga0055530_10005838 Ga0055530_100058384 187
41 3300003791 Ga0055530_10009279 Ga0055530_100092793 187
42 3300003791 Ga0055530_10017340 Ga0055530_100173402 187
43 3300003794 Ga0055531_10008976 Ga0055531_100089762 187
44 3300004625 Ga0055543_1001755 Ga0055543_10017557 187
45 3300005262 Ga0065165_1000034 Ga0065165_1000034162 187
46 3300005262 Ga0065165_1000201 Ga0065165_100020126 187
47 3300005289 Ga0065704_10002132 Ga0065704_100021326 187
48 3300005289 Ga0065704_10103203 Ga0065704_101032033 187
49 3300005329 Ga0070683_100003434 Ga0070683_10000343410 187
50 3300005329 Ga0070683_100129620 Ga0070683_1001296203 187
51 3300005335 Ga0070666_10012958 Ga0070666_100129582 187
52 3300005336 Ga0070680_100101269 Ga0070680_1001012692 187
53 3300005344 Ga0070661_100732717 Ga0070661_1007327171 187
54 3300005347 Ga0070668_100029073 Ga0070668_1000290736 187
55 3300005347 Ga0070668_100051660 Ga0070668_1000516605 187
56 3300005353 Ga0070669_100108785 Ga0070669_1001087852 187
57 3300005353 Ga0070669_100792781 Ga0070669_1007927811 187
58 3300005355 Ga0070671_100077914 Ga0070671_1000779142 187
59 3300005367 Ga0070667_100000641 Ga0070667_10000064125 187
60 3300005367 Ga0070667_100443740 Ga0070667_1004437402 187
61 3300005455 Ga0070663_100150234 Ga0070663_1001502342 187
62 3300005457 Ga0070662_100107064 Ga0070662_1001070642 187
63 3300005458 Ga0070681_10088271 Ga0070681_100882713 187
64 3300005458 Ga0070681_10531691 Ga0070681_105316911 187
65 3300005467 Ga0070706_100167714 Ga0070706_1001677141 187
66 3300005530 Ga0070679_100171386 Ga0070679_1001713862 187
67 3300005535 Ga0070684_100019470 Ga0070684_1000194702 187
68 3300005539 Ga0068853_100059993 Ga0068853_1000599935 187
69 3300005539 Ga0068853_100486010 Ga0068853_1004860102 187
70 3300005548 Ga0070665_100070111 Ga0070665_1000701113 187
71 3300005548 Ga0070665_100136898 Ga0070665_1001368982 187
72 3300005548 Ga0070665_100386040 Ga0070665_1003860402 187
73 3300005563 Ga0068855_100000578 Ga0068855_10000057818 187
74 3300005563 Ga0068855_100006609 Ga0068855_10000660911 187
75 3300005563 Ga0068855_100212232 Ga0068855_1002122323 187
76 3300005563 Ga0068855_100284476 Ga0068855_1002844762 187
77 3300005563 Ga0068855_101195589 Ga0068855_1011955891 187
78 3300005578 Ga0068854_100065040 Ga0068854_1000650402 187
79 3300005614 Ga0068856_100005054 Ga0068856_1000050542 187
80 3300005616 Ga0068852_100028904 Ga0068852_1000289045 187
81 3300005617 Ga0068859_100442449 Ga0068859_1004424492 187
82 3300005618 Ga0068864_100043363 Ga0068864_1000433632 187
83 3300005719 Ga0068861_100241584 Ga0068861_1002415842 187
84 3300005834 Ga0068851_10006331 Ga0068851_100063313 187
85 3300005841 Ga0068863_100000047 Ga0068863_10000004797 187
86 3300005843 Ga0068860_100000083 Ga0068860_100000083133 187
87 3300005843 Ga0068860_100033785 Ga0068860_1000337856 187
88 3300005844 Ga0068862_100031630 Ga0068862_1000316302 187
89 3300006038 Ga0075365_10483784 Ga0075365_104837841 187
90 3300006042 Ga0075368_10004678 Ga0075368_100046785 187
91 3300006048 Ga0075363_100074975 Ga0075363_1000749752 187
92 3300006051 Ga0075364_10062738 Ga0075364_100627382 187
93 3300006178 Ga0075367_10000432 Ga0075367_1000043212 187
94 3300006186 Ga0075369_10184509 Ga0075369_101845091 187
95 3300006195 Ga0075366_10057177 Ga0075366_100571773 187
96 3300006353 Ga0075370_10024908 Ga0075370_100249082 187
97 3300006358 Ga0068871_100424830 Ga0068871_1004248302 187
98 3300006847 Ga0075431_100146462 Ga0075431_1001464623 187
99 3300006880 Ga0075429_100766057 Ga0075429_1007660571 187
100 3300006931 Ga0097620_100442457 Ga0097620_1004424572 187
101 3300006946 Ga0079104_1000233 Ga0079104_100023362 187
102 3300007265 Ga0099794_10076257 Ga0099794_100762573 187
103 3300009093 Ga0105240_10001958 Ga0105240_1000195812 187
104 3300009093 Ga0105240_10008326 Ga0105240_100083267 187
105 3300009093 Ga0105240_10339483 Ga0105240_103394831 187
106 3300009101 Ga0105247_10108411 Ga0105247_101084113 187
107 3300009545 Ga0105237_10042893 Ga0105237_100428935 187
108 3300009545 Ga0105237_10168162 Ga0105237_101681622 187
109 3300009545 Ga0105237_10473179 Ga0105237_104731791 187
110 3300009545 Ga0105237_10497327 Ga0105237_104973272 187
111 3300009551 Ga0105238_10006093 Ga0105238_100060937 187
112 3300009551 Ga0105238_10028456 Ga0105238_100284563 187
113 3300009551 Ga0105238_10128901 Ga0105238_101289012 187
114 3300009551 Ga0105238_10301227 Ga0105238_103012271 187
115 3300009978 Ga0105148_100126 Ga0105148_1001265 187
116 3300009993 Ga0105028_101109 Ga0105028_1011092 187
117 3300010375 Ga0105239_10033754 Ga0105239_100337544 187
118 3300010375 Ga0105239_10100056 Ga0105239_101000563 187
119 3300010375 Ga0105239_10819860 Ga0105239_108198601 187
120 3300013102 Ga0157371_10000149 Ga0157371_1000014947 187
121 3300013104 Ga0157370_10000127 Ga0157370_1000012763 187
122 3300013104 Ga0157370_10157576 Ga0157370_101575764 187
123 3300013104 Ga0157370_10494962 Ga0157370_104949622 187
124 3300013105 Ga0157369_10097084 Ga0157369_100970844 187
125 3300013307 Ga0157372_10021887 Ga0157372_100218877 187
126 3300014497 Ga0182008_10010811 Ga0182008_100108112 187
127 3300014497 Ga0182008_10081456 Ga0182008_100814562 187
128 3300014497 Ga0182008_10282673 Ga0182008_102826731 187
129 3300015261 Ga0182006_1000066 Ga0182006_100006620 187
130 3300015261 Ga0182006_1008015 Ga0182006_10080155 187
131 3300015262 Ga0182007_10026530 Ga0182007_100265303 187
132 3300015262 Ga0182007_10028669 Ga0182007_100286692 187
133 3300015262 Ga0182007_10039739 Ga0182007_100397392 187
134 3300015265 Ga0182005_1000045 Ga0182005_100004544 187
135 3300015265 Ga0182005_1015093 Ga0182005_10150933 187
136 3300015684 Ga0183365_10004 Ga0183365_1000449 187
137 3300017792 Ga0163161_10175512 Ga0163161_101755122 187
138 3300017792 Ga0163161_10549019 Ga0163161_105490191 187
139 3300020076 Ga0206355_1722878 Ga0206355_17228781 187
140 3300021384 Ga0213876_10013112 Ga0213876_100131122 187
141 3300025226 Ga0209674_100408 Ga0209674_10040815 187
142 3300025228 Ga0209672_105007 Ga0209672_1050073 187
143 3300025229 Ga0209147_101509 Ga0209147_1015098 187
144 3300025230 Ga0209563_100147 Ga0209563_10014728 187
145 3300025233 Ga0209437_101033 Ga0209437_1010339 187
146 3300025254 Ga0209148_1001708 Ga0209148_10017085 187
147 3300025261 Ga0209233_1040117 Ga0209233_10401172 187
148 3300025272 Ga0209455_1000528 Ga0209455_100052829 187
149 3300025284 Ga0209130_1000016 Ga0209130_100001646 187
150 3300025292 Ga0209676_1000031 Ga0209676_1000031284 187
151 3300025292 Ga0209676_1000057 Ga0209676_100005790 187
152 3300025292 Ga0209676_1009299 Ga0209676_10092993 187
153 3300025295 Ga0209564_1025690 Ga0209564_10256902 187
154 3300025298 Ga0209050_1000135 Ga0209050_1000135162 187
155 3300025298 Ga0209050_1000522 Ga0209050_10005224 187
156 3300025298 Ga0209050_1001148 Ga0209050_10011483 187
157 3300025299 Ga0209256_1015077 Ga0209256_10150773 187
158 3300025299 Ga0209256_1015450 Ga0209256_10154504 187
159 3300025303 Ga0209051_1000720 Ga0209051_100072029 187
160 3300025303 Ga0209051_1001452 Ga0209051_100145213 187
161 3300025303 Ga0209051_1022249 Ga0209051_10222493 187
162 3300025304 Ga0209257_1000050 Ga0209257_1000050146 187
