F482887
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 400 | 824 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300025924|Ga0207694_10004368|Ga0207694_100043682 |
| Length | 226 |
| Sequence | LNPLLPDMPSPNPSRKREGDFQKECEMTKVLVLYYSSYGHLEQMADAVAEGARSAGAEVDIRRVPETAPAEVAIAAGFKVDTAHPTIGGVAELANYDAIIVGAPTRFGRMPSQMASFLDQAGGLWFTGALNGKVGGAFTSTATQHGGQETTLFSIITNLLHFGLTIVGLDYGFAGQSGVKEVHGNSPYGATTIADSDGSRQPSSVELDGARYQGRRIAEVAGKLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 3 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 4 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 5 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 6 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 7 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 8 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 9 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 10 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 11 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 93 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 213 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 221 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 222 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 223 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 224 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 344 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 363 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 364 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 374 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 375 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 379 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 380 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 382 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 384 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 385 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 386 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 387 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 388 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.29 |
| Metatranscriptomes | 2.27 |
| Isolates | 1.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.43 |
| Nodule | 0.48 |
| Rhizoplane | 4.78 |
| Rhizosphere | 69.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1004560 | 3300001915 | Bacteria | 3044 |
| 2 | JGI24740J21852_10015017 | 3300001979 | Bacteria | 2839 |
| 3 | JGI24740J21852_10058307 | 3300001979 | Bacteria | 1074 |
| 4 | JGI24739J22299_10001701 | 3300001989 | Bacteria | 8365 |
| 5 | JGI24737J22298_10006194 | 3300001990 | Bacteria | 4096 |
| 6 | JGI24737J22298_10028777 | 3300001990 | Bacteria | 1745 |
| 7 | JGI24735J21928_10005514 | 3300002067 | Bacteria | 4195 |
| 8 | JGI24742J22300_10007013 | 3300002244 | Bacteria | 1856 |
| 9 | JGI25159J45721_1001111 | 3300002987 | Bacteria | 11488 |
| 10 | JGI25165J46597_1000095 | 3300003214 | Bacteria | 163883 |
| 11 | JGI25165J46597_1033269 | 3300003214 | Bacteria | 665 |
| 12 | JGI25153J46596_10000070 | 3300003215 | Bacteria | 117125 |
| 13 | Ga0055532_1008694 | 3300003758 | Bacteria | 1257 |
| 14 | Ga0055525_1000203 | 3300003759 | Bacteria | 68926 |
| 15 | Ga0055542_1000040 | 3300003762 | Bacteria | 214035 |
| 16 | Ga0055542_1024935 | 3300003762 | Bacteria | 820 |
| 17 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 18 | Ga0055529_1008275 | 3300003763 | Bacteria | 1387 |
| 19 | Ga0055536_1010073 | 3300003781 | Bacteria | 3807 |
| 20 | Ga0055536_1011254 | 3300003781 | Bacteria | 3451 |
| 21 | Ga0055536_1011520 | 3300003781 | Bacteria | 3381 |
| 22 | Ga0055530_10005838 | 3300003791 | Bacteria | 5707 |
| 23 | Ga0055530_10009279 | 3300003791 | Bacteria | 3807 |
| 24 | Ga0055530_10017340 | 3300003791 | Bacteria | 2261 |
| 25 | Ga0055531_10008976 | 3300003794 | Bacteria | 5173 |
| 26 | Ga0055543_1001755 | 3300004625 | Bacteria | 8103 |
| 27 | Ga0065165_1000034 | 3300005262 | Bacteria | 214644 |
| 28 | Ga0065165_1000201 | 3300005262 | Bacteria | 103327 |
| 29 | Ga0065165_1019972 | 3300005262 | Bacteria | 2375 |
| 30 | Ga0065704_10002132 | 3300005289 | Bacteria | 5808 |
| 31 | Ga0065704_10103203 | 3300005289 | Bacteria | 2179 |
| 32 | Ga0070658_10000493 | 3300005327 | Bacteria | 34309 |
| 33 | Ga0070658_10214969 | 3300005327 | Bacteria | 1625 |
| 34 | Ga0070683_100003434 | 3300005329 | Bacteria | 12861 |
| 35 | Ga0070683_100129620 | 3300005329 | Bacteria | 2386 |
| 36 | Ga0070670_100222087 | 3300005331 | Bacteria | 1644 |
| 37 | Ga0070666_10012958 | 3300005335 | Bacteria | 5277 |
| 38 | Ga0070680_100101269 | 3300005336 | Bacteria | 2391 |
| 39 | Ga0070682_100557312 | 3300005337 | Bacteria | 898 |
| 40 | Ga0070660_100018126 | 3300005339 | Bacteria | 5138 |
| 41 | Ga0070661_100007029 | 3300005344 | Bacteria | 7766 |
| 42 | Ga0070661_100732717 | 3300005344 | Bacteria | 807 |
| 43 | Ga0070668_100029073 | 3300005347 | Bacteria | 4196 |
| 44 | Ga0070668_100051660 | 3300005347 | Bacteria | 3168 |
| 45 | Ga0070668_100146008 | 3300005347 | Bacteria | 1910 |
| 46 | Ga0070669_100108785 | 3300005353 | Bacteria | 2101 |
| 47 | Ga0070669_100792781 | 3300005353 | Bacteria | 805 |
| 48 | Ga0070675_100902593 | 3300005354 | Bacteria | 810 |
| 49 | Ga0070671_100077914 | 3300005355 | Bacteria | 2770 |
| 50 | Ga0070671_100867727 | 3300005355 | Bacteria | 788 |
| 51 | Ga0070674_100094329 | 3300005356 | Bacteria | 2167 |
| 52 | Ga0070673_100065542 | 3300005364 | Bacteria | 2898 |
| 53 | Ga0070667_100000641 | 3300005367 | Bacteria | 33965 |
| 54 | Ga0070667_100443740 | 3300005367 | Bacteria | 1185 |
| 55 | Ga0070711_100518536 | 3300005439 | Bacteria | 985 |
| 56 | Ga0070663_100061428 | 3300005455 | Bacteria | 2706 |
| 57 | Ga0070663_100150234 | 3300005455 | Bacteria | 1786 |
| 58 | Ga0070678_100000151 | 3300005456 | Bacteria | 28884 |
| 59 | Ga0070662_100107064 | 3300005457 | Bacteria | 2125 |
| 60 | Ga0070681_10088271 | 3300005458 | Bacteria | 3053 |
| 61 | Ga0070681_10531691 | 3300005458 | Bacteria | 1089 |
| 62 | Ga0068867_100125191 | 3300005459 | Bacteria | 1991 |
| 63 | Ga0070706_100167714 | 3300005467 | Bacteria | 2050 |
| 64 | Ga0070679_100171386 | 3300005530 | Bacteria | 2143 |
| 65 | Ga0070684_100019470 | 3300005535 | Bacteria | 5614 |
| 66 | Ga0068853_100059993 | 3300005539 | Bacteria | 3286 |
| 67 | Ga0068853_100486010 | 3300005539 | Bacteria | 1164 |
| 68 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 69 | Ga0070665_100070111 | 3300005548 | Bacteria | 3512 |
| 70 | Ga0070665_100126039 | 3300005548 | Bacteria | 2563 |
| 71 | Ga0070665_100136898 | 3300005548 | Bacteria | 2452 |
| 72 | Ga0070665_100386040 | 3300005548 | Bacteria | 1408 |
| 73 | Ga0068855_100000578 | 3300005563 | Bacteria | 44980 |
| 74 | Ga0068855_100006609 | 3300005563 | Bacteria | 14087 |
| 75 | Ga0068855_100212232 | 3300005563 | Bacteria | 2175 |
| 76 | Ga0068855_100284476 | 3300005563 | Bacteria | 1835 |
| 77 | Ga0068855_101195589 | 3300005563 | Bacteria | 791 |
| 78 | Ga0070664_100079939 | 3300005564 | Bacteria | 2815 |
| 79 | Ga0068857_100507882 | 3300005577 | Bacteria | 1132 |
| 80 | Ga0068854_100065040 | 3300005578 | Bacteria | 2650 |
| 81 | Ga0068856_100005054 | 3300005614 | Bacteria | 13058 |
| 82 | Ga0068856_100614898 | 3300005614 | Bacteria | 1107 |
| 83 | Ga0068852_100028904 | 3300005616 | Bacteria | 4545 |
| 84 | Ga0068859_100442449 | 3300005617 | Bacteria | 1396 |
| 85 | Ga0068864_100043363 | 3300005618 | Bacteria | 3852 |
| 86 | Ga0068861_100119692 | 3300005719 | Bacteria | 2122 |
| 87 | Ga0068861_100241584 | 3300005719 | Bacteria | 1536 |
| 88 | Ga0068851_10006331 | 3300005834 | Bacteria | 5401 |
| 89 | Ga0068863_100000047 | 3300005841 | Bacteria | 140249 |
| 90 | Ga0068858_100001609 | 3300005842 | Bacteria | 23039 |
| 91 | Ga0068860_100000083 | 3300005843 | Bacteria | 168189 |
| 92 | Ga0068860_100033785 | 3300005843 | Bacteria | 4908 |
| 93 | Ga0068862_100031630 | 3300005844 | Bacteria | 4469 |
| 94 | Ga0075365_10483784 | 3300006038 | Bacteria | 875 |
| 95 | Ga0075368_10004678 | 3300006042 | Bacteria | 4654 |
| 96 | Ga0075363_100074975 | 3300006048 | Bacteria | 1843 |
| 97 | Ga0075364_10062738 | 3300006051 | Bacteria | 2439 |
| 98 | Ga0075367_10000432 | 3300006178 | Bacteria | 15550 |
| 99 | Ga0075369_10184509 | 3300006186 | Bacteria | 960 |
| 100 | Ga0075369_10286418 | 3300006186 | Bacteria | 768 |
| 101 | Ga0075366_10057177 | 3300006195 | Bacteria | 2318 |
| 102 | Ga0075366_10515073 | 3300006195 | Bacteria | 740 |
| 103 | Ga0097621_100308053 | 3300006237 | Bacteria | 1400 |
| 104 | Ga0075370_10024908 | 3300006353 | Bacteria | 3308 |
| 105 | Ga0068871_100424830 | 3300006358 | Bacteria | 1187 |
| 106 | Ga0075431_100146462 | 3300006847 | Bacteria | 2434 |
| 107 | Ga0075429_100766057 | 3300006880 | Bacteria | 845 |
| 108 | Ga0097620_100442457 | 3300006931 | Bacteria | 1396 |
| 109 | Ga0079104_1000233 | 3300006946 | Bacteria | 75184 |
| 110 | Ga0099794_10076257 | 3300007265 | Bacteria | 1648 |
| 111 | Ga0105240_10001958 | 3300009093 | Bacteria | 34069 |
| 112 | Ga0105240_10008326 | 3300009093 | Bacteria | 14839 |
| 113 | Ga0105240_10339483 | 3300009093 | Bacteria | 1707 |
| 114 | Ga0105240_11744777 | 3300009093 | Bacteria | 649 |
| 115 | Ga0105245_10002151 | 3300009098 | Bacteria | 17853 |
| 116 | Ga0105247_10108411 | 3300009101 | Bacteria | 1784 |
| 117 | Ga0105243_10000847 | 3300009148 | Bacteria | 29024 |
| 118 | Ga0105243_10009064 | 3300009148 | Bacteria | 7601 |
| 119 | Ga0105237_10042893 | 3300009545 | Bacteria | 4559 |
| 120 | Ga0105237_10168162 | 3300009545 | Bacteria | 2192 |
| 121 | Ga0105237_10473179 | 3300009545 | Bacteria | 1259 |
| 122 | Ga0105237_10497327 | 3300009545 | Bacteria | 1226 |
| 123 | Ga0105238_10006093 | 3300009551 | Bacteria | 11960 |
| 124 | Ga0105238_10008522 | 3300009551 | Bacteria | 10261 |
| 125 | Ga0105238_10028456 | 3300009551 | Bacteria | 5693 |
| 126 | Ga0105238_10128901 | 3300009551 | Bacteria | 2508 |
| 127 | Ga0105238_10301227 | 3300009551 | Bacteria | 1587 |
| 128 | Ga0105238_10414726 | 3300009551 | Bacteria | 1341 |
| 129 | Ga0105148_100126 | 3300009978 | Bacteria | 11756 |
| 130 | Ga0105028_101109 | 3300009993 | Bacteria | 2848 |
| 131 | Ga0105239_10033754 | 3300010375 | Bacteria | 5618 |
| 132 | Ga0105239_10100056 | 3300010375 | Bacteria | 3206 |
| 133 | Ga0105239_10819860 | 3300010375 | Bacteria | 1066 |
| 134 | Ga0157373_10343162 | 3300013100 | Bacteria | 1065 |
| 135 | Ga0157371_10000029 | 3300013102 | Bacteria | 252131 |
| 136 | Ga0157371_10000149 | 3300013102 | Bacteria | 101593 |
| 137 | Ga0157370_10000127 | 3300013104 | Bacteria | 90772 |
| 138 | Ga0157370_10157576 | 3300013104 | Bacteria | 2112 |
| 139 | Ga0157370_10494962 | 3300013104 | Bacteria | 1123 |
| 140 | Ga0157369_10097084 | 3300013105 | Unclassified | 3143 |
| 141 | Ga0157369_10979721 | 3300013105 | Bacteria | 866 |
| 142 | Ga0157374_10413154 | 3300013296 | Bacteria | 1347 |
| 143 | Ga0157378_10107733 | 3300013297 | Bacteria | 2550 |
| 144 | Ga0157378_10377941 | 3300013297 | Bacteria | 1391 |
| 145 | Ga0157372_10021887 | 3300013307 | Bacteria | 6911 |
| 146 | Ga0182008_10010811 | 3300014497 | Bacteria | 4874 |
| 147 | Ga0182008_10081456 | 3300014497 | Unclassified | 1593 |
| 148 | Ga0182008_10282673 | 3300014497 | Bacteria | 864 |
| 149 | Ga0182006_1000066 | 3300015261 | Bacteria | 151095 |
| 150 | Ga0182006_1008015 | 3300015261 | Bacteria | 4800 |
| 151 | Ga0182007_10026530 | 3300015262 | Unclassified | 2006 |
| 152 | Ga0182007_10028669 | 3300015262 | Bacteria | 1911 |
| 153 | Ga0182007_10039739 | 3300015262 | Bacteria | 1573 |
| 154 | Ga0182005_1000045 | 3300015265 | Bacteria | 138175 |
| 155 | Ga0182005_1015093 | 3300015265 | Unclassified | 2156 |
| 156 | Ga0183365_10004 | 3300015684 | Bacteria | 333304 |
| 157 | Ga0163161_10018355 | 3300017792 | Bacteria | 4903 |
| 158 | Ga0163161_10175512 | 3300017792 | Bacteria | 1640 |
| 159 | Ga0163161_10549019 | 3300017792 | Bacteria | 947 |
| 160 | Ga0206355_1722878 | 3300020076 | Bacteria | 793 |
| 161 | Ga0213876_10013112 | 3300021384 | Bacteria | 4404 |
| 162 | Ga0209674_100408 | 3300025226 | Bacteria | 21338 |
| 163 | Ga0209672_105007 | 3300025228 | Bacteria | 2345 |
| 164 | Ga0209147_101509 | 3300025229 | Bacteria | 8174 |
| 165 | Ga0209563_100147 | 3300025230 | Bacteria | 69021 |
| 166 | Ga0209437_101033 | 3300025233 | Bacteria | 9416 |
| 167 | Ga0209437_102846 | 3300025233 | Bacteria | 3247 |
| 168 | Ga0209646_1019045 | 3300025246 | Bacteria | 1001 |
| 169 | Ga0209026_1017308 | 3300025250 | Bacteria | 1155 |
| 170 | Ga0209677_109799 | 3300025253 | Bacteria | 1674 |
| 171 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 172 | Ga0209148_1001708 | 3300025254 | Bacteria | 9684 |
| 173 | Ga0209233_1000052 | 3300025261 | Bacteria | 445813 |
| 174 | Ga0209233_1021386 | 3300025261 | Bacteria | 1676 |
| 175 | Ga0209233_1040117 | 3300025261 | Bacteria | 1021 |
| 176 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 177 | Ga0209455_1000528 | 3300025272 | Bacteria | 26777 |
| 178 | Ga0209455_1005748 | 3300025272 | Bacteria | 3774 |
| 179 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 180 | Ga0209676_1000031 | 3300025292 | Bacteria | 478976 |
| 181 | Ga0209676_1000057 | 3300025292 | Bacteria | 361061 |
| 182 | Ga0209676_1009299 | 3300025292 | Bacteria | 4255 |
| 183 | Ga0209564_1025690 | 3300025295 | Bacteria | 1972 |
| 184 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 185 | Ga0209050_1000135 | 3300025298 | Bacteria | 184020 |
| 186 | Ga0209050_1000522 | 3300025298 | Bacteria | 63985 |
| 187 | Ga0209050_1001148 | 3300025298 | Bacteria | 31730 |
| 188 | Ga0209256_1015077 | 3300025299 | Bacteria | 2728 |
| 189 | Ga0209256_1015450 | 3300025299 | Bacteria | 2669 |
| 190 | Ga0209051_1000720 | 3300025303 | Bacteria | 36140 |
| 191 | Ga0209051_1001452 | 3300025303 | Bacteria | 20096 |
| 192 | Ga0209051_1022249 | 3300025303 | Bacteria | 2673 |
| 193 | Ga0209257_1000050 | 3300025304 | Bacteria | 439325 |
| 194 | Ga0209257_1015126 | 3300025304 | Bacteria | 3243 |
| 195 | Ga0207656_10008808 | 3300025321 | Bacteria | 3731 |
| 196 | Ga0207710_10092745 | 3300025900 | Bacteria | 1416 |
| 197 | Ga0207688_10028488 | 3300025901 | Bacteria | 3072 |
| 198 | Ga0207680_10011782 | 3300025903 | Bacteria | 4431 |
| 199 | Ga0207647_10005180 | 3300025904 | Bacteria | 9593 |
| 200 | Ga0207647_10020030 | 3300025904 | Bacteria | 4491 |
| 201 | Ga0207699_10347450 | 3300025906 | Bacteria | 1046 |