163 3300025304 Ga0209257_1015126 Ga0209257_10151262 187
164 3300025321 Ga0207656_10008808 Ga0207656_100088083 187
165 3300025900 Ga0207710_10092745 Ga0207710_100927451 187
166 3300025903 Ga0207680_10011782 Ga0207680_100117822 187
167 3300025904 Ga0207647_10005180 Ga0207647_100051807 187
168 3300025906 Ga0207699_10347450 Ga0207699_103474501 187
169 3300025910 Ga0207684_10629550 Ga0207684_106295501 187
170 3300025912 Ga0207707_10028648 Ga0207707_100286481 187
171 3300025913 Ga0207695_10011982 Ga0207695_100119826 187
172 3300025913 Ga0207695_10034335 Ga0207695_100343351 187
173 3300025913 Ga0207695_10467702 Ga0207695_104677022 187
174 3300025914 Ga0207671_10021399 Ga0207671_100213994 187
175 3300025914 Ga0207671_10026997 Ga0207671_100269975 187
176 3300025914 Ga0207671_10246904 Ga0207671_102469042 187
177 3300025917 Ga0207660_10085410 Ga0207660_100854102 187
178 3300025920 Ga0207649_10027081 Ga0207649_100270813 187
179 3300025920 Ga0207649_10097031 Ga0207649_100970313 187
180 3300025920 Ga0207649_10642154 Ga0207649_106421541 187
181 3300025921 Ga0207652_10172685 Ga0207652_101726853 187
182 3300025923 Ga0207681_10157779 Ga0207681_101577792 187
183 3300025924 Ga0207694_10072771 Ga0207694_100727713 187
184 3300025924 Ga0207694_10084123 Ga0207694_100841232 187
185 3300025924 Ga0207694_10288462 Ga0207694_102884622 187
186 3300025924 Ga0207694_10487408 Ga0207694_104874081 187
187 3300025933 Ga0207706_10169919 Ga0207706_101699192 187
188 3300025941 Ga0207711_10578814 Ga0207711_105788141 187
189 3300025944 Ga0207661_10002953 Ga0207661_100029539 187
190 3300025949 Ga0207667_10003995 Ga0207667_1000399513 187
191 3300025949 Ga0207667_10033611 Ga0207667_100336116 187
192 3300025972 Ga0207668_10000459 Ga0207668_1000045919 187
193 3300025972 Ga0207668_10101088 Ga0207668_101010882 187
194 3300025981 Ga0207640_10151241 Ga0207640_101512411 187
195 3300025986 Ga0207658_10000539 Ga0207658_1000053911 187
196 3300026041 Ga0207639_10017056 Ga0207639_100170561 187
197 3300026041 Ga0207639_10030241 Ga0207639_100302412 187
198 3300026067 Ga0207678_10036071 Ga0207678_100360714 187
199 3300026067 Ga0207678_10078493 Ga0207678_100784933 187
200 3300026078 Ga0207702_10024157 Ga0207702_100241576 187
201 3300026088 Ga0207641_10000079 Ga0207641_1000007996 187
202 3300026095 Ga0207676_10102002 Ga0207676_101020022 187
203 3300026116 Ga0207674_10034505 Ga0207674_100345052 187
204 3300026142 Ga0207698_10080544 Ga0207698_100805442 187
205 3300027111 Ga0209281_1000076 Ga0209281_1000076199 187
206 3300027512 Ga0209179_1014034 Ga0209179_10140342 187
207 3300027866 Ga0209813_10000193 Ga0209813_100001936 187
208 3300028379 Ga0268266_10098802 Ga0268266_100988023 187
209 3300028379 Ga0268266_10312702 Ga0268266_103127022 187
210 3300028379 Ga0268266_10393901 Ga0268266_103939012 187
211 3300028380 Ga0268265_10000441 Ga0268265_100004416 187
212 3300028381 Ga0268264_10000055 Ga0268264_10000055267 187
213 3300028381 Ga0268264_10022045 Ga0268264_100220452 187
214 3300028381 Ga0268264_11507938 Ga0268264_115079381 187
215 3300028573 Ga0265334_10108569 Ga0265334_101085691 187
216 3300028794 Ga0307515_10048081 Ga0307515_100480813 187
217 3300028794 Ga0307515_10105375 Ga0307515_101053754 187
218 3300028794 Ga0307515_10373205 Ga0307515_103732052 187
219 3300028800 Ga0265338_10069689 Ga0265338_100696894 187
220 3300030521 Ga0307511_10004068 Ga0307511_100040685 187
221 3300031235 Ga0265330_10000281 Ga0265330_100002812 187
222 3300031238 Ga0265332_10000008 Ga0265332_10000008113 187
223 3300031240 Ga0265320_10001142 Ga0265320_1000114215 187
224 3300031240 Ga0265320_10025201 Ga0265320_100252012 187
225 3300031241 Ga0265325_10002464 Ga0265325_100024648 187
226 3300031241 Ga0265325_10003681 Ga0265325_100036818 187
227 3300031241 Ga0265325_10014671 Ga0265325_100146712 187
228 3300031247 Ga0265340_10014774 Ga0265340_100147742 187
229 3300031247 Ga0265340_10026996 Ga0265340_100269962 187
230 3300031247 Ga0265340_10223790 Ga0265340_102237901 187
231 3300031249 Ga0265339_10013193 Ga0265339_100131935 187
232 3300031250 Ga0265331_10009489 Ga0265331_100094893 187
233 3300031251 Ga0265327_10000039 Ga0265327_1000003962 187
234 3300031251 Ga0265327_10042551 Ga0265327_100425512 187
235 3300031344 Ga0265316_10043352 Ga0265316_100433524 187
236 3300031507 Ga0307509_10000034 Ga0307509_1000003465 187
237 3300031548 Ga0307408_100029072 Ga0307408_1000290725 187
238 3300031595 Ga0265313_10075898 Ga0265313_100758982 187
239 3300031649 Ga0307514_10001251 Ga0307514_1000125131 187
240 3300031711 Ga0265314_10000065 Ga0265314_1000006533 187
241 3300031711 Ga0265314_10087721 Ga0265314_100877212 187
242 3300031712 Ga0265342_10099855 Ga0265342_100998551 187
243 3300031730 Ga0307516_10000001 Ga0307516_10000001176 187
244 3300031730 Ga0307516_10000405 Ga0307516_1000040546 187
245 3300031731 Ga0307405_10204646 Ga0307405_102046462 187
246 3300031824 Ga0307413_10085428 Ga0307413_100854282 187
247 3300031911 Ga0307412_10083948 Ga0307412_100839481 187
248 3300031995 Ga0307409_100288371 Ga0307409_1002883712 187
249 3300033442 Ga0315911_1000005 Ga0315911_1000005421 187
250 3300035692 Ga0373935_0015118 Ga0373935_0015118_2520_3206 187
251 3300036401 Ga0373937_0018626 Ga0373937_0018626_302_988 187
252 3300036534 Ga0310109_017351 Ga0310109_017351_315_914 187
253 3300037068 Ga0373925_0690309 Ga0373925_0690309_120_719 187
254 3300037312 Ga0395899_0211793 Ga0395899_0211793_485_1084 187
255 3300037418 Ga0395900_0013472 Ga0395900_0013472_1157_1756 187
256 3300037418 Ga0395900_0144077 Ga0395900_0144077_1138_1737 187
257 3300038443 Ga0395901_0085564 Ga0395901_0085564_213_812 187
258 3300038443 Ga0395901_1170714 Ga0395901_1170714_84_683 187
259 3300038705 Ga0237819_01183 Ga0237819_01183_143_742 187
260 3300039145 Ga0237816_00202 Ga0237816_00202_3592_4191 187
261 3300039437 Ga0436365_0604521 Ga0436365_0604521_80_679 187
262 3300039437 Ga0436365_0743078 Ga0436365_0743078_16138_16737 187
263 3300039437 Ga0436365_1106902 Ga0436365_1106902_151_750 187
264 3300039453 Ga0436362_0543628 Ga0436362_0543628_1176_1775 187
265 3300041410 Ga0439461_0028876 Ga0439461_0028876_69_677 187
266 3300041456 Ga0451795_0975754 Ga0451795_0975754_103_702 187
267 3300042115 Ga0450911_000005 Ga0450911_000005_75632_76243 187
268 3300042137 Ga0450902_014459 Ga0450902_014459_165_776 187
269 3300042156 Ga0439446_0046748 Ga0439446_0046748_36_635 187
270 3300042184 Ga0450908_000048 Ga0450908_000048_9488_10087 187
271 3300044712 Ga0453684_0622467 Ga0453684_0622467_213_815 187
272 3300045049 Ga0466959_0012635 Ga0466959_0012635_715_1317 187
273 3300045976 Ga0466967_1002745 Ga0466967_1002745_117_716 187
274 3300046452 Ga0495617_000024 Ga0495617_000024_110598_111197 187
275 3300046452 Ga0495617_000296 Ga0495617_000296_17492_18091 187
276 3300046452 Ga0495617_140271 Ga0495617_140271_38_667 187
277 3300046452 Ga0495617_144857 Ga0495617_144857_145_744 187
278 3300046453 Ga0495627_000478 Ga0495627_000478_134_733 187
279 3300046454 Ga0495592_0059295 Ga0495592_0059295_1993_2679 187
280 3300046455 Ga0495603_0354853 Ga0495603_0354853_150_749 187
281 3300046457 Ga0495590_0018331 Ga0495590_0018331_1233_1832 187
282 3300046457 Ga0495590_0029296 Ga0495590_0029296_746_1345 187
283 3300046459 Ga0495629_0000027 Ga0495629_0000027_42541_43140 187
284 3300046459 Ga0495629_0000130 Ga0495629_0000130_2552_3151 187
285 3300046459 Ga0495629_0000281 Ga0495629_0000281_18709_19308 187
286 3300046460 Ga0495638_0000363 Ga0495638_0000363_49958_50557 187
287 3300046460 Ga0495638_0006293 Ga0495638_0006293_4715_5314 187
288 3300046460 Ga0495638_0006659 Ga0495638_0006659_1732_2331 187
289 3300046460 Ga0495638_0057822 Ga0495638_0057822_1277_1876 187
290 3300046460 Ga0495638_0078605 Ga0495638_0078605_86_685 187
291 3300046460 Ga0495638_0275069 Ga0495638_0275069_264_863 187
292 3300046461 Ga0495641_0108463 Ga0495641_0108463_71_670 187
293 3300046462 Ga0495651_0007550 Ga0495651_0007550_3417_4103 187
294 3300046463 Ga0495653_0000449 Ga0495653_0000449_18681_19280 187
295 3300046463 Ga0495653_0000885 Ga0495653_0000885_2548_3147 187
296 3300046463 Ga0495653_0033105 Ga0495653_0033105_777_1376 187
297 3300046471 Ga0495650_0000226 Ga0495650_0000226_12409_13008 187
298 3300046471 Ga0495650_0001371 Ga0495650_0001371_7201_7800 187
299 3300046471 Ga0495650_0005382 Ga0495650_0005382_606_1205 187
300 3300046471 Ga0495650_0006744 Ga0495650_0006744_2578_3177 187
301 3300046471 Ga0495650_0033401 Ga0495650_0033401_1407_2006 187
302 3300046472 Ga0495580_0003983 Ga0495580_0003983_4762_5361 187
303 3300046472 Ga0495580_0005607 Ga0495580_0005607_9397_9996 187
304 3300046472 Ga0495580_0005620 Ga0495580_0005620_7463_8062 187
305 3300046472 Ga0495580_0006044 Ga0495580_0006044_4764_5363 187
306 3300046472 Ga0495580_0007400 Ga0495580_0007400_1718_2317 187
307 3300046472 Ga0495580_0021463 Ga0495580_0021463_1691_2290 187
308 3300046472 Ga0495580_0027966 Ga0495580_0027966_1812_2411 187
309 3300046472 Ga0495580_0097802 Ga0495580_0097802_605_1204 187
310 3300046473 Ga0495582_0032237 Ga0495582_0032237_1928_2527 187
311 3300046474 Ga0495605_0013142 Ga0495605_0013142_3058_3657 187
312 3300046474 Ga0495605_0044778 Ga0495605_0044778_709_1308 187
313 3300046477 Ga0495664_0010704 Ga0495664_0010704_1736_2335 187
314 3300046477 Ga0495664_0067107 Ga0495664_0067107_910_1509 187
315 3300046491 Ga0495584_0199762 Ga0495584_0199762_40_639 187
316 3300046491 Ga0495584_0393420 Ga0495584_0393420_30_629 187
317 3300046492 Ga0495585_0000143 Ga0495585_0000143_64680_65279 187
318 3300046492 Ga0495585_0000360 Ga0495585_0000360_20939_21538 187
319 3300046492 Ga0495585_0032133 Ga0495585_0032133_1389_1988 187
320 3300046500 Ga0495596_0104288 Ga0495596_0104288_368_967 187
321 3300046501 Ga0495607_0000083 Ga0495607_0000083_89706_90305 187
322 3300046501 Ga0495607_0000460 Ga0495607_0000460_18511_19110 187
323 3300046501 Ga0495607_0003621 Ga0495607_0003621_9318_9917 187
324 3300046501 Ga0495607_0045245 Ga0495607_0045245_470_1069 187
325 3300046501 Ga0495607_0108152 Ga0495607_0108152_747_1346 187
326 3300046506 Ga0495583_0002869 Ga0495583_0002869_3539_4138 187
327 3300046506 Ga0495583_0021304 Ga0495583_0021304_2350_2949 187
328 3300046506 Ga0495583_0036880 Ga0495583_0036880_1330_1929 187
329 3300046506 Ga0495583_0065054 Ga0495583_0065054_11_610 187
330 3300046506 Ga0495583_0179260 Ga0495583_0179260_116_715 187
331 3300046507 Ga0495606_0000066 Ga0495606_0000066_22369_22968 187
332 3300046507 Ga0495606_0000136 Ga0495606_0000136_77929_78528 187
333 3300046507 Ga0495606_0001286 Ga0495606_0001286_22645_23244 187
334 3300046507 Ga0495606_0010585 Ga0495606_0010585_1716_2315 187
335 3300046507 Ga0495606_0023113 Ga0495606_0023113_174_773 187
336 3300046507 Ga0495606_0112148 Ga0495606_0112148_971_1570 187
337 3300046507 Ga0495606_0115834 Ga0495606_0115834_462_1061 187
338 3300046512 Ga0495610_0000356 Ga0495610_0000356_26362_27012 187
339 3300046512 Ga0495610_0005518 Ga0495610_0005518_5364_5963 187
340 3300046512 Ga0495610_0214499 Ga0495610_0214499_60_659 187
341 3300046513 Ga0495616_0000003 Ga0495616_0000003_103512_104111 187
342 3300046513 Ga0495616_0000018 Ga0495616_0000018_146980_147579 187
343 3300046513 Ga0495616_0025623 Ga0495616_0025623_1755_2354 187
344 3300046513 Ga0495616_0151260 Ga0495616_0151260_162_761 187
345 3300046515 Ga0495620_0000102 Ga0495620_0000102_45739_46338 187
346 3300046515 Ga0495620_0027224 Ga0495620_0027224_166_765 187
347 3300046515 Ga0495620_0038233 Ga0495620_0038233_1329_1928 187
348 3300046516 Ga0495628_0007163 Ga0495628_0007163_5482_6081 187
349 3300046516 Ga0495628_0047361 Ga0495628_0047361_930_1529 187
350 3300046516 Ga0495628_0052696 Ga0495628_0052696_255_854 187
351 3300046516 Ga0495628_0080520 Ga0495628_0080520_98_784 187
352 3300046516 Ga0495628_0110409 Ga0495628_0110409_893_1492 187
353 3300046518 Ga0495631_0000022 Ga0495631_0000022_13098_13697 187
354 3300046518 Ga0495631_0000267 Ga0495631_0000267_7040_7639 187
355 3300046518 Ga0495631_0002903 Ga0495631_0002903_6826_7425 187
356 3300046518 Ga0495631_0173186 Ga0495631_0173186_127_726 187
357 3300046519 Ga0495632_0000008 Ga0495632_0000008_29219_29818 187
358 3300046519 Ga0495632_0000042 Ga0495632_0000042_68033_68632 187
359 3300046519 Ga0495632_0002853 Ga0495632_0002853_5720_6319 187
360 3300046519 Ga0495632_0006266 Ga0495632_0006266_6773_7372 187
361 3300046520 Ga0495637_0008748 Ga0495637_0008748_4351_4950 187
362 3300046520 Ga0495637_0012500 Ga0495637_0012500_3343_3993 187
363 3300046520 Ga0495637_0044545 Ga0495637_0044545_781_1380 187
364 3300046522 Ga0495643_0000005 Ga0495643_0000005_374504_375103 187
365 3300046522 Ga0495643_0065152 Ga0495643_0065152_973_1572 187
366 3300046523 Ga0495644_0014817 Ga0495644_0014817_1113_1712 187
367 3300046524 Ga0495648_0001155 Ga0495648_0001155_13351_13950 187
368 3300046524 Ga0495648_0001362 Ga0495648_0001362_1833_2432 187
369 3300046524 Ga0495648_0004160 Ga0495648_0004160_5445_6044 187
370 3300046524 Ga0495648_0012133 Ga0495648_0012133_2602_3201 187
371 3300046524 Ga0495648_0052312 Ga0495648_0052312_1591_2190 187
372 3300046524 Ga0495648_0068302 Ga0495648_0068302_1081_1680 187
373 3300046524 Ga0495648_0081807 Ga0495648_0081807_1160_1759 187
374 3300046524 Ga0495648_0089274 Ga0495648_0089274_56_694 187
375 3300046524 Ga0495648_0100208 Ga0495648_0100208_29_628 187
376 3300046525 Ga0495663_0000015 Ga0495663_0000015_76554_77153 187
377 3300046526 Ga0495666_0240105 Ga0495666_0240105_40_639 187
378 3300046528 Ga0495642_0054429 Ga0495642_0054429_261_860 187
379 3300046531 Ga0495665_0043904 Ga0495665_0043904_1510_2109 187
380 3300046531 Ga0495665_0229958 Ga0495665_0229958_306_905 187
381 3300046533 Ga0495640_0192125 Ga0495640_0192125_289_888 187
382 3300046535 Ga0495586_0228330 Ga0495586_0228330_276_875 187
383 3300046538 Ga0495609_0013558 Ga0495609_0013558_310_948 187
384 3300046538 Ga0495609_0014939 Ga0495609_0014939_1131_1730 187
385 3300046538 Ga0495609_0027977 Ga0495609_0027977_1124_1786 187
386 3300046538 Ga0495609_0178062 Ga0495609_0178062_260_859 187
387 3300046542 Ga0495597_0011589 Ga0495597_0011589_1802_2401 187
388 3300046543 Ga0495645_0007813 Ga0495645_0007813_4957_5556 187
389 3300046543 Ga0495645_0303663 Ga0495645_0303663_244_897 187
390 3300046558 Ga0495633_0000197 Ga0495633_0000197_3062_3661 187