| 202 | Ga0207645_10028085 | 3300025907 | Bacteria | 3633 |
| 203 | Ga0207645_10039222 | 3300025907 | Bacteria | 3035 |
| 204 | Ga0207705_10001210 | 3300025909 | Bacteria | 20932 |
| 205 | Ga0207684_10629550 | 3300025910 | Bacteria | 915 |
| 206 | Ga0207707_10028648 | 3300025912 | Bacteria | 4867 |
| 207 | Ga0207695_10011982 | 3300025913 | Bacteria | 10433 |
| 208 | Ga0207695_10034335 | 3300025913 | Bacteria | 5517 |
| 209 | Ga0207695_10467702 | 3300025913 | Bacteria | 1143 |
| 210 | Ga0207695_10533118 | 3300025913 | Bacteria | 1056 |
| 211 | Ga0207671_10017854 | 3300025914 | Bacteria | 5458 |
| 212 | Ga0207671_10021399 | 3300025914 | Bacteria | 4907 |
| 213 | Ga0207671_10026997 | 3300025914 | Bacteria | 4295 |
| 214 | Ga0207671_10246904 | 3300025914 | Bacteria | 1403 |
| 215 | Ga0207663_10392401 | 3300025916 | Bacteria | 1060 |
| 216 | Ga0207660_10085410 | 3300025917 | Bacteria | 2328 |
| 217 | Ga0207657_10019604 | 3300025919 | Bacteria | 6415 |
| 218 | Ga0207649_10000710 | 3300025920 | Bacteria | 21878 |
| 219 | Ga0207649_10027081 | 3300025920 | Bacteria | 3361 |
| 220 | Ga0207649_10097031 | 3300025920 | Bacteria | 1943 |
| 221 | Ga0207649_10642154 | 3300025920 | Bacteria | 819 |
| 222 | Ga0207652_10172685 | 3300025921 | Bacteria | 1940 |
| 223 | Ga0207681_10157779 | 3300025923 | Bacteria | 1707 |
| 224 | Ga0207694_10004368 | 3300025924 | Bacteria | 11042 |
| 225 | Ga0207694_10018654 | 3300025924 | Bacteria | 5245 |
| 226 | Ga0207694_10072771 | 3300025924 | Bacteria | 2688 |
| 227 | Ga0207694_10084123 | 3300025924 | Bacteria | 2502 |
| 228 | Ga0207694_10288462 | 3300025924 | Bacteria | 1349 |
| 229 | Ga0207694_10487408 | 3300025924 | Bacteria | 1032 |
| 230 | Ga0207650_10234968 | 3300025925 | Bacteria | 1480 |
| 231 | Ga0207687_10000798 | 3300025927 | Bacteria | 21269 |
| 232 | Ga0207706_10105523 | 3300025933 | Bacteria | 2479 |
| 233 | Ga0207706_10169919 | 3300025933 | Bacteria | 1916 |
| 234 | Ga0207709_10000039 | 3300025935 | Bacteria | 260127 |
| 235 | Ga0207669_10000117 | 3300025937 | Bacteria | 39781 |
| 236 | Ga0207669_10000382 | 3300025937 | Bacteria | 19815 |
| 237 | Ga0207711_10578814 | 3300025941 | Bacteria | 1047 |
| 238 | Ga0207661_10002953 | 3300025944 | Bacteria | 11757 |
| 239 | Ga0207679_10947931 | 3300025945 | Bacteria | 788 |
| 240 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 241 | Ga0207667_10003995 | 3300025949 | Bacteria | 18117 |
| 242 | Ga0207667_10033611 | 3300025949 | Bacteria | 5512 |
| 243 | Ga0207651_10360248 | 3300025960 | Bacteria | 1227 |
| 244 | Ga0207668_10000459 | 3300025972 | Bacteria | 25616 |
| 245 | Ga0207668_10101088 | 3300025972 | Bacteria | 2142 |
| 246 | Ga0207668_10744655 | 3300025972 | Bacteria | 864 |
| 247 | Ga0207640_10151241 | 3300025981 | Bacteria | 1705 |
| 248 | Ga0207658_10000539 | 3300025986 | Bacteria | 34304 |
| 249 | Ga0207658_10073092 | 3300025986 | Bacteria | 2602 |
| 250 | Ga0207703_10000847 | 3300026035 | Bacteria | 30021 |
| 251 | Ga0207639_10017056 | 3300026041 | Bacteria | 5146 |
| 252 | Ga0207639_10030241 | 3300026041 | Bacteria | 3971 |
| 253 | Ga0207639_10172214 | 3300026041 | Bacteria | 1834 |
| 254 | Ga0207639_10407957 | 3300026041 | Bacteria | 1225 |
| 255 | Ga0207678_10016640 | 3300026067 | Bacteria | 6460 |
| 256 | Ga0207678_10036071 | 3300026067 | Bacteria | 4304 |
| 257 | Ga0207678_10078493 | 3300026067 | Bacteria | 2828 |
| 258 | Ga0207702_10024157 | 3300026078 | Bacteria | 5042 |
| 259 | Ga0207702_10034995 | 3300026078 | Bacteria | 4200 |
| 260 | Ga0207641_10000079 | 3300026088 | Bacteria | 141110 |
| 261 | Ga0207648_10047537 | 3300026089 | Bacteria | 3761 |
| 262 | Ga0207676_10102002 | 3300026095 | Bacteria | 2381 |
| 263 | Ga0207674_10024940 | 3300026116 | Bacteria | 6382 |
| 264 | Ga0207674_10034505 | 3300026116 | Bacteria | 5287 |
| 265 | Ga0207683_10000496 | 3300026121 | Bacteria | 36404 |
| 266 | Ga0207683_10021185 | 3300026121 | Bacteria | 5562 |
| 267 | Ga0207698_10004357 | 3300026142 | Bacteria | 8617 |
| 268 | Ga0207698_10080544 | 3300026142 | Bacteria | 2624 |
| 269 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 270 | Ga0209179_1014034 | 3300027512 | Bacteria | 1465 |
| 271 | Ga0209813_10000193 | 3300027866 | Bacteria | 19061 |
| 272 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 273 | Ga0268266_10098802 | 3300028379 | Bacteria | 2569 |
| 274 | Ga0268266_10144375 | 3300028379 | Bacteria | 2138 |
| 275 | Ga0268266_10312702 | 3300028379 | Bacteria | 1468 |
| 276 | Ga0268266_10393901 | 3300028379 | Bacteria | 1308 |
| 277 | Ga0268265_10000441 | 3300028380 | Bacteria | 43786 |
| 278 | Ga0268264_10000055 | 3300028381 | Bacteria | 314947 |
| 279 | Ga0268264_10022045 | 3300028381 | Bacteria | 5198 |
| 280 | Ga0268264_11507938 | 3300028381 | Bacteria | 683 |
| 281 | Ga0265334_10108569 | 3300028573 | Bacteria | 999 |
| 282 | Ga0307517_10055671 | 3300028786 | Bacteria | 3878 |
| 283 | Ga0307515_10048081 | 3300028794 | Bacteria | 6460 |
| 284 | Ga0307515_10105375 | 3300028794 | Bacteria | 3358 |
| 285 | Ga0307515_10373205 | 3300028794 | Bacteria | 1062 |
| 286 | Ga0265338_10069689 | 3300028800 | Bacteria | 3019 |
| 287 | Ga0307511_10004068 | 3300030521 | Bacteria | 14953 |
| 288 | Ga0265330_10000281 | 3300031235 | Bacteria | 37503 |
| 289 | Ga0265332_10000008 | 3300031238 | Bacteria | 301609 |
| 290 | Ga0265320_10001142 | 3300031240 | Bacteria | 19529 |
| 291 | Ga0265320_10025201 | 3300031240 | Bacteria | 3131 |
| 292 | Ga0265325_10002464 | 3300031241 | Bacteria | 12475 |
| 293 | Ga0265325_10003681 | 3300031241 | Bacteria | 9926 |
| 294 | Ga0265325_10014671 | 3300031241 | Bacteria | 4421 |
| 295 | Ga0265340_10014774 | 3300031247 | Bacteria | 4070 |
| 296 | Ga0265340_10026996 | 3300031247 | Bacteria | 2897 |
| 297 | Ga0265340_10223790 | 3300031247 | Bacteria | 843 |
| 298 | Ga0265339_10013193 | 3300031249 | Bacteria | 5012 |
| 299 | Ga0265331_10009489 | 3300031250 | Bacteria | 5460 |
| 300 | Ga0265327_10000039 | 3300031251 | Bacteria | 292334 |
| 301 | Ga0265327_10042551 | 3300031251 | Bacteria | 2437 |
| 302 | Ga0265316_10043352 | 3300031344 | Bacteria | 3587 |
| 303 | Ga0307513_10024144 | 3300031456 | Bacteria | 7079 |
| 304 | Ga0307509_10000034 | 3300031507 | Bacteria | 193380 |
| 305 | Ga0307509_10310343 | 3300031507 | Bacteria | 1320 |
| 306 | Ga0307408_100029072 | 3300031548 | Bacteria | 3826 |
| 307 | Ga0265313_10075898 | 3300031595 | Bacteria | 1537 |
| 308 | Ga0307508_10000317 | 3300031616 | Bacteria | 58176 |
| 309 | Ga0307514_10001251 | 3300031649 | Bacteria | 33354 |
| 310 | Ga0265314_10000065 | 3300031711 | Bacteria | 158383 |
| 311 | Ga0265314_10087721 | 3300031711 | Bacteria | 2034 |
| 312 | Ga0265342_10099855 | 3300031712 | Bacteria | 1655 |
| 313 | Ga0307516_10000001 | 3300031730 | Bacteria | 510338 |
| 314 | Ga0307516_10000405 | 3300031730 | Bacteria | 56495 |
| 315 | Ga0307405_10204646 | 3300031731 | Bacteria | 1436 |
| 316 | Ga0307413_10085428 | 3300031824 | Bacteria | 2037 |
| 317 | Ga0307413_10754999 | 3300031824 | Bacteria | 813 |
| 318 | Ga0307412_10083948 | 3300031911 | Bacteria | 2210 |
| 319 | Ga0307409_100288371 | 3300031995 | Bacteria | 1521 |
| 320 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 321 | Ga0373935_0015118 | 3300035692 | Bacteria | 4661 |
| 322 | Ga0373937_0018626 | 3300036401 | Bacteria | 6203 |
| 323 | Ga0310109_017351 | 3300036534 | Bacteria | 973 |
| 324 | Ga0373925_0690309 | 3300037068 | Bacteria | 842 |
| 325 | Ga0395899_0211793 | 3300037312 | Bacteria | 1346 |
| 326 | Ga0395900_0013472 | 3300037418 | Bacteria | 8355 |
| 327 | Ga0395900_0144077 | 3300037418 | Bacteria | 2438 |
| 328 | Ga0395900_0625948 | 3300037418 | Bacteria | 1015 |
| 329 | Ga0395901_0085564 | 3300038443 | Bacteria | 3296 |
| 330 | Ga0395901_0221211 | 3300038443 | Bacteria | 1979 |
| 331 | Ga0395901_1170714 | 3300038443 | Bacteria | 736 |
| 332 | Ga0237819_01183 | 3300038705 | Bacteria | 7350 |
| 333 | Ga0237816_00202 | 3300039145 | Bacteria | 4847 |
| 334 | Ga0436365_0604521 | 3300039437 | Bacteria | 1010 |
| 335 | Ga0436365_0743078 | 3300039437 | Bacteria | 30672 |
| 336 | Ga0436365_1106902 | 3300039437 | Bacteria | 1086 |
| 337 | Ga0436362_0543628 | 3300039453 | Bacteria | 2137 |
| 338 | Ga0439461_0028876 | 3300041410 | Bacteria | 1145 |
| 339 | Ga0451795_0975754 | 3300041456 | Bacteria | 802 |
| 340 | Ga0451795_1434403 | 3300041456 | Bacteria | 1124 |
| 341 | Ga0451800_1633068 | 3300041459 | Bacteria | 1017 |
| 342 | Ga0451804_1057260 | 3300041463 | Bacteria | 657 |
| 343 | Ga0439443_014595 | 3300042003 | Bacteria | 1185 |
| 344 | Ga0450911_000005 | 3300042115 | Bacteria | 233469 |
| 345 | Ga0450902_014459 | 3300042137 | Bacteria | 1277 |
| 346 | Ga0439446_0046748 | 3300042156 | Bacteria | 1286 |
| 347 | Ga0450908_000048 | 3300042184 | Bacteria | 24178 |
| 348 | Ga0453684_0622467 | 3300044712 | Bacteria | 1181 |
| 349 | Ga0466959_0012635 | 3300045049 | Bacteria | 6107 |
| 350 | Ga0466967_1002745 | 3300045976 | Bacteria | 831 |
| 351 | Ga0495617_000024 | 3300046452 | Bacteria | 174402 |
| 352 | Ga0495617_000296 | 3300046452 | Bacteria | 28300 |
| 353 | Ga0495617_024660 | 3300046452 | Bacteria | 2029 |
| 354 | Ga0495617_140271 | 3300046452 | Bacteria | 772 |
| 355 | Ga0495617_144857 | 3300046452 | Bacteria | 757 |
| 356 | Ga0495627_000478 | 3300046453 | Bacteria | 33914 |
| 357 | Ga0495592_0059295 | 3300046454 | Bacteria | 2819 |
| 358 | Ga0495592_0088409 | 3300046454 | Bacteria | 2227 |
| 359 | Ga0495603_0354853 | 3300046455 | Bacteria | 841 |
| 360 | Ga0495590_0018331 | 3300046457 | Bacteria | 2506 |
| 361 | Ga0495590_0029296 | 3300046457 | Bacteria | 1930 |
| 362 | Ga0495629_0000027 | 3300046459 | Bacteria | 129244 |
| 363 | Ga0495629_0000130 | 3300046459 | Bacteria | 65355 |
| 364 | Ga0495629_0000281 | 3300046459 | Bacteria | 44035 |
| 365 | Ga0495629_0041152 | 3300046459 | Bacteria | 3252 |
| 366 | Ga0495638_0000128 | 3300046460 | Bacteria | 123567 |
| 367 | Ga0495638_0000363 | 3300046460 | Bacteria | 56118 |
| 368 | Ga0495638_0006293 | 3300046460 | Bacteria | 8657 |
| 369 | Ga0495638_0006659 | 3300046460 | Bacteria | 8384 |
| 370 | Ga0495638_0057822 | 3300046460 | Bacteria | 2404 |
| 371 | Ga0495638_0078605 | 3300046460 | Bacteria | 2007 |
| 372 | Ga0495638_0275069 | 3300046460 | Bacteria | 917 |
| 373 | Ga0495641_0108463 | 3300046461 | Bacteria | 1239 |
| 374 | Ga0495651_0007550 | 3300046462 | Bacteria | 8318 |
| 375 | Ga0495653_0000449 | 3300046463 | Bacteria | 32095 |
| 376 | Ga0495653_0000885 | 3300046463 | Bacteria | 23146 |
| 377 | Ga0495653_0033105 | 3300046463 | Bacteria | 4097 |
| 378 | Ga0495650_0000226 | 3300046471 | Bacteria | 115930 |
| 379 | Ga0495650_0000470 | 3300046471 | Bacteria | 62114 |
| 380 | Ga0495650_0001371 | 3300046471 | Bacteria | 24045 |
| 381 | Ga0495650_0005382 | 3300046471 | Bacteria | 8328 |
| 382 | Ga0495650_0006744 | 3300046471 | Bacteria | 7102 |
| 383 | Ga0495650_0033401 | 3300046471 | Bacteria | 2290 |
| 384 | Ga0495650_0159613 | 3300046471 | Bacteria | 805 |
| 385 | Ga0495580_0003983 | 3300046472 | Bacteria | 12464 |
| 386 | Ga0495580_0005607 | 3300046472 | Bacteria | 10338 |
| 387 | Ga0495580_0005620 | 3300046472 | Bacteria | 10326 |
| 388 | Ga0495580_0006044 | 3300046472 | Bacteria | 9911 |
| 389 | Ga0495580_0007400 | 3300046472 | Bacteria | 8831 |
| 390 | Ga0495580_0021463 | 3300046472 | Bacteria | 4764 |
| 391 | Ga0495580_0027966 | 3300046472 | Bacteria | 4101 |
| 392 | Ga0495580_0097802 | 3300046472 | Bacteria | 2041 |
| 393 | Ga0495582_0032237 | 3300046473 | Bacteria | 2883 |
| 394 | Ga0495605_0013142 | 3300046474 | Bacteria | 4574 |
| 395 | Ga0495605_0044778 | 3300046474 | Bacteria | 2185 |
| 396 | Ga0495664_0010704 | 3300046477 | Bacteria | 5152 |
| 397 | Ga0495664_0067107 | 3300046477 | Bacteria | 2140 |
| 398 | Ga0495584_0004592 | 3300046491 | Bacteria | 7400 |
| 399 | Ga0495584_0165160 | 3300046491 | Bacteria | 1125 |
| 400 | Ga0495584_0199762 | 3300046491 | Bacteria | 1016 |
| 401 | Ga0495584_0393420 | 3300046491 | Bacteria | 704 |
| 402 | Ga0495585_0000143 | 3300046492 | Bacteria | 78365 |
| 403 | Ga0495585_0000360 | 3300046492 | Bacteria | 44156 |
| 404 | Ga0495585_0003270 | 3300046492 | Bacteria | 11027 |
| 405 | Ga0495585_0032133 | 3300046492 | Bacteria | 2975 |
| 406 | Ga0495585_0064674 | 3300046492 | Bacteria | 2005 |
| 407 | Ga0495585_0174619 | 3300046492 | Bacteria | 1108 |
| 408 | Ga0495596_0104288 | 3300046500 | Bacteria | 1101 |
| 409 | Ga0495596_0180383 | 3300046500 | Bacteria | 821 |
| 410 | Ga0495607_0000083 | 3300046501 | Bacteria | 96690 |
| 411 | Ga0495607_0000460 | 3300046501 | Bacteria | 40825 |
| 412 | Ga0495607_0003621 | 3300046501 | Bacteria | 11730 |
| 413 | Ga0495607_0045245 | 3300046501 | Bacteria | 2590 |
| 414 | Ga0495607_0108152 | 3300046501 | Bacteria | 1478 |
| 415 | Ga0495583_0001366 | 3300046506 | Bacteria | 25162 |
| 416 | Ga0495583_0002817 | 3300046506 | Bacteria | 14221 |
| 417 | Ga0495583_0002869 | 3300046506 | Bacteria | 14011 |
| 418 | Ga0495583_0021304 | 3300046506 | Bacteria | 3338 |
| 419 | Ga0495583_0034073 | 3300046506 | Bacteria | 2443 |
| 420 | Ga0495583_0036880 | 3300046506 | Bacteria | 2321 |
| 421 | Ga0495583_0065054 | 3300046506 | Bacteria | 1616 |
| 422 | Ga0495583_0179260 | 3300046506 | Bacteria | 868 |
| 423 | Ga0495606_0000066 | 3300046507 | Bacteria | 181028 |
| 424 | Ga0495606_0000092 | 3300046507 | Bacteria | 152369 |
| 425 | Ga0495606_0000136 | 3300046507 | Bacteria | 125611 |
| 426 | Ga0495606_0001286 | 3300046507 | Bacteria | 34779 |
| 427 | Ga0495606_0010585 | 3300046507 | Bacteria | 7634 |
| 428 | Ga0495606_0023113 | 3300046507 | Bacteria | 4514 |
| 429 | Ga0495606_0084167 | 3300046507 | Bacteria | 1970 |
| 430 | Ga0495606_0112148 | 3300046507 | Bacteria | 1643 |
| 431 | Ga0495606_0115834 | 3300046507 | Bacteria | 1610 |
| 432 | Ga0495606_0343390 | 3300046507 | Bacteria | 794 |
| 433 | Ga0495610_0000356 | 3300046512 | Bacteria | 47959 |
| 434 | Ga0495610_0005518 | 3300046512 | Bacteria | 8963 |
| 435 | Ga0495610_0214499 | 3300046512 | Bacteria | 780 |
| 436 | Ga0495616_0000003 | 3300046513 | Bacteria | 290178 |
| 437 | Ga0495616_0000018 | 3300046513 | Bacteria | 167281 |
| 438 | Ga0495616_0025623 | 3300046513 | Bacteria | 3148 |
| 439 | Ga0495616_0151260 | 3300046513 | Bacteria | 1050 |
| 440 | Ga0495620_0000102 | 3300046515 | Bacteria | 68028 |
| 441 | Ga0495620_0027224 | 3300046515 | Bacteria | 2678 |