391 3300046558 Ga0495633_0000222 Ga0495633_0000222_5636_6235 187
392 3300046558 Ga0495633_0000371 Ga0495633_0000371_8848_9450 187
393 3300046558 Ga0495633_0067556 Ga0495633_0067556_99_698 187
394 3300046558 Ga0495633_0131657 Ga0495633_0131657_394_993 187
395 3300046558 Ga0495633_0249159 Ga0495633_0249159_71_721 187
396 3300046615 Ga0495656_0391587 Ga0495656_0391587_25_624 187
397 3300046616 Ga0495668_0000019 Ga0495668_0000019_76017_76616 187
398 3300046616 Ga0495668_0000061 Ga0495668_0000061_24835_25434 187
399 3300046616 Ga0495668_0000066 Ga0495668_0000066_128055_128654 187
400 3300046616 Ga0495668_0020487 Ga0495668_0020487_208_807 187
401 3300046616 Ga0495668_0123686 Ga0495668_0123686_199_798 187
402 3300046642 Ga0495634_0181821 Ga0495634_0181821_312_911 187
403 3300046648 Ga0495611_0000004 Ga0495611_0000004_122122_122721 187
404 3300046648 Ga0495611_0000113 Ga0495611_0000113_49133_49732 187
405 3300046648 Ga0495611_0155574 Ga0495611_0155574_442_1041 187
406 3300046660 Ga0495625_0000024 Ga0495625_0000024_85121_85720 187
407 3300046660 Ga0495625_0016404 Ga0495625_0016404_1607_2206 187
408 3300046660 Ga0495625_0264849 Ga0495625_0264849_119_718 187
409 3300046660 Ga0495625_0265681 Ga0495625_0265681_221_820 187
410 3300046664 Ga0495659_0046350 Ga0495659_0046350_442_1044 187
411 3300046665 Ga0495661_0023232 Ga0495661_0023232_290_889 187
412 3300046678 Ga0495599_0175318 Ga0495599_0175318_237_836 187
413 3300046680 Ga0495646_0002861 Ga0495646_0002861_3928_4527 187
414 3300046680 Ga0495646_0006551 Ga0495646_0006551_3065_3664 187
415 3300046680 Ga0495646_0056805 Ga0495646_0056805_1702_2301 187
416 3300046689 Ga0495613_0056868 Ga0495613_0056868_766_1365 187
417 3300046689 Ga0495613_0077881 Ga0495613_0077881_1724_2323 187
418 3300046689 Ga0495613_0101505 Ga0495613_0101505_658_1257 187
419 3300046690 Ga0495624_0004752 Ga0495624_0004752_6466_7065 187
420 3300046690 Ga0495624_0005955 Ga0495624_0005955_5554_6153 187
421 3300046690 Ga0495624_0006209 Ga0495624_0006209_379_978 187
422 3300046690 Ga0495624_0022978 Ga0495624_0022978_1854_2453 187
423 3300046691 Ga0495670_0001381 Ga0495670_0001381_5369_5968 187
424 3300046691 Ga0495670_0002072 Ga0495670_0002072_8903_9502 187
425 3300046691 Ga0495670_0040453 Ga0495670_0040453_1342_1941 187
426 3300046692 Ga0495671_0000007 Ga0495671_0000007_374438_375037 187
427 3300046692 Ga0495671_0001491 Ga0495671_0001491_5314_5913 187
428 3300046692 Ga0495671_0061148 Ga0495671_0061148_126_725 187
429 3300046692 Ga0495671_0065703 Ga0495671_0065703_301_906 187
430 3300046694 Ga0495649_0021687 Ga0495649_0021687_291_896 187
431 3300046694 Ga0495649_0085604 Ga0495649_0085604_562_1161 187
432 3300046794 Ga0495589_0000367 Ga0495589_0000367_30933_31532 187
433 3300046810 Ga0495660_0000052 Ga0495660_0000052_37714_38313 187
434 3300046810 Ga0495660_0000064 Ga0495660_0000064_36072_36671 187
435 3300047317 Ga0495604_0488753 Ga0495604_0488753_123_776 187
436 3300047319 Ga0495674_0001399 Ga0495674_0001399_17898_18497 187
437 3300047319 Ga0495674_0001405 Ga0495674_0001405_8515_9114 187
438 3300047319 Ga0495674_0005169 Ga0495674_0005169_7559_8158 187
439 3300047319 Ga0495674_0192671 Ga0495674_0192671_169_768 187
440 3300047320 Ga0495672_0001207 Ga0495672_0001207_4437_5066 187
441 3300047320 Ga0495672_0025394 Ga0495672_0025394_2591_3190 187
442 3300047320 Ga0495672_0078132 Ga0495672_0078132_1168_1767 187
443 3300047320 Ga0495672_0162524 Ga0495672_0162524_344_943 187
444 3300047321 Ga0495676_0053985 Ga0495676_0053985_969_1568 187
445 3300047321 Ga0495676_0054767 Ga0495676_0054767_764_1363 187
446 3300047322 Ga0495680_0315834 Ga0495680_0315834_205_891 187
447 3300047323 Ga0495683_0006619 Ga0495683_0006619_853_1452 187
448 3300047443 Ga0495687_112000 Ga0495687_112000_11_691 187
449 3300047444 Ga0495675_0374154 Ga0495675_0374154_91_690 187
450 3300047446 Ga0495679_000009 Ga0495679_000009_228080_228679 187
451 3300047446 Ga0495679_000011 Ga0495679_000011_187240_187839 187
452 3300047446 Ga0495679_000102 Ga0495679_000102_42409_43008 187
453 3300047446 Ga0495679_012887 Ga0495679_012887_2528_3127 187
454 3300047469 Ga0495673_0000028 Ga0495673_0000028_252979_253578 187
455 3300047469 Ga0495673_0000036 Ga0495673_0000036_151729_152328 187
456 3300047469 Ga0495673_0000101 Ga0495673_0000101_7149_7748 187
457 3300047469 Ga0495673_0003573 Ga0495673_0003573_7515_8114 187
458 3300047469 Ga0495673_0086782 Ga0495673_0086782_45_644 187
459 3300047470 Ga0495681_0000032 Ga0495681_0000032_27161_27811 187
460 3300047470 Ga0495681_0033770 Ga0495681_0033770_207_806 187
461 3300047470 Ga0495681_0055878 Ga0495681_0055878_1033_1632 187
462 3300047470 Ga0495681_0175854 Ga0495681_0175854_209_808 187
463 3300047472 Ga0495686_0000033 Ga0495686_0000033_243227_243826 187
464 3300047472 Ga0495686_0000180 Ga0495686_0000180_10171_10770 187
465 3300047472 Ga0495686_0000190 Ga0495686_0000190_52078_52677 187
466 3300047472 Ga0495686_0001592 Ga0495686_0001592_69_668 187
467 3300047472 Ga0495686_0002384 Ga0495686_0002384_8033_8632 187
468 3300047472 Ga0495686_0024922 Ga0495686_0024922_1957_2556 187
469 3300047472 Ga0495686_0070152 Ga0495686_0070152_582_1181 187
470 3300047472 Ga0495686_0155947 Ga0495686_0155947_696_1295 187
471 3300047472 Ga0495686_0224032 Ga0495686_0224032_193_792 187
472 3300047673 Ga0495593_0004348 Ga0495593_0004348_4379_4978 187
473 3300047673 Ga0495593_0014869 Ga0495593_0014869_2552_3151 187
474 3300047673 Ga0495593_0223157 Ga0495593_0223157_32_631 187
475 3300047673 Ga0495593_0373848 Ga0495593_0373848_71_670 187
476 3300048091 Ga0495626_0004650 Ga0495626_0004650_3505_4104 187
477 3300048091 Ga0495626_0005244 Ga0495626_0005244_3863_4462 187
478 3300048091 Ga0495626_0030318 Ga0495626_0030318_1424_2023 187
479 3300048091 Ga0495626_0040568 Ga0495626_0040568_979_1578 187
480 3300048903 Ga0496100_0056714 Ga0496100_0056714_710_1345 187
481 3300048903 Ga0496100_0208709 Ga0496100_0208709_447_1046 187
482 3300048904 Ga0496101_0000999 Ga0496101_0000999_9523_10122 187
483 3300048904 Ga0496101_0168706 Ga0496101_0168706_781_1416 187
484 3300048905 Ga0496102_0027920 Ga0496102_0027920_2914_3516 187
485 3300048905 Ga0496102_0126223 Ga0496102_0126223_1062_1661 187
486 3300048905 Ga0496102_0627485 Ga0496102_0627485_352_951 187
487 3300048905 Ga0496102_0927401 Ga0496102_0927401_142_741 187
488 3300048906 Ga0496103_0205226 Ga0496103_0205226_250_852 187
489 3300048907 Ga0496104_0008489 Ga0496104_0008489_3692_4327 187
490 3300048908 Ga0496105_0002897 Ga0496105_0002897_4742_5377 187
491 3300048909 Ga0496106_0474159 Ga0496106_0474159_115_714 187
492 3300048911 Ga0496108_0203733 Ga0496108_0203733_11_610 187
493 3300048912 Ga0496109_0083486 Ga0496109_0083486_321_920 187
494 3300048913 Ga0496110_0058192 Ga0496110_0058192_2669_3268 187
495 3300048913 Ga0496110_0245520 Ga0496110_0245520_586_1221 187
496 3300048914 Ga0496111_0016400 Ga0496111_0016400_907_1542 187
497 3300048915 Ga0496112_0000052 Ga0496112_0000052_64860_65459 187
498 3300048915 Ga0496112_0304667 Ga0496112_0304667_688_1323 187
499 3300048916 Ga0496113_0885374 Ga0496113_0885374_24_623 187
500 3300048918 Ga0496115_0027713 Ga0496115_0027713_843_1559 187
501 3300048918 Ga0496115_0283942 Ga0496115_0283942_291_890 187
502 3300048918 Ga0496115_0369101 Ga0496115_0369101_512_1111 187
503 3300048918 Ga0496115_0436424 Ga0496115_0436424_128_727 187
504 3300048918 Ga0496115_0496133 Ga0496115_0496133_306_905 187
505 3300048918 Ga0496115_0826663 Ga0496115_0826663_61_660 187
506 3300048919 Ga0496116_0015207 Ga0496116_0015207_2486_3088 187
507 3300048919 Ga0496116_0081560 Ga0496116_0081560_1114_1713 187
508 3300048920 Ga0496117_0000102 Ga0496117_0000102_162099_162701 187
509 3300048920 Ga0496117_0012119 Ga0496117_0012119_105_704 187
510 3300048920 Ga0496117_0109260 Ga0496117_0109260_36_635 187
511 3300048920 Ga0496117_0207727 Ga0496117_0207727_481_1080 187
512 3300048921 Ga0496118_0000038 Ga0496118_0000038_152737_153339 187
513 3300048921 Ga0496118_0000696 Ga0496118_0000696_52829_53428 187
514 3300048921 Ga0496118_0005851 Ga0496118_0005851_9385_9984 187
515 3300048921 Ga0496118_0060180 Ga0496118_0060180_1327_1926 187
516 3300048921 Ga0496118_0188363 Ga0496118_0188363_55_666 187
517 3300048921 Ga0496118_0287098 Ga0496118_0287098_30_629 187
518 3300048922 Ga0496119_0003348 Ga0496119_0003348_13149_13751 187
519 3300048922 Ga0496119_0024539 Ga0496119_0024539_3483_4085 187
520 3300048923 Ga0496120_0030390 Ga0496120_0030390_2409_3011 187
521 3300048923 Ga0496120_0108714 Ga0496120_0108714_695_1297 187
522 3300048924 Ga0496121_0000208 Ga0496121_0000208_57648_58247 187
523 3300048924 Ga0496121_0000782 Ga0496121_0000782_5071_5670 187
524 3300048924 Ga0496121_0001227 Ga0496121_0001227_33776_34375 187
525 3300048924 Ga0496121_0028584 Ga0496121_0028584_1200_1802 187
526 3300048924 Ga0496121_0057869 Ga0496121_0057869_1200_1802 187
527 3300048924 Ga0496121_0059804 Ga0496121_0059804_583_1182 187
528 3300048924 Ga0496121_0066519 Ga0496121_0066519_519_1118 187
529 3300048924 Ga0496121_0075697 Ga0496121_0075697_1953_2552 187
530 3300048924 Ga0496121_0232510 Ga0496121_0232510_593_1192 187
531 3300048924 Ga0496121_0317860 Ga0496121_0317860_104_703 187
532 3300048924 Ga0496121_0402299 Ga0496121_0402299_258_857 187
533 3300048925 Ga0496122_0010032 Ga0496122_0010032_4919_5521 187
534 3300048925 Ga0496122_0011694 Ga0496122_0011694_5432_6031 187
535 3300048925 Ga0496122_0045690 Ga0496122_0045690_2399_3010 187
536 3300048925 Ga0496122_0051420 Ga0496122_0051420_781_1380 187
537 3300048926 Ga0496123_0000539 Ga0496123_0000539_36408_37010 187
538 3300048926 Ga0496123_0004774 Ga0496123_0004774_10055_10654 187
539 3300048926 Ga0496123_0007053 Ga0496123_0007053_405_1004 187
540 3300048927 Ga0496124_0019294 Ga0496124_0019294_4433_5032 187
541 3300048927 Ga0496124_0024928 Ga0496124_0024928_2017_2616 187
542 3300048927 Ga0496124_0075331 Ga0496124_0075331_1740_2339 187
543 3300048927 Ga0496124_0120736 Ga0496124_0120736_1370_1969 187
544 3300048927 Ga0496124_0249998 Ga0496124_0249998_665_1264 187
545 3300048927 Ga0496124_0289547 Ga0496124_0289547_136_738 187
546 3300048928 Ga0496125_0005247 Ga0496125_0005247_11176_11778 187
547 3300048928 Ga0496125_0078684 Ga0496125_0078684_1477_2076 187
548 3300048928 Ga0496125_0145693 Ga0496125_0145693_336_935 187
549 3300048928 Ga0496125_0480177 Ga0496125_0480177_24_623 187
550 3300048929 Ga0496126_0000817 Ga0496126_0000817_33313_33912 187
551 3300048929 Ga0496126_0054808 Ga0496126_0054808_312_959 187
552 3300048929 Ga0496126_0084486 Ga0496126_0084486_1200_1802 187
553 3300048929 Ga0496126_0094153 Ga0496126_0094153_1858_2460 187
554 3300048929 Ga0496126_0285009 Ga0496126_0285009_265_876 187
555 3300049459 Ga0495678_000067 Ga0495678_000067_13644_14243 187
556 3300049459 Ga0495678_001527 Ga0495678_001527_15128_15727 187
557 3300049459 Ga0495678_030533 Ga0495678_030533_1511_2161 187
558 3300049459 Ga0495678_035460 Ga0495678_035460_385_984 187
559 3300049459 Ga0495678_053007 Ga0495678_053007_561_1160 187
560 3300049460 Ga0495682_0009921 Ga0495682_0009921_265_864 187
561 3300049460 Ga0495682_0102406 Ga0495682_0102406_195_794 187
562 3300049551 Ga0501335_001954 Ga0501335_001954_990_1589 187
563 3300049570 Ga0501033_0361177 Ga0501033_0361177_159_758 187
564 3300049571 Ga0501034_0008945 Ga0501034_0008945_4292_4891 187
565 3300049571 Ga0501034_0043506 Ga0501034_0043506_802_1401 187
566 3300049571 Ga0501034_0074510 Ga0501034_0074510_779_1411 187
567 3300049571 Ga0501034_0278855 Ga0501034_0278855_469_1068 187
568 3300049571 Ga0501034_0667521 Ga0501034_0667521_68_667 187
569 3300049573 Ga0501037_0015498 Ga0501037_0015498_4361_4993 187
570 3300049575 Ga0501039_0477245 Ga0501039_0477245_68_667 187
571 3300049579 Ga0501043_0114352 Ga0501043_0114352_389_1021 187
572 3300049581 Ga0501047_0157204 Ga0501047_0157204_792_1391 187
573 3300049581 Ga0501047_0258557 Ga0501047_0258557_265_864 187
574 3300049589 Ga0501073_0676047 Ga0501073_0676047_72_671 187
575 3300049679 Ga0501249_000057 Ga0501249_000057_40265_40864 187
576 3300049705 Ga0501225_0005256 Ga0501225_0005256_2793_3392 187
577 3300049705 Ga0501225_0008501 Ga0501225_0008501_2043_2642 187
578 3300049822 Ga0501035_0012166 Ga0501035_0012166_209_808 187
579 3300049822 Ga0501035_0049902 Ga0501035_0049902_759_1358 187
580 3300049822 Ga0501035_0653511 Ga0501035_0653511_208_840 187
581 3300049823 Ga0501044_0000515 Ga0501044_0000515_32554_33153 187
582 3300049823 Ga0501044_0092841 Ga0501044_0092841_1029_1628 187
583 3300049823 Ga0501044_0208817 Ga0501044_0208817_1186_1785 187
584 3300049850 Ga0501204_007499 Ga0501204_007499_608_1207 187
585 3300050491 nmdc:mga00v17_11948_c1 nmdc:mga00v17_11948_c1_630_1229 187
586 3300050492 nmdc:mga0yw44_266370_c1 nmdc:mga0yw44_266370_c1_376_975 187
587 3300050493 nmdc:mga0k408_316310_c1 nmdc:mga0k408_316310_c1_168_767 187
588 3300050494 nmdc:mga06z11_27_c1 nmdc:mga06z11_27_c1_59933_60532 187
589 3300050495 nmdc:mga04h51_2074_c1 nmdc:mga04h51_2074_c1_696_1295 187
590 3300050496 nmdc:mga07m45_45066_c1 nmdc:mga07m45_45066_c1_1315_1914 187
591 3300050508 nmdc:mga09592_67153_c1 nmdc:mga09592_67153_c1_1733_2332 187
592 3300053077 Ga0495601_0192739 Ga0495601_0192739_559_1245 187
593 3300053084 Ga0495595_0184311 Ga0495595_0184311_112_765 187
594 3300053085 Ga0495619_0277068 Ga0495619_0277068_35_688 187
595 3300053086 Ga0500578_0000005 Ga0500578_0000005_199155_199754 187
596 3300053087 Ga0500643_000012 Ga0500643_000012_121896_122495 187
597 3300053087 Ga0500643_000199 Ga0500643_000199_41039_41638 187
598 3300053087 Ga0500643_000466 Ga0500643_000466_13190_13789 187
599 3300053087 Ga0500643_000848 Ga0500643_000848_434_1033 187
600 3300053087 Ga0500643_023732 Ga0500643_023732_704_1303 187
601 3300053090 Ga0500646_0017402 Ga0500646_0017402_926_1774 187
602 3300053091 Ga0500647_0076062 Ga0500647_0076062_1002_1601 187
603 3300053096 Ga0500641_0000152 Ga0500641_0000152_418_1017 187
604 3300053103 Ga0500555_000594 Ga0500555_000594_12717_13316 187
605 3300053108 Ga0500562_001900 Ga0500562_001900_99_698 187
606 3300053108 Ga0500562_036021 Ga0500562_036021_332_931 187
607 3300053108 Ga0500562_044569 Ga0500562_044569_520_1119 187
608 3300053118 Ga0500594_0000079 Ga0500594_0000079_14058_14657 187
609 3300053119 Ga0500595_147439 Ga0500595_147439_16_615 187