| 442 | Ga0495620_0038233 | 3300046515 | Bacteria | 2131 |
| 443 | Ga0495620_0110997 | 3300046515 | Bacteria | 1087 |
| 444 | Ga0495628_0007163 | 3300046516 | Bacteria | 9658 |
| 445 | Ga0495628_0047361 | 3300046516 | Bacteria | 3411 |
| 446 | Ga0495628_0052696 | 3300046516 | Bacteria | 3213 |
| 447 | Ga0495628_0080520 | 3300046516 | Bacteria | 2531 |
| 448 | Ga0495628_0110409 | 3300046516 | Bacteria | 2116 |
| 449 | Ga0495631_0000022 | 3300046518 | Bacteria | 91377 |
| 450 | Ga0495631_0000267 | 3300046518 | Bacteria | 36464 |
| 451 | Ga0495631_0002903 | 3300046518 | Bacteria | 9494 |
| 452 | Ga0495631_0173186 | 3300046518 | Bacteria | 925 |
| 453 | Ga0495632_0000008 | 3300046519 | Bacteria | 294056 |
| 454 | Ga0495632_0000042 | 3300046519 | Bacteria | 145186 |
| 455 | Ga0495632_0002853 | 3300046519 | Bacteria | 12755 |
| 456 | Ga0495632_0006266 | 3300046519 | Bacteria | 7688 |
| 457 | Ga0495637_0008748 | 3300046520 | Bacteria | 4961 |
| 458 | Ga0495637_0012500 | 3300046520 | Bacteria | 4059 |
| 459 | Ga0495637_0044545 | 3300046520 | Bacteria | 1888 |
| 460 | Ga0495637_0202655 | 3300046520 | Bacteria | 728 |
| 461 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 462 | Ga0495643_0000530 | 3300046522 | Bacteria | 47567 |
| 463 | Ga0495643_0009416 | 3300046522 | Bacteria | 6073 |
| 464 | Ga0495643_0019650 | 3300046522 | Bacteria | 3904 |
| 465 | Ga0495643_0065152 | 3300046522 | Bacteria | 1924 |
| 466 | Ga0495644_0014817 | 3300046523 | Bacteria | 2985 |
| 467 | Ga0495648_0000146 | 3300046524 | Bacteria | 84443 |
| 468 | Ga0495648_0000363 | 3300046524 | Bacteria | 50055 |
| 469 | Ga0495648_0001155 | 3300046524 | Bacteria | 26690 |
| 470 | Ga0495648_0001362 | 3300046524 | Bacteria | 24150 |
| 471 | Ga0495648_0004160 | 3300046524 | Bacteria | 12442 |
| 472 | Ga0495648_0012133 | 3300046524 | Bacteria | 6449 |
| 473 | Ga0495648_0025432 | 3300046524 | Bacteria | 4008 |
| 474 | Ga0495648_0052312 | 3300046524 | Bacteria | 2481 |
| 475 | Ga0495648_0068302 | 3300046524 | Bacteria | 2074 |
| 476 | Ga0495648_0081807 | 3300046524 | Bacteria | 1836 |
| 477 | Ga0495648_0089274 | 3300046524 | Bacteria | 1730 |
| 478 | Ga0495648_0100208 | 3300046524 | Bacteria | 1601 |
| 479 | Ga0495663_0000015 | 3300046525 | Bacteria | 145185 |
| 480 | Ga0495663_0001818 | 3300046525 | Bacteria | 6592 |
| 481 | Ga0495666_0240105 | 3300046526 | Bacteria | 827 |
| 482 | Ga0495642_0002091 | 3300046528 | Bacteria | 8263 |
| 483 | Ga0495642_0054429 | 3300046528 | Bacteria | 1650 |
| 484 | Ga0495665_0043904 | 3300046531 | Bacteria | 2376 |
| 485 | Ga0495665_0229958 | 3300046531 | Bacteria | 957 |
| 486 | Ga0495640_0192125 | 3300046533 | Bacteria | 1297 |
| 487 | Ga0495586_0228330 | 3300046535 | Bacteria | 1059 |
| 488 | Ga0495609_0013558 | 3300046538 | Bacteria | 3847 |
| 489 | Ga0495609_0014939 | 3300046538 | Bacteria | 3642 |
| 490 | Ga0495609_0027977 | 3300046538 | Bacteria | 2574 |
| 491 | Ga0495609_0178062 | 3300046538 | Bacteria | 896 |
| 492 | Ga0495597_0011589 | 3300046542 | Bacteria | 4271 |
| 493 | Ga0495597_0091236 | 3300046542 | Bacteria | 1293 |
| 494 | Ga0495645_0007813 | 3300046543 | Bacteria | 7439 |
| 495 | Ga0495645_0303663 | 3300046543 | Bacteria | 1042 |
| 496 | Ga0495622_0000811 | 3300046557 | Bacteria | 17289 |
| 497 | Ga0495622_0218024 | 3300046557 | Bacteria | 846 |
| 498 | Ga0495633_0000197 | 3300046558 | Bacteria | 76903 |
| 499 | Ga0495633_0000222 | 3300046558 | Bacteria | 70418 |
| 500 | Ga0495633_0000371 | 3300046558 | Bacteria | 48203 |
| 501 | Ga0495633_0000842 | 3300046558 | Bacteria | 27022 |
| 502 | Ga0495633_0067556 | 3300046558 | Bacteria | 1669 |
| 503 | Ga0495633_0131657 | 3300046558 | Bacteria | 1157 |
| 504 | Ga0495633_0249159 | 3300046558 | Bacteria | 811 |
| 505 | Ga0495656_0391587 | 3300046615 | Bacteria | 726 |
| 506 | Ga0495668_0000019 | 3300046616 | Bacteria | 416042 |
| 507 | Ga0495668_0000056 | 3300046616 | Bacteria | 197862 |
| 508 | Ga0495668_0000061 | 3300046616 | Bacteria | 192499 |
| 509 | Ga0495668_0000066 | 3300046616 | Bacteria | 178533 |
| 510 | Ga0495668_0020487 | 3300046616 | Bacteria | 3804 |
| 511 | Ga0495668_0123686 | 3300046616 | Bacteria | 1415 |
| 512 | Ga0495634_0090030 | 3300046642 | Bacteria | 1994 |
| 513 | Ga0495634_0181821 | 3300046642 | Bacteria | 1316 |
| 514 | Ga0495611_0000004 | 3300046648 | Bacteria | 308149 |
| 515 | Ga0495611_0000113 | 3300046648 | Bacteria | 56814 |
| 516 | Ga0495611_0011961 | 3300046648 | Bacteria | 3686 |
| 517 | Ga0495611_0015996 | 3300046648 | Bacteria | 3207 |
| 518 | Ga0495611_0155574 | 3300046648 | Bacteria | 1067 |
| 519 | Ga0495625_0000024 | 3300046660 | Bacteria | 271126 |
| 520 | Ga0495625_0000255 | 3300046660 | Bacteria | 82750 |
| 521 | Ga0495625_0008595 | 3300046660 | Bacteria | 8690 |
| 522 | Ga0495625_0009405 | 3300046660 | Bacteria | 8179 |
| 523 | Ga0495625_0016404 | 3300046660 | Bacteria | 5832 |
| 524 | Ga0495625_0264849 | 3300046660 | Bacteria | 1111 |
| 525 | Ga0495625_0265681 | 3300046660 | Bacteria | 1109 |
| 526 | Ga0495625_0273380 | 3300046660 | Bacteria | 1089 |
| 527 | Ga0495659_0046350 | 3300046664 | Bacteria | 1569 |
| 528 | Ga0495661_0023232 | 3300046665 | Bacteria | 4025 |
| 529 | Ga0495661_0147719 | 3300046665 | Bacteria | 1272 |
| 530 | Ga0495599_0175318 | 3300046678 | Bacteria | 1322 |
| 531 | Ga0495646_0002861 | 3300046680 | Bacteria | 10686 |
| 532 | Ga0495646_0006551 | 3300046680 | Bacteria | 7388 |
| 533 | Ga0495646_0056805 | 3300046680 | Bacteria | 2345 |
| 534 | Ga0495669_0000155 | 3300046684 | Bacteria | 43475 |
| 535 | Ga0495613_0056868 | 3300046689 | Bacteria | 2873 |
| 536 | Ga0495613_0077881 | 3300046689 | Bacteria | 2412 |
| 537 | Ga0495613_0101505 | 3300046689 | Bacteria | 2078 |
| 538 | Ga0495613_0774563 | 3300046689 | Bacteria | 627 |
| 539 | Ga0495624_0004752 | 3300046690 | Bacteria | 9880 |
| 540 | Ga0495624_0005955 | 3300046690 | Bacteria | 8714 |
| 541 | Ga0495624_0006209 | 3300046690 | Bacteria | 8493 |
| 542 | Ga0495624_0022978 | 3300046690 | Bacteria | 4115 |
| 543 | Ga0495670_0001381 | 3300046691 | Bacteria | 11876 |
| 544 | Ga0495670_0002072 | 3300046691 | Bacteria | 9885 |
| 545 | Ga0495670_0040453 | 3300046691 | Bacteria | 2324 |
| 546 | Ga0495670_0364507 | 3300046691 | Bacteria | 778 |
| 547 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 548 | Ga0495671_0001491 | 3300046692 | Bacteria | 15677 |
| 549 | Ga0495671_0061148 | 3300046692 | Bacteria | 1858 |
| 550 | Ga0495671_0065703 | 3300046692 | Bacteria | 1785 |
| 551 | Ga0495671_0193287 | 3300046692 | Bacteria | 988 |
| 552 | Ga0495649_0021687 | 3300046694 | Bacteria | 3598 |
| 553 | Ga0495649_0085604 | 3300046694 | Bacteria | 1682 |
| 554 | Ga0495649_0263956 | 3300046694 | Bacteria | 882 |
| 555 | Ga0495589_0000367 | 3300046794 | Bacteria | 35022 |
| 556 | Ga0495600_0005075 | 3300046809 | Bacteria | 7912 |
| 557 | Ga0495660_0000052 | 3300046810 | Bacteria | 137821 |
| 558 | Ga0495660_0000064 | 3300046810 | Bacteria | 124968 |
| 559 | Ga0495660_0030727 | 3300046810 | Bacteria | 3025 |
| 560 | Ga0495604_0488753 | 3300047317 | Bacteria | 800 |
| 561 | Ga0495674_0001399 | 3300047319 | Bacteria | 23591 |
| 562 | Ga0495674_0001405 | 3300047319 | Bacteria | 23564 |
| 563 | Ga0495674_0005169 | 3300047319 | Bacteria | 12533 |
| 564 | Ga0495674_0192671 | 3300047319 | Bacteria | 1693 |
| 565 | Ga0495672_0001207 | 3300047320 | Bacteria | 26064 |
| 566 | Ga0495672_0025394 | 3300047320 | Bacteria | 3793 |
| 567 | Ga0495672_0078132 | 3300047320 | Bacteria | 1852 |
| 568 | Ga0495672_0162524 | 3300047320 | Bacteria | 1146 |
| 569 | Ga0495676_0053985 | 3300047321 | Bacteria | 3198 |
| 570 | Ga0495676_0054767 | 3300047321 | Bacteria | 3168 |
| 571 | Ga0495680_0315834 | 3300047322 | Bacteria | 1094 |
| 572 | Ga0495683_0006619 | 3300047323 | Bacteria | 6318 |
| 573 | Ga0495683_0012572 | 3300047323 | Bacteria | 4444 |
| 574 | Ga0495687_000077 | 3300047443 | Bacteria | 148889 |
| 575 | Ga0495687_000353 | 3300047443 | Bacteria | 58833 |
| 576 | Ga0495687_112000 | 3300047443 | Bacteria | 1001 |
| 577 | Ga0495675_0374154 | 3300047444 | Bacteria | 834 |
| 578 | Ga0495679_000009 | 3300047446 | Bacteria | 343637 |
| 579 | Ga0495679_000011 | 3300047446 | Bacteria | 324498 |
| 580 | Ga0495679_000102 | 3300047446 | Bacteria | 76337 |
| 581 | Ga0495679_012887 | 3300047446 | Bacteria | 3162 |
| 582 | Ga0495673_0000028 | 3300047469 | Bacteria | 473418 |
| 583 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 584 | Ga0495673_0000101 | 3300047469 | Bacteria | 173409 |
| 585 | Ga0495673_0003573 | 3300047469 | Bacteria | 10216 |
| 586 | Ga0495673_0086782 | 3300047469 | Bacteria | 1285 |
| 587 | Ga0495681_0000032 | 3300047470 | Bacteria | 127415 |
| 588 | Ga0495681_0010146 | 3300047470 | Bacteria | 5727 |
| 589 | Ga0495681_0033770 | 3300047470 | Bacteria | 2557 |
| 590 | Ga0495681_0055878 | 3300047470 | Bacteria | 1839 |
| 591 | Ga0495681_0175854 | 3300047470 | Bacteria | 882 |
| 592 | Ga0495686_0000033 | 3300047472 | Bacteria | 342031 |
| 593 | Ga0495686_0000180 | 3300047472 | Bacteria | 121204 |
| 594 | Ga0495686_0000190 | 3300047472 | Bacteria | 115114 |
| 595 | Ga0495686_0001592 | 3300047472 | Bacteria | 23973 |
| 596 | Ga0495686_0002384 | 3300047472 | Bacteria | 17849 |
| 597 | Ga0495686_0024922 | 3300047472 | Bacteria | 3925 |
| 598 | Ga0495686_0070152 | 3300047472 | Bacteria | 2159 |
| 599 | Ga0495686_0100699 | 3300047472 | Bacteria | 1743 |
| 600 | Ga0495686_0155947 | 3300047472 | Bacteria | 1337 |
| 601 | Ga0495686_0224032 | 3300047472 | Bacteria | 1068 |
| 602 | Ga0495593_0004348 | 3300047673 | Bacteria | 8431 |
| 603 | Ga0495593_0014869 | 3300047673 | Bacteria | 4421 |
| 604 | Ga0495593_0223157 | 3300047673 | Bacteria | 945 |
| 605 | Ga0495593_0373848 | 3300047673 | Bacteria | 712 |
| 606 | Ga0495626_0004650 | 3300048091 | Bacteria | 8338 |
| 607 | Ga0495626_0005244 | 3300048091 | Bacteria | 7667 |
| 608 | Ga0495626_0030318 | 3300048091 | Bacteria | 2609 |
| 609 | Ga0495626_0040568 | 3300048091 | Bacteria | 2198 |
| 610 | Ga0496100_0056714 | 3300048903 | Bacteria | 2564 |
| 611 | Ga0496100_0208709 | 3300048903 | Bacteria | 1427 |
| 612 | Ga0496101_0000999 | 3300048904 | Bacteria | 16755 |
| 613 | Ga0496101_0168706 | 3300048904 | Bacteria | 1681 |
| 614 | Ga0496102_0000163 | 3300048905 | Bacteria | 89673 |
| 615 | Ga0496102_0027920 | 3300048905 | Bacteria | 5042 |
| 616 | Ga0496102_0126223 | 3300048905 | Bacteria | 2392 |
| 617 | Ga0496102_0627485 | 3300048905 | Bacteria | 998 |
| 618 | Ga0496102_0927401 | 3300048905 | Bacteria | 792 |
| 619 | Ga0496103_0000052 | 3300048906 | Bacteria | 149437 |
| 620 | Ga0496103_0205226 | 3300048906 | Bacteria | 1267 |
| 621 | Ga0496104_0008489 | 3300048907 | Bacteria | 9135 |
| 622 | Ga0496105_0001302 | 3300048908 | Bacteria | 17462 |
| 623 | Ga0496105_0002897 | 3300048908 | Bacteria | 12589 |
| 624 | Ga0496106_0474159 | 3300048909 | Bacteria | 1005 |
| 625 | Ga0496107_0175449 | 3300048910 | Bacteria | 1591 |
| 626 | Ga0496108_0203733 | 3300048911 | Bacteria | 1717 |
| 627 | Ga0496109_0083486 | 3300048912 | Bacteria | 2946 |
| 628 | Ga0496109_0206942 | 3300048912 | Bacteria | 1845 |
| 629 | Ga0496110_0058192 | 3300048913 | Bacteria | 3404 |
| 630 | Ga0496110_0145791 | 3300048913 | Bacteria | 2141 |
| 631 | Ga0496110_0245520 | 3300048913 | Bacteria | 1629 |
| 632 | Ga0496111_0002111 | 3300048914 | Bacteria | 11868 |
| 633 | Ga0496111_0016400 | 3300048914 | Bacteria | 5103 |
| 634 | Ga0496112_0000052 | 3300048915 | Bacteria | 81285 |
| 635 | Ga0496112_0304667 | 3300048915 | Bacteria | 1538 |
| 636 | Ga0496113_0028812 | 3300048916 | Bacteria | 3999 |
| 637 | Ga0496113_0885374 | 3300048916 | Bacteria | 707 |
| 638 | Ga0496114_0342325 | 3300048917 | Bacteria | 1322 |
| 639 | Ga0496115_0000078 | 3300048918 | Bacteria | 89817 |
| 640 | Ga0496115_0027713 | 3300048918 | Bacteria | 4434 |
| 641 | Ga0496115_0283942 | 3300048918 | Bacteria | 1359 |
| 642 | Ga0496115_0369101 | 3300048918 | Bacteria | 1168 |
| 643 | Ga0496115_0436424 | 3300048918 | Bacteria | 1059 |
| 644 | Ga0496115_0496133 | 3300048918 | Bacteria | 982 |
| 645 | Ga0496115_0826663 | 3300048918 | Bacteria | 719 |
| 646 | Ga0496116_0015207 | 3300048919 | Bacteria | 6095 |
| 647 | Ga0496116_0081560 | 3300048919 | Bacteria | 2005 |
| 648 | Ga0496116_0088333 | 3300048919 | Bacteria | 1894 |
| 649 | Ga0496117_0000102 | 3300048920 | Bacteria | 189959 |
| 650 | Ga0496117_0000141 | 3300048920 | Bacteria | 158041 |
| 651 | Ga0496117_0012119 | 3300048920 | Bacteria | 7645 |
| 652 | Ga0496117_0109260 | 3300048920 | Bacteria | 1727 |
| 653 | Ga0496117_0207727 | 3300048920 | Bacteria | 1100 |
| 654 | Ga0496118_0000038 | 3300048921 | Bacteria | 315464 |
| 655 | Ga0496118_0000103 | 3300048921 | Bacteria | 158099 |
| 656 | Ga0496118_0000696 | 3300048921 | Bacteria | 54619 |
| 657 | Ga0496118_0005851 | 3300048921 | Bacteria | 13787 |
| 658 | Ga0496118_0060180 | 3300048921 | Bacteria | 2822 |
| 659 | Ga0496118_0188363 | 3300048921 | Bacteria | 1237 |
| 660 | Ga0496118_0287098 | 3300048921 | Bacteria | 912 |
| 661 | Ga0496119_0003348 | 3300048922 | Bacteria | 16702 |
| 662 | Ga0496119_0009712 | 3300048922 | Bacteria | 8194 |
| 663 | Ga0496119_0024539 | 3300048922 | Bacteria | 4238 |
| 664 | Ga0496120_0030390 | 3300048923 | Bacteria | 3284 |
| 665 | Ga0496120_0062358 | 3300048923 | Bacteria | 2077 |
| 666 | Ga0496120_0108714 | 3300048923 | Bacteria | 1452 |
| 667 | Ga0496121_0000156 | 3300048924 | Bacteria | 149376 |
| 668 | Ga0496121_0000208 | 3300048924 | Bacteria | 129753 |
| 669 | Ga0496121_0000782 | 3300048924 | Bacteria | 58365 |
| 670 | Ga0496121_0001227 | 3300048924 | Bacteria | 44616 |
| 671 | Ga0496121_0028584 | 3300048924 | Bacteria | 5187 |
| 672 | Ga0496121_0057869 | 3300048924 | Bacteria | 3209 |
| 673 | Ga0496121_0059804 | 3300048924 | Bacteria | 3139 |
| 674 | Ga0496121_0066519 | 3300048924 | Bacteria | 2926 |
| 675 | Ga0496121_0075697 | 3300048924 | Bacteria | 2688 |
| 676 | Ga0496121_0232510 | 3300048924 | Bacteria | 1290 |
| 677 | Ga0496121_0317860 | 3300048924 | Bacteria | 1049 |
| 678 | Ga0496121_0402299 | 3300048924 | Bacteria | 896 |
| 679 | Ga0496122_0002015 | 3300048925 | Bacteria | 30205 |
| 680 | Ga0496122_0010032 | 3300048925 | Bacteria | 9853 |
| 681 | Ga0496122_0011694 | 3300048925 | Bacteria | 8847 |
| 682 | Ga0496122_0045690 | 3300048925 | Bacteria | 3401 |
| 683 | Ga0496122_0051420 | 3300048925 | Bacteria | 3131 |