610 3300053122 Ga0500608_000039 Ga0500608_000039_44487_45086 187
611 3300053122 Ga0500608_000151 Ga0500608_000151_27354_27953 187
612 3300053122 Ga0500608_000351 Ga0500608_000351_16906_17505 187
613 3300053122 Ga0500608_000636 Ga0500608_000636_2367_2966 187
614 3300053136 Ga0500559_0000190 Ga0500559_0000190_642_1241 187
615 3300053136 Ga0500559_0001426 Ga0500559_0001426_7377_7976 187
616 3300053136 Ga0500559_0011010 Ga0500559_0011010_2647_3246 187
617 3300053136 Ga0500559_0014015 Ga0500559_0014015_2374_2973 187
618 3300053137 Ga0500561_0010843 Ga0500561_0010843_560_1159 187
619 3300053138 Ga0500564_018193 Ga0500564_018193_2130_2729 187
620 3300053140 Ga0500573_0061486 Ga0500573_0061486_1077_1679 187
621 3300053140 Ga0500573_0181186 Ga0500573_0181186_84_683 187
622 3300053146 Ga0500588_0184032 Ga0500588_0184032_124_723 187
623 3300053151 Ga0500604_0106670 Ga0500604_0106670_76_771 187
624 3300053153 Ga0500616_0044966 Ga0500616_0044966_1383_1982 187
625 3300053156 Ga0500622_0001545 Ga0500622_0001545_16770_17369 187
626 3300053156 Ga0500622_0002329 Ga0500622_0002329_6872_7474 187
627 3300053156 Ga0500622_0008683 Ga0500622_0008683_233_832 187
628 3300053156 Ga0500622_0024452 Ga0500622_0024452_811_1410 187
629 3300053156 Ga0500622_0055833 Ga0500622_0055833_1403_2002 187
630 3300053157 Ga0500624_000053 Ga0500624_000053_2426_3025 187
631 3300053158 Ga0500627_0091911 Ga0500627_0091911_164_763 187
632 3300053160 Ga0500633_0031530 Ga0500633_0031530_513_1112 187
633 3300053178 Ga0500637_0102461 Ga0500637_0102461_376_978 187
634 3300053723 Ga0500567_038725 Ga0500567_038725_543_1142 187
635 3300053729 Ga0500625_000002 Ga0500625_000002_51107_51706 187
636 3300053730 Ga0500645_000566 Ga0500645_000566_6970_7569 187
637 3300053730 Ga0500645_010918 Ga0500645_010918_1903_2502 187
638 3300060344 Ga0587071_038487 Ga0587071_038487_38_640 187
639 3300060346 Ga0587111_0014016 Ga0587111_0014016_361_963 187
640 3300060346 Ga0587111_0015291 Ga0587111_0015291_12_611 187
641 3300060346 Ga0587111_0047376 Ga0587111_0047376_60_662 187
642 3300001915 JGI24741J21665_1004560 JGI24741J21665_10045602 188
643 3300001979 JGI24740J21852_10015017 JGI24740J21852_100150172 188
644 3300001990 JGI24737J22298_10028777 JGI24737J22298_100287773 188
645 3300002244 JGI24742J22300_10007013 JGI24742J22300_100070131 188
646 3300003214 JGI25165J46597_1000095 JGI25165J46597_1000095109 188
647 3300003214 JGI25165J46597_1033269 JGI25165J46597_10332691 188
648 3300003215 JGI25153J46596_10000070 JGI25153J46596_1000007022 188
649 3300003762 Ga0055542_1000040 Ga0055542_1000040123 188
650 3300003763 Ga0055529_1000037 Ga0055529_100003798 188
651 3300005262 Ga0065165_1019972 Ga0065165_10199722 188
652 3300005327 Ga0070658_10000493 Ga0070658_100004938 188
653 3300005327 Ga0070658_10214969 Ga0070658_102149692 188
654 3300005331 Ga0070670_100222087 Ga0070670_1002220872 188
655 3300005337 Ga0070682_100557312 Ga0070682_1005573121 188
656 3300005339 Ga0070660_100018126 Ga0070660_1000181264 188
657 3300005344 Ga0070661_100007029 Ga0070661_1000070296 188
658 3300005347 Ga0070668_100146008 Ga0070668_1001460082 188
659 3300005354 Ga0070675_100902593 Ga0070675_1009025931 188
660 3300005355 Ga0070671_100867727 Ga0070671_1008677271 188
661 3300005356 Ga0070674_100094329 Ga0070674_1000943292 188
662 3300005364 Ga0070673_100065542 Ga0070673_1000655423 188
663 3300005439 Ga0070711_100518536 Ga0070711_1005185361 188
664 3300005455 Ga0070663_100061428 Ga0070663_1000614281 188
665 3300005456 Ga0070678_100000151 Ga0070678_10000015118 188
666 3300005459 Ga0068867_100125191 Ga0068867_1001251911 188
667 3300005548 Ga0070665_100000023 Ga0070665_100000023304 188
668 3300005548 Ga0070665_100126039 Ga0070665_1001260393 188
669 3300005564 Ga0070664_100079939 Ga0070664_1000799393 188
670 3300005577 Ga0068857_100507882 Ga0068857_1005078821 188
671 3300005614 Ga0068856_100614898 Ga0068856_1006148981 188
672 3300005719 Ga0068861_100119692 Ga0068861_1001196923 188
673 3300005842 Ga0068858_100001609 Ga0068858_10000160924 188
674 3300006186 Ga0075369_10286418 Ga0075369_102864181 188
675 3300006195 Ga0075366_10515073 Ga0075366_105150731 188
676 3300006237 Ga0097621_100308053 Ga0097621_1003080532 188
677 3300009093 Ga0105240_11744777 Ga0105240_117447771 188
678 3300009098 Ga0105245_10002151 Ga0105245_100021516 188
679 3300009148 Ga0105243_10000847 Ga0105243_100008477 188
680 3300009148 Ga0105243_10009064 Ga0105243_100090642 188
681 3300009551 Ga0105238_10008522 Ga0105238_100085222 188
682 3300009551 Ga0105238_10414726 Ga0105238_104147262 188
683 3300013100 Ga0157373_10343162 Ga0157373_103431622 188
684 3300013102 Ga0157371_10000029 Ga0157371_1000002949 188
685 3300013105 Ga0157369_10979721 Ga0157369_109797212 188
686 3300013297 Ga0157378_10107733 Ga0157378_101077332 188
687 3300013297 Ga0157378_10377941 Ga0157378_103779411 188
688 3300017792 Ga0163161_10018355 Ga0163161_100183554 188
689 3300025233 Ga0209437_102846 Ga0209437_1028465 188
690 3300025246 Ga0209646_1019045 Ga0209646_10190451 188
691 3300025250 Ga0209026_1017308 Ga0209026_10173082 188
692 3300025253 Ga0209677_109799 Ga0209677_1097993 188
693 3300025254 Ga0209148_1000011 Ga0209148_10000111020 188
694 3300025261 Ga0209233_1000052 Ga0209233_100005249 188
695 3300025261 Ga0209233_1021386 Ga0209233_10213863 188
696 3300025272 Ga0209455_1000006 Ga0209455_1000006172 188
697 3300025272 Ga0209455_1005748 Ga0209455_10057484 188
698 3300025297 Ga0209758_1000023 Ga0209758_1000023398 188
699 3300025901 Ga0207688_10028488 Ga0207688_100284883 188
700 3300025904 Ga0207647_10020030 Ga0207647_100200304 188
701 3300025907 Ga0207645_10028085 Ga0207645_100280853 188
702 3300025907 Ga0207645_10039222 Ga0207645_100392224 188
703 3300025909 Ga0207705_10001210 Ga0207705_1000121014 188
704 3300025913 Ga0207695_10533118 Ga0207695_105331182 188
705 3300025914 Ga0207671_10017854 Ga0207671_100178544 188
706 3300025916 Ga0207663_10392401 Ga0207663_103924012 188
707 3300025919 Ga0207657_10019604 Ga0207657_100196044 188
708 3300025920 Ga0207649_10000710 Ga0207649_1000071021 188
709 3300025924 Ga0207694_10004368 Ga0207694_100043682 188
710 3300025924 Ga0207694_10018654 Ga0207694_100186545 188
711 3300025925 Ga0207650_10234968 Ga0207650_102349681 188
712 3300025927 Ga0207687_10000798 Ga0207687_1000079811 188
713 3300025933 Ga0207706_10105523 Ga0207706_101055232 188
714 3300025935 Ga0207709_10000039 Ga0207709_10000039190 188
715 3300025937 Ga0207669_10000117 Ga0207669_1000011739 188
716 3300025937 Ga0207669_10000382 Ga0207669_1000038212 188
717 3300025945 Ga0207679_10947931 Ga0207679_109479311 188
718 3300025949 Ga0207667_10000002 Ga0207667_10000002867 188
719 3300025960 Ga0207651_10360248 Ga0207651_103602482 188
720 3300025972 Ga0207668_10744655 Ga0207668_107446551 188
721 3300025986 Ga0207658_10073092 Ga0207658_100730923 188
722 3300026035 Ga0207703_10000847 Ga0207703_1000084725 188
723 3300026041 Ga0207639_10172214 Ga0207639_101722142 188
724 3300026041 Ga0207639_10407957 Ga0207639_104079571 188
725 3300026067 Ga0207678_10016640 Ga0207678_100166404 188
726 3300026078 Ga0207702_10034995 Ga0207702_100349951 188