| 684 | Ga0496123_0000539 | 3300048926 | Bacteria | 65166 |
| 685 | Ga0496123_0004774 | 3300048926 | Bacteria | 14014 |
| 686 | Ga0496123_0007053 | 3300048926 | Bacteria | 10693 |
| 687 | Ga0496123_0022976 | 3300048926 | Bacteria | 4788 |
| 688 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 689 | Ga0496124_0019294 | 3300048927 | Bacteria | 6351 |
| 690 | Ga0496124_0024928 | 3300048927 | Bacteria | 5427 |
| 691 | Ga0496124_0075331 | 3300048927 | Bacteria | 2788 |
| 692 | Ga0496124_0120736 | 3300048927 | Bacteria | 2095 |
| 693 | Ga0496124_0249998 | 3300048927 | Bacteria | 1312 |
| 694 | Ga0496124_0289547 | 3300048927 | Bacteria | 1189 |
| 695 | Ga0496125_0000238 | 3300048928 | Bacteria | 113252 |
| 696 | Ga0496125_0005247 | 3300048928 | Bacteria | 14519 |
| 697 | Ga0496125_0078684 | 3300048928 | Bacteria | 2533 |
| 698 | Ga0496125_0145693 | 3300048928 | Bacteria | 1637 |
| 699 | Ga0496125_0480177 | 3300048928 | Bacteria | 704 |
| 700 | Ga0496126_0000155 | 3300048929 | Bacteria | 158816 |
| 701 | Ga0496126_0000817 | 3300048929 | Bacteria | 55573 |
| 702 | Ga0496126_0054808 | 3300048929 | Bacteria | 3609 |
| 703 | Ga0496126_0084486 | 3300048929 | Bacteria | 2800 |
| 704 | Ga0496126_0094153 | 3300048929 | Bacteria | 2629 |
| 705 | Ga0496126_0285009 | 3300048929 | Bacteria | 1367 |
| 706 | Ga0495678_000067 | 3300049459 | Bacteria | 132540 |
| 707 | Ga0495678_001527 | 3300049459 | Bacteria | 17887 |
| 708 | Ga0495678_030533 | 3300049459 | Bacteria | 2254 |
| 709 | Ga0495678_035460 | 3300049459 | Bacteria | 2045 |
| 710 | Ga0495678_053007 | 3300049459 | Bacteria | 1559 |
| 711 | Ga0495682_0009921 | 3300049460 | Bacteria | 3704 |
| 712 | Ga0495682_0039341 | 3300049460 | Bacteria | 1736 |
| 713 | Ga0495682_0102406 | 3300049460 | Bacteria | 1027 |
| 714 | Ga0501335_001954 | 3300049551 | Bacteria | 1637 |
| 715 | Ga0501033_0361177 | 3300049570 | Bacteria | 1016 |
| 716 | Ga0501034_0008945 | 3300049571 | Bacteria | 10528 |
| 717 | Ga0501034_0043506 | 3300049571 | Bacteria | 4545 |
| 718 | Ga0501034_0074510 | 3300049571 | Bacteria | 3402 |
| 719 | Ga0501034_0278855 | 3300049571 | Bacteria | 1611 |
| 720 | Ga0501034_0667521 | 3300049571 | Bacteria | 940 |
| 721 | Ga0501037_0015498 | 3300049573 | Bacteria | 5609 |
| 722 | Ga0501039_0477245 | 3300049575 | Bacteria | 979 |
| 723 | Ga0501043_0114352 | 3300049579 | Bacteria | 2119 |
| 724 | Ga0501047_0157204 | 3300049581 | Bacteria | 2147 |
| 725 | Ga0501047_0258557 | 3300049581 | Bacteria | 1589 |
| 726 | Ga0501073_0676047 | 3300049589 | Bacteria | 712 |
| 727 | Ga0501249_000057 | 3300049679 | Bacteria | 40985 |
| 728 | Ga0501225_0005256 | 3300049705 | Bacteria | 3812 |
| 729 | Ga0501225_0008501 | 3300049705 | Bacteria | 2944 |
| 730 | Ga0501035_0012166 | 3300049822 | Bacteria | 7958 |
| 731 | Ga0501035_0049902 | 3300049822 | Bacteria | 3751 |
| 732 | Ga0501035_0653511 | 3300049822 | Bacteria | 852 |
| 733 | Ga0501044_0000515 | 3300049823 | Bacteria | 47051 |
| 734 | Ga0501044_0092841 | 3300049823 | Bacteria | 3044 |
| 735 | Ga0501044_0208817 | 3300049823 | Bacteria | 1908 |
| 736 | Ga0501044_0838402 | 3300049823 | Bacteria | 797 |
| 737 | Ga0501204_007499 | 3300049850 | Bacteria | 1229 |
| 738 | nmdc:mga00v17_11948_c1 | 3300050491 | Bacteria | 4781 |
| 739 | nmdc:mga00v17_703184_c1 | 3300050491 | Bacteria | 648 |
| 740 | nmdc:mga0yw44_266370_c1 | 3300050492 | Bacteria | 1143 |
| 741 | nmdc:mga0k408_316310_c1 | 3300050493 | Bacteria | 932 |
| 742 | nmdc:mga0k408_469216_c1 | 3300050493 | Bacteria | 747 |
| 743 | nmdc:mga06z11_27_c1 | 3300050494 | Bacteria | 64010 |
| 744 | nmdc:mga04h51_2074_c1 | 3300050495 | Bacteria | 4707 |
| 745 | nmdc:mga07m45_45066_c1 | 3300050496 | Bacteria | 2476 |
| 746 | nmdc:mga09592_67153_c1 | 3300050508 | Bacteria | 3040 |
| 747 | Ga0495601_0192739 | 3300053077 | Bacteria | 1332 |
| 748 | Ga0495601_0215168 | 3300053077 | Bacteria | 1255 |
| 749 | Ga0500610_0000144 | 3300053079 | Bacteria | 21374 |
| 750 | Ga0495595_0184311 | 3300053084 | Bacteria | 1036 |
| 751 | Ga0495619_0277068 | 3300053085 | Bacteria | 1162 |
| 752 | Ga0500578_0000005 | 3300053086 | Bacteria | 243789 |
| 753 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 754 | Ga0500643_000199 | 3300053087 | Bacteria | 57141 |
| 755 | Ga0500643_000466 | 3300053087 | Bacteria | 29832 |
| 756 | Ga0500643_000848 | 3300053087 | Bacteria | 19517 |
| 757 | Ga0500643_023732 | 3300053087 | Bacteria | 1957 |
| 758 | Ga0500646_0017402 | 3300053090 | Bacteria | 1885 |
| 759 | Ga0500647_0076062 | 3300053091 | Bacteria | 1611 |
| 760 | Ga0500583_0136685 | 3300053092 | Bacteria | 1217 |
| 761 | Ga0500651_0368218 | 3300053093 | Bacteria | 813 |
| 762 | Ga0500641_0000152 | 3300053096 | Bacteria | 25722 |
| 763 | Ga0500641_0020030 | 3300053096 | Bacteria | 2535 |
| 764 | Ga0500555_000594 | 3300053103 | Bacteria | 14125 |
| 765 | Ga0500562_001900 | 3300053108 | Bacteria | 5241 |
| 766 | Ga0500562_036021 | 3300053108 | Bacteria | 1311 |
| 767 | Ga0500562_044569 | 3300053108 | Bacteria | 1181 |
| 768 | Ga0500594_0000079 | 3300053118 | Bacteria | 29754 |
| 769 | Ga0500595_016627 | 3300053119 | Bacteria | 2735 |
| 770 | Ga0500595_147439 | 3300053119 | Bacteria | 658 |
| 771 | Ga0500608_000039 | 3300053122 | Bacteria | 59428 |
| 772 | Ga0500608_000151 | 3300053122 | Bacteria | 28926 |
| 773 | Ga0500608_000351 | 3300053122 | Bacteria | 17772 |
| 774 | Ga0500608_000636 | 3300053122 | Bacteria | 12933 |
| 775 | Ga0500642_0096758 | 3300053130 | Bacteria | 1369 |
| 776 | Ga0500658_0002778 | 3300053134 | Bacteria | 6718 |
| 777 | Ga0500559_0000190 | 3300053136 | Bacteria | 49263 |
| 778 | Ga0500559_0001426 | 3300053136 | Bacteria | 13564 |
| 779 | Ga0500559_0011010 | 3300053136 | Bacteria | 3872 |
| 780 | Ga0500559_0014015 | 3300053136 | Bacteria | 3389 |
| 781 | Ga0500559_0039778 | 3300053136 | Bacteria | 2046 |
| 782 | Ga0500561_0010843 | 3300053137 | Bacteria | 1898 |
| 783 | Ga0500564_018193 | 3300053138 | Bacteria | 3200 |
| 784 | Ga0500568_0007024 | 3300053139 | Bacteria | 5569 |
| 785 | Ga0500568_0015017 | 3300053139 | Bacteria | 3475 |
| 786 | Ga0500573_0000271 | 3300053140 | Bacteria | 21909 |
| 787 | Ga0500573_0061486 | 3300053140 | Bacteria | 2151 |
| 788 | Ga0500573_0181186 | 3300053140 | Bacteria | 1132 |
| 789 | Ga0500588_0184032 | 3300053146 | Bacteria | 769 |
| 790 | Ga0500604_0106670 | 3300053151 | Bacteria | 927 |
| 791 | Ga0500616_0044966 | 3300053153 | Bacteria | 2355 |
| 792 | Ga0500619_000886 | 3300053154 | Bacteria | 5108 |
| 793 | Ga0500622_0001545 | 3300053156 | Bacteria | 18217 |
| 794 | Ga0500622_0002329 | 3300053156 | Bacteria | 13867 |
| 795 | Ga0500622_0008683 | 3300053156 | Bacteria | 5669 |
| 796 | Ga0500622_0024452 | 3300053156 | Bacteria | 3193 |
| 797 | Ga0500622_0055833 | 3300053156 | Bacteria | 2022 |
| 798 | Ga0500624_000053 | 3300053157 | Bacteria | 74086 |
| 799 | Ga0500627_0091911 | 3300053158 | Bacteria | 1358 |
| 800 | Ga0500633_0031530 | 3300053160 | Bacteria | 1714 |
| 801 | Ga0500636_0003608 | 3300053177 | Bacteria | 8724 |
| 802 | Ga0500637_0102461 | 3300053178 | Bacteria | 1660 |
| 803 | Ga0500567_038725 | 3300053723 | Bacteria | 2230 |
| 804 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 805 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 806 | Ga0500645_000566 | 3300053730 | Bacteria | 24221 |
| 807 | Ga0500645_010918 | 3300053730 | Bacteria | 2984 |
| 808 | Ga0500661_046605 | 3300055283 | Bacteria | 771 |
| 809 | Ga0587084_003395 | 3300059477 | Bacteria | 1748 |
| 810 | Ga0587088_004364 | 3300059508 | Bacteria | 1786 |
| 811 | Ga0587090_003778 | 3300059510 | Bacteria | 1786 |
| 812 | Ga0587094_002775 | 3300059513 | Bacteria | 1839 |
| 813 | Ga0587128_005805 | 3300059630 | Bacteria | 1495 |
| 814 | Ga0587069_005954 | 3300059642 | Bacteria | 1444 |
| 815 | Ga0587078_002342 | 3300059646 | Bacteria | 1830 |
| 816 | Ga0587079_005621 | 3300059647 | Bacteria | 1784 |
| 817 | Ga0587102_000884 | 3300059649 | Bacteria | 1902 |
| 818 | Ga0587096_00527 | 3300060247 | Bacteria | 1081 |
| 819 | Ga0587071_006951 | 3300060344 | Bacteria | 1788 |
| 820 | Ga0587071_038487 | 3300060344 | Bacteria | 950 |
| 821 | Ga0587111_0006342 | 3300060346 | Bacteria | 1872 |
| 822 | Ga0587111_0014016 | 3300060346 | Bacteria | 1443 |
| 823 | Ga0587111_0015291 | 3300060346 | Bacteria | 1401 |
| 824 | Ga0587111_0047376 | 3300060346 | Bacteria | 937 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046642 | Ga0495634_0090030 | Ga0495634_0090030_17_562 | 169 |
| 2 | 3300046557 | Ga0495622_0218024 | Ga0495622_0218024_272_823 | 171 |
| 3 | 3300013296 | Ga0157374_10413154 | Ga0157374_104131542 | 174 |
| 4 | 3300041459 | Ga0451800_1633068 | Ga0451800_1633068_434_994 | 174 |
| 5 | 3300046515 | Ga0495620_0110997 | Ga0495620_0110997_492_1052 | 174 |
| 6 | 3300046520 | Ga0495637_0202655 | Ga0495637_0202655_21_581 | 174 |
| 7 | 3300046689 | Ga0495613_0774563 | Ga0495613_0774563_37_597 | 174 |
| 8 | 3300046694 | Ga0495649_0263956 | Ga0495649_0263956_299_859 | 174 |
| 9 | 3300048917 | Ga0496114_0342325 | Ga0496114_0342325_27_587 | 174 |
| 10 | 3300046471 | Ga0495650_0159613 | Ga0495650_0159613_67_726 | 176 |
| 11 | 3300046507 | Ga0495606_0084167 | Ga0495606_0084167_447_1109 | 180 |
| 12 | 3300046524 | Ga0495648_0000363 | Ga0495648_0000363_24819_25481 | 180 |
| 13 | iso_pu_bacteria | 2582581867 | 2585400558 | 182 |
| 14 | iso_pu_bacteria | 2585427590 | 2585819880 | 182 |
| 15 | iso_pu_bacteria | 2511231221 | 2512035364 | 183 |
| 16 | iso_pu_bacteria | 2615840626 | 2616310858 | 183 |
| 17 | iso_pu_bacteria | 2842914999 | 2842918434 | 183 |
| 18 | iso_pu_bacteria | 2928972540 | 2928974838 | 183 |
| 19 | iso_pu_bacteria | 2939631187 | 2939634858 | 183 |
| 20 | iso_pu_bacteria | 2977240413 | 2977242118 | 183 |
| 21 | iso_pu_bacteria | 2989776772 | 2989780942 | 183 |
| 22 | iso_pu_bacteria | 8045864390 | 8045865643 | 183 |
| 23 | iso_pu_bacteria | 2830075706 | 2830078984 | 184 |
| 24 | iso_pu_bacteria | 2885429604 | 2885431589 | 184 |
| 25 | 3300049460 | Ga0495682_0039341 | Ga0495682_0039341_587_1216 | 185 |
| 26 | 3300046454 | Ga0495592_0088409 | Ga0495592_0088409_476_1129 | 186 |
| 27 | 3300053077 | Ga0495601_0215168 | Ga0495601_0215168_346_999 | 186 |
| 28 | 3300001979 | JGI24740J21852_10058307 | JGI24740J21852_100583071 | 187 |
| 29 | 3300001989 | JGI24739J22299_10001701 | JGI24739J22299_100017016 | 187 |
| 30 | 3300001990 | JGI24737J22298_10006194 | JGI24737J22298_100061945 | 187 |
| 31 | 3300002067 | JGI24735J21928_10005514 | JGI24735J21928_100055145 | 187 |
| 32 | 3300002987 | JGI25159J45721_1001111 | JGI25159J45721_10011115 | 187 |
| 33 | 3300003758 | Ga0055532_1008694 | Ga0055532_10086941 | 187 |
| 34 | 3300003759 | Ga0055525_1000203 | Ga0055525_100020327 | 187 |
| 35 | 3300003762 | Ga0055542_1024935 | Ga0055542_10249351 | 187 |
| 36 | 3300003763 | Ga0055529_1008275 | Ga0055529_10082751 | 187 |
| 37 | 3300003781 | Ga0055536_1010073 | Ga0055536_10100733 | 187 |
| 38 | 3300003781 | Ga0055536_1011254 | Ga0055536_10112542 | 187 |
| 39 | 3300003781 | Ga0055536_1011520 | Ga0055536_10115202 | 187 |
| 40 | 3300003791 | Ga0055530_10005838 | Ga0055530_100058384 | 187 |
| 41 | 3300003791 | Ga0055530_10009279 | Ga0055530_100092793 | 187 |
| 42 | 3300003791 | Ga0055530_10017340 | Ga0055530_100173402 | 187 |
| 43 | 3300003794 | Ga0055531_10008976 | Ga0055531_100089762 | 187 |
| 44 | 3300004625 | Ga0055543_1001755 | Ga0055543_10017557 | 187 |
| 45 | 3300005262 | Ga0065165_1000034 | Ga0065165_1000034162 | 187 |
| 46 | 3300005262 | Ga0065165_1000201 | Ga0065165_100020126 | 187 |
| 47 | 3300005289 | Ga0065704_10002132 | Ga0065704_100021326 | 187 |
| 48 | 3300005289 | Ga0065704_10103203 | Ga0065704_101032033 | 187 |
| 49 | 3300005329 | Ga0070683_100003434 | Ga0070683_10000343410 | 187 |
| 50 | 3300005329 | Ga0070683_100129620 | Ga0070683_1001296203 | 187 |
| 51 | 3300005335 | Ga0070666_10012958 | Ga0070666_100129582 | 187 |
| 52 | 3300005336 | Ga0070680_100101269 | Ga0070680_1001012692 | 187 |
| 53 | 3300005344 | Ga0070661_100732717 | Ga0070661_1007327171 | 187 |
| 54 | 3300005347 | Ga0070668_100029073 | Ga0070668_1000290736 | 187 |
| 55 | 3300005347 | Ga0070668_100051660 | Ga0070668_1000516605 | 187 |
| 56 | 3300005353 | Ga0070669_100108785 | Ga0070669_1001087852 | 187 |
| 57 | 3300005353 | Ga0070669_100792781 | Ga0070669_1007927811 | 187 |
| 58 | 3300005355 | Ga0070671_100077914 | Ga0070671_1000779142 | 187 |
| 59 | 3300005367 | Ga0070667_100000641 | Ga0070667_10000064125 | 187 |
| 60 | 3300005367 | Ga0070667_100443740 | Ga0070667_1004437402 | 187 |
| 61 | 3300005455 | Ga0070663_100150234 | Ga0070663_1001502342 | 187 |
| 62 | 3300005457 | Ga0070662_100107064 | Ga0070662_1001070642 | 187 |
| 63 | 3300005458 | Ga0070681_10088271 | Ga0070681_100882713 | 187 |
| 64 | 3300005458 | Ga0070681_10531691 | Ga0070681_105316911 | 187 |
| 65 | 3300005467 | Ga0070706_100167714 | Ga0070706_1001677141 | 187 |
| 66 | 3300005530 | Ga0070679_100171386 | Ga0070679_1001713862 | 187 |
| 67 | 3300005535 | Ga0070684_100019470 | Ga0070684_1000194702 | 187 |
| 68 | 3300005539 | Ga0068853_100059993 | Ga0068853_1000599935 | 187 |
| 69 | 3300005539 | Ga0068853_100486010 | Ga0068853_1004860102 | 187 |
| 70 | 3300005548 | Ga0070665_100070111 | Ga0070665_1000701113 | 187 |
| 71 | 3300005548 | Ga0070665_100136898 | Ga0070665_1001368982 | 187 |
| 72 | 3300005548 | Ga0070665_100386040 | Ga0070665_1003860402 | 187 |
| 73 | 3300005563 | Ga0068855_100000578 | Ga0068855_10000057818 | 187 |
| 74 | 3300005563 | Ga0068855_100006609 | Ga0068855_10000660911 | 187 |
| 75 | 3300005563 | Ga0068855_100212232 | Ga0068855_1002122323 | 187 |
| 76 | 3300005563 | Ga0068855_100284476 | Ga0068855_1002844762 | 187 |
| 77 | 3300005563 | Ga0068855_101195589 | Ga0068855_1011955891 | 187 |
| 78 | 3300005578 | Ga0068854_100065040 | Ga0068854_1000650402 | 187 |
| 79 | 3300005614 | Ga0068856_100005054 | Ga0068856_1000050542 | 187 |
| 80 | 3300005616 | Ga0068852_100028904 | Ga0068852_1000289045 | 187 |
| 81 | 3300005617 | Ga0068859_100442449 | Ga0068859_1004424492 | 187 |
| 82 | 3300005618 | Ga0068864_100043363 | Ga0068864_1000433632 | 187 |
| 83 | 3300005719 | Ga0068861_100241584 | Ga0068861_1002415842 | 187 |
| 84 | 3300005834 | Ga0068851_10006331 | Ga0068851_100063313 | 187 |
| 85 | 3300005841 | Ga0068863_100000047 | Ga0068863_10000004797 | 187 |
| 86 | 3300005843 | Ga0068860_100000083 | Ga0068860_100000083133 | 187 |
| 87 | 3300005843 | Ga0068860_100033785 | Ga0068860_1000337856 | 187 |
| 88 | 3300005844 | Ga0068862_100031630 | Ga0068862_1000316302 | 187 |
| 89 | 3300006038 | Ga0075365_10483784 | Ga0075365_104837841 | 187 |
| 90 | 3300006042 | Ga0075368_10004678 | Ga0075368_100046785 | 187 |
| 91 | 3300006048 | Ga0075363_100074975 | Ga0075363_1000749752 | 187 |
| 92 | 3300006051 | Ga0075364_10062738 | Ga0075364_100627382 | 187 |
| 93 | 3300006178 | Ga0075367_10000432 | Ga0075367_1000043212 | 187 |
| 94 | 3300006186 | Ga0075369_10184509 | Ga0075369_101845091 | 187 |
| 95 | 3300006195 | Ga0075366_10057177 | Ga0075366_100571773 | 187 |
| 96 | 3300006353 | Ga0075370_10024908 | Ga0075370_100249082 | 187 |
| 97 | 3300006358 | Ga0068871_100424830 | Ga0068871_1004248302 | 187 |
| 98 | 3300006847 | Ga0075431_100146462 | Ga0075431_1001464623 | 187 |
| 99 | 3300006880 | Ga0075429_100766057 | Ga0075429_1007660571 | 187 |
| 100 | 3300006931 | Ga0097620_100442457 | Ga0097620_1004424572 | 187 |
| 101 | 3300006946 | Ga0079104_1000233 | Ga0079104_100023362 | 187 |
| 102 | 3300007265 | Ga0099794_10076257 | Ga0099794_100762573 | 187 |
| 103 | 3300009093 | Ga0105240_10001958 | Ga0105240_1000195812 | 187 |
| 104 | 3300009093 | Ga0105240_10008326 | Ga0105240_100083267 | 187 |
| 105 | 3300009093 | Ga0105240_10339483 | Ga0105240_103394831 | 187 |
| 106 | 3300009101 | Ga0105247_10108411 | Ga0105247_101084113 | 187 |
| 107 | 3300009545 | Ga0105237_10042893 | Ga0105237_100428935 | 187 |
| 108 | 3300009545 | Ga0105237_10168162 | Ga0105237_101681622 | 187 |
| 109 | 3300009545 | Ga0105237_10473179 | Ga0105237_104731791 | 187 |
| 110 | 3300009545 | Ga0105237_10497327 | Ga0105237_104973272 | 187 |
| 111 | 3300009551 | Ga0105238_10006093 | Ga0105238_100060937 | 187 |
| 112 | 3300009551 | Ga0105238_10028456 | Ga0105238_100284563 | 187 |
| 113 | 3300009551 | Ga0105238_10128901 | Ga0105238_101289012 | 187 |
| 114 | 3300009551 | Ga0105238_10301227 | Ga0105238_103012271 | 187 |
| 115 | 3300009978 | Ga0105148_100126 | Ga0105148_1001265 | 187 |
| 116 | 3300009993 | Ga0105028_101109 | Ga0105028_1011092 | 187 |
| 117 | 3300010375 | Ga0105239_10033754 | Ga0105239_100337544 | 187 |
| 118 | 3300010375 | Ga0105239_10100056 | Ga0105239_101000563 | 187 |
| 119 | 3300010375 | Ga0105239_10819860 | Ga0105239_108198601 | 187 |
| 120 | 3300013102 | Ga0157371_10000149 | Ga0157371_1000014947 | 187 |
| 121 | 3300013104 | Ga0157370_10000127 | Ga0157370_1000012763 | 187 |
| 122 | 3300013104 | Ga0157370_10157576 | Ga0157370_101575764 | 187 |
| 123 | 3300013104 | Ga0157370_10494962 | Ga0157370_104949622 | 187 |
| 124 | 3300013105 | Ga0157369_10097084 | Ga0157369_100970844 | 187 |
| 125 | 3300013307 | Ga0157372_10021887 | Ga0157372_100218877 | 187 |
| 126 | 3300014497 | Ga0182008_10010811 | Ga0182008_100108112 | 187 |
| 127 | 3300014497 | Ga0182008_10081456 | Ga0182008_100814562 | 187 |
| 128 | 3300014497 | Ga0182008_10282673 | Ga0182008_102826731 | 187 |
| 129 | 3300015261 | Ga0182006_1000066 | Ga0182006_100006620 | 187 |
| 130 | 3300015261 | Ga0182006_1008015 | Ga0182006_10080155 | 187 |
| 131 | 3300015262 | Ga0182007_10026530 | Ga0182007_100265303 | 187 |
| 132 | 3300015262 | Ga0182007_10028669 | Ga0182007_100286692 | 187 |
| 133 | 3300015262 | Ga0182007_10039739 | Ga0182007_100397392 | 187 |
| 134 | 3300015265 | Ga0182005_1000045 | Ga0182005_100004544 | 187 |
| 135 | 3300015265 | Ga0182005_1015093 | Ga0182005_10150933 | 187 |
| 136 | 3300015684 | Ga0183365_10004 | Ga0183365_1000449 | 187 |
| 137 | 3300017792 | Ga0163161_10175512 | Ga0163161_101755122 | 187 |
| 138 | 3300017792 | Ga0163161_10549019 | Ga0163161_105490191 | 187 |
| 139 | 3300020076 | Ga0206355_1722878 | Ga0206355_17228781 | 187 |
| 140 | 3300021384 | Ga0213876_10013112 | Ga0213876_100131122 | 187 |
| 141 | 3300025226 | Ga0209674_100408 | Ga0209674_10040815 | 187 |
| 142 | 3300025228 | Ga0209672_105007 | Ga0209672_1050073 | 187 |
| 143 | 3300025229 | Ga0209147_101509 | Ga0209147_1015098 | 187 |
| 144 | 3300025230 | Ga0209563_100147 | Ga0209563_10014728 | 187 |
| 145 | 3300025233 | Ga0209437_101033 | Ga0209437_1010339 | 187 |
| 146 | 3300025254 | Ga0209148_1001708 | Ga0209148_10017085 | 187 |
| 147 | 3300025261 | Ga0209233_1040117 | Ga0209233_10401172 | 187 |
| 148 | 3300025272 | Ga0209455_1000528 | Ga0209455_100052829 | 187 |
| 149 | 3300025284 | Ga0209130_1000016 | Ga0209130_100001646 | 187 |
| 150 | 3300025292 | Ga0209676_1000031 | Ga0209676_1000031284 | 187 |
| 151 | 3300025292 | Ga0209676_1000057 | Ga0209676_100005790 | 187 |
| 152 | 3300025292 | Ga0209676_1009299 | Ga0209676_10092993 | 187 |
| 153 | 3300025295 | Ga0209564_1025690 | Ga0209564_10256902 | 187 |
| 154 | 3300025298 | Ga0209050_1000135 | Ga0209050_1000135162 | 187 |
| 155 | 3300025298 | Ga0209050_1000522 | Ga0209050_10005224 | 187 |
| 156 | 3300025298 | Ga0209050_1001148 | Ga0209050_10011483 | 187 |
| 157 | 3300025299 | Ga0209256_1015077 | Ga0209256_10150773 | 187 |
| 158 | 3300025299 | Ga0209256_1015450 | Ga0209256_10154504 | 187 |
| 159 | 3300025303 | Ga0209051_1000720 | Ga0209051_100072029 | 187 |
| 160 | 3300025303 | Ga0209051_1001452 | Ga0209051_100145213 | 187 |
| 161 | 3300025303 | Ga0209051_1022249 | Ga0209051_10222493 | 187 |
| 162 | 3300025304 | Ga0209257_1000050 | Ga0209257_1000050146 | 187 |
| 163 | 3300025304 | Ga0209257_1015126 | Ga0209257_10151262 | 187 |
| 164 | 3300025321 | Ga0207656_10008808 | Ga0207656_100088083 | 187 |
| 165 | 3300025900 | Ga0207710_10092745 | Ga0207710_100927451 | 187 |
| 166 | 3300025903 | Ga0207680_10011782 | Ga0207680_100117822 | 187 |
| 167 | 3300025904 | Ga0207647_10005180 | Ga0207647_100051807 | 187 |
| 168 | 3300025906 | Ga0207699_10347450 | Ga0207699_103474501 | 187 |
| 169 | 3300025910 | Ga0207684_10629550 | Ga0207684_106295501 | 187 |
| 170 | 3300025912 | Ga0207707_10028648 | Ga0207707_100286481 | 187 |
| 171 | 3300025913 | Ga0207695_10011982 | Ga0207695_100119826 | 187 |
| 172 | 3300025913 | Ga0207695_10034335 | Ga0207695_100343351 | 187 |
| 173 | 3300025913 | Ga0207695_10467702 | Ga0207695_104677022 | 187 |
| 174 | 3300025914 | Ga0207671_10021399 | Ga0207671_100213994 | 187 |
| 175 | 3300025914 | Ga0207671_10026997 | Ga0207671_100269975 | 187 |
| 176 | 3300025914 | Ga0207671_10246904 | Ga0207671_102469042 | 187 |
| 177 | 3300025917 | Ga0207660_10085410 | Ga0207660_100854102 | 187 |
| 178 | 3300025920 | Ga0207649_10027081 | Ga0207649_100270813 | 187 |
| 179 | 3300025920 | Ga0207649_10097031 | Ga0207649_100970313 | 187 |
| 180 | 3300025920 | Ga0207649_10642154 | Ga0207649_106421541 | 187 |
| 181 | 3300025921 | Ga0207652_10172685 | Ga0207652_101726853 | 187 |
| 182 | 3300025923 | Ga0207681_10157779 | Ga0207681_101577792 | 187 |
| 183 | 3300025924 | Ga0207694_10072771 | Ga0207694_100727713 | 187 |
| 184 | 3300025924 | Ga0207694_10084123 | Ga0207694_100841232 | 187 |
| 185 | 3300025924 | Ga0207694_10288462 | Ga0207694_102884622 | 187 |
| 186 | 3300025924 | Ga0207694_10487408 | Ga0207694_104874081 | 187 |
| 187 | 3300025933 | Ga0207706_10169919 | Ga0207706_101699192 | 187 |
| 188 | 3300025941 | Ga0207711_10578814 | Ga0207711_105788141 | 187 |
| 189 | 3300025944 | Ga0207661_10002953 | Ga0207661_100029539 | 187 |
| 190 | 3300025949 | Ga0207667_10003995 | Ga0207667_1000399513 | 187 |
| 191 | 3300025949 | Ga0207667_10033611 | Ga0207667_100336116 | 187 |
| 192 | 3300025972 | Ga0207668_10000459 | Ga0207668_1000045919 | 187 |
| 193 | 3300025972 | Ga0207668_10101088 | Ga0207668_101010882 | 187 |
| 194 | 3300025981 | Ga0207640_10151241 | Ga0207640_101512411 | 187 |
| 195 | 3300025986 | Ga0207658_10000539 | Ga0207658_1000053911 | 187 |
| 196 | 3300026041 | Ga0207639_10017056 | Ga0207639_100170561 | 187 |
| 197 | 3300026041 | Ga0207639_10030241 | Ga0207639_100302412 | 187 |
| 198 | 3300026067 | Ga0207678_10036071 | Ga0207678_100360714 | 187 |
| 199 | 3300026067 | Ga0207678_10078493 | Ga0207678_100784933 | 187 |
| 200 | 3300026078 | Ga0207702_10024157 | Ga0207702_100241576 | 187 |
| 201 | 3300026088 | Ga0207641_10000079 | Ga0207641_1000007996 | 187 |
| 202 | 3300026095 | Ga0207676_10102002 | Ga0207676_101020022 | 187 |
| 203 | 3300026116 | Ga0207674_10034505 | Ga0207674_100345052 | 187 |
| 204 | 3300026142 | Ga0207698_10080544 | Ga0207698_100805442 | 187 |
| 205 | 3300027111 | Ga0209281_1000076 | Ga0209281_1000076199 | 187 |
| 206 | 3300027512 | Ga0209179_1014034 | Ga0209179_10140342 | 187 |
| 207 | 3300027866 | Ga0209813_10000193 | Ga0209813_100001936 | 187 |
| 208 | 3300028379 | Ga0268266_10098802 | Ga0268266_100988023 | 187 |
| 209 | 3300028379 | Ga0268266_10312702 | Ga0268266_103127022 | 187 |
| 210 | 3300028379 | Ga0268266_10393901 | Ga0268266_103939012 | 187 |
| 211 | 3300028380 | Ga0268265_10000441 | Ga0268265_100004416 | 187 |
| 212 | 3300028381 | Ga0268264_10000055 | Ga0268264_10000055267 | 187 |
| 213 | 3300028381 | Ga0268264_10022045 | Ga0268264_100220452 | 187 |
| 214 | 3300028381 | Ga0268264_11507938 | Ga0268264_115079381 | 187 |
| 215 | 3300028573 | Ga0265334_10108569 | Ga0265334_101085691 | 187 |
| 216 | 3300028794 | Ga0307515_10048081 | Ga0307515_100480813 | 187 |
| 217 | 3300028794 | Ga0307515_10105375 | Ga0307515_101053754 | 187 |
| 218 | 3300028794 | Ga0307515_10373205 | Ga0307515_103732052 | 187 |
| 219 | 3300028800 | Ga0265338_10069689 | Ga0265338_100696894 | 187 |
| 220 | 3300030521 | Ga0307511_10004068 | Ga0307511_100040685 | 187 |
| 221 | 3300031235 | Ga0265330_10000281 | Ga0265330_100002812 | 187 |
| 222 | 3300031238 | Ga0265332_10000008 | Ga0265332_10000008113 | 187 |
| 223 | 3300031240 | Ga0265320_10001142 | Ga0265320_1000114215 | 187 |
| 224 | 3300031240 | Ga0265320_10025201 | Ga0265320_100252012 | 187 |
| 225 | 3300031241 | Ga0265325_10002464 | Ga0265325_100024648 | 187 |
| 226 | 3300031241 | Ga0265325_10003681 | Ga0265325_100036818 | 187 |
| 227 | 3300031241 | Ga0265325_10014671 | Ga0265325_100146712 | 187 |
| 228 | 3300031247 | Ga0265340_10014774 | Ga0265340_100147742 | 187 |
| 229 | 3300031247 | Ga0265340_10026996 | Ga0265340_100269962 | 187 |
| 230 | 3300031247 | Ga0265340_10223790 | Ga0265340_102237901 | 187 |
| 231 | 3300031249 | Ga0265339_10013193 | Ga0265339_100131935 | 187 |
| 232 | 3300031250 | Ga0265331_10009489 | Ga0265331_100094893 | 187 |
| 233 | 3300031251 | Ga0265327_10000039 | Ga0265327_1000003962 | 187 |
| 234 | 3300031251 | Ga0265327_10042551 | Ga0265327_100425512 | 187 |
| 235 | 3300031344 | Ga0265316_10043352 | Ga0265316_100433524 | 187 |
| 236 | 3300031507 | Ga0307509_10000034 | Ga0307509_1000003465 | 187 |
| 237 | 3300031548 | Ga0307408_100029072 | Ga0307408_1000290725 | 187 |
| 238 | 3300031595 | Ga0265313_10075898 | Ga0265313_100758982 | 187 |
| 239 | 3300031649 | Ga0307514_10001251 | Ga0307514_1000125131 | 187 |
| 240 | 3300031711 | Ga0265314_10000065 | Ga0265314_1000006533 | 187 |
| 241 | 3300031711 | Ga0265314_10087721 | Ga0265314_100877212 | 187 |
| 242 | 3300031712 | Ga0265342_10099855 | Ga0265342_100998551 | 187 |
| 243 | 3300031730 | Ga0307516_10000001 | Ga0307516_10000001176 | 187 |
| 244 | 3300031730 | Ga0307516_10000405 | Ga0307516_1000040546 | 187 |
| 245 | 3300031731 | Ga0307405_10204646 | Ga0307405_102046462 | 187 |
| 246 | 3300031824 | Ga0307413_10085428 | Ga0307413_100854282 | 187 |
| 247 | 3300031911 | Ga0307412_10083948 | Ga0307412_100839481 | 187 |
| 248 | 3300031995 | Ga0307409_100288371 | Ga0307409_1002883712 | 187 |
| 249 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005421 | 187 |
| 250 | 3300035692 | Ga0373935_0015118 | Ga0373935_0015118_2520_3206 | 187 |
| 251 | 3300036401 | Ga0373937_0018626 | Ga0373937_0018626_302_988 | 187 |
| 252 | 3300036534 | Ga0310109_017351 | Ga0310109_017351_315_914 | 187 |
| 253 | 3300037068 | Ga0373925_0690309 | Ga0373925_0690309_120_719 | 187 |
| 254 | 3300037312 | Ga0395899_0211793 | Ga0395899_0211793_485_1084 | 187 |
| 255 | 3300037418 | Ga0395900_0013472 | Ga0395900_0013472_1157_1756 | 187 |
| 256 | 3300037418 | Ga0395900_0144077 | Ga0395900_0144077_1138_1737 | 187 |
| 257 | 3300038443 | Ga0395901_0085564 | Ga0395901_0085564_213_812 | 187 |
| 258 | 3300038443 | Ga0395901_1170714 | Ga0395901_1170714_84_683 | 187 |
| 259 | 3300038705 | Ga0237819_01183 | Ga0237819_01183_143_742 | 187 |
| 260 | 3300039145 | Ga0237816_00202 | Ga0237816_00202_3592_4191 | 187 |
| 261 | 3300039437 | Ga0436365_0604521 | Ga0436365_0604521_80_679 | 187 |
| 262 | 3300039437 | Ga0436365_0743078 | Ga0436365_0743078_16138_16737 | 187 |
| 263 | 3300039437 | Ga0436365_1106902 | Ga0436365_1106902_151_750 | 187 |
| 264 | 3300039453 | Ga0436362_0543628 | Ga0436362_0543628_1176_1775 | 187 |
| 265 | 3300041410 | Ga0439461_0028876 | Ga0439461_0028876_69_677 | 187 |
| 266 | 3300041456 | Ga0451795_0975754 | Ga0451795_0975754_103_702 | 187 |
| 267 | 3300042115 | Ga0450911_000005 | Ga0450911_000005_75632_76243 | 187 |
| 268 | 3300042137 | Ga0450902_014459 | Ga0450902_014459_165_776 | 187 |
| 269 | 3300042156 | Ga0439446_0046748 | Ga0439446_0046748_36_635 | 187 |
| 270 | 3300042184 | Ga0450908_000048 | Ga0450908_000048_9488_10087 | 187 |
| 271 | 3300044712 | Ga0453684_0622467 | Ga0453684_0622467_213_815 | 187 |
| 272 | 3300045049 | Ga0466959_0012635 | Ga0466959_0012635_715_1317 | 187 |
| 273 | 3300045976 | Ga0466967_1002745 | Ga0466967_1002745_117_716 | 187 |
| 274 | 3300046452 | Ga0495617_000024 | Ga0495617_000024_110598_111197 | 187 |
| 275 | 3300046452 | Ga0495617_000296 | Ga0495617_000296_17492_18091 | 187 |
| 276 | 3300046452 | Ga0495617_140271 | Ga0495617_140271_38_667 | 187 |
| 277 | 3300046452 | Ga0495617_144857 | Ga0495617_144857_145_744 | 187 |
| 278 | 3300046453 | Ga0495627_000478 | Ga0495627_000478_134_733 | 187 |
| 279 | 3300046454 | Ga0495592_0059295 | Ga0495592_0059295_1993_2679 | 187 |
| 280 | 3300046455 | Ga0495603_0354853 | Ga0495603_0354853_150_749 | 187 |
| 281 | 3300046457 | Ga0495590_0018331 | Ga0495590_0018331_1233_1832 | 187 |
| 282 | 3300046457 | Ga0495590_0029296 | Ga0495590_0029296_746_1345 | 187 |
| 283 | 3300046459 | Ga0495629_0000027 | Ga0495629_0000027_42541_43140 | 187 |
| 284 | 3300046459 | Ga0495629_0000130 | Ga0495629_0000130_2552_3151 | 187 |
| 285 | 3300046459 | Ga0495629_0000281 | Ga0495629_0000281_18709_19308 | 187 |
| 286 | 3300046460 | Ga0495638_0000363 | Ga0495638_0000363_49958_50557 | 187 |
| 287 | 3300046460 | Ga0495638_0006293 | Ga0495638_0006293_4715_5314 | 187 |
| 288 | 3300046460 | Ga0495638_0006659 | Ga0495638_0006659_1732_2331 | 187 |
| 289 | 3300046460 | Ga0495638_0057822 | Ga0495638_0057822_1277_1876 | 187 |