727 3300026089 Ga0207648_10047537 Ga0207648_100475372 188
728 3300026116 Ga0207674_10024940 Ga0207674_100249406 188
729 3300026121 Ga0207683_10000496 Ga0207683_1000049623 188
730 3300026121 Ga0207683_10021185 Ga0207683_100211853 188
731 3300026142 Ga0207698_10004357 Ga0207698_1000435710 188
732 3300028379 Ga0268266_10000002 Ga0268266_100000021177 188
733 3300028379 Ga0268266_10144375 Ga0268266_101443752 188
734 3300028786 Ga0307517_10055671 Ga0307517_100556712 188
735 3300031456 Ga0307513_10024144 Ga0307513_100241443 188
736 3300031507 Ga0307509_10310343 Ga0307509_103103431 188
737 3300031616 Ga0307508_10000317 Ga0307508_1000031727 188
738 3300031824 Ga0307413_10754999 Ga0307413_107549991 188
739 3300037418 Ga0395900_0625948 Ga0395900_0625948_322_924 188
740 3300038443 Ga0395901_0221211 Ga0395901_0221211_1061_1663 188
741 3300041456 Ga0451795_1434403 Ga0451795_1434403_480_1082 188
742 3300041463 Ga0451804_1057260 Ga0451804_1057260_33_638 188
743 3300042003 Ga0439443_014595 Ga0439443_014595_191_793 188
744 3300046452 Ga0495617_024660 Ga0495617_024660_544_1146 188
745 3300046459 Ga0495629_0041152 Ga0495629_0041152_1959_2561 188
746 3300046460 Ga0495638_0000128 Ga0495638_0000128_109844_110446 188
747 3300046471 Ga0495650_0000470 Ga0495650_0000470_18858_19460 188
748 3300046491 Ga0495584_0004592 Ga0495584_0004592_2382_2984 188
749 3300046491 Ga0495584_0165160 Ga0495584_0165160_391_993 188
750 3300046492 Ga0495585_0003270 Ga0495585_0003270_1828_2430 188
751 3300046492 Ga0495585_0064674 Ga0495585_0064674_1319_1921 188
752 3300046492 Ga0495585_0174619 Ga0495585_0174619_301_903 188
753 3300046500 Ga0495596_0180383 Ga0495596_0180383_123_725 188
754 3300046506 Ga0495583_0001366 Ga0495583_0001366_17668_18270 188
755 3300046506 Ga0495583_0002817 Ga0495583_0002817_10014_10616 188
756 3300046506 Ga0495583_0034073 Ga0495583_0034073_869_1471 188
757 3300046507 Ga0495606_0000092 Ga0495606_0000092_94282_94884 188
758 3300046507 Ga0495606_0343390 Ga0495606_0343390_164_766 188
759 3300046522 Ga0495643_0000530 Ga0495643_0000530_2078_2680 188
760 3300046522 Ga0495643_0009416 Ga0495643_0009416_148_750 188
761 3300046522 Ga0495643_0019650 Ga0495643_0019650_855_1457 188
762 3300046524 Ga0495648_0000146 Ga0495648_0000146_83010_83612 188
763 3300046524 Ga0495648_0025432 Ga0495648_0025432_743_1345 188
764 3300046525 Ga0495663_0001818 Ga0495663_0001818_3864_4466 188
765 3300046528 Ga0495642_0002091 Ga0495642_0002091_3983_4585 188
766 3300046542 Ga0495597_0091236 Ga0495597_0091236_84_686 188
767 3300046557 Ga0495622_0000811 Ga0495622_0000811_14960_15562 188
768 3300046558 Ga0495633_0000842 Ga0495633_0000842_2612_3214 188
769 3300046616 Ga0495668_0000056 Ga0495668_0000056_143446_144048 188
770 3300046648 Ga0495611_0011961 Ga0495611_0011961_2308_2910 188
771 3300046648 Ga0495611_0015996 Ga0495611_0015996_2324_2926 188
772 3300046660 Ga0495625_0000255 Ga0495625_0000255_28089_28691 188
773 3300046660 Ga0495625_0008595 Ga0495625_0008595_5356_6000 188
774 3300046660 Ga0495625_0009405 Ga0495625_0009405_3338_3940 188
775 3300046660 Ga0495625_0273380 Ga0495625_0273380_155_757 188
776 3300046665 Ga0495661_0147719 Ga0495661_0147719_518_1120 188
777 3300046684 Ga0495669_0000155 Ga0495669_0000155_24737_25339 188
778 3300046691 Ga0495670_0364507 Ga0495670_0364507_52_654 188
779 3300046692 Ga0495671_0193287 Ga0495671_0193287_259_861 188
780 3300046809 Ga0495600_0005075 Ga0495600_0005075_4747_5349 188
781 3300046810 Ga0495660_0030727 Ga0495660_0030727_2291_2893 188
782 3300047323 Ga0495683_0012572 Ga0495683_0012572_1627_2229 188
783 3300047443 Ga0495687_000077 Ga0495687_000077_7508_8110 188
784 3300047443 Ga0495687_000353 Ga0495687_000353_27617_28219 188
785 3300047470 Ga0495681_0010146 Ga0495681_0010146_1033_1635 188
786 3300047472 Ga0495686_0100699 Ga0495686_0100699_994_1596 188
787 3300048905 Ga0496102_0000163 Ga0496102_0000163_37163_37765 188
788 3300048906 Ga0496103_0000052 Ga0496103_0000052_105562_106164 188
789 3300048908 Ga0496105_0001302 Ga0496105_0001302_16440_17042 188
790 3300048910 Ga0496107_0175449 Ga0496107_0175449_402_1004 188
791 3300048912 Ga0496109_0206942 Ga0496109_0206942_896_1498 188
792 3300048913 Ga0496110_0145791 Ga0496110_0145791_684_1286 188
793 3300048914 Ga0496111_0002111 Ga0496111_0002111_10318_10920 188
794 3300048916 Ga0496113_0028812 Ga0496113_0028812_1806_2408 188
795 3300048918 Ga0496115_0000078 Ga0496115_0000078_51942_52544 188
796 3300048919 Ga0496116_0088333 Ga0496116_0088333_859_1461 188
797 3300048920 Ga0496117_0000141 Ga0496117_0000141_51877_52479 188
798 3300048921 Ga0496118_0000103 Ga0496118_0000103_51935_52537 188
799 3300048922 Ga0496119_0009712 Ga0496119_0009712_6839_7441 188
800 3300048923 Ga0496120_0062358 Ga0496120_0062358_656_1258 188
801 3300048924 Ga0496121_0000156 Ga0496121_0000156_105544_106146 188
802 3300048925 Ga0496122_0002015 Ga0496122_0002015_22006_22608 188
803 3300048926 Ga0496123_0022976 Ga0496123_0022976_4075_4677 188
804 3300048927 Ga0496124_0000041 Ga0496124_0000041_107435_108037 188
805 3300048928 Ga0496125_0000238 Ga0496125_0000238_27242_27844 188
806 3300048929 Ga0496126_0000155 Ga0496126_0000155_51929_52531 188
807 3300049823 Ga0501044_0838402 Ga0501044_0838402_167_769 188
808 3300050491 nmdc:mga00v17_703184_c1 nmdc:mga00v17_703184_c1_34_636 188
809 3300050493 nmdc:mga0k408_469216_c1 nmdc:mga0k408_469216_c1_46_648 188
810 3300053079 Ga0500610_0000144 Ga0500610_0000144_12164_12766 188
811 3300053092 Ga0500583_0136685 Ga0500583_0136685_167_769 188
812 3300053093 Ga0500651_0368218 Ga0500651_0368218_142_744 188
813 3300053096 Ga0500641_0020030 Ga0500641_0020030_1180_1779 188
814 3300053119 Ga0500595_016627 Ga0500595_016627_1966_2568 188
815 3300053130 Ga0500642_0096758 Ga0500642_0096758_47_649 188
816 3300053134 Ga0500658_0002778 Ga0500658_0002778_2252_2854 188
817 3300053136 Ga0500559_0039778 Ga0500559_0039778_1285_1887 188
818 3300053139 Ga0500568_0007024 Ga0500568_0007024_3067_3693 188
819 3300053139 Ga0500568_0015017 Ga0500568_0015017_1070_1672 188
820 3300053140 Ga0500573_0000271 Ga0500573_0000271_16394_16996 188
821 3300053154 Ga0500619_000886 Ga0500619_000886_3266_3868 188
822 3300053177 Ga0500636_0003608 Ga0500636_0003608_1034_1636 188
823 3300053730 Ga0500645_000001 Ga0500645_000001_319439_320041 188
824 3300055283 Ga0500661_046605 Ga0500661_046605_16_618 188
825 3300059477 Ga0587084_003395 Ga0587084_003395_318_920 188
826 3300059508 Ga0587088_004364 Ga0587088_004364_831_1433 188
827 3300059510 Ga0587090_003778 Ga0587090_003778_831_1433 188
828 3300059513 Ga0587094_002775 Ga0587094_002775_1074_1676 188
829 3300059630 Ga0587128_005805 Ga0587128_005805_18_620 188
830 3300059642 Ga0587069_005954 Ga0587069_005954_830_1432 188
831 3300059646 Ga0587078_002342 Ga0587078_002342_833_1435 188
832 3300059647 Ga0587079_005621 Ga0587079_005621_829_1431 188
833 3300059649 Ga0587102_000884 Ga0587102_000884_947_1549 188
834 3300060247 Ga0587096_00527 Ga0587096_00527_348_950 188
835 3300060344 Ga0587071_006951 Ga0587071_006951_833_1435 188
836 3300060346 Ga0587111_0006342 Ga0587111_0006342_917_1519 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00258