| 290 | 3300046460 | Ga0495638_0078605 | Ga0495638_0078605_86_685 | 187 |
| 291 | 3300046460 | Ga0495638_0275069 | Ga0495638_0275069_264_863 | 187 |
| 292 | 3300046461 | Ga0495641_0108463 | Ga0495641_0108463_71_670 | 187 |
| 293 | 3300046462 | Ga0495651_0007550 | Ga0495651_0007550_3417_4103 | 187 |
| 294 | 3300046463 | Ga0495653_0000449 | Ga0495653_0000449_18681_19280 | 187 |
| 295 | 3300046463 | Ga0495653_0000885 | Ga0495653_0000885_2548_3147 | 187 |
| 296 | 3300046463 | Ga0495653_0033105 | Ga0495653_0033105_777_1376 | 187 |
| 297 | 3300046471 | Ga0495650_0000226 | Ga0495650_0000226_12409_13008 | 187 |
| 298 | 3300046471 | Ga0495650_0001371 | Ga0495650_0001371_7201_7800 | 187 |
| 299 | 3300046471 | Ga0495650_0005382 | Ga0495650_0005382_606_1205 | 187 |
| 300 | 3300046471 | Ga0495650_0006744 | Ga0495650_0006744_2578_3177 | 187 |
| 301 | 3300046471 | Ga0495650_0033401 | Ga0495650_0033401_1407_2006 | 187 |
| 302 | 3300046472 | Ga0495580_0003983 | Ga0495580_0003983_4762_5361 | 187 |
| 303 | 3300046472 | Ga0495580_0005607 | Ga0495580_0005607_9397_9996 | 187 |
| 304 | 3300046472 | Ga0495580_0005620 | Ga0495580_0005620_7463_8062 | 187 |
| 305 | 3300046472 | Ga0495580_0006044 | Ga0495580_0006044_4764_5363 | 187 |
| 306 | 3300046472 | Ga0495580_0007400 | Ga0495580_0007400_1718_2317 | 187 |
| 307 | 3300046472 | Ga0495580_0021463 | Ga0495580_0021463_1691_2290 | 187 |
| 308 | 3300046472 | Ga0495580_0027966 | Ga0495580_0027966_1812_2411 | 187 |
| 309 | 3300046472 | Ga0495580_0097802 | Ga0495580_0097802_605_1204 | 187 |
| 310 | 3300046473 | Ga0495582_0032237 | Ga0495582_0032237_1928_2527 | 187 |
| 311 | 3300046474 | Ga0495605_0013142 | Ga0495605_0013142_3058_3657 | 187 |
| 312 | 3300046474 | Ga0495605_0044778 | Ga0495605_0044778_709_1308 | 187 |
| 313 | 3300046477 | Ga0495664_0010704 | Ga0495664_0010704_1736_2335 | 187 |
| 314 | 3300046477 | Ga0495664_0067107 | Ga0495664_0067107_910_1509 | 187 |
| 315 | 3300046491 | Ga0495584_0199762 | Ga0495584_0199762_40_639 | 187 |
| 316 | 3300046491 | Ga0495584_0393420 | Ga0495584_0393420_30_629 | 187 |
| 317 | 3300046492 | Ga0495585_0000143 | Ga0495585_0000143_64680_65279 | 187 |
| 318 | 3300046492 | Ga0495585_0000360 | Ga0495585_0000360_20939_21538 | 187 |
| 319 | 3300046492 | Ga0495585_0032133 | Ga0495585_0032133_1389_1988 | 187 |
| 320 | 3300046500 | Ga0495596_0104288 | Ga0495596_0104288_368_967 | 187 |
| 321 | 3300046501 | Ga0495607_0000083 | Ga0495607_0000083_89706_90305 | 187 |
| 322 | 3300046501 | Ga0495607_0000460 | Ga0495607_0000460_18511_19110 | 187 |
| 323 | 3300046501 | Ga0495607_0003621 | Ga0495607_0003621_9318_9917 | 187 |
| 324 | 3300046501 | Ga0495607_0045245 | Ga0495607_0045245_470_1069 | 187 |
| 325 | 3300046501 | Ga0495607_0108152 | Ga0495607_0108152_747_1346 | 187 |
| 326 | 3300046506 | Ga0495583_0002869 | Ga0495583_0002869_3539_4138 | 187 |
| 327 | 3300046506 | Ga0495583_0021304 | Ga0495583_0021304_2350_2949 | 187 |
| 328 | 3300046506 | Ga0495583_0036880 | Ga0495583_0036880_1330_1929 | 187 |
| 329 | 3300046506 | Ga0495583_0065054 | Ga0495583_0065054_11_610 | 187 |
| 330 | 3300046506 | Ga0495583_0179260 | Ga0495583_0179260_116_715 | 187 |
| 331 | 3300046507 | Ga0495606_0000066 | Ga0495606_0000066_22369_22968 | 187 |
| 332 | 3300046507 | Ga0495606_0000136 | Ga0495606_0000136_77929_78528 | 187 |
| 333 | 3300046507 | Ga0495606_0001286 | Ga0495606_0001286_22645_23244 | 187 |
| 334 | 3300046507 | Ga0495606_0010585 | Ga0495606_0010585_1716_2315 | 187 |
| 335 | 3300046507 | Ga0495606_0023113 | Ga0495606_0023113_174_773 | 187 |
| 336 | 3300046507 | Ga0495606_0112148 | Ga0495606_0112148_971_1570 | 187 |
| 337 | 3300046507 | Ga0495606_0115834 | Ga0495606_0115834_462_1061 | 187 |
| 338 | 3300046512 | Ga0495610_0000356 | Ga0495610_0000356_26362_27012 | 187 |
| 339 | 3300046512 | Ga0495610_0005518 | Ga0495610_0005518_5364_5963 | 187 |
| 340 | 3300046512 | Ga0495610_0214499 | Ga0495610_0214499_60_659 | 187 |
| 341 | 3300046513 | Ga0495616_0000003 | Ga0495616_0000003_103512_104111 | 187 |
| 342 | 3300046513 | Ga0495616_0000018 | Ga0495616_0000018_146980_147579 | 187 |
| 343 | 3300046513 | Ga0495616_0025623 | Ga0495616_0025623_1755_2354 | 187 |
| 344 | 3300046513 | Ga0495616_0151260 | Ga0495616_0151260_162_761 | 187 |
| 345 | 3300046515 | Ga0495620_0000102 | Ga0495620_0000102_45739_46338 | 187 |
| 346 | 3300046515 | Ga0495620_0027224 | Ga0495620_0027224_166_765 | 187 |
| 347 | 3300046515 | Ga0495620_0038233 | Ga0495620_0038233_1329_1928 | 187 |
| 348 | 3300046516 | Ga0495628_0007163 | Ga0495628_0007163_5482_6081 | 187 |
| 349 | 3300046516 | Ga0495628_0047361 | Ga0495628_0047361_930_1529 | 187 |
| 350 | 3300046516 | Ga0495628_0052696 | Ga0495628_0052696_255_854 | 187 |
| 351 | 3300046516 | Ga0495628_0080520 | Ga0495628_0080520_98_784 | 187 |
| 352 | 3300046516 | Ga0495628_0110409 | Ga0495628_0110409_893_1492 | 187 |
| 353 | 3300046518 | Ga0495631_0000022 | Ga0495631_0000022_13098_13697 | 187 |
| 354 | 3300046518 | Ga0495631_0000267 | Ga0495631_0000267_7040_7639 | 187 |
| 355 | 3300046518 | Ga0495631_0002903 | Ga0495631_0002903_6826_7425 | 187 |
| 356 | 3300046518 | Ga0495631_0173186 | Ga0495631_0173186_127_726 | 187 |
| 357 | 3300046519 | Ga0495632_0000008 | Ga0495632_0000008_29219_29818 | 187 |
| 358 | 3300046519 | Ga0495632_0000042 | Ga0495632_0000042_68033_68632 | 187 |
| 359 | 3300046519 | Ga0495632_0002853 | Ga0495632_0002853_5720_6319 | 187 |
| 360 | 3300046519 | Ga0495632_0006266 | Ga0495632_0006266_6773_7372 | 187 |
| 361 | 3300046520 | Ga0495637_0008748 | Ga0495637_0008748_4351_4950 | 187 |
| 362 | 3300046520 | Ga0495637_0012500 | Ga0495637_0012500_3343_3993 | 187 |
| 363 | 3300046520 | Ga0495637_0044545 | Ga0495637_0044545_781_1380 | 187 |
| 364 | 3300046522 | Ga0495643_0000005 | Ga0495643_0000005_374504_375103 | 187 |
| 365 | 3300046522 | Ga0495643_0065152 | Ga0495643_0065152_973_1572 | 187 |
| 366 | 3300046523 | Ga0495644_0014817 | Ga0495644_0014817_1113_1712 | 187 |
| 367 | 3300046524 | Ga0495648_0001155 | Ga0495648_0001155_13351_13950 | 187 |
| 368 | 3300046524 | Ga0495648_0001362 | Ga0495648_0001362_1833_2432 | 187 |
| 369 | 3300046524 | Ga0495648_0004160 | Ga0495648_0004160_5445_6044 | 187 |
| 370 | 3300046524 | Ga0495648_0012133 | Ga0495648_0012133_2602_3201 | 187 |
| 371 | 3300046524 | Ga0495648_0052312 | Ga0495648_0052312_1591_2190 | 187 |
| 372 | 3300046524 | Ga0495648_0068302 | Ga0495648_0068302_1081_1680 | 187 |
| 373 | 3300046524 | Ga0495648_0081807 | Ga0495648_0081807_1160_1759 | 187 |
| 374 | 3300046524 | Ga0495648_0089274 | Ga0495648_0089274_56_694 | 187 |
| 375 | 3300046524 | Ga0495648_0100208 | Ga0495648_0100208_29_628 | 187 |
| 376 | 3300046525 | Ga0495663_0000015 | Ga0495663_0000015_76554_77153 | 187 |
| 377 | 3300046526 | Ga0495666_0240105 | Ga0495666_0240105_40_639 | 187 |
| 378 | 3300046528 | Ga0495642_0054429 | Ga0495642_0054429_261_860 | 187 |
| 379 | 3300046531 | Ga0495665_0043904 | Ga0495665_0043904_1510_2109 | 187 |
| 380 | 3300046531 | Ga0495665_0229958 | Ga0495665_0229958_306_905 | 187 |
| 381 | 3300046533 | Ga0495640_0192125 | Ga0495640_0192125_289_888 | 187 |
| 382 | 3300046535 | Ga0495586_0228330 | Ga0495586_0228330_276_875 | 187 |
| 383 | 3300046538 | Ga0495609_0013558 | Ga0495609_0013558_310_948 | 187 |
| 384 | 3300046538 | Ga0495609_0014939 | Ga0495609_0014939_1131_1730 | 187 |
| 385 | 3300046538 | Ga0495609_0027977 | Ga0495609_0027977_1124_1786 | 187 |
| 386 | 3300046538 | Ga0495609_0178062 | Ga0495609_0178062_260_859 | 187 |
| 387 | 3300046542 | Ga0495597_0011589 | Ga0495597_0011589_1802_2401 | 187 |
| 388 | 3300046543 | Ga0495645_0007813 | Ga0495645_0007813_4957_5556 | 187 |
| 389 | 3300046543 | Ga0495645_0303663 | Ga0495645_0303663_244_897 | 187 |
| 390 | 3300046558 | Ga0495633_0000197 | Ga0495633_0000197_3062_3661 | 187 |
| 391 | 3300046558 | Ga0495633_0000222 | Ga0495633_0000222_5636_6235 | 187 |
| 392 | 3300046558 | Ga0495633_0000371 | Ga0495633_0000371_8848_9450 | 187 |
| 393 | 3300046558 | Ga0495633_0067556 | Ga0495633_0067556_99_698 | 187 |
| 394 | 3300046558 | Ga0495633_0131657 | Ga0495633_0131657_394_993 | 187 |
| 395 | 3300046558 | Ga0495633_0249159 | Ga0495633_0249159_71_721 | 187 |
| 396 | 3300046615 | Ga0495656_0391587 | Ga0495656_0391587_25_624 | 187 |
| 397 | 3300046616 | Ga0495668_0000019 | Ga0495668_0000019_76017_76616 | 187 |
| 398 | 3300046616 | Ga0495668_0000061 | Ga0495668_0000061_24835_25434 | 187 |
| 399 | 3300046616 | Ga0495668_0000066 | Ga0495668_0000066_128055_128654 | 187 |
| 400 | 3300046616 | Ga0495668_0020487 | Ga0495668_0020487_208_807 | 187 |
| 401 | 3300046616 | Ga0495668_0123686 | Ga0495668_0123686_199_798 | 187 |
| 402 | 3300046642 | Ga0495634_0181821 | Ga0495634_0181821_312_911 | 187 |
| 403 | 3300046648 | Ga0495611_0000004 | Ga0495611_0000004_122122_122721 | 187 |
| 404 | 3300046648 | Ga0495611_0000113 | Ga0495611_0000113_49133_49732 | 187 |
| 405 | 3300046648 | Ga0495611_0155574 | Ga0495611_0155574_442_1041 | 187 |
| 406 | 3300046660 | Ga0495625_0000024 | Ga0495625_0000024_85121_85720 | 187 |
| 407 | 3300046660 | Ga0495625_0016404 | Ga0495625_0016404_1607_2206 | 187 |
| 408 | 3300046660 | Ga0495625_0264849 | Ga0495625_0264849_119_718 | 187 |
| 409 | 3300046660 | Ga0495625_0265681 | Ga0495625_0265681_221_820 | 187 |
| 410 | 3300046664 | Ga0495659_0046350 | Ga0495659_0046350_442_1044 | 187 |
| 411 | 3300046665 | Ga0495661_0023232 | Ga0495661_0023232_290_889 | 187 |
| 412 | 3300046678 | Ga0495599_0175318 | Ga0495599_0175318_237_836 | 187 |
| 413 | 3300046680 | Ga0495646_0002861 | Ga0495646_0002861_3928_4527 | 187 |
| 414 | 3300046680 | Ga0495646_0006551 | Ga0495646_0006551_3065_3664 | 187 |
| 415 | 3300046680 | Ga0495646_0056805 | Ga0495646_0056805_1702_2301 | 187 |
| 416 | 3300046689 | Ga0495613_0056868 | Ga0495613_0056868_766_1365 | 187 |
| 417 | 3300046689 | Ga0495613_0077881 | Ga0495613_0077881_1724_2323 | 187 |
| 418 | 3300046689 | Ga0495613_0101505 | Ga0495613_0101505_658_1257 | 187 |
| 419 | 3300046690 | Ga0495624_0004752 | Ga0495624_0004752_6466_7065 | 187 |
| 420 | 3300046690 | Ga0495624_0005955 | Ga0495624_0005955_5554_6153 | 187 |
| 421 | 3300046690 | Ga0495624_0006209 | Ga0495624_0006209_379_978 | 187 |
| 422 | 3300046690 | Ga0495624_0022978 | Ga0495624_0022978_1854_2453 | 187 |
| 423 | 3300046691 | Ga0495670_0001381 | Ga0495670_0001381_5369_5968 | 187 |
| 424 | 3300046691 | Ga0495670_0002072 | Ga0495670_0002072_8903_9502 | 187 |
| 425 | 3300046691 | Ga0495670_0040453 | Ga0495670_0040453_1342_1941 | 187 |
| 426 | 3300046692 | Ga0495671_0000007 | Ga0495671_0000007_374438_375037 | 187 |
| 427 | 3300046692 | Ga0495671_0001491 | Ga0495671_0001491_5314_5913 | 187 |
| 428 | 3300046692 | Ga0495671_0061148 | Ga0495671_0061148_126_725 | 187 |
| 429 | 3300046692 | Ga0495671_0065703 | Ga0495671_0065703_301_906 | 187 |
| 430 | 3300046694 | Ga0495649_0021687 | Ga0495649_0021687_291_896 | 187 |
| 431 | 3300046694 | Ga0495649_0085604 | Ga0495649_0085604_562_1161 | 187 |
| 432 | 3300046794 | Ga0495589_0000367 | Ga0495589_0000367_30933_31532 | 187 |
| 433 | 3300046810 | Ga0495660_0000052 | Ga0495660_0000052_37714_38313 | 187 |
| 434 | 3300046810 | Ga0495660_0000064 | Ga0495660_0000064_36072_36671 | 187 |
| 435 | 3300047317 | Ga0495604_0488753 | Ga0495604_0488753_123_776 | 187 |
| 436 | 3300047319 | Ga0495674_0001399 | Ga0495674_0001399_17898_18497 | 187 |
| 437 | 3300047319 | Ga0495674_0001405 | Ga0495674_0001405_8515_9114 | 187 |
| 438 | 3300047319 | Ga0495674_0005169 | Ga0495674_0005169_7559_8158 | 187 |
| 439 | 3300047319 | Ga0495674_0192671 | Ga0495674_0192671_169_768 | 187 |
| 440 | 3300047320 | Ga0495672_0001207 | Ga0495672_0001207_4437_5066 | 187 |
| 441 | 3300047320 | Ga0495672_0025394 | Ga0495672_0025394_2591_3190 | 187 |
| 442 | 3300047320 | Ga0495672_0078132 | Ga0495672_0078132_1168_1767 | 187 |
| 443 | 3300047320 | Ga0495672_0162524 | Ga0495672_0162524_344_943 | 187 |
| 444 | 3300047321 | Ga0495676_0053985 | Ga0495676_0053985_969_1568 | 187 |
| 445 | 3300047321 | Ga0495676_0054767 | Ga0495676_0054767_764_1363 | 187 |
| 446 | 3300047322 | Ga0495680_0315834 | Ga0495680_0315834_205_891 | 187 |
| 447 | 3300047323 | Ga0495683_0006619 | Ga0495683_0006619_853_1452 | 187 |
| 448 | 3300047443 | Ga0495687_112000 | Ga0495687_112000_11_691 | 187 |
| 449 | 3300047444 | Ga0495675_0374154 | Ga0495675_0374154_91_690 | 187 |
| 450 | 3300047446 | Ga0495679_000009 | Ga0495679_000009_228080_228679 | 187 |
| 451 | 3300047446 | Ga0495679_000011 | Ga0495679_000011_187240_187839 | 187 |
| 452 | 3300047446 | Ga0495679_000102 | Ga0495679_000102_42409_43008 | 187 |
| 453 | 3300047446 | Ga0495679_012887 | Ga0495679_012887_2528_3127 | 187 |
| 454 | 3300047469 | Ga0495673_0000028 | Ga0495673_0000028_252979_253578 | 187 |
| 455 | 3300047469 | Ga0495673_0000036 | Ga0495673_0000036_151729_152328 | 187 |
| 456 | 3300047469 | Ga0495673_0000101 | Ga0495673_0000101_7149_7748 | 187 |
| 457 | 3300047469 | Ga0495673_0003573 | Ga0495673_0003573_7515_8114 | 187 |
| 458 | 3300047469 | Ga0495673_0086782 | Ga0495673_0086782_45_644 | 187 |
| 459 | 3300047470 | Ga0495681_0000032 | Ga0495681_0000032_27161_27811 | 187 |
| 460 | 3300047470 | Ga0495681_0033770 | Ga0495681_0033770_207_806 | 187 |
| 461 | 3300047470 | Ga0495681_0055878 | Ga0495681_0055878_1033_1632 | 187 |
| 462 | 3300047470 | Ga0495681_0175854 | Ga0495681_0175854_209_808 | 187 |
| 463 | 3300047472 | Ga0495686_0000033 | Ga0495686_0000033_243227_243826 | 187 |
| 464 | 3300047472 | Ga0495686_0000180 | Ga0495686_0000180_10171_10770 | 187 |
| 465 | 3300047472 | Ga0495686_0000190 | Ga0495686_0000190_52078_52677 | 187 |
| 466 | 3300047472 | Ga0495686_0001592 | Ga0495686_0001592_69_668 | 187 |
| 467 | 3300047472 | Ga0495686_0002384 | Ga0495686_0002384_8033_8632 | 187 |
| 468 | 3300047472 | Ga0495686_0024922 | Ga0495686_0024922_1957_2556 | 187 |
| 469 | 3300047472 | Ga0495686_0070152 | Ga0495686_0070152_582_1181 | 187 |
| 470 | 3300047472 | Ga0495686_0155947 | Ga0495686_0155947_696_1295 | 187 |
| 471 | 3300047472 | Ga0495686_0224032 | Ga0495686_0224032_193_792 | 187 |
| 472 | 3300047673 | Ga0495593_0004348 | Ga0495593_0004348_4379_4978 | 187 |
| 473 | 3300047673 | Ga0495593_0014869 | Ga0495593_0014869_2552_3151 | 187 |
| 474 | 3300047673 | Ga0495593_0223157 | Ga0495593_0223157_32_631 | 187 |
| 475 | 3300047673 | Ga0495593_0373848 | Ga0495593_0373848_71_670 | 187 |
| 476 | 3300048091 | Ga0495626_0004650 | Ga0495626_0004650_3505_4104 | 187 |
| 477 | 3300048091 | Ga0495626_0005244 | Ga0495626_0005244_3863_4462 | 187 |
| 478 | 3300048091 | Ga0495626_0030318 | Ga0495626_0030318_1424_2023 | 187 |
| 479 | 3300048091 | Ga0495626_0040568 | Ga0495626_0040568_979_1578 | 187 |
| 480 | 3300048903 | Ga0496100_0056714 | Ga0496100_0056714_710_1345 | 187 |
| 481 | 3300048903 | Ga0496100_0208709 | Ga0496100_0208709_447_1046 | 187 |
| 482 | 3300048904 | Ga0496101_0000999 | Ga0496101_0000999_9523_10122 | 187 |
| 483 | 3300048904 | Ga0496101_0168706 | Ga0496101_0168706_781_1416 | 187 |
| 484 | 3300048905 | Ga0496102_0027920 | Ga0496102_0027920_2914_3516 | 187 |
| 485 | 3300048905 | Ga0496102_0126223 | Ga0496102_0126223_1062_1661 | 187 |
| 486 | 3300048905 | Ga0496102_0627485 | Ga0496102_0627485_352_951 | 187 |
| 487 | 3300048905 | Ga0496102_0927401 | Ga0496102_0927401_142_741 | 187 |
| 488 | 3300048906 | Ga0496103_0205226 | Ga0496103_0205226_250_852 | 187 |
| 489 | 3300048907 | Ga0496104_0008489 | Ga0496104_0008489_3692_4327 | 187 |
| 490 | 3300048908 | Ga0496105_0002897 | Ga0496105_0002897_4742_5377 | 187 |
| 491 | 3300048909 | Ga0496106_0474159 | Ga0496106_0474159_115_714 | 187 |
| 492 | 3300048911 | Ga0496108_0203733 | Ga0496108_0203733_11_610 | 187 |
| 493 | 3300048912 | Ga0496109_0083486 | Ga0496109_0083486_321_920 | 187 |
| 494 | 3300048913 | Ga0496110_0058192 | Ga0496110_0058192_2669_3268 | 187 |
| 495 | 3300048913 | Ga0496110_0245520 | Ga0496110_0245520_586_1221 | 187 |
| 496 | 3300048914 | Ga0496111_0016400 | Ga0496111_0016400_907_1542 | 187 |
| 497 | 3300048915 | Ga0496112_0000052 | Ga0496112_0000052_64860_65459 | 187 |
| 498 | 3300048915 | Ga0496112_0304667 | Ga0496112_0304667_688_1323 | 187 |
| 499 | 3300048916 | Ga0496113_0885374 | Ga0496113_0885374_24_623 | 187 |
| 500 | 3300048918 | Ga0496115_0027713 | Ga0496115_0027713_843_1559 | 187 |
| 501 | 3300048918 | Ga0496115_0283942 | Ga0496115_0283942_291_890 | 187 |
| 502 | 3300048918 | Ga0496115_0369101 | Ga0496115_0369101_512_1111 | 187 |
| 503 | 3300048918 | Ga0496115_0436424 | Ga0496115_0436424_128_727 | 187 |
| 504 | 3300048918 | Ga0496115_0496133 | Ga0496115_0496133_306_905 | 187 |
| 505 | 3300048918 | Ga0496115_0826663 | Ga0496115_0826663_61_660 | 187 |
| 506 | 3300048919 | Ga0496116_0015207 | Ga0496116_0015207_2486_3088 | 187 |
| 507 | 3300048919 | Ga0496116_0081560 | Ga0496116_0081560_1114_1713 | 187 |
| 508 | 3300048920 | Ga0496117_0000102 | Ga0496117_0000102_162099_162701 | 187 |
| 509 | 3300048920 | Ga0496117_0012119 | Ga0496117_0012119_105_704 | 187 |
| 510 | 3300048920 | Ga0496117_0109260 | Ga0496117_0109260_36_635 | 187 |
| 511 | 3300048920 | Ga0496117_0207727 | Ga0496117_0207727_481_1080 | 187 |
| 512 | 3300048921 | Ga0496118_0000038 | Ga0496118_0000038_152737_153339 | 187 |
| 513 | 3300048921 | Ga0496118_0000696 | Ga0496118_0000696_52829_53428 | 187 |
| 514 | 3300048921 | Ga0496118_0005851 | Ga0496118_0005851_9385_9984 | 187 |
| 515 | 3300048921 | Ga0496118_0060180 | Ga0496118_0060180_1327_1926 | 187 |
| 516 | 3300048921 | Ga0496118_0188363 | Ga0496118_0188363_55_666 | 187 |
| 517 | 3300048921 | Ga0496118_0287098 | Ga0496118_0287098_30_629 | 187 |
| 518 | 3300048922 | Ga0496119_0003348 | Ga0496119_0003348_13149_13751 | 187 |
| 519 | 3300048922 | Ga0496119_0024539 | Ga0496119_0024539_3483_4085 | 187 |
| 520 | 3300048923 | Ga0496120_0030390 | Ga0496120_0030390_2409_3011 | 187 |
| 521 | 3300048923 | Ga0496120_0108714 | Ga0496120_0108714_695_1297 | 187 |
| 522 | 3300048924 | Ga0496121_0000208 | Ga0496121_0000208_57648_58247 | 187 |
| 523 | 3300048924 | Ga0496121_0000782 | Ga0496121_0000782_5071_5670 | 187 |
| 524 | 3300048924 | Ga0496121_0001227 | Ga0496121_0001227_33776_34375 | 187 |
| 525 | 3300048924 | Ga0496121_0028584 | Ga0496121_0028584_1200_1802 | 187 |
| 526 | 3300048924 | Ga0496121_0057869 | Ga0496121_0057869_1200_1802 | 187 |
| 527 | 3300048924 | Ga0496121_0059804 | Ga0496121_0059804_583_1182 | 187 |
| 528 | 3300048924 | Ga0496121_0066519 | Ga0496121_0066519_519_1118 | 187 |
| 529 | 3300048924 | Ga0496121_0075697 | Ga0496121_0075697_1953_2552 | 187 |
| 530 | 3300048924 | Ga0496121_0232510 | Ga0496121_0232510_593_1192 | 187 |
| 531 | 3300048924 | Ga0496121_0317860 | Ga0496121_0317860_104_703 | 187 |
| 532 | 3300048924 | Ga0496121_0402299 | Ga0496121_0402299_258_857 | 187 |
| 533 | 3300048925 | Ga0496122_0010032 | Ga0496122_0010032_4919_5521 | 187 |
| 534 | 3300048925 | Ga0496122_0011694 | Ga0496122_0011694_5432_6031 | 187 |
| 535 | 3300048925 | Ga0496122_0045690 | Ga0496122_0045690_2399_3010 | 187 |
| 536 | 3300048925 | Ga0496122_0051420 | Ga0496122_0051420_781_1380 | 187 |
| 537 | 3300048926 | Ga0496123_0000539 | Ga0496123_0000539_36408_37010 | 187 |
| 538 | 3300048926 | Ga0496123_0004774 | Ga0496123_0004774_10055_10654 | 187 |
| 539 | 3300048926 | Ga0496123_0007053 | Ga0496123_0007053_405_1004 | 187 |
| 540 | 3300048927 | Ga0496124_0019294 | Ga0496124_0019294_4433_5032 | 187 |
| 541 | 3300048927 | Ga0496124_0024928 | Ga0496124_0024928_2017_2616 | 187 |
| 542 | 3300048927 | Ga0496124_0075331 | Ga0496124_0075331_1740_2339 | 187 |
| 543 | 3300048927 | Ga0496124_0120736 | Ga0496124_0120736_1370_1969 | 187 |
| 544 | 3300048927 | Ga0496124_0249998 | Ga0496124_0249998_665_1264 | 187 |
| 545 | 3300048927 | Ga0496124_0289547 | Ga0496124_0289547_136_738 | 187 |
| 546 | 3300048928 | Ga0496125_0005247 | Ga0496125_0005247_11176_11778 | 187 |
| 547 | 3300048928 | Ga0496125_0078684 | Ga0496125_0078684_1477_2076 | 187 |
| 548 | 3300048928 | Ga0496125_0145693 | Ga0496125_0145693_336_935 | 187 |
| 549 | 3300048928 | Ga0496125_0480177 | Ga0496125_0480177_24_623 | 187 |
| 550 | 3300048929 | Ga0496126_0000817 | Ga0496126_0000817_33313_33912 | 187 |
| 551 | 3300048929 | Ga0496126_0054808 | Ga0496126_0054808_312_959 | 187 |
| 552 | 3300048929 | Ga0496126_0084486 | Ga0496126_0084486_1200_1802 | 187 |
| 553 | 3300048929 | Ga0496126_0094153 | Ga0496126_0094153_1858_2460 | 187 |
| 554 | 3300048929 | Ga0496126_0285009 | Ga0496126_0285009_265_876 | 187 |
| 555 | 3300049459 | Ga0495678_000067 | Ga0495678_000067_13644_14243 | 187 |
| 556 | 3300049459 | Ga0495678_001527 | Ga0495678_001527_15128_15727 | 187 |
| 557 | 3300049459 | Ga0495678_030533 | Ga0495678_030533_1511_2161 | 187 |
| 558 | 3300049459 | Ga0495678_035460 | Ga0495678_035460_385_984 | 187 |
| 559 | 3300049459 | Ga0495678_053007 | Ga0495678_053007_561_1160 | 187 |
| 560 | 3300049460 | Ga0495682_0009921 | Ga0495682_0009921_265_864 | 187 |
| 561 | 3300049460 | Ga0495682_0102406 | Ga0495682_0102406_195_794 | 187 |
| 562 | 3300049551 | Ga0501335_001954 | Ga0501335_001954_990_1589 | 187 |
| 563 | 3300049570 | Ga0501033_0361177 | Ga0501033_0361177_159_758 | 187 |
| 564 | 3300049571 | Ga0501034_0008945 | Ga0501034_0008945_4292_4891 | 187 |
| 565 | 3300049571 | Ga0501034_0043506 | Ga0501034_0043506_802_1401 | 187 |
| 566 | 3300049571 | Ga0501034_0074510 | Ga0501034_0074510_779_1411 | 187 |
| 567 | 3300049571 | Ga0501034_0278855 | Ga0501034_0278855_469_1068 | 187 |
| 568 | 3300049571 | Ga0501034_0667521 | Ga0501034_0667521_68_667 | 187 |
| 569 | 3300049573 | Ga0501037_0015498 | Ga0501037_0015498_4361_4993 | 187 |
| 570 | 3300049575 | Ga0501039_0477245 | Ga0501039_0477245_68_667 | 187 |
| 571 | 3300049579 | Ga0501043_0114352 | Ga0501043_0114352_389_1021 | 187 |
| 572 | 3300049581 | Ga0501047_0157204 | Ga0501047_0157204_792_1391 | 187 |
| 573 | 3300049581 | Ga0501047_0258557 | Ga0501047_0258557_265_864 | 187 |
| 574 | 3300049589 | Ga0501073_0676047 | Ga0501073_0676047_72_671 | 187 |
| 575 | 3300049679 | Ga0501249_000057 | Ga0501249_000057_40265_40864 | 187 |
| 576 | 3300049705 | Ga0501225_0005256 | Ga0501225_0005256_2793_3392 | 187 |
| 577 | 3300049705 | Ga0501225_0008501 | Ga0501225_0008501_2043_2642 | 187 |
| 578 | 3300049822 | Ga0501035_0012166 | Ga0501035_0012166_209_808 | 187 |
| 579 | 3300049822 | Ga0501035_0049902 | Ga0501035_0049902_759_1358 | 187 |
| 580 | 3300049822 | Ga0501035_0653511 | Ga0501035_0653511_208_840 | 187 |
| 581 | 3300049823 | Ga0501044_0000515 | Ga0501044_0000515_32554_33153 | 187 |
| 582 | 3300049823 | Ga0501044_0092841 | Ga0501044_0092841_1029_1628 | 187 |
| 583 | 3300049823 | Ga0501044_0208817 | Ga0501044_0208817_1186_1785 | 187 |
| 584 | 3300049850 | Ga0501204_007499 | Ga0501204_007499_608_1207 | 187 |
| 585 | 3300050491 | nmdc:mga00v17_11948_c1 | nmdc:mga00v17_11948_c1_630_1229 | 187 |
| 586 | 3300050492 | nmdc:mga0yw44_266370_c1 | nmdc:mga0yw44_266370_c1_376_975 | 187 |
| 587 | 3300050493 | nmdc:mga0k408_316310_c1 | nmdc:mga0k408_316310_c1_168_767 | 187 |
| 588 | 3300050494 | nmdc:mga06z11_27_c1 | nmdc:mga06z11_27_c1_59933_60532 | 187 |
| 589 | 3300050495 | nmdc:mga04h51_2074_c1 | nmdc:mga04h51_2074_c1_696_1295 | 187 |
| 590 | 3300050496 | nmdc:mga07m45_45066_c1 | nmdc:mga07m45_45066_c1_1315_1914 | 187 |
| 591 | 3300050508 | nmdc:mga09592_67153_c1 | nmdc:mga09592_67153_c1_1733_2332 | 187 |
| 592 | 3300053077 | Ga0495601_0192739 | Ga0495601_0192739_559_1245 | 187 |
| 593 | 3300053084 | Ga0495595_0184311 | Ga0495595_0184311_112_765 | 187 |
| 594 | 3300053085 | Ga0495619_0277068 | Ga0495619_0277068_35_688 | 187 |
| 595 | 3300053086 | Ga0500578_0000005 | Ga0500578_0000005_199155_199754 | 187 |
| 596 | 3300053087 | Ga0500643_000012 | Ga0500643_000012_121896_122495 | 187 |
| 597 | 3300053087 | Ga0500643_000199 | Ga0500643_000199_41039_41638 | 187 |
| 598 | 3300053087 | Ga0500643_000466 | Ga0500643_000466_13190_13789 | 187 |
| 599 | 3300053087 | Ga0500643_000848 | Ga0500643_000848_434_1033 | 187 |
| 600 | 3300053087 | Ga0500643_023732 | Ga0500643_023732_704_1303 | 187 |
| 601 | 3300053090 | Ga0500646_0017402 | Ga0500646_0017402_926_1774 | 187 |
| 602 | 3300053091 | Ga0500647_0076062 | Ga0500647_0076062_1002_1601 | 187 |
| 603 | 3300053096 | Ga0500641_0000152 | Ga0500641_0000152_418_1017 | 187 |
| 604 | 3300053103 | Ga0500555_000594 | Ga0500555_000594_12717_13316 | 187 |
| 605 | 3300053108 | Ga0500562_001900 | Ga0500562_001900_99_698 | 187 |
| 606 | 3300053108 | Ga0500562_036021 | Ga0500562_036021_332_931 | 187 |
| 607 | 3300053108 | Ga0500562_044569 | Ga0500562_044569_520_1119 | 187 |
| 608 | 3300053118 | Ga0500594_0000079 | Ga0500594_0000079_14058_14657 | 187 |
| 609 | 3300053119 | Ga0500595_147439 | Ga0500595_147439_16_615 | 187 |
| 610 | 3300053122 | Ga0500608_000039 | Ga0500608_000039_44487_45086 | 187 |
| 611 | 3300053122 | Ga0500608_000151 | Ga0500608_000151_27354_27953 | 187 |
| 612 | 3300053122 | Ga0500608_000351 | Ga0500608_000351_16906_17505 | 187 |
| 613 | 3300053122 | Ga0500608_000636 | Ga0500608_000636_2367_2966 | 187 |
| 614 | 3300053136 | Ga0500559_0000190 | Ga0500559_0000190_642_1241 | 187 |
| 615 | 3300053136 | Ga0500559_0001426 | Ga0500559_0001426_7377_7976 | 187 |
| 616 | 3300053136 | Ga0500559_0011010 | Ga0500559_0011010_2647_3246 | 187 |
| 617 | 3300053136 | Ga0500559_0014015 | Ga0500559_0014015_2374_2973 | 187 |
| 618 | 3300053137 | Ga0500561_0010843 | Ga0500561_0010843_560_1159 | 187 |
| 619 | 3300053138 | Ga0500564_018193 | Ga0500564_018193_2130_2729 | 187 |
| 620 | 3300053140 | Ga0500573_0061486 | Ga0500573_0061486_1077_1679 | 187 |
| 621 | 3300053140 | Ga0500573_0181186 | Ga0500573_0181186_84_683 | 187 |
| 622 | 3300053146 | Ga0500588_0184032 | Ga0500588_0184032_124_723 | 187 |
| 623 | 3300053151 | Ga0500604_0106670 | Ga0500604_0106670_76_771 | 187 |
| 624 | 3300053153 | Ga0500616_0044966 | Ga0500616_0044966_1383_1982 | 187 |
| 625 | 3300053156 | Ga0500622_0001545 | Ga0500622_0001545_16770_17369 | 187 |
| 626 | 3300053156 | Ga0500622_0002329 | Ga0500622_0002329_6872_7474 | 187 |
| 627 | 3300053156 | Ga0500622_0008683 | Ga0500622_0008683_233_832 | 187 |
| 628 | 3300053156 | Ga0500622_0024452 | Ga0500622_0024452_811_1410 | 187 |
| 629 | 3300053156 | Ga0500622_0055833 | Ga0500622_0055833_1403_2002 | 187 |
| 630 | 3300053157 | Ga0500624_000053 | Ga0500624_000053_2426_3025 | 187 |
| 631 | 3300053158 | Ga0500627_0091911 | Ga0500627_0091911_164_763 | 187 |
| 632 | 3300053160 | Ga0500633_0031530 | Ga0500633_0031530_513_1112 | 187 |
| 633 | 3300053178 | Ga0500637_0102461 | Ga0500637_0102461_376_978 | 187 |
| 634 | 3300053723 | Ga0500567_038725 | Ga0500567_038725_543_1142 | 187 |
| 635 | 3300053729 | Ga0500625_000002 | Ga0500625_000002_51107_51706 | 187 |
| 636 | 3300053730 | Ga0500645_000566 | Ga0500645_000566_6970_7569 | 187 |
| 637 | 3300053730 | Ga0500645_010918 | Ga0500645_010918_1903_2502 | 187 |
| 638 | 3300060344 | Ga0587071_038487 | Ga0587071_038487_38_640 | 187 |
| 639 | 3300060346 | Ga0587111_0014016 | Ga0587111_0014016_361_963 | 187 |
| 640 | 3300060346 | Ga0587111_0015291 | Ga0587111_0015291_12_611 | 187 |
| 641 | 3300060346 | Ga0587111_0047376 | Ga0587111_0047376_60_662 | 187 |
| 642 | 3300001915 | JGI24741J21665_1004560 | JGI24741J21665_10045602 | 188 |
| 643 | 3300001979 | JGI24740J21852_10015017 | JGI24740J21852_100150172 | 188 |
| 644 | 3300001990 | JGI24737J22298_10028777 | JGI24737J22298_100287773 | 188 |
| 645 | 3300002244 | JGI24742J22300_10007013 | JGI24742J22300_100070131 | 188 |
| 646 | 3300003214 | JGI25165J46597_1000095 | JGI25165J46597_1000095109 | 188 |
| 647 | 3300003214 | JGI25165J46597_1033269 | JGI25165J46597_10332691 | 188 |
| 648 | 3300003215 | JGI25153J46596_10000070 | JGI25153J46596_1000007022 | 188 |
| 649 | 3300003762 | Ga0055542_1000040 | Ga0055542_1000040123 | 188 |
| 650 | 3300003763 | Ga0055529_1000037 | Ga0055529_100003798 | 188 |
| 651 | 3300005262 | Ga0065165_1019972 | Ga0065165_10199722 | 188 |
| 652 | 3300005327 | Ga0070658_10000493 | Ga0070658_100004938 | 188 |
| 653 | 3300005327 | Ga0070658_10214969 | Ga0070658_102149692 | 188 |
| 654 | 3300005331 | Ga0070670_100222087 | Ga0070670_1002220872 | 188 |
| 655 | 3300005337 | Ga0070682_100557312 | Ga0070682_1005573121 | 188 |
| 656 | 3300005339 | Ga0070660_100018126 | Ga0070660_1000181264 | 188 |
| 657 | 3300005344 | Ga0070661_100007029 | Ga0070661_1000070296 | 188 |
| 658 | 3300005347 | Ga0070668_100146008 | Ga0070668_1001460082 | 188 |
| 659 | 3300005354 | Ga0070675_100902593 | Ga0070675_1009025931 | 188 |
| 660 | 3300005355 | Ga0070671_100867727 | Ga0070671_1008677271 | 188 |
| 661 | 3300005356 | Ga0070674_100094329 | Ga0070674_1000943292 | 188 |
| 662 | 3300005364 | Ga0070673_100065542 | Ga0070673_1000655423 | 188 |
| 663 | 3300005439 | Ga0070711_100518536 | Ga0070711_1005185361 | 188 |
| 664 | 3300005455 | Ga0070663_100061428 | Ga0070663_1000614281 | 188 |