Flavodoxin_1

Flavodoxin

32

160

0.82

PF03358

FMN_red

NADPH-dependent FMN reductase

28

175

0.82

PF02525

Flavodoxin_2

Flavodoxin-like fold

28

171

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4la4-assembly1.cif.gz_B-2 crystal structure of native pnpb 0.9644 1 187
4laf-assembly1.cif.gz_C crystal structure of pnpb complex with fmn 0.9598 1 187
7q6n-assembly1.cif.gz_A structure of wrba from salmonella typhimurium bound to me0052 0.9558 1 186
4laf-assembly1.cif.gz_D crystal structure of pnpb complex with fmn 0.9533 2 188
4la4-assembly1.cif.gz_A crystal structure of native pnpb 0.953 1 187
ID Description Score Start End Superfamily
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.953 1 187 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9483 1 188 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9434 1 188 3.40.50.360
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9431 1 187 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.934 1 188 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2R7QAX1-F1-model_v4 deleted 0.9799 58 188
AF-A0A418NU94-F1-model_v4 NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) 0.9736 1 188 GO:0008753
GO:0010181
GO:0016020
GO:0050136
GO:0050660
GO:0050661
GO:0051287
AF-A0A7C1HH78-F1-model_v4 NAD(P)H:quinone oxidoreductase (EC 1.6.5.2) 0.9726 72 188 GO:0003955
GO:0010181
GO:0016020
AF-A0A2R7QAX1-F1-model_v4 deleted 0.9725 58 188
AF-F8XTR7-F1-model_v4 deleted 0.9724 53 188

Feature Viewer

pLDDT pTM Quality
92.77 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map