| 665 | 3300005456 | Ga0070678_100000151 | Ga0070678_10000015118 | 188 |
| 666 | 3300005459 | Ga0068867_100125191 | Ga0068867_1001251911 | 188 |
| 667 | 3300005548 | Ga0070665_100000023 | Ga0070665_100000023304 | 188 |
| 668 | 3300005548 | Ga0070665_100126039 | Ga0070665_1001260393 | 188 |
| 669 | 3300005564 | Ga0070664_100079939 | Ga0070664_1000799393 | 188 |
| 670 | 3300005577 | Ga0068857_100507882 | Ga0068857_1005078821 | 188 |
| 671 | 3300005614 | Ga0068856_100614898 | Ga0068856_1006148981 | 188 |
| 672 | 3300005719 | Ga0068861_100119692 | Ga0068861_1001196923 | 188 |
| 673 | 3300005842 | Ga0068858_100001609 | Ga0068858_10000160924 | 188 |
| 674 | 3300006186 | Ga0075369_10286418 | Ga0075369_102864181 | 188 |
| 675 | 3300006195 | Ga0075366_10515073 | Ga0075366_105150731 | 188 |
| 676 | 3300006237 | Ga0097621_100308053 | Ga0097621_1003080532 | 188 |
| 677 | 3300009093 | Ga0105240_11744777 | Ga0105240_117447771 | 188 |
| 678 | 3300009098 | Ga0105245_10002151 | Ga0105245_100021516 | 188 |
| 679 | 3300009148 | Ga0105243_10000847 | Ga0105243_100008477 | 188 |
| 680 | 3300009148 | Ga0105243_10009064 | Ga0105243_100090642 | 188 |
| 681 | 3300009551 | Ga0105238_10008522 | Ga0105238_100085222 | 188 |
| 682 | 3300009551 | Ga0105238_10414726 | Ga0105238_104147262 | 188 |
| 683 | 3300013100 | Ga0157373_10343162 | Ga0157373_103431622 | 188 |
| 684 | 3300013102 | Ga0157371_10000029 | Ga0157371_1000002949 | 188 |
| 685 | 3300013105 | Ga0157369_10979721 | Ga0157369_109797212 | 188 |
| 686 | 3300013297 | Ga0157378_10107733 | Ga0157378_101077332 | 188 |
| 687 | 3300013297 | Ga0157378_10377941 | Ga0157378_103779411 | 188 |
| 688 | 3300017792 | Ga0163161_10018355 | Ga0163161_100183554 | 188 |
| 689 | 3300025233 | Ga0209437_102846 | Ga0209437_1028465 | 188 |
| 690 | 3300025246 | Ga0209646_1019045 | Ga0209646_10190451 | 188 |
| 691 | 3300025250 | Ga0209026_1017308 | Ga0209026_10173082 | 188 |
| 692 | 3300025253 | Ga0209677_109799 | Ga0209677_1097993 | 188 |
| 693 | 3300025254 | Ga0209148_1000011 | Ga0209148_10000111020 | 188 |
| 694 | 3300025261 | Ga0209233_1000052 | Ga0209233_100005249 | 188 |
| 695 | 3300025261 | Ga0209233_1021386 | Ga0209233_10213863 | 188 |
| 696 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006172 | 188 |
| 697 | 3300025272 | Ga0209455_1005748 | Ga0209455_10057484 | 188 |
| 698 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023398 | 188 |
| 699 | 3300025901 | Ga0207688_10028488 | Ga0207688_100284883 | 188 |
| 700 | 3300025904 | Ga0207647_10020030 | Ga0207647_100200304 | 188 |
| 701 | 3300025907 | Ga0207645_10028085 | Ga0207645_100280853 | 188 |
| 702 | 3300025907 | Ga0207645_10039222 | Ga0207645_100392224 | 188 |
| 703 | 3300025909 | Ga0207705_10001210 | Ga0207705_1000121014 | 188 |
| 704 | 3300025913 | Ga0207695_10533118 | Ga0207695_105331182 | 188 |
| 705 | 3300025914 | Ga0207671_10017854 | Ga0207671_100178544 | 188 |
| 706 | 3300025916 | Ga0207663_10392401 | Ga0207663_103924012 | 188 |
| 707 | 3300025919 | Ga0207657_10019604 | Ga0207657_100196044 | 188 |
| 708 | 3300025920 | Ga0207649_10000710 | Ga0207649_1000071021 | 188 |
| 709 | 3300025924 | Ga0207694_10004368 | Ga0207694_100043682 | 188 |
| 710 | 3300025924 | Ga0207694_10018654 | Ga0207694_100186545 | 188 |
| 711 | 3300025925 | Ga0207650_10234968 | Ga0207650_102349681 | 188 |
| 712 | 3300025927 | Ga0207687_10000798 | Ga0207687_1000079811 | 188 |
| 713 | 3300025933 | Ga0207706_10105523 | Ga0207706_101055232 | 188 |
| 714 | 3300025935 | Ga0207709_10000039 | Ga0207709_10000039190 | 188 |
| 715 | 3300025937 | Ga0207669_10000117 | Ga0207669_1000011739 | 188 |
| 716 | 3300025937 | Ga0207669_10000382 | Ga0207669_1000038212 | 188 |
| 717 | 3300025945 | Ga0207679_10947931 | Ga0207679_109479311 | 188 |
| 718 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002867 | 188 |
| 719 | 3300025960 | Ga0207651_10360248 | Ga0207651_103602482 | 188 |
| 720 | 3300025972 | Ga0207668_10744655 | Ga0207668_107446551 | 188 |
| 721 | 3300025986 | Ga0207658_10073092 | Ga0207658_100730923 | 188 |
| 722 | 3300026035 | Ga0207703_10000847 | Ga0207703_1000084725 | 188 |
| 723 | 3300026041 | Ga0207639_10172214 | Ga0207639_101722142 | 188 |
| 724 | 3300026041 | Ga0207639_10407957 | Ga0207639_104079571 | 188 |
| 725 | 3300026067 | Ga0207678_10016640 | Ga0207678_100166404 | 188 |
| 726 | 3300026078 | Ga0207702_10034995 | Ga0207702_100349951 | 188 |
| 727 | 3300026089 | Ga0207648_10047537 | Ga0207648_100475372 | 188 |
| 728 | 3300026116 | Ga0207674_10024940 | Ga0207674_100249406 | 188 |
| 729 | 3300026121 | Ga0207683_10000496 | Ga0207683_1000049623 | 188 |
| 730 | 3300026121 | Ga0207683_10021185 | Ga0207683_100211853 | 188 |
| 731 | 3300026142 | Ga0207698_10004357 | Ga0207698_1000435710 | 188 |
| 732 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021177 | 188 |
| 733 | 3300028379 | Ga0268266_10144375 | Ga0268266_101443752 | 188 |
| 734 | 3300028786 | Ga0307517_10055671 | Ga0307517_100556712 | 188 |
| 735 | 3300031456 | Ga0307513_10024144 | Ga0307513_100241443 | 188 |
| 736 | 3300031507 | Ga0307509_10310343 | Ga0307509_103103431 | 188 |
| 737 | 3300031616 | Ga0307508_10000317 | Ga0307508_1000031727 | 188 |
| 738 | 3300031824 | Ga0307413_10754999 | Ga0307413_107549991 | 188 |
| 739 | 3300037418 | Ga0395900_0625948 | Ga0395900_0625948_322_924 | 188 |
| 740 | 3300038443 | Ga0395901_0221211 | Ga0395901_0221211_1061_1663 | 188 |
| 741 | 3300041456 | Ga0451795_1434403 | Ga0451795_1434403_480_1082 | 188 |
| 742 | 3300041463 | Ga0451804_1057260 | Ga0451804_1057260_33_638 | 188 |
| 743 | 3300042003 | Ga0439443_014595 | Ga0439443_014595_191_793 | 188 |
| 744 | 3300046452 | Ga0495617_024660 | Ga0495617_024660_544_1146 | 188 |
| 745 | 3300046459 | Ga0495629_0041152 | Ga0495629_0041152_1959_2561 | 188 |
| 746 | 3300046460 | Ga0495638_0000128 | Ga0495638_0000128_109844_110446 | 188 |
| 747 | 3300046471 | Ga0495650_0000470 | Ga0495650_0000470_18858_19460 | 188 |
| 748 | 3300046491 | Ga0495584_0004592 | Ga0495584_0004592_2382_2984 | 188 |
| 749 | 3300046491 | Ga0495584_0165160 | Ga0495584_0165160_391_993 | 188 |
| 750 | 3300046492 | Ga0495585_0003270 | Ga0495585_0003270_1828_2430 | 188 |
| 751 | 3300046492 | Ga0495585_0064674 | Ga0495585_0064674_1319_1921 | 188 |
| 752 | 3300046492 | Ga0495585_0174619 | Ga0495585_0174619_301_903 | 188 |
| 753 | 3300046500 | Ga0495596_0180383 | Ga0495596_0180383_123_725 | 188 |
| 754 | 3300046506 | Ga0495583_0001366 | Ga0495583_0001366_17668_18270 | 188 |
| 755 | 3300046506 | Ga0495583_0002817 | Ga0495583_0002817_10014_10616 | 188 |
| 756 | 3300046506 | Ga0495583_0034073 | Ga0495583_0034073_869_1471 | 188 |
| 757 | 3300046507 | Ga0495606_0000092 | Ga0495606_0000092_94282_94884 | 188 |
| 758 | 3300046507 | Ga0495606_0343390 | Ga0495606_0343390_164_766 | 188 |
| 759 | 3300046522 | Ga0495643_0000530 | Ga0495643_0000530_2078_2680 | 188 |
| 760 | 3300046522 | Ga0495643_0009416 | Ga0495643_0009416_148_750 | 188 |
| 761 | 3300046522 | Ga0495643_0019650 | Ga0495643_0019650_855_1457 | 188 |
| 762 | 3300046524 | Ga0495648_0000146 | Ga0495648_0000146_83010_83612 | 188 |
| 763 | 3300046524 | Ga0495648_0025432 | Ga0495648_0025432_743_1345 | 188 |
| 764 | 3300046525 | Ga0495663_0001818 | Ga0495663_0001818_3864_4466 | 188 |
| 765 | 3300046528 | Ga0495642_0002091 | Ga0495642_0002091_3983_4585 | 188 |
| 766 | 3300046542 | Ga0495597_0091236 | Ga0495597_0091236_84_686 | 188 |
| 767 | 3300046557 | Ga0495622_0000811 | Ga0495622_0000811_14960_15562 | 188 |
| 768 | 3300046558 | Ga0495633_0000842 | Ga0495633_0000842_2612_3214 | 188 |
| 769 | 3300046616 | Ga0495668_0000056 | Ga0495668_0000056_143446_144048 | 188 |
| 770 | 3300046648 | Ga0495611_0011961 | Ga0495611_0011961_2308_2910 | 188 |
| 771 | 3300046648 | Ga0495611_0015996 | Ga0495611_0015996_2324_2926 | 188 |
| 772 | 3300046660 | Ga0495625_0000255 | Ga0495625_0000255_28089_28691 | 188 |
| 773 | 3300046660 | Ga0495625_0008595 | Ga0495625_0008595_5356_6000 | 188 |
| 774 | 3300046660 | Ga0495625_0009405 | Ga0495625_0009405_3338_3940 | 188 |
| 775 | 3300046660 | Ga0495625_0273380 | Ga0495625_0273380_155_757 | 188 |
| 776 | 3300046665 | Ga0495661_0147719 | Ga0495661_0147719_518_1120 | 188 |
| 777 | 3300046684 | Ga0495669_0000155 | Ga0495669_0000155_24737_25339 | 188 |
| 778 | 3300046691 | Ga0495670_0364507 | Ga0495670_0364507_52_654 | 188 |
| 779 | 3300046692 | Ga0495671_0193287 | Ga0495671_0193287_259_861 | 188 |
| 780 | 3300046809 | Ga0495600_0005075 | Ga0495600_0005075_4747_5349 | 188 |
| 781 | 3300046810 | Ga0495660_0030727 | Ga0495660_0030727_2291_2893 | 188 |
| 782 | 3300047323 | Ga0495683_0012572 | Ga0495683_0012572_1627_2229 | 188 |
| 783 | 3300047443 | Ga0495687_000077 | Ga0495687_000077_7508_8110 | 188 |
| 784 | 3300047443 | Ga0495687_000353 | Ga0495687_000353_27617_28219 | 188 |
| 785 | 3300047470 | Ga0495681_0010146 | Ga0495681_0010146_1033_1635 | 188 |
| 786 | 3300047472 | Ga0495686_0100699 | Ga0495686_0100699_994_1596 | 188 |
| 787 | 3300048905 | Ga0496102_0000163 | Ga0496102_0000163_37163_37765 | 188 |
| 788 | 3300048906 | Ga0496103_0000052 | Ga0496103_0000052_105562_106164 | 188 |
| 789 | 3300048908 | Ga0496105_0001302 | Ga0496105_0001302_16440_17042 | 188 |
| 790 | 3300048910 | Ga0496107_0175449 | Ga0496107_0175449_402_1004 | 188 |
| 791 | 3300048912 | Ga0496109_0206942 | Ga0496109_0206942_896_1498 | 188 |
| 792 | 3300048913 | Ga0496110_0145791 | Ga0496110_0145791_684_1286 | 188 |
| 793 | 3300048914 | Ga0496111_0002111 | Ga0496111_0002111_10318_10920 | 188 |
| 794 | 3300048916 | Ga0496113_0028812 | Ga0496113_0028812_1806_2408 | 188 |
| 795 | 3300048918 | Ga0496115_0000078 | Ga0496115_0000078_51942_52544 | 188 |
| 796 | 3300048919 | Ga0496116_0088333 | Ga0496116_0088333_859_1461 | 188 |
| 797 | 3300048920 | Ga0496117_0000141 | Ga0496117_0000141_51877_52479 | 188 |
| 798 | 3300048921 | Ga0496118_0000103 | Ga0496118_0000103_51935_52537 | 188 |
| 799 | 3300048922 | Ga0496119_0009712 | Ga0496119_0009712_6839_7441 | 188 |
| 800 | 3300048923 | Ga0496120_0062358 | Ga0496120_0062358_656_1258 | 188 |
| 801 | 3300048924 | Ga0496121_0000156 | Ga0496121_0000156_105544_106146 | 188 |
| 802 | 3300048925 | Ga0496122_0002015 | Ga0496122_0002015_22006_22608 | 188 |
| 803 | 3300048926 | Ga0496123_0022976 | Ga0496123_0022976_4075_4677 | 188 |
| 804 | 3300048927 | Ga0496124_0000041 | Ga0496124_0000041_107435_108037 | 188 |
| 805 | 3300048928 | Ga0496125_0000238 | Ga0496125_0000238_27242_27844 | 188 |
| 806 | 3300048929 | Ga0496126_0000155 | Ga0496126_0000155_51929_52531 | 188 |
| 807 | 3300049823 | Ga0501044_0838402 | Ga0501044_0838402_167_769 | 188 |
| 808 | 3300050491 | nmdc:mga00v17_703184_c1 | nmdc:mga00v17_703184_c1_34_636 | 188 |
| 809 | 3300050493 | nmdc:mga0k408_469216_c1 | nmdc:mga0k408_469216_c1_46_648 | 188 |
| 810 | 3300053079 | Ga0500610_0000144 | Ga0500610_0000144_12164_12766 | 188 |
| 811 | 3300053092 | Ga0500583_0136685 | Ga0500583_0136685_167_769 | 188 |
| 812 | 3300053093 | Ga0500651_0368218 | Ga0500651_0368218_142_744 | 188 |
| 813 | 3300053096 | Ga0500641_0020030 | Ga0500641_0020030_1180_1779 | 188 |
| 814 | 3300053119 | Ga0500595_016627 | Ga0500595_016627_1966_2568 | 188 |
| 815 | 3300053130 | Ga0500642_0096758 | Ga0500642_0096758_47_649 | 188 |
| 816 | 3300053134 | Ga0500658_0002778 | Ga0500658_0002778_2252_2854 | 188 |
| 817 | 3300053136 | Ga0500559_0039778 | Ga0500559_0039778_1285_1887 | 188 |
| 818 | 3300053139 | Ga0500568_0007024 | Ga0500568_0007024_3067_3693 | 188 |
| 819 | 3300053139 | Ga0500568_0015017 | Ga0500568_0015017_1070_1672 | 188 |
| 820 | 3300053140 | Ga0500573_0000271 | Ga0500573_0000271_16394_16996 | 188 |
| 821 | 3300053154 | Ga0500619_000886 | Ga0500619_000886_3266_3868 | 188 |
| 822 | 3300053177 | Ga0500636_0003608 | Ga0500636_0003608_1034_1636 | 188 |
| 823 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_319439_320041 | 188 |
| 824 | 3300055283 | Ga0500661_046605 | Ga0500661_046605_16_618 | 188 |
| 825 | 3300059477 | Ga0587084_003395 | Ga0587084_003395_318_920 | 188 |
| 826 | 3300059508 | Ga0587088_004364 | Ga0587088_004364_831_1433 | 188 |
| 827 | 3300059510 | Ga0587090_003778 | Ga0587090_003778_831_1433 | 188 |
| 828 | 3300059513 | Ga0587094_002775 | Ga0587094_002775_1074_1676 | 188 |
| 829 | 3300059630 | Ga0587128_005805 | Ga0587128_005805_18_620 | 188 |
| 830 | 3300059642 | Ga0587069_005954 | Ga0587069_005954_830_1432 | 188 |
| 831 | 3300059646 | Ga0587078_002342 | Ga0587078_002342_833_1435 | 188 |
| 832 | 3300059647 | Ga0587079_005621 | Ga0587079_005621_829_1431 | 188 |
| 833 | 3300059649 | Ga0587102_000884 | Ga0587102_000884_947_1549 | 188 |
| 834 | 3300060247 | Ga0587096_00527 | Ga0587096_00527_348_950 | 188 |
| 835 | 3300060344 | Ga0587071_006951 | Ga0587071_006951_833_1435 | 188 |
| 836 | 3300060346 | Ga0587111_0006342 | Ga0587111_0006342_917_1519 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4la4-assembly1.cif.gz_B-2 | crystal structure of native pnpb | 0.9644 | 1 | 187 |
| 4laf-assembly1.cif.gz_C | crystal structure of pnpb complex with fmn | 0.9598 | 1 | 187 |
| 7q6n-assembly1.cif.gz_A | structure of wrba from salmonella typhimurium bound to me0052 | 0.9558 | 1 | 186 |
| 4laf-assembly1.cif.gz_D | crystal structure of pnpb complex with fmn | 0.9533 | 2 | 188 |
| 4la4-assembly1.cif.gz_A | crystal structure of native pnpb | 0.953 | 1 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4la4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.953 | 1 | 187 | 3.40.50.360 |
| af_A0A0R0H261_1_202_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9483 | 1 | 188 | 3.40.50.360 |
| af_A0A0R0H261_1_202_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9434 | 1 | 188 | 3.40.50.360 |
| 4la4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9431 | 1 | 187 | 3.40.50.360 |
| 2a5lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.934 | 1 | 188 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7QAX1-F1-model_v4 | deleted | 0.9799 | 58 | 188 |
|
| AF-A0A418NU94-F1-model_v4 | NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) | 0.9736 | 1 | 188 |
GO:0008753
GO:0010181 GO:0016020 GO:0050136 GO:0050660 GO:0050661 GO:0051287 |
| AF-A0A7C1HH78-F1-model_v4 | NAD(P)H:quinone oxidoreductase (EC 1.6.5.2) | 0.9726 | 72 | 188 |
GO:0003955
GO:0010181 GO:0016020 |
| AF-A0A2R7QAX1-F1-model_v4 | deleted | 0.9725 | 58 | 188 |
|
| AF-F8XTR7-F1-model_v4 | deleted | 0.9724 | 53 | 188 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar