F482844

General Info

Members Datasets Scaffolds Average Seq Length
835 390 835 371

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10000106|Ga0265325_100001069
Length 412
Sequence MAWGNGPPAGVLVQGEQGSETFSMRNDSTSSAGSILFGTREQVGVGRGLAEFRAGRPIMVTSSEETLLCLPVEGLNKDRLVAFRAVCEPIAPRLVLTSRRARSLGIDANDPVALELRPDVDASRILNIASEATSDHVFVPEPAGRAAVAAIELVKLAQILPAVLVADSDTAVAGTFTPRVITVDAGAVARFRANATQSLTIAGEAYVPLSSGVRTRFVVFRDAFGDDPVAVIVGTPDLSKPVPVRIHSACLTGDVFGSRRCDCGDQLRLALARLQEAGGGVILYLAQEGRGVGLANKMRTYKLQDAGLDTVDANTTLGFDDDERDYGTAVRMLQMLGCTRVVLLTNNPAKLDGLSKAGIEITGRMPIETPVNSDNRRYLTAKASRAGHQLRHVIAALAETPEDDGEKASLAP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
267 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
384 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
385 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 9.94
Rhizosphere 86.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745206 2209111006 Bacteria 15476
2 ARSoilOldRDRAFT_c000055 3300000044 Bacteria 23615
3 ARCol0oldRDRAFT_c00723 3300000045 Bacteria 2821
4 ARCol0yngRDRAFT_1000044 3300000652 Bacteria 21392
5 JGI24032J14994_100612 3300001430 Bacteria 1859
6 JGI24747J21853_1002443 3300001978 Bacteria 1517
7 JGI24739J22299_10002793 3300001989 Bacteria 6708
8 JGI24737J22298_10000342 3300001990 Bacteria 15658
9 JGI24737J22298_10018616 3300001990 Bacteria 2227
10 JGI24750J21931_1000308 3300002070 Bacteria 8403
11 JGI24745J21846_1001695 3300002073 Bacteria 2174
12 JGI24748J21848_1003909 3300002074 Bacteria 1706
13 JGI24738J21930_10000339 3300002075 Bacteria 12791
14 JGI24749J21850_1006261 3300002076 Bacteria 1659
15 JGI24744J21845_10001479 3300002077 Bacteria 4668
16 JGI24744J21845_10003255 3300002077 Bacteria 3334
17 JGI24033J26618_1003260 3300002155 Bacteria 1704
18 JGI24034J26672_10000564 3300002239 Bacteria 4721
19 JGI24742J22300_10000317 3300002244 Bacteria 7200
20 JGI25153J46596_10009559 3300003215 Bacteria 4485
21 JGI25405J52794_10008771 3300003911 Bacteria 1896
22 Ga0065717_1002092 3300005276 Bacteria 2986
23 Ga0065716_1001996 3300005277 Bacteria 2495
24 Ga0065712_10072393 3300005290 Bacteria 4772
25 Ga0065712_10096990 3300005290 Bacteria 2165
26 Ga0065715_10000671 3300005293 Bacteria 11029
27 Ga0065707_10116717 3300005295 Bacteria 2228
28 Ga0070658_10056357 3300005327 Bacteria 3193
29 Ga0070676_10000016 3300005328 Bacteria 52098
30 Ga0070676_10044116 3300005328 Bacteria 2594
31 Ga0070683_100000075 3300005329 Bacteria 67998
32 Ga0070690_100000713 3300005330 Bacteria 17071
33 Ga0070690_100001770 3300005330 Bacteria 11417
34 Ga0070690_100008341 3300005330 Bacteria 5962
35 Ga0070690_100026952 3300005330 Bacteria 3550
36 Ga0070690_100211054 3300005330 Bacteria 1356
37 Ga0070670_100003906 3300005331 Bacteria 12433
38 Ga0070670_100010481 3300005331 Bacteria 7912
39 Ga0070677_10000005 3300005333 Bacteria 79035
40 Ga0070677_10020671 3300005333 Bacteria 2402
41 Ga0068869_100000578 3300005334 Bacteria 20535
42 Ga0068869_100093314 3300005334 Bacteria 2267
43 Ga0070666_10004550 3300005335 Bacteria 8453
44 Ga0070666_10011843 3300005335 Bacteria 5485
45 Ga0070680_100000526 3300005336 Bacteria 26129
46 Ga0070680_100013741 3300005336 Bacteria 6315
47 Ga0070680_100017732 3300005336 Bacteria 5615
48 Ga0070680_100099422 3300005336 Bacteria 2414
49 Ga0070680_100334758 3300005336 Bacteria 1286
50 Ga0070682_100000144 3300005337 Bacteria 56618
51 Ga0068868_100007091 3300005338 Bacteria 7966
52 Ga0068868_100224248 3300005338 Bacteria 1574
53 Ga0070660_100000153 3300005339 Bacteria 44533
54 Ga0070689_100000563 3300005340 Bacteria 22227
55 Ga0070689_100002363 3300005340 Bacteria 12295
56 Ga0070689_100014436 3300005340 Bacteria 5738
57 Ga0070689_100047315 3300005340 Bacteria 3317
58 Ga0070691_10000030 3300005341 Bacteria 39784
59 Ga0070691_10024288 3300005341 Bacteria 2817
60 Ga0070687_100000016 3300005343 Bacteria 55051
61 Ga0070687_100000523 3300005343 Bacteria 12899
62 Ga0070687_100058316 3300005343 Bacteria 2028
63 Ga0070687_100060447 3300005343 Bacteria 1999
64 Ga0070661_100000249 3300005344 Bacteria 44246
65 Ga0070692_10002752 3300005345 Bacteria 6918
66 Ga0070692_10034075 3300005345 Bacteria 2569
67 Ga0070668_100009086 3300005347 Bacteria 7380
68 Ga0070668_100011400 3300005347 Bacteria 6623
69 Ga0070668_100057949 3300005347 Bacteria 2995
70 Ga0070669_100000145 3300005353 Bacteria 63377
71 Ga0070675_100000081 3300005354 Bacteria 56087
72 Ga0070675_100006337 3300005354 Bacteria 9082
73 Ga0070671_100000267 3300005355 Bacteria 35238
74 Ga0070671_100043196 3300005355 Bacteria 3746
75 Ga0070671_100101011 3300005355 Bacteria 2420
76 Ga0070671_100150959 3300005355 Bacteria 1962
77 Ga0070674_100037837 3300005356 Bacteria 3248
78 Ga0070674_100268633 3300005356 Bacteria 1347
79 Ga0070673_100000125 3300005364 Bacteria 35606
80 Ga0070673_100245620 3300005364 Bacteria 1558
81 Ga0070688_100000075 3300005365 Bacteria 49279
82 Ga0070688_100009829 3300005365 Bacteria 5257
83 Ga0070688_100012438 3300005365 Bacteria 4770
84 Ga0070688_100029833 3300005365 Bacteria 3269
85 Ga0070659_100000144 3300005366 Bacteria 55051
86 Ga0070659_100061626 3300005366 Bacteria 2964
87 Ga0070659_100081479 3300005366 Bacteria 2585
88 Ga0070667_100001956 3300005367 Bacteria 18291
89 Ga0070667_100009767 3300005367 Bacteria 7956
90 Ga0070667_100055136 3300005367 Bacteria 3357
91 Ga0070703_10001239 3300005406 Bacteria 7783
92 Ga0070709_10090603 3300005434 Bacteria 2016
93 Ga0070709_10130240 3300005434 Bacteria 1717
94 Ga0070714_100013260 3300005435 Bacteria 6599
95 Ga0070714_100140036 3300005435 Bacteria 2170
96 Ga0070710_10027434 3300005437 Bacteria 3036
97 Ga0070710_10075895 3300005437 Bacteria 1949
98 Ga0070701_10000058 3300005438 Bacteria 29228
99 Ga0070701_10001508 3300005438 Bacteria 8628
100 Ga0070701_10022221 3300005438 Bacteria 3039
101 Ga0070711_100120613 3300005439 Bacteria 1939
102 Ga0070705_100000926 3300005440 Bacteria 16411
103 Ga0070700_100000100 3300005441 Bacteria 54110
104 Ga0070700_100010505 3300005441 Bacteria 5115
105 Ga0070700_100038892 3300005441 Bacteria 2902
106 Ga0070694_100000041 3300005444 Bacteria 59039
107 Ga0070694_100035205 3300005444 Bacteria 3308
108 Ga0070708_100004960 3300005445 Bacteria 10518
109 Ga0070663_100000071 3300005455 Bacteria 44246
110 Ga0070663_100014182 3300005455 Bacteria 5109
111 Ga0070678_100000239 3300005456 Bacteria 25186
112 Ga0070678_100028854 3300005456 Bacteria 3791
113 Ga0070678_100083113 3300005456 Bacteria 2433
114 Ga0070678_100318403 3300005456 Bacteria 1327
115 Ga0070662_100010549 3300005457 Bacteria 6070
116 Ga0070662_100011560 3300005457 Bacteria 5825
117 Ga0070662_100184016 3300005457 Bacteria 1649
118 Ga0070681_10053662 3300005458 Bacteria 4017
119 Ga0070681_10095556 3300005458 Bacteria 2920
120 Ga0068867_100005147 3300005459 Bacteria 9242
121 Ga0070685_10000994 3300005466 Bacteria 15225
122 Ga0070685_10036941 3300005466 Bacteria 2764
123 Ga0070679_100000464 3300005530 Bacteria 34507
124 Ga0070679_100036186 3300005530 Bacteria 4898
125 Ga0070679_100099308 3300005530 Bacteria 2898
126 Ga0070679_100114627 3300005530 Bacteria 2681
127 Ga0070679_100172886 3300005530 Bacteria 2133
128 Ga0070684_100010477 3300005535 Bacteria 7346
129 Ga0070684_100023560 3300005535 Bacteria 5153
130 Ga0070697_100057257 3300005536 Bacteria 3172
131 Ga0070697_100324573 3300005536 Bacteria 1326
132 Ga0068853_100001732 3300005539 Bacteria 15993
133 Ga0070672_100000035 3300005543 Bacteria 60570
134 Ga0070686_100000086 3300005544 Bacteria 65438
135 Ga0070686_100003387 3300005544 Bacteria 8737
136 Ga0070686_100005194 3300005544 Bacteria 7192
137 Ga0070686_100083193 3300005544 Bacteria 2124
138 Ga0070695_100000036 3300005545 Bacteria 51060
139 Ga0070695_100014019 3300005545 Bacteria 4826
140 Ga0070696_100003543 3300005546 Bacteria 10392
141 Ga0070696_100225253 3300005546 Bacteria 1408
142 Ga0070693_100000310 3300005547 Bacteria 22583
143 Ga0070693_100012712 3300005547 Bacteria 4268
144 Ga0070665_100011985 3300005548 Bacteria 8752
145 Ga0070704_100011024 3300005549 Bacteria 5516
146 Ga0070704_100078764 3300005549 Bacteria 2419
147 Ga0068855_100015219 3300005563 Bacteria 9262
148 Ga0068855_100088285 3300005563 Bacteria 3582
149 Ga0068855_100246579 3300005563 Bacteria 1993
150 Ga0070664_100004564 3300005564 Bacteria 11111
151 Ga0070664_100022839 3300005564 Bacteria 5160
152 Ga0070664_100023143 3300005564 Bacteria 5129
153 Ga0068857_100000122 3300005577 Bacteria 46603
154 Ga0068857_100114445 3300005577 Bacteria 2426
155 Ga0068854_100000410 3300005578 Bacteria 26884
156 Ga0068856_100001112 3300005614 Bacteria 28418
157 Ga0068856_100064233 3300005614 Bacteria 3627
158 Ga0068856_100193400 3300005614 Bacteria 2048
159 Ga0068852_100013184 3300005616 Bacteria 6317
160 Ga0068852_100016621 3300005616 Bacteria 5747
161 Ga0068852_100044248 3300005616 Bacteria 3780
162 Ga0068859_100000365 3300005617 Bacteria 45011
163 Ga0068859_100047840 3300005617 Bacteria 4297
164 Ga0068859_100412923 3300005617 Bacteria 1446
165 Ga0068864_100000271 3300005618 Bacteria 46062
166 Ga0068864_100008822 3300005618 Bacteria 8313
167 Ga0068864_100114845 3300005618 Bacteria 2401
168 Ga0068864_100320760 3300005618 Bacteria 1455
169 Ga0068866_10000213 3300005718 Bacteria 27527
170 Ga0068866_10022761 3300005718 Bacteria 2904
171 Ga0068861_100000340 3300005719 Bacteria 26546
172 Ga0068851_10042084 3300005834 Bacteria 2299
173 Ga0068870_10000079 3300005840 Bacteria 31219
174 Ga0068870_10028939 3300005840 Bacteria 2786
175 Ga0068863_100000372 3300005841 Bacteria 45645
176 Ga0068863_100018999 3300005841 Bacteria 6577
177 Ga0068858_100000809 3300005842 Bacteria 32733
178 Ga0068858_100075189 3300005842 Bacteria 3137
179 Ga0068860_100000709 3300005843 Bacteria 38176
180 Ga0068860_100020845 3300005843 Bacteria 6350
181 Ga0068860_100035563 3300005843 Bacteria 4777
182 Ga0068862_100000512 3300005844 Bacteria 41177
183 Ga0068862_100004009 3300005844 Bacteria 12486
184 Ga0068862_100076488 3300005844 Bacteria 2897
185 Ga0068862_100203993 3300005844 Bacteria 1784
186 Ga0081455_10000007 3300005937 Bacteria 269394
187 Ga0081455_10005639 3300005937 Bacteria 13672
188 Ga0081538_10029783 3300005981 Bacteria 3721
189 Ga0081540_1024073 3300005983 Bacteria 3542
190 Ga0070717_10018110 3300006028 Bacteria 5494
191 Ga0070717_10022929 3300006028 Unclassified 4940
192 Ga0070717_10128784 3300006028 Bacteria 2175
193 Ga0075365_10007934 3300006038 Bacteria 5984
194 Ga0075365_10018478 3300006038 Bacteria 4288
195 Ga0075365_10152320 3300006038 Bacteria 1609
196 Ga0075368_10037512 3300006042 Bacteria 1895
197 Ga0075364_10096848 3300006051 Bacteria 1962
198 Ga0075364_10135245 3300006051 Bacteria 1656
199 Ga0075432_10000890 3300006058 Bacteria 9398
200 Ga0070715_10003805 3300006163 Bacteria 4871
201 Ga0070715_10063039 3300006163 Bacteria 1633
202 Ga0070716_100020144 3300006173 Bacteria 3498
203 Ga0070716_100044437 3300006173 Bacteria 2489
204 Ga0070712_100001284 3300006175 Bacteria 15170
205 Ga0070712_100055031 3300006175 Bacteria 2784
206 Ga0075367_10044338 3300006178 Bacteria 2606
207 Ga0075367_10129676 3300006178 Bacteria 1558
208 Ga0075366_10001684 3300006195 Bacteria 11097
209 Ga0097621_100000047 3300006237 Bacteria 63910
210 Ga0075370_10028682 3300006353 Bacteria 3095
211 Ga0075370_10096283 3300006353 Bacteria 1710
212 Ga0068871_100000721 3300006358 Bacteria 22411
213 Ga0075428_100000945 3300006844 Bacteria 30758
214 Ga0075428_100005796 3300006844 Bacteria 13717
215 Ga0075428_100038586 3300006844 Bacteria 5257
216 Ga0075428_100067105 3300006844 Bacteria 3928
217 Ga0075428_100339283 3300006844 Bacteria 1614
218 Ga0075430_100000770 3300006846 Bacteria 24728
219 Ga0075430_100012439 3300006846 Bacteria 7242
220 Ga0075430_100130940 3300006846 Bacteria 2091
221 Ga0075430_100145136 3300006846 Bacteria 1977
222 Ga0075431_100000399 3300006847 Bacteria 35027
223 Ga0075431_100000864 3300006847 Bacteria 26611
224 Ga0075431_100002340 3300006847 Bacteria 18197
225 Ga0075431_100019719 3300006847 Bacteria 6882
226 Ga0075431_100035827 3300006847 Bacteria 5109
227 Ga0075431_100090910 3300006847 Bacteria 3151
228 Ga0075433_10000374 3300006852 Bacteria 28158
229 Ga0075433_10002587 3300006852 Bacteria 13788
230 Ga0075433_10105325 3300006852 Bacteria 2499
231 Ga0075434_100001558 3300006871 Bacteria 19441
232 Ga0075434_100021991 3300006871 Bacteria 6208
233 Ga0075434_100045630 3300006871 Bacteria 4348
234 Ga0075434_100075588 3300006871 Bacteria 3362
235 Ga0075429_100002444 3300006880 Bacteria 15642
236 Ga0075429_100016146 3300006880 Bacteria 6469
237 Ga0075429_100042323 3300006880 Bacteria 3964
238 Ga0068865_100000415 3300006881 Bacteria 23798
239 Ga0068865_100015689 3300006881 Bacteria 4834
240 Ga0075436_100062929 3300006914 Bacteria 2565
241 Ga0075436_100216097 3300006914 Bacteria 1360
242 Ga0097620_100000365 3300006931 Bacteria 45011
243 Ga0097620_100047843 3300006931 Bacteria 4297
244 Ga0097620_100412883 3300006931 Bacteria 1446
245 Ga0075435_100004974 3300007076 Bacteria 9226
246 Ga0075435_100165546 3300007076 Bacteria 1864
247 Ga0105240_10032816 3300009093 Bacteria 6717
248 Ga0105240_10139901 3300009093 Bacteria 2894
249 Ga0105240_10304265 3300009093 Bacteria 1823
250 Ga0105240_10403803 3300009093 Bacteria 1538
251 Ga0111539_10000185 3300009094 Bacteria 72688
252 Ga0111539_10001287 3300009094 Bacteria 33486
253 Ga0111539_10001763 3300009094 Bacteria 28733
254 Ga0111539_10064483 3300009094 Bacteria 4333
255 Ga0111539_10256160 3300009094 Bacteria 2038
256 Ga0111539_10598327 3300009094 Bacteria 1284
257 Ga0105245_10000213 3300009098 Bacteria 55096
258 Ga0105245_10054347 3300009098 Bacteria 3596
259 Ga0105247_10002058 3300009101 Bacteria 13924
260 Ga0105247_10012021 3300009101 Bacteria 5199
261 Ga0105247_10092998 3300009101 Bacteria 1916
262 Ga0114129_10001337 3300009147 Bacteria 33051
263 Ga0114129_10001978 3300009147 Bacteria 28018
264 Ga0114129_10006361 3300009147 Bacteria 16744
265 Ga0114129_10006806 3300009147 Bacteria 16234
266 Ga0114129_10139264 3300009147 Bacteria 3328
267 Ga0105243_10000175 3300009148 Bacteria 73728
268 Ga0105243_10003796 3300009148 Bacteria 12086
269 Ga0105241_10000734 3300009174 Bacteria 24869
270 Ga0105242_10000170 3300009176 Bacteria 49285
271 Ga0105248_10003499 3300009177 Bacteria 17428
272 Ga0105248_10006875 3300009177 Bacteria 12467
273 Ga0105248_10013011 3300009177 Bacteria 9171
274 Ga0105237_10003191 3300009545 Bacteria 19674
275 Ga0105237_10007504 3300009545 Bacteria 11926
276 Ga0105237_10023530 3300009545 Bacteria 6311
277 Ga0105237_10111179 3300009545 Bacteria 2731
278 Ga0105238_10096307 3300009551 Bacteria 2945
279 Ga0105238_10302396 3300009551 Bacteria 1583
280 Ga0105249_10000200 3300009553 Bacteria 68748
281 Ga0105249_10007192 3300009553 Bacteria 9721
282 Ga0105249_10042898 3300009553 Bacteria 4115
283 Ga0099796_10022992 3300010159 Bacteria 1941
284 Ga0105239_10000834 3300010375 Bacteria 43762
285 Ga0105239_10007410 3300010375 Bacteria 12587
286 Ga0105239_10030237 3300010375 Bacteria 5953
287 Ga0105239_10141445 3300010375 Bacteria 2682
288 Ga0105246_10000050 3300011119 Bacteria 46833
289 Ga0157373_10061392 3300013100 Bacteria 2662
290 Ga0157374_10002488 3300013296 Bacteria 15565
291 Ga0157374_10121362 3300013296 Bacteria 2523
292 Ga0157378_10000581 3300013297 Bacteria 34391
293 Ga0157378_10074159 3300013297 Bacteria 3061
294 Ga0157378_10124457 3300013297 Bacteria 2380
295 Ga0163162_10000222 3300013306 Bacteria 52141
296 Ga0163162_10029144 3300013306 Bacteria 5461
297 Ga0157372_10001777 3300013307 Bacteria 23400
298 Ga0157375_10001098 3300013308 Bacteria 23463
299 Ga0157375_10015199 3300013308 Bacteria 6887
300 Ga0157375_10167137 3300013308 Bacteria 2345
301 Ga0163163_10000693 3300014325 Bacteria 28657
302 Ga0163163_10005957 3300014325 Bacteria 10607
303 Ga0163163_10008982 3300014325 Bacteria 8906
304 Ga0163163_10032794 3300014325 Bacteria 5019
305 Ga0163163_10044003 3300014325 Bacteria 4379
306 Ga0157380_10000361 3300014326 Bacteria 27316
307 Ga0157380_10156665 3300014326 Bacteria 1975
308 Ga0157377_10000204 3300014745 Bacteria 32705
309 Ga0157377_10017981 3300014745 Bacteria 3667
310 Ga0157377_10124970 3300014745 Bacteria 1564
311 Ga0157379_10000036 3300014968 Bacteria 81888
312 Ga0157379_10019284 3300014968 Bacteria 6023
313 Ga0157376_10000062 3300014969 Bacteria 89308
314 Ga0163161_10000363 3300017792 Bacteria 37872
315 Ga0163161_10015961 3300017792 Bacteria 5241
316 Ga0207666_1000015 3300025271 Bacteria 41241
317 Ga0207666_1002258 3300025271 Bacteria 2311
318 Ga0207673_1000067 3300025290 Bacteria 8932
319 Ga0209758_1000063 3300025297 Bacteria 315999
320 Ga0209758_1015119 3300025297 Bacteria 4027
321 Ga0207697_10000088 3300025315 Bacteria 41270
322 Ga0207697_10020214 3300025315 Bacteria 2726
323 Ga0207653_10000413 3300025885 Bacteria 18224
324 Ga0207682_10000004 3300025893 Bacteria 104760
325 Ga0207692_10089732 3300025898 Bacteria 1664
326 Ga0207642_10000291 3300025899 Bacteria 14980
327 Ga0207642_10037070 3300025899 Bacteria 2098
328 Ga0207710_10001511 3300025900 Bacteria 11534
329 Ga0207688_10000042 3300025901 Bacteria 44479
330 Ga0207688_10000735 3300025901 Bacteria 16242
331 Ga0207680_10000311 3300025903 Bacteria 23202
332 Ga0207647_10000417 3300025904 Bacteria 35010
333 Ga0207647_10009783 3300025904 Bacteria 6800
334 Ga0207647_10074921 3300025904 Bacteria 2038
335 Ga0207685_10027824 3300025905 Bacteria 1983
336 Ga0207645_10000061 3300025907 Bacteria 77457
337 Ga0207645_10009017 3300025907 Bacteria 6921
338 Ga0207643_10000012 3300025908 Bacteria 133318
339 Ga0207643_10000820 3300025908 Bacteria 18861
340 Ga0207654_10001794 3300025911 Bacteria 11151
341 Ga0207707_10006621 3300025912 Bacteria 10109
342 Ga0207707_10150646 3300025912 Bacteria 2034
343 Ga0207707_10275037 3300025912 Bacteria 1459
344 Ga0207695_10151269 3300025913 Bacteria 2260
345 Ga0207671_10004932 3300025914 Bacteria 12520
346 Ga0207671_10011350 3300025914 Bacteria 7258
347 Ga0207671_10220962 3300025914 Bacteria 1484
348 Ga0207693_10002503 3300025915 Bacteria 15983
349 Ga0207693_10004962 3300025915 Bacteria 11175
350 Ga0207660_10000008 3300025917 Bacteria 98521
351 Ga0207660_10059606 3300025917 Bacteria 2741
352 Ga0207660_10173842 3300025917 Bacteria 1669
353 Ga0207662_10000097 3300025918 Bacteria 41243
354 Ga0207662_10001103 3300025918 Bacteria 12684
355 Ga0207657_10000503 3300025919 Bacteria 41249
356 Ga0207657_10002293 3300025919 Bacteria 20727
357 Ga0207649_10000099 3300025920 Bacteria 71350
358 Ga0207652_10001041 3300025921 Bacteria 25403
359 Ga0207652_10045826 3300025921 Bacteria 3728
360 Ga0207652_10195128 3300025921 Bacteria 1821
361 Ga0207652_10245066 3300025921 Bacteria 1616
362 Ga0207681_10000141 3300025923 Bacteria 59951
363 Ga0207681_10035982 3300025923 Bacteria 3264
364 Ga0207681_10209316 3300025923 Bacteria 1502
365 Ga0207694_10076058 3300025924 Bacteria 2629
366 Ga0207650_10007055 3300025925 Bacteria 7659
367 Ga0207650_10007962 3300025925 Bacteria 7224
368 Ga0207650_10017621 3300025925 Bacteria 5002
369 Ga0207650_10039576 3300025925 Bacteria 3445
370 Ga0207659_10000023 3300025926 Bacteria 142947
371 Ga0207659_10189377 3300025926 Bacteria 1636
372 Ga0207687_10000319 3300025927 Bacteria 32748
373 Ga0207687_10015396 3300025927 Bacteria 5014
374 Ga0207700_10007483 3300025928 Bacteria 6677
375 Ga0207700_10014366 3300025928 Bacteria 5186
376 Ga0207664_10077228 3300025929 Unclassified 2698
377 Ga0207664_10084933 3300025929 Bacteria 2583
378 Ga0207644_10015130 3300025931 Bacteria 5175
379 Ga0207644_10119075 3300025931 Bacteria 2007
380 Ga0207690_10000105 3300025932 Bacteria 68515
381 Ga0207690_10034446 3300025932 Bacteria 3263
382 Ga0207706_10000438 3300025933 Bacteria 44481
383 Ga0207706_10005437 3300025933 Bacteria 11870
384 Ga0207706_10010940 3300025933 Bacteria 8276
385 Ga0207686_10000140 3300025934 Bacteria 56605
386 Ga0207686_10031116 3300025934 Bacteria 3166
387 Ga0207709_10000264 3300025935 Bacteria 62258
388 Ga0207709_10005146 3300025935 Bacteria 7460
389 Ga0207670_10000108 3300025936 Bacteria 56906
390 Ga0207670_10003337 3300025936 Bacteria 8514
391 Ga0207670_10073327 3300025936 Bacteria 2373
392 Ga0207669_10000110 3300025937 Bacteria 40953
393 Ga0207669_10044617 3300025937 Bacteria 2606
394 Ga0207704_10000171 3300025938 Bacteria 34340
395 Ga0207665_10001690 3300025939 Bacteria 14832
396 Ga0207665_10070355 3300025939 Bacteria 2387
397 Ga0207691_10001108 3300025940 Bacteria 26807
398 Ga0207691_10002227 3300025940 Bacteria 18970
399 Ga0207711_10002682 3300025941 Bacteria 15745
400 Ga0207711_10083012 3300025941 Bacteria 2802
401 Ga0207689_10000008 3300025942 Bacteria 127942
402 Ga0207689_10018552 3300025942 Bacteria 5869
403 Ga0207661_10000053 3300025944 Bacteria 90600
404 Ga0207679_10000053 3300025945 Bacteria 109038
405 Ga0207679_10046497 3300025945 Bacteria 3146
406 Ga0207667_10008564 3300025949 Bacteria 12140
407 Ga0207651_10000052 3300025960 Bacteria 53826
408 Ga0207651_10192522 3300025960 Bacteria 1628
409 Ga0207651_10301061 3300025960 Bacteria 1333
410 Ga0207712_10000156 3300025961 Bacteria 70300
411 Ga0207668_10000160 3300025972 Bacteria 47008
412 Ga0207668_10015910 3300025972 Bacteria 4683
413 Ga0207668_10032006 3300025972 Bacteria 3471
414 Ga0207640_10000325 3300025981 Bacteria 31933
415 Ga0207640_10113109 3300025981 Bacteria 1929
416 Ga0207658_10021600 3300025986 Bacteria 4472
417 Ga0207658_10036051 3300025986 Bacteria 3545
418 Ga0207658_10057895 3300025986 Bacteria 2882
419 Ga0207658_10094028 3300025986 Bacteria 2332
420 Ga0207703_10001510 3300026035 Bacteria 21203
421 Ga0207703_10022564 3300026035 Bacteria 4938
422 Ga0207703_10038453 3300026035 Bacteria 3818
423 Ga0207639_10001511 3300026041 Bacteria 15635
424 Ga0207678_10000185 3300026067 Bacteria 53359
425 Ga0207678_10031346 3300026067 Bacteria 4638
426 Ga0207708_10000263 3300026075 Bacteria 41243
427 Ga0207708_10001344 3300026075 Bacteria 18498
428 Ga0207708_10005439 3300026075 Bacteria 9392
429 Ga0207702_10000297 3300026078 Bacteria 57296
430 Ga0207641_10067239 3300026088 Bacteria 3069
431 Ga0207648_10000469 3300026089 Bacteria 45034
432 Ga0207648_10038076 3300026089 Bacteria 4233
433 Ga0207648_10132054 3300026089 Bacteria 2198
434 Ga0207676_10001235 3300026095 Bacteria 19009
435 Ga0207674_10001208 3300026116 Bacteria 33667
436 Ga0207675_100000342 3300026118 Bacteria 44471
437 Ga0207675_100002754 3300026118 Bacteria 17280
438 Ga0207675_100033440 3300026118 Bacteria 4791
439 Ga0207683_10000006 3300026121 Bacteria 181260
440 Ga0207683_10009722 3300026121 Bacteria 8202
441 Ga0207683_10024092 3300026121 Bacteria 5238
442 Ga0207683_10139099 3300026121 Bacteria 2187
443 Ga0207698_10000236 3300026142 Bacteria 34581
444 Ga0207698_10269963 3300026142 Bacteria 1568
445 Ga0207698_10337831 3300026142 Bacteria 1417
446 Ga0209995_1004032 3300027471 Bacteria 2345
447 Ga0209971_1003649 3300027682 Bacteria 3644
448 Ga0209966_1001615 3300027695 Bacteria 3857
449 Ga0209998_10001431 3300027717 Bacteria 5774
450 Ga0209998_10004020 3300027717 Bacteria 3148
451 Ga0209974_10002024 3300027876 Bacteria 7403
452 Ga0207428_10000112 3300027907 Bacteria 110733
453 Ga0207428_10000417 3300027907 Bacteria 52860
454 Ga0207428_10000480 3300027907 Bacteria 48240
455 Ga0268266_10017509 3300028379 Bacteria 6113
456 Ga0268266_10028193 3300028379 Bacteria 4774
457 Ga0268265_10000257 3300028380 Bacteria 60485
458 Ga0268265_10037761 3300028380 Bacteria 3547
459 Ga0268264_10000579 3300028381 Bacteria 44364
460 Ga0268264_10046931 3300028381 Bacteria 3590
461 Ga0265330_10045863 3300031235 Bacteria 1927
462 Ga0265332_10014392 3300031238 Bacteria 3499
463 Ga0265325_10000004 3300031241 Bacteria 347347
464 Ga0265325_10000106 3300031241 Bacteria 59197
465 Ga0265325_10019773 3300031241 Bacteria 3718
466 Ga0265325_10028908 3300031241 Bacteria 2984
467 Ga0265340_10013567 3300031247 Bacteria 4278
468 Ga0265340_10014025 3300031247 Bacteria 4198
469 Ga0265331_10024375 3300031250 Bacteria 3061
470 Ga0265331_10036762 3300031250 Bacteria 2402
471 Ga0265316_10144407 3300031344 Bacteria 1785
472 Ga0265313_10011012 3300031595 Bacteria 5653
473 Ga0265314_10005765 3300031711 Bacteria 11114
474 Ga0265342_10012693 3300031712 Bacteria 5697
475 Ga0373930_0000160 3300034816 Bacteria 7781
476 Ga0373958_0000508 3300034819 Bacteria 4829
477 Ga0373958_0000865 3300034819 Bacteria 3891
478 Ga0373959_0000573 3300034820 Bacteria 6467
479 Ga0373938_0000090 3300034957 Bacteria 12290
480 Ga0373938_0001252 3300034957 Bacteria 4089
481 Ga0373926_0001790 3300035083 Bacteria 6673
482 Ga0373926_0064737 3300035083 Bacteria 1336
483 Ga0373928_0000536 3300035084 Bacteria 7378
484 Ga0373929_0000741 3300035085 Bacteria 6324
485 Ga0373929_0003008 3300035085 Bacteria 3069
486 Ga0373929_0011677 3300035085 Bacteria 1658
487 Ga0373929_0011950 3300035085 Bacteria 1643
488 Ga0373934_0002928 3300035086 Bacteria 6245
489 Ga0373934_0050861 3300035086 Bacteria 1642
490 Ga0373940_0000074 3300035088 Bacteria 11657
491 Ga0373949_0000489 3300035090 Bacteria 13482
492 Ga0373949_0001646 3300035090 Bacteria 6231
493 Ga0373951_0001485 3300035091 Bacteria 6116
494 Ga0373951_0003044 3300035091 Bacteria 4146
495 Ga0373952_0000166 3300035092 Bacteria 10016
496 Ga0373952_0001370 3300035092 Bacteria 4459
497 Ga0373923_0009157 3300035111 Bacteria 3561
498 Ga0373932_0001675 3300035112 Bacteria 6050
499 Ga0373939_0000873 3300035114 Bacteria 7470
500 Ga0373939_0001847 3300035114 Bacteria 5085
501 Ga0373941_0000030 3300035115 Bacteria 21511
502 Ga0373941_0001773 3300035115 Bacteria 4647
503 Ga0373945_0019356 3300035116 Bacteria 2324
504 Ga0373953_0000578 3300035117 Bacteria 10189
505 Ga0373953_0002486 3300035117 Bacteria 5578
506 Ga0373954_0001627 3300035118 Bacteria 9195
507 Ga0373954_0040916 3300035118 Bacteria 2160
508 Ga0373956_0001905 3300035119 Bacteria 8610
509 Ga0373957_0000887 3300035120 Bacteria 7827
510 Ga0373960_0000108 3300035121 Bacteria 13171
511 Ga0373960_0014890 3300035121 Bacteria 1977
512 Ga0373943_0025977 3300035170 Bacteria 2740
513 Ga0373943_0090527 3300035170 Bacteria 1584
514 Ga0373943_0099870 3300035170 Bacteria 1516
515 Ga0373946_0032273 3300035171 Bacteria 2102
516 Ga0373955_0000175 3300035172 Bacteria 26347
517 Ga0373955_0013942 3300035172 Bacteria 3901
518 Ga0373942_0000232 3300035207 Bacteria 14790
519 Ga0373942_0001290 3300035207 Bacteria 6558
520 Ga0373961_0000666 3300035241 Bacteria 12175
521 Ga0373961_0001000 3300035241 Bacteria 9283
522 Ga0373924_0000864 3300035410 Bacteria 9547
523 Ga0373924_0054220 3300035410 Bacteria 1667
524 Ga0373924_0058362 3300035410 Bacteria 1611
525 Ga0373931_0000084 3300035691 Bacteria 44377
526 Ga0373931_0000494 3300035691 Bacteria 16104
527 Ga0373931_0007939 3300035691 Bacteria 5021
528 Ga0373931_0018612 3300035691 Bacteria 3457
529 Ga0373935_0084039 3300035692 Bacteria 2073
530 Ga0373935_0251671 3300035692 Bacteria 1236
531 Ga0373927_0007901 3300035695 Bacteria 7188
532 Ga0373927_0008654 3300035695 Bacteria 6840
533 Ga0373947_0027758 3300035725 Bacteria 3314
534 Ga0373947_0113242 3300035725 Bacteria 1717
535 Ga0373937_0025710 3300036401 Bacteria 5317
536 Ga0373937_0028847 3300036401 Bacteria 5024
537 Ga0373937_0091616 3300036401 Unclassified 2817
538 Ga0373937_0122848 3300036401 Bacteria 2421
539 Ga0373937_0324634 3300036401 Bacteria 1456
540 Ga0373925_0003332 3300037068 Bacteria 12485
541 Ga0373925_0020865 3300037068 Bacteria 4775
542 Ga0373925_0034015 3300037068 Bacteria 3756
543 Ga0373925_0045279 3300037068 Bacteria 3268
544 Ga0373925_0092277 3300037068 Bacteria 2316
545 Ga0395900_0050508 3300037418 Bacteria 4283
546 Ga0395898_0021789 3300037466 Bacteria 6492
547 Ga0395901_0003398 3300038443 Bacteria 16036
548 Ga0395901_0014946 3300038443 Bacteria 7888
549 Ga0436362_0393363 3300039453 Bacteria 1186
550 Ga0439455_0001935 3300042012 Bacteria 3643
551 Ga0466966_0040567 3300044684 Unclassified 2996
552 Ga0453684_0078254 3300044712 Bacteria 4139
553 Ga0466959_0005260 3300045049 Bacteria 8839
554 Ga0495592_0001017 3300046454 Bacteria 19452
555 Ga0495592_0007899 3300046454 Bacteria 7978
556 Ga0495603_0001247 3300046455 Bacteria 14873
557 Ga0495603_0021569 3300046455 Bacteria 3901
558 Ga0495603_0109076 3300046455 Bacteria 1615
559 Ga0495629_0001052 3300046459 Bacteria 22061
560 Ga0495629_0001205 3300046459 Bacteria 20378
561 Ga0495641_0013443 3300046461 Bacteria 4499
562 Ga0495641_0072818 3300046461 Bacteria 1541
563 Ga0495651_0037434 3300046462 Bacteria 3776
564 Ga0495653_0008098 3300046463 Bacteria 8610
565 Ga0495653_0060993 3300046463 Bacteria 2855
566 Ga0495580_0036343 3300046472 Bacteria 3536
567 Ga0495582_0000221 3300046473 Bacteria 31591
568 Ga0495582_0002529 3300046473 Bacteria 10175
569 Ga0495582_0011254 3300046473 Bacteria 4930
570 Ga0495582_0105981 3300046473 Bacteria 1576
571 Ga0495639_0001053 3300046475 Bacteria 12441
572 Ga0495662_0005160 3300046476 Bacteria 6548
573 Ga0495584_0064495 3300046491 Bacteria 1842
574 Ga0495584_0067001 3300046491 Bacteria 1806
575 Ga0495584_0080323 3300046491 Bacteria 1641
576 Ga0495585_0017904 3300046492 Bacteria 4089
577 Ga0495594_0003526 3300046499 Bacteria 8057
578 Ga0495594_0007017 3300046499 Bacteria 5791
579 Ga0495607_0095057 3300046501 Bacteria 1607
580 Ga0495618_0085903 3300046514 Bacteria 2011
581 Ga0495628_0001389 3300046516 Bacteria 22209
582 Ga0495630_0002234 3300046517 Bacteria 13474
583 Ga0495632_0043518 3300046519 Bacteria 2244
584 Ga0495666_0034071 3300046526 Bacteria 2485
585 Ga0495666_0042705 3300046526 Bacteria 2191
586 Ga0495665_0000755 3300046531 Bacteria 16775
587 Ga0495640_0014178 3300046533 Bacteria 6042
588 Ga0495640_0046151 3300046533 Bacteria 3020
589 Ga0495587_0005876 3300046536 Bacteria 7995
590 Ga0495598_0008275 3300046537 Bacteria 2416
591 Ga0495598_0074145 3300046537 Bacteria 1078
592 Ga0495645_0000359 3300046543 Bacteria 31690
593 Ga0495645_0113424 3300046543 Bacteria 1916
594 Ga0495622_0016865 3300046557 Bacteria 3400
595 Ga0495667_0008233 3300046559 Bacteria 7073
596 Ga0495667_0064630 3300046559 Bacteria 2393
597 Ga0495656_0100005 3300046615 Bacteria 1340
598 Ga0495668_0100798 3300046616 Bacteria 1580
599 Ga0495634_0003584 3300046642 Bacteria 12413
600 Ga0495634_0006941 3300046642 Bacteria 8552
601 Ga0495635_0010668 3300046663 Bacteria 6431
602 Ga0495635_0011640 3300046663 Bacteria 6165
603 Ga0495661_0080219 3300046665 Bacteria 1884
604 Ga0495588_0027388 3300046674 Bacteria 2848
605 Ga0495657_0010478 3300046675 Bacteria 6974
606 Ga0495599_0004983 3300046678 Bacteria 7898
607 Ga0495599_0047473 3300046678 Bacteria 2691
608 Ga0495623_0022892 3300046679 Bacteria 4034
609 Ga0495646_0016189 3300046680 Bacteria 4733
610 Ga0495647_0001581 3300046681 Bacteria 7034
611 Ga0495613_0000393 3300046689 Bacteria 37458
612 Ga0495613_0002804 3300046689 Bacteria 13079
613 Ga0495613_0123852 3300046689 Bacteria 1854
614 Ga0495624_0000182 3300046690 Bacteria 46968
615 Ga0495624_0036468 3300046690 Bacteria 3169
616 Ga0495649_0060592 3300046694 Bacteria 2036
617 Ga0495600_0001577 3300046809 Bacteria 12681
618 Ga0495581_0000093 3300047315 Bacteria 36772
619 Ga0495604_0017879 3300047317 Bacteria 5672
620 Ga0495674_0005687 3300047319 Bacteria 11939
621 Ga0495674_0095353 3300047319 Bacteria 2537
622 Ga0495674_0232056 3300047319 Bacteria 1523
623 Ga0495674_0252583 3300047319 Bacteria 1451
624 Ga0495676_0024359 3300047321 Bacteria 5241
625 Ga0495676_0040682 3300047321 Bacteria 3833
626 Ga0495680_0022292 3300047322 Bacteria 5281
627 Ga0495680_0027232 3300047322 Bacteria 4698
628 Ga0495675_0018960 3300047444 Bacteria 4369
629 Ga0495685_067404 3300047447 Bacteria 1202
630 Ga0495684_0000820 3300047471 Bacteria 25141
631 Ga0495593_0000827 3300047673 Bacteria 17976
632 Ga0495626_0051454 3300048091 Bacteria 1900
633 Ga0496100_0000764 3300048903 Bacteria 15274
634 Ga0496100_0035775 3300048903 Bacteria 3126
635 Ga0496100_0148799 3300048903 Bacteria 1668
636 Ga0496100_0149559 3300048903 Bacteria 1664
637 Ga0496100_0211998 3300048903 Bacteria 1417
638 Ga0496100_0254855 3300048903 Bacteria 1299
639 Ga0496101_0003468 3300048904 Bacteria 9842
640 Ga0496101_0014395 3300048904 Bacteria 5314
641 Ga0496101_0031669 3300048904 Bacteria 3719
642 Ga0496101_0067460 3300048904 Bacteria 2612
643 Ga0496101_0099022 3300048904 Bacteria 2179
644 Ga0496102_0007474 3300048905 Bacteria 9338
645 Ga0496102_0022873 3300048905 Bacteria 5543
646 Ga0496102_0030198 3300048905 Bacteria 4850
647 Ga0496102_0041352 3300048905 Bacteria 4173
648 Ga0496102_0104173 3300048905 Bacteria 2639
649 Ga0496102_0206151 3300048905 Bacteria 1854
650 Ga0496103_0001517 3300048906 Bacteria 15519
651 Ga0496103_0066124 3300048906 Bacteria 2256
652 Ga0496103_0100997 3300048906 Bacteria 1826
653 Ga0496104_0000086 3300048907 Bacteria 89916
654 Ga0496104_0004926 3300048907 Bacteria 11648
655 Ga0496104_0008501 3300048907 Bacteria 9130
656 Ga0496104_0040247 3300048907 Bacteria 4380
657 Ga0496104_0042897 3300048907 Bacteria 4248
658 Ga0496104_0081606 3300048907 Bacteria 3084
659 Ga0496104_0108990 3300048907 Bacteria 2654
660 Ga0496104_0340744 3300048907 Bacteria 1412
661 Ga0496105_0000126 3300048908 Bacteria 51169
662 Ga0496105_0014861 3300048908 Bacteria 6198
663 Ga0496105_0205299 3300048908 Bacteria 1607
664 Ga0496106_0000679 3300048909 Bacteria 24408
665 Ga0496106_0054199 3300048909 Bacteria 3029
666 Ga0496106_0148270 3300048909 Bacteria 1849
667 Ga0496106_0198217 3300048909 Bacteria 1597
668 Ga0496107_0000078 3300048910 Bacteria 46997
669 Ga0496107_0047175 3300048910 Bacteria 3102
670 Ga0496107_0171249 3300048910 Bacteria 1611
671 Ga0496108_0002072 3300048911 Bacteria 16038
672 Ga0496108_0022206 3300048911 Bacteria 5217
673 Ga0496108_0065772 3300048911 Bacteria 3056
674 Ga0496109_0000406 3300048912 Bacteria 38388
675 Ga0496109_0001673 3300048912 Bacteria 18482
676 Ga0496109_0004222 3300048912 Bacteria 11987
677 Ga0496109_0028801 3300048912 Bacteria 4971
678 Ga0496109_0063539 3300048912 Bacteria 3377
679 Ga0496109_0077972 3300048912 Bacteria 3049
680 Ga0496109_0174413 3300048912 Bacteria 2018
681 Ga0496110_0012691 3300048913 Bacteria 6934
682 Ga0496110_0012834 3300048913 Bacteria 6902
683 Ga0496110_0033216 3300048913 Bacteria 4461
684 Ga0496110_0065237 3300048913 Bacteria 3219
685 Ga0496110_0095429 3300048913 Bacteria 2663
686 Ga0496110_0247160 3300048913 Bacteria 1623
687 Ga0496110_0249396 3300048913 Bacteria 1616
688 Ga0496110_0386640 3300048913 Bacteria 1275
689 Ga0496111_0025158 3300048914 Bacteria 4198
690 Ga0496111_0036370 3300048914 Bacteria 3520
691 Ga0496111_0041711 3300048914 Bacteria 3294
692 Ga0496111_0044673 3300048914 Bacteria 3185
693 Ga0496111_0099634 3300048914 Bacteria 2134
694 Ga0496111_0120539 3300048914 Bacteria 1937
695 Ga0496112_0019395 3300048915 Bacteria 6419
696 Ga0496112_0096078 3300048915 Bacteria 2934
697 Ga0496112_0097332 3300048915 Bacteria 2913
698 Ga0496112_0485709 3300048915 Bacteria 1171
699 Ga0496113_0001460 3300048916 Bacteria 13167
700 Ga0496113_0017355 3300048916 Bacteria 4994
701 Ga0496113_0043809 3300048916 Bacteria 3313
702 Ga0496113_0107228 3300048916 Bacteria 2170
703 Ga0496113_0136034 3300048916 Bacteria 1931
704 Ga0496113_0193901 3300048916 Bacteria 1613
705 Ga0496114_0005590 3300048917 Bacteria 9855
706 Ga0496114_0008843 3300048917 Bacteria 7982
707 Ga0496114_0029110 3300048917 Bacteria 4537
708 Ga0496114_0071714 3300048917 Bacteria 2911
709 Ga0496114_0078697 3300048917 Bacteria 2782
710 Ga0496114_0300504 3300048917 Bacteria 1417
711 Ga0496115_0004237 3300048918 Bacteria 10369
712 Ga0496115_0007631 3300048918 Bacteria 7971
713 Ga0496115_0058356 3300048918 Bacteria 3106
714 Ga0496115_0092834 3300048918 Bacteria 2468
715 Ga0496115_0095640 3300048918 Bacteria 2432
716 Ga0501033_0022816 3300049570 Bacteria 4718
717 Ga0501033_0045901 3300049570 Bacteria 3250
718 Ga0501034_0073053 3300049571 Bacteria 3438
719 Ga0501036_0010943 3300049572 Bacteria 7499
720 Ga0501037_0013366 3300049573 Bacteria 6047
721 Ga0501038_0010259 3300049574 Bacteria 8571
722 Ga0501038_0180510 3300049574 Bacteria 1703
723 Ga0501039_0007484 3300049575 Bacteria 8337
724 Ga0501039_0153845 3300049575 Bacteria 1807
725 Ga0501042_0116411 3300049578 Bacteria 1924
726 Ga0501043_0025254 3300049579 Bacteria 4661
727 Ga0501046_0013958 3300049580 Bacteria 6785
728 Ga0501047_0078028 3300049581 Bacteria 3185
729 Ga0501048_0001781 3300049582 Bacteria 16367
730 Ga0501048_0204323 3300049582 Bacteria 1401
731 Ga0501067_0014605 3300049583 Bacteria 4347
732 Ga0501068_0017660 3300049584 Bacteria 4128
733 Ga0501068_0131683 3300049584 Bacteria 1564
734 Ga0501069_0031721 3300049585 Bacteria 2908
735 Ga0501070_0020533 3300049586 Bacteria 5540
736 Ga0501071_0005688 3300049587 Bacteria 8042
737 Ga0501071_0064510 3300049587 Bacteria 2657
738 Ga0501072_0048450 3300049588 Bacteria 3346
739 Ga0501072_0282925 3300049588 Bacteria 1319
740 Ga0501073_0028888 3300049589 Bacteria 3962
741 Ga0501074_0164344 3300049590 Bacteria 1585
742 Ga0501075_0082700 3300049591 Bacteria 2432
743 Ga0501075_0255217 3300049591 Bacteria 1336
744 Ga0501076_0072897 3300049592 Bacteria 2749
745 Ga0501076_0084933 3300049592 Bacteria 2543
746 Ga0501076_0135108 3300049592 Bacteria 2002
747 Ga0501077_0115300 3300049593 Bacteria 1703
748 Ga0501077_0153567 3300049593 Bacteria 1461
749 Ga0501077_0159680 3300049593 Bacteria 1431
750 Ga0501079_0025644 3300049741 Bacteria 4519
751 Ga0501079_0141339 3300049741 Bacteria 1875
752 Ga0501081_0091331 3300049743 Bacteria 2141
753 Ga0501083_0015718 3300049744 Bacteria 5297
754 Ga0501083_0029748 3300049744 Bacteria 3754
755 Ga0501035_0008784 3300049822 Bacteria 9407
756 Ga0501035_0018830 3300049822 Bacteria 6361
757 Ga0501044_0000361 3300049823 Bacteria 56979
758 Ga0501044_0012272 3300049823 Bacteria 9275
759 Ga0501044_0033572 3300049823 Bacteria 5391
760 Ga0501044_0049843 3300049823 Bacteria 4322
761 Ga0501045_0129268 3300049824 Bacteria 1877
762 Ga0501045_0203981 3300049824 Bacteria 1473
763 nmdc:mga03683_26217_c1 3300050489 Bacteria 2298
764 nmdc:mga03n38_42337_c1 3300050490 Bacteria 1990
765 nmdc:mga0yw44_45643_c1 3300050492 Bacteria 2628
766 nmdc:mga0yw44_94441_c1 3300050492 Bacteria 1895
767 nmdc:mga0yw44_9643_c1 3300050492 Bacteria 4897
768 nmdc:mga0k408_24125_c1 3300050493 Bacteria 3436
769 nmdc:mga06z11_26901_c1 3300050494 Bacteria 2744
770 nmdc:mga06z11_28752_c1 3300050494 Bacteria 2670
771 nmdc:mga06z11_30625_c1 3300050494 Bacteria 2605
772 nmdc:mga06z11_52236_c1 3300050494 Bacteria 2096
773 nmdc:mga05p37_16000_c2 3300050507 Bacteria 6104
774 nmdc:mga05p37_27070_c1 3300050507 Bacteria 6978
775 nmdc:mga05p37_365352_c1 3300050507 Bacteria 1695
776 nmdc:mga05p37_4104_c1 3300050507 Bacteria 17023
777 nmdc:mga05p37_531_c1 3300050507 Bacteria 42040
778 nmdc:mga05p37_6362_c1 3300050507 Bacteria 13917
779 nmdc:mga05p37_694042_c1 3300050507 Unclassified 1132
780 nmdc:mga09592_1318_c1 3300050508 Bacteria 19917
781 nmdc:mga09592_2402_c1 3300050508 Bacteria 15117
782 nmdc:mga0qj67_16803_c1 3300050509 Bacteria 5557
783 nmdc:mga0qj67_3470_c1 3300050509 Bacteria 11358
784 nmdc:mga0qj67_413_c1 3300050509 Bacteria 29228
785 nmdc:mga06r32_105143_c1 3300050510 Unclassified 2773
786 nmdc:mga06r32_1369_c1 3300050510 Bacteria 22022
787 nmdc:mga06r32_15_c1 3300050510 Bacteria 106010
788 nmdc:mga06r32_1915_c1 3300050510 Bacteria 18535
789 nmdc:mga06r32_299562_c1 3300050510 Bacteria 1594
790 nmdc:mga06r32_81997_c1 3300050510 Bacteria 3141
791 nmdc:mga08y16_132617_c1 3300050511 Bacteria 2590
792 nmdc:mga08y16_2163_c1 3300050511 Bacteria 20157
793 nmdc:mga08y16_2892_c1 3300050511 Bacteria 17659
794 nmdc:mga08y16_29359_c1 3300050511 Bacteria 5794
795 nmdc:mga08y16_3734_c1 3300050511 Bacteria 15850
796 nmdc:mga08y16_502150_c1 3300050511 Bacteria 1232
797 nmdc:mga08y16_88647_c1 3300050511 Bacteria 3224
798 nmdc:mga08y16_91_c4 3300050511 Bacteria 3465
799 nmdc:mga0n895_111610_c1 3300050512 Bacteria 2750
800 nmdc:mga0n895_137945_c1 3300050512 Bacteria 2466
801 nmdc:mga0n895_141275_c1 3300050512 Bacteria 2436
802 nmdc:mga0n895_209_c1 3300050512 Bacteria 36635
803 nmdc:mga0n895_232792_c1 3300050512 Bacteria 1870
804 nmdc:mga0n895_4169_c1 3300050512 Bacteria 11801
805 nmdc:mga0n895_60015_c1 3300050512 Bacteria 3752
806 nmdc:mga0n895_82182_c1 3300050512 Bacteria 3211
807 nmdc:mga0rr50_37915_c1 3300050513 Bacteria 3483
808 nmdc:mga0rr50_591_c1 3300050513 Bacteria 19417
809 nmdc:mga0a205_12176_c1 3300050515 Bacteria 7953
810 nmdc:mga0a205_306300_c1 3300050515 Bacteria 1461
811 nmdc:mga0a205_82673_c1 3300050515 Bacteria 3102
812 nmdc:mga0a205_9124_c1 3300050515 Bacteria 9052
813 Ga0495601_0000137 3300053077 Bacteria 41334
814 Ga0495601_0022124 3300053077 Bacteria 3901
815 Ga0495601_0079273 3300053077 Bacteria 2105
816 Ga0495601_0202313 3300053077 Bacteria 1297
817 Ga0495612_0000679 3300053078 Bacteria 13704
818 Ga0495595_0001498 3300053084 Bacteria 9126
819 Ga0495595_0001994 3300053084 Bacteria 7944
820 Ga0495619_0099834 3300053085 Bacteria 1974
821 Ga0495619_0132323 3300053085 Bacteria 1714
822 Ga0500554_058796 3300053102 Bacteria 1228
823 Ga0500595_005762 3300053119 Bacteria 5359
824 Ga0500603_000736 3300053150 Bacteria 7974
825 Ga0500616_0019864 3300053153 Bacteria 3782
826 Ga0500616_0040270 3300053153 Bacteria 2514
827 Ga0500637_0152687 3300053178 Bacteria 1333
828 Ga0501084_0002309 3300054114 Bacteria 15309
829 Ga0501084_0079471 3300054114 Bacteria 2749
830 Ga0501084_0096575 3300054114 Bacteria 2481
831 Ga0501084_0179675 3300054114 Bacteria 1786
832 Ga0501082_0032278 3300060353 Bacteria 4516
833 Ga0501082_0232485 3300060353 Bacteria 1604
834 Ga0501082_0269410 3300060353 Bacteria 1482
835 Ga0530510_0186571 3300061734 Bacteria 1539

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0153567 Ga0501077_0153567_54_1007 305
2 3300046537 Ga0495598_0074145 Ga0495598_0074145_40_1056 316
3 3300047319 Ga0495674_0232056 Ga0495674_0232056_13_984 316
4 3300050494 nmdc:mga06z11_30625_c1 nmdc:mga06z11_30625_c1_1496_2542 322
5 3300035170 Ga0373943_0099870 Ga0373943_0099870_438_1484 324
6 3300060353 Ga0501082_0232485 Ga0501082_0232485_605_1582 324
7 3300009098 Ga0105245_10054347 Ga0105245_100543474 325
8 3300009101 Ga0105247_10012021 Ga0105247_100120213 325
9 3300009177 Ga0105248_10006875 Ga0105248_1000687512 325
10 3300009545 Ga0105237_10023530 Ga0105237_100235303 325
11 3300010375 Ga0105239_10141445 Ga0105239_101414454 325
12 3300013296 Ga0157374_10121362 Ga0157374_101213621 325
13 3300013308 Ga0157375_10015199 Ga0157375_100151994 325
14 3300014325 Ga0163163_10032794 Ga0163163_100327943 325
15 3300014745 Ga0157377_10017981 Ga0157377_100179813 325
16 3300014968 Ga0157379_10019284 Ga0157379_100192847 325
17 3300047447 Ga0495685_067404 Ga0495685_067404_12_1058 325
18 3300048904 Ga0496101_0014395 Ga0496101_0014395_569_1615 325
19 3300048905 Ga0496102_0007474 Ga0496102_0007474_4928_5974 325
20 3300048909 Ga0496106_0054199 Ga0496106_0054199_1684_2730 325
21 3300048912 Ga0496109_0077972 Ga0496109_0077972_1857_2903 325
22 3300048913 Ga0496110_0247160 Ga0496110_0247160_147_1193 325
23 3300048914 Ga0496111_0099634 Ga0496111_0099634_812_1858 325
24 3300048915 Ga0496112_0019395 Ga0496112_0019395_2342_3388 325
25 3300048918 Ga0496115_0007631 Ga0496115_0007631_4300_5346 325
26 3300009551 Ga0105238_10096307 Ga0105238_100963073 326
27 3300046501 Ga0495607_0095057 Ga0495607_0095057_420_1466 326
28 3300046519 Ga0495632_0043518 Ga0495632_0043518_892_1938 326
29 3300046615 Ga0495656_0100005 Ga0495656_0100005_221_1267 326
30 3300046616 Ga0495668_0100798 Ga0495668_0100798_260_1306 326
31 3300046694 Ga0495649_0060592 Ga0495649_0060592_284_1330 326
32 3300048091 Ga0495626_0051454 Ga0495626_0051454_166_1212 326
33 3300048917 Ga0496114_0008843 Ga0496114_0008843_3352_4398 326
34 3300035083 Ga0373926_0064737 Ga0373926_0064737_155_1222 331
35 3300037068 Ga0373925_0020865 Ga0373925_0020865_2061_3128 331
36 3300039453 Ga0436362_0393363 Ga0436362_0393363_110_1123 331
37 3300048903 Ga0496100_0148799 Ga0496100_0148799_501_1526 331
38 3300048917 Ga0496114_0005590 Ga0496114_0005590_8479_9504 331
39 3300049584 Ga0501068_0131683 Ga0501068_0131683_17_1015 331
40 3300053085 Ga0495619_0099834 Ga0495619_0099834_932_1957 331
41 3300009093 Ga0105240_10032816 Ga0105240_100328163 333
42 3300009545 Ga0105237_10007504 Ga0105237_1000750411 333
43 3300010375 Ga0105239_10007410 Ga0105239_1000741012 333
44 3300025914 Ga0207671_10004932 Ga0207671_100049323 333
45 3300050507 nmdc:mga05p37_694042_c1 nmdc:mga05p37_694042_c1_67_1089 333
46 3300046537 Ga0495598_0008275 Ga0495598_0008275_1305_2351 336
47 3300050492 nmdc:mga0yw44_94441_c1 nmdc:mga0yw44_94441_c1_261_1301 339
48 3300009101 Ga0105247_10092998 Ga0105247_100929982 341
49 3300009147 Ga0114129_10001337 Ga0114129_1000133724 341
50 3300013297 Ga0157378_10124457 Ga0157378_101244573 341
51 3300014325 Ga0163163_10008982 Ga0163163_100089827 341
52 3300025921 Ga0207652_10001041 Ga0207652_1000104119 341
53 3300035170 Ga0373943_0025977 Ga0373943_0025977_1208_2254 341
54 3300035171 Ga0373946_0032273 Ga0373946_0032273_479_1525 341
55 3300035692 Ga0373935_0251671 Ga0373935_0251671_76_1122 341
56 3300035695 Ga0373927_0008654 Ga0373927_0008654_2409_3455 341
57 3300035725 Ga0373947_0027758 Ga0373947_0027758_1446_2492 341
58 3300037068 Ga0373925_0092277 Ga0373925_0092277_1151_2197 341
59 3300046455 Ga0495603_0021569 Ga0495603_0021569_1726_2772 341
60 3300046461 Ga0495641_0072818 Ga0495641_0072818_238_1284 341
61 3300046473 Ga0495582_0011254 Ga0495582_0011254_2727_3773 341
62 3300046473 Ga0495582_0105981 Ga0495582_0105981_105_1151 341
63 3300046492 Ga0495585_0017904 Ga0495585_0017904_592_1638 341
64 3300046499 Ga0495594_0007017 Ga0495594_0007017_3779_4825 341
65 3300046665 Ga0495661_0080219 Ga0495661_0080219_100_1146 341
66 3300046689 Ga0495613_0123852 Ga0495613_0123852_416_1462 341
67 3300046690 Ga0495624_0036468 Ga0495624_0036468_1883_2929 341
68 3300047321 Ga0495676_0040682 Ga0495676_0040682_1608_2654 341
69 3300048903 Ga0496100_0254855 Ga0496100_0254855_207_1253 341
70 3300048904 Ga0496101_0099022 Ga0496101_0099022_403_1449 341
71 3300048906 Ga0496103_0066124 Ga0496103_0066124_976_2022 341
72 3300048907 Ga0496104_0008501 Ga0496104_0008501_4540_5586 341
73 3300048908 Ga0496105_0014861 Ga0496105_0014861_2376_3422 341
74 3300048910 Ga0496107_0047175 Ga0496107_0047175_955_2001 341
75 3300048911 Ga0496108_0022206 Ga0496108_0022206_61_1107 341
76 3300048912 Ga0496109_0001673 Ga0496109_0001673_7178_8224 341
77 3300048913 Ga0496110_0095429 Ga0496110_0095429_240_1286 341
78 3300048913 Ga0496110_0249396 Ga0496110_0249396_172_1218 341
79 3300048914 Ga0496111_0025158 Ga0496111_0025158_2499_3545 341
80 3300048916 Ga0496113_0001460 Ga0496113_0001460_8860_9906 341
81 3300048917 Ga0496114_0029110 Ga0496114_0029110_2886_3932 341
82 3300050492 nmdc:mga0yw44_45643_c1 nmdc:mga0yw44_45643_c1_770_1816 341
83 3300050494 nmdc:mga06z11_28752_c1 nmdc:mga06z11_28752_c1_416_1462 341
84 3300050507 nmdc:mga05p37_16000_c2 nmdc:mga05p37_16000_c2_387_1433 341
85 3300050510 nmdc:mga06r32_299562_c1 nmdc:mga06r32_299562_c1_415_1461 341
86 3300050511 nmdc:mga08y16_502150_c1 nmdc:mga08y16_502150_c1_48_1094 341
87 3300050512 nmdc:mga0n895_111610_c1 nmdc:mga0n895_111610_c1_1302_2348 341
88 3300053085 Ga0495619_0132323 Ga0495619_0132323_545_1591 341
89 3300060353 Ga0501082_0269410 Ga0501082_0269410_414_1466 341
90 3300005347 Ga0070668_100057949 Ga0070668_1000579493 343
91 3300005365 Ga0070688_100009829 Ga0070688_1000098294 343
92 3300005435 Ga0070714_100013260 Ga0070714_1000132605 343
93 3300025923 Ga0207681_10035982 Ga0207681_100359822 343
94 3300025929 Ga0207664_10084933 Ga0207664_100849332 343
95 3300026121 Ga0207683_10139099 Ga0207683_101390992 343
96 3300035086 Ga0373934_0050861 Ga0373934_0050861_509_1540 343
97 3300035117 Ga0373953_0002486 Ga0373953_0002486_2724_3755 343
98 3300035118 Ga0373954_0040916 Ga0373954_0040916_888_1919 343
99 3300035410 Ga0373924_0054220 Ga0373924_0054220_408_1439 343
100 3300035692 Ga0373935_0084039 Ga0373935_0084039_19_1050 343
101 3300036401 Ga0373937_0324634 Ga0373937_0324634_191_1222 343
102 3300037068 Ga0373925_0045279 Ga0373925_0045279_1095_2126 343
103 3300046454 Ga0495592_0007899 Ga0495592_0007899_543_1574 343
104 3300046462 Ga0495651_0037434 Ga0495651_0037434_434_1465 343
105 3300046516 Ga0495628_0001389 Ga0495628_0001389_3667_4698 343
106 3300046536 Ga0495587_0005876 Ga0495587_0005876_164_1195 343
107 3300046543 Ga0495645_0000359 Ga0495645_0000359_9288_10319 343
108 3300046559 Ga0495667_0064630 Ga0495667_0064630_84_1115 343
109 3300046678 Ga0495599_0047473 Ga0495599_0047473_1441_2472 343
110 3300046809 Ga0495600_0001577 Ga0495600_0001577_10782_11813 343
111 3300047319 Ga0495674_0252583 Ga0495674_0252583_20_1084 343
112 3300047322 Ga0495680_0027232 Ga0495680_0027232_797_1828 343
113 3300048907 Ga0496104_0000086 Ga0496104_0000086_49460_50491 343
114 3300048908 Ga0496105_0000126 Ga0496105_0000126_43918_44949 343
115 3300048917 Ga0496114_0078697 Ga0496114_0078697_135_1166 343
116 3300048918 Ga0496115_0058356 Ga0496115_0058356_1795_2826 343
117 3300048918 Ga0496115_0095640 Ga0496115_0095640_800_1867 343
118 3300049570 Ga0501033_0022816 Ga0501033_0022816_1794_2873 343
119 3300049571 Ga0501034_0073053 Ga0501034_0073053_1150_2229 343
120 3300049572 Ga0501036_0010943 Ga0501036_0010943_2109_3188 343
121 3300049573 Ga0501037_0013366 Ga0501037_0013366_1210_2289 343
122 3300049574 Ga0501038_0010259 Ga0501038_0010259_5897_6976 343
123 3300049575 Ga0501039_0007484 Ga0501039_0007484_2936_4015 343
124 3300049578 Ga0501042_0116411 Ga0501042_0116411_739_1818 343
125 3300049580 Ga0501046_0013958 Ga0501046_0013958_1338_2417 343
126 3300049582 Ga0501048_0001781 Ga0501048_0001781_5663_6742 343
127 3300049583 Ga0501067_0014605 Ga0501067_0014605_1391_2470 343
128 3300049584 Ga0501068_0017660 Ga0501068_0017660_1922_3001 343
129 3300049587 Ga0501071_0005688 Ga0501071_0005688_5349_6428 343
130 3300049589 Ga0501073_0028888 Ga0501073_0028888_945_2024 343
131 3300049592 Ga0501076_0135108 Ga0501076_0135108_826_1905 343
132 3300049741 Ga0501079_0025644 Ga0501079_0025644_1391_2470 343
133 3300049744 Ga0501083_0015718 Ga0501083_0015718_426_1505 343
134 3300049822 Ga0501035_0008784 Ga0501035_0008784_2427_3506 343
135 3300049823 Ga0501044_0000361 Ga0501044_0000361_43296_44375 343
136 3300049823 Ga0501044_0033572 Ga0501044_0033572_2975_4054 343
137 3300049824 Ga0501045_0129268 Ga0501045_0129268_243_1322 343
138 3300053077 Ga0495601_0000137 Ga0495601_0000137_38099_39130 343
139 3300053078 Ga0495612_0000679 Ga0495612_0000679_1598_2629 343
140 3300053084 Ga0495595_0001994 Ga0495595_0001994_2855_3886 343
141 3300054114 Ga0501084_0002309 Ga0501084_0002309_11332_12411 343
142 3300060353 Ga0501082_0032278 Ga0501082_0032278_2403_3482 343
143 3300005434 Ga0070709_10090603 Ga0070709_100906032 346
144 3300006844 Ga0075428_100000945 Ga0075428_10000094527 346
145 3300006846 Ga0075430_100012439 Ga0075430_1000124397 346
146 3300006847 Ga0075431_100000864 Ga0075431_10000086413 346
147 3300006880 Ga0075429_100042323 Ga0075429_1000423232 346
148 3300006844 Ga0075428_100339283 Ga0075428_1003392831 349
149 3300031241 Ga0265325_10019773 Ga0265325_100197733 349
150 3300031250 Ga0265331_10036762 Ga0265331_100367621 349
151 3300031344 Ga0265316_10144407 Ga0265316_101444072 349
152 3300031712 Ga0265342_10012693 Ga0265342_100126932 349
153 3300035725 Ga0373947_0113242 Ga0373947_0113242_146_1276 349
154 3300050510 nmdc:mga06r32_81997_c1 nmdc:mga06r32_81997_c1_595_1734 349
155 3300050507 nmdc:mga05p37_365352_c1 nmdc:mga05p37_365352_c1_23_1123 350
156 3300050489 nmdc:mga03683_26217_c1 nmdc:mga03683_26217_c1_595_1692 351
157 3300050494 nmdc:mga06z11_52236_c1 nmdc:mga06z11_52236_c1_924_2021 351
158 3300005844 Ga0068862_100203993 Ga0068862_1002039931 352
159 3300048915 Ga0496112_0485709 Ga0496112_0485709_69_1148 352
160 3300049575 Ga0501039_0153845 Ga0501039_0153845_556_1635 352
161 3300049588 Ga0501072_0282925 Ga0501072_0282925_38_1132 352
162 3300049592 Ga0501076_0084933 Ga0501076_0084933_1178_2257 352
163 3300049741 Ga0501079_0141339 Ga0501079_0141339_601_1680 352
164 3300049587 Ga0501071_0064510 Ga0501071_0064510_767_1834 354
165 3300049593 Ga0501077_0159680 Ga0501077_0159680_327_1394 354
166 3300061734 Ga0530510_0186571 Ga0530510_0186571_199_1266 354
167 3300031235 Ga0265330_10045863 Ga0265330_100458632 356
168 3300031250 Ga0265331_10024375 Ga0265331_100243752 356
169 3300049574 Ga0501038_0180510 Ga0501038_0180510_439_1602 356
170 3300049579 Ga0501043_0025254 Ga0501043_0025254_2978_4141 356
171 3300049581 Ga0501047_0078028 Ga0501047_0078028_1360_2523 356
172 3300049586 Ga0501070_0020533 Ga0501070_0020533_1074_2237 356
173 3300049743 Ga0501081_0091331 Ga0501081_0091331_476_1618 356
174 3300049822 Ga0501035_0018830 Ga0501035_0018830_4700_5863 356
175 3300049823 Ga0501044_0049843 Ga0501044_0049843_3132_4295 356
176 3300050511 nmdc:mga08y16_88647_c1 nmdc:mga08y16_88647_c1_904_2013 356
177 3300002077 JGI24744J21845_10001479 JGI24744J21845_100014793 357
178 3300005330 Ga0070690_100008341 Ga0070690_1000083416 357
179 3300005331 Ga0070670_100010481 Ga0070670_1000104812 357
180 3300005334 Ga0068869_100093314 Ga0068869_1000933142 357
181 3300005335 Ga0070666_10011843 Ga0070666_100118436 357
182 3300005338 Ga0068868_100007091 Ga0068868_1000070918 357
183 3300005340 Ga0070689_100002363 Ga0070689_1000023634 357
184 3300005343 Ga0070687_100060447 Ga0070687_1000604472 357
185 3300005354 Ga0070675_100006337 Ga0070675_10000633710 357
186 3300005355 Ga0070671_100043196 Ga0070671_1000431962 357
187 3300005365 Ga0070688_100029833 Ga0070688_1000298334 357
188 3300005367 Ga0070667_100009767 Ga0070667_1000097675 357
189 3300005438 Ga0070701_10022221 Ga0070701_100222212 357
190 3300005439 Ga0070711_100120613 Ga0070711_1001206132 357
191 3300005441 Ga0070700_100038892 Ga0070700_1000388923 357
192 3300005455 Ga0070663_100014182 Ga0070663_1000141822 357
193 3300005456 Ga0070678_100083113 Ga0070678_1000831131 357
194 3300005457 Ga0070662_100184016 Ga0070662_1001840161 357
195 3300005466 Ga0070685_10036941 Ga0070685_100369412 357
196 3300005535 Ga0070684_100023560 Ga0070684_1000235604 357
197 3300005544 Ga0070686_100005194 Ga0070686_1000051946 357
198 3300005549 Ga0070704_100078764 Ga0070704_1000787642 357
199 3300005564 Ga0070664_100023143 Ga0070664_1000231436 357
200 3300005618 Ga0068864_100008822 Ga0068864_1000088226 357
201 3300005718 Ga0068866_10022761 Ga0068866_100227612 357
202 3300005840 Ga0068870_10028939 Ga0068870_100289393 357
203 3300005841 Ga0068863_100018999 Ga0068863_1000189992 357
204 3300005842 Ga0068858_100075189 Ga0068858_1000751894 357
205 3300005843 Ga0068860_100020845 Ga0068860_1000208457 357
206 3300005844 Ga0068862_100076488 Ga0068862_1000764882 357
207 3300006163 Ga0070715_10063039 Ga0070715_100630392 357
208 3300006881 Ga0068865_100015689 Ga0068865_1000156894 357
209 3300025898 Ga0207692_10089732 Ga0207692_100897322 357
210 3300025899 Ga0207642_10037070 Ga0207642_100370702 357
211 3300025901 Ga0207688_10000735 Ga0207688_100007357 357
212 3300025905 Ga0207685_10027824 Ga0207685_100278242 357
213 3300025907 Ga0207645_10009017 Ga0207645_100090177 357
214 3300025908 Ga0207643_10000820 Ga0207643_100008204 357
215 3300025918 Ga0207662_10001103 Ga0207662_100011038 357
216 3300025925 Ga0207650_10007962 Ga0207650_100079625 357
217 3300025927 Ga0207687_10015396 Ga0207687_100153964 357
218 3300025931 Ga0207644_10119075 Ga0207644_101190752 357
219 3300025932 Ga0207690_10034446 Ga0207690_100344464 357
220 3300025933 Ga0207706_10010940 Ga0207706_100109402 357
221 3300025934 Ga0207686_10031116 Ga0207686_100311164 357
222 3300025940 Ga0207691_10001108 Ga0207691_1000110820 357
223 3300025941 Ga0207711_10083012 Ga0207711_100830123 357
224 3300025972 Ga0207668_10015910 Ga0207668_100159105 357
225 3300025986 Ga0207658_10021600 Ga0207658_100216005 357
226 3300026035 Ga0207703_10038453 Ga0207703_100384531 357
227 3300026075 Ga0207708_10005439 Ga0207708_100054395 357
228 3300026088 Ga0207641_10067239 Ga0207641_100672394 357
229 3300026118 Ga0207675_100002754 Ga0207675_10000275415 357
230 3300026121 Ga0207683_10009722 Ga0207683_100097224 357
231 3300028379 Ga0268266_10028193 Ga0268266_100281934 357
232 3300028380 Ga0268265_10037761 Ga0268265_100377614 357
233 3300005333 Ga0070677_10020671 Ga0070677_100206711 358
234 3300009551 Ga0105238_10302396 Ga0105238_103023961 358
235 3300017792 Ga0163161_10015961 Ga0163161_100159614 358
236 3300025924 Ga0207694_10076058 Ga0207694_100760582 358
237 3300025942 Ga0207689_10018552 Ga0207689_100185522 358
238 3300009553 Ga0105249_10042898 Ga0105249_100428981 359
239 3300037418 Ga0395900_0050508 Ga0395900_0050508_2162_3262 359
240 3300037466 Ga0395898_0021789 Ga0395898_0021789_4243_5343 359
241 3300038443 Ga0395901_0014946 Ga0395901_0014946_6428_7528 359
242 3300049591 Ga0501075_0082700 Ga0501075_0082700_221_1402 359
243 3300054114 Ga0501084_0179675 Ga0501084_0179675_437_1618 359
244 3300002077 JGI24744J21845_10003255 JGI24744J21845_100032554 362
245 3300006846 Ga0075430_100130940 Ga0075430_1001309402 362
246 3300006847 Ga0075431_100035827 Ga0075431_1000358272 362
247 3300038443 Ga0395901_0003398 Ga0395901_0003398_13165_14274 362
248 3300049585 Ga0501069_0031721 Ga0501069_0031721_582_1745 362
249 3300049744 Ga0501083_0029748 Ga0501083_0029748_982_2145 362
250 3300050509 nmdc:mga0qj67_16803_c1 nmdc:mga0qj67_16803_c1_4274_5383 362
251 3300050511 nmdc:mga08y16_132617_c1 nmdc:mga08y16_132617_c1_1322_2458 362
252 3300050512 nmdc:mga0n895_141275_c1 nmdc:mga0n895_141275_c1_502_1614 362
253 3300005983 Ga0081540_1024073 Ga0081540_10240733 364
254 3300006847 Ga0075431_100090910 Ga0075431_1000909102 364
255 3300006852 Ga0075433_10105325 Ga0075433_101053252 364
256 3300006871 Ga0075434_100045630 Ga0075434_1000456304 364
257 3300046491 Ga0495584_0067001 Ga0495584_0067001_384_1523 364
258 3300050512 nmdc:mga0n895_232792_c1 nmdc:mga0n895_232792_c1_413_1627 364
259 3300006871 Ga0075434_100075588 Ga0075434_1000755884 365
260 3300042012 Ga0439455_0001935 Ga0439455_0001935_32_1129 365
261 3300048913 Ga0496110_0033216 Ga0496110_0033216_3138_4256 365
262 3300048914 Ga0496111_0041711 Ga0496111_0041711_1905_3023 365
263 3300050512 nmdc:mga0n895_137945_c1 nmdc:mga0n895_137945_c1_1141_2259 365
264 3300050515 nmdc:mga0a205_306300_c1 nmdc:mga0a205_306300_c1_185_1303 365
265 3300005355 Ga0070671_100150959 Ga0070671_1001509592 366
266 3300009177 Ga0105248_10013011 Ga0105248_100130117 366
267 3300013297 Ga0157378_10074159 Ga0157378_100741592 366
268 3300035085 Ga0373929_0011950 Ga0373929_0011950_425_1591 366
269 3300035691 Ga0373931_0018612 Ga0373931_0018612_320_1486 366
270 3300048903 Ga0496100_0035775 Ga0496100_0035775_1864_3030 366
271 3300048904 Ga0496101_0031669 Ga0496101_0031669_482_1648 366
272 3300048905 Ga0496102_0022873 Ga0496102_0022873_4149_5324 366
273 3300048907 Ga0496104_0108990 Ga0496104_0108990_610_1776 366
274 3300048908 Ga0496105_0205299 Ga0496105_0205299_416_1582 366
275 3300048911 Ga0496108_0065772 Ga0496108_0065772_283_1449 366
276 3300048912 Ga0496109_0028801 Ga0496109_0028801_2558_3724 366
277 3300048913 Ga0496110_0012691 Ga0496110_0012691_1193_2359 366
278 3300048914 Ga0496111_0120539 Ga0496111_0120539_300_1466 366
279 3300048916 Ga0496113_0107228 Ga0496113_0107228_440_1606 366
280 3300048917 Ga0496114_0071714 Ga0496114_0071714_697_1863 366
281 3300009147 Ga0114129_10006361 Ga0114129_100063613 367
282 3300036401 Ga0373937_0091616 Ga0373937_0091616_67_1233 367
283 3300050507 nmdc:mga05p37_6362_c1 nmdc:mga05p37_6362_c1_1430_2575 367
284 3300009094 Ga0111539_10064483 Ga0111539_100644834 368
285 3300035086 Ga0373934_0002928 Ga0373934_0002928_1877_3022 368
286 3300035111 Ga0373923_0009157 Ga0373923_0009157_2189_3334 368
287 3300035117 Ga0373953_0000578 Ga0373953_0000578_5571_6716 368
288 3300035118 Ga0373954_0001627 Ga0373954_0001627_1241_2386 368
289 3300035119 Ga0373956_0001905 Ga0373956_0001905_5031_6176 368
290 3300035120 Ga0373957_0000887 Ga0373957_0000887_4302_5447 368
291 3300035172 Ga0373955_0000175 Ga0373955_0000175_12340_13485 368
292 3300035410 Ga0373924_0000864 Ga0373924_0000864_5781_6926 368
293 3300035691 Ga0373931_0007939 Ga0373931_0007939_2787_3935 368
294 3300036401 Ga0373937_0028847 Ga0373937_0028847_1241_2386 368
295 3300046454 Ga0495592_0001017 Ga0495592_0001017_14347_15492 368
296 3300046459 Ga0495629_0001205 Ga0495629_0001205_4658_5803 368
297 3300046463 Ga0495653_0008098 Ga0495653_0008098_3377_4522 368
298 3300046533 Ga0495640_0014178 Ga0495640_0014178_3199_4344 368
299 3300046559 Ga0495667_0008233 Ga0495667_0008233_1670_2815 368
300 3300046642 Ga0495634_0006941 Ga0495634_0006941_5972_7117 368
301 3300046663 Ga0495635_0010668 Ga0495635_0010668_3365_4510 368
302 3300046675 Ga0495657_0010478 Ga0495657_0010478_1571_2716 368
303 3300046678 Ga0495599_0004983 Ga0495599_0004983_3348_4493 368
304 3300046679 Ga0495623_0022892 Ga0495623_0022892_1241_2386 368
305 3300046680 Ga0495646_0016189 Ga0495646_0016189_1698_2843 368
306 3300046689 Ga0495613_0002804 Ga0495613_0002804_9469_10614 368
307 3300047317 Ga0495604_0017879 Ga0495604_0017879_2694_3839 368
308 3300047322 Ga0495680_0022292 Ga0495680_0022292_2566_3711 368
309 3300047444 Ga0495675_0018960 Ga0495675_0018960_2250_3395 368
310 3300047471 Ga0495684_0000820 Ga0495684_0000820_4996_6141 368
311 3300048907 Ga0496104_0042897 Ga0496104_0042897_101_1249 368
312 3300048918 Ga0496115_0092834 Ga0496115_0092834_938_2086 368
313 3300053077 Ga0495601_0079273 Ga0495601_0079273_946_2091 368
314 3300053084 Ga0495595_0001498 Ga0495595_0001498_4635_5780 368
315 3300010159 Ga0099796_10022992 Ga0099796_100229922 370
316 3300046491 Ga0495584_0064495 Ga0495584_0064495_250_1440 370
317 3300046491 Ga0495584_0080323 Ga0495584_0080323_236_1426 370
318 3300005981 Ga0081538_10029783 Ga0081538_100297833 372
319 3300006038 Ga0075365_10007934 Ga0075365_100079342 372
320 3300006038 Ga0075365_10018478 Ga0075365_100184782 372
321 3300006844 Ga0075428_100038586 Ga0075428_1000385863 372
322 3300006844 Ga0075428_100067105 Ga0075428_1000671052 372
323 3300006847 Ga0075431_100002340 Ga0075431_1000023409 372
324 3300006847 Ga0075431_100019719 Ga0075431_1000197192 372
325 3300006880 Ga0075429_100016146 Ga0075429_1000161464 372
326 3300009147 Ga0114129_10139264 Ga0114129_101392643 372
327 3300044684 Ga0466966_0040567 Ga0466966_0040567_903_2075 372
328 3300045049 Ga0466959_0005260 Ga0466959_0005260_1626_2798 372
329 3300049588 Ga0501072_0048450 Ga0501072_0048450_851_2005 372
330 3300050492 nmdc:mga0yw44_9643_c1 nmdc:mga0yw44_9643_c1_3576_4715 372
331 3300050507 nmdc:mga05p37_27070_c1 nmdc:mga05p37_27070_c1_1982_3160 372
332 3300050510 nmdc:mga06r32_1369_c1 nmdc:mga06r32_1369_c1_4712_5854 372
333 3300054114 Ga0501084_0096575 Ga0501084_0096575_1238_2392 372
334 3300005355 Ga0070671_100101011 Ga0070671_1001010112 373
335 3300005434 Ga0070709_10130240 Ga0070709_101302401 373
336 3300005437 Ga0070710_10027434 Ga0070710_100274342 373
337 3300005437 Ga0070710_10075895 Ga0070710_100758952 373
338 3300005546 Ga0070696_100225253 Ga0070696_1002252532 373
339 3300006028 Ga0070717_10018110 Ga0070717_100181102 373
340 3300006038 Ga0075365_10152320 Ga0075365_101523202 373
341 3300006051 Ga0075364_10135245 Ga0075364_101352451 373
342 3300006163 Ga0070715_10003805 Ga0070715_100038052 373
343 3300006173 Ga0070716_100020144 Ga0070716_1000201442 373
344 3300006175 Ga0070712_100001284 Ga0070712_1000012843 373
345 3300025904 Ga0207647_10074921 Ga0207647_100749212 373
346 3300025915 Ga0207693_10002503 Ga0207693_100025033 373
347 3300025915 Ga0207693_10004962 Ga0207693_100049629 373
348 3300025925 Ga0207650_10017621 Ga0207650_100176212 373
349 3300025928 Ga0207700_10007483 Ga0207700_100074835 373
350 3300025939 Ga0207665_10001690 Ga0207665_100016907 373
351 3300048903 Ga0496100_0149559 Ga0496100_0149559_93_1235 373
352 3300048903 Ga0496100_0211998 Ga0496100_0211998_149_1291 373
353 3300048904 Ga0496101_0067460 Ga0496101_0067460_1178_2320 373
354 3300048905 Ga0496102_0104173 Ga0496102_0104173_288_1430 373
355 3300048907 Ga0496104_0004926 Ga0496104_0004926_6111_7253 373
356 3300048907 Ga0496104_0040247 Ga0496104_0040247_904_2046 373
357 3300048909 Ga0496106_0148270 Ga0496106_0148270_278_1420 373
358 3300048909 Ga0496106_0198217 Ga0496106_0198217_104_1246 373
359 3300048912 Ga0496109_0174413 Ga0496109_0174413_111_1253 373
360 3300048916 Ga0496113_0193901 Ga0496113_0193901_355_1497 373
361 3300048917 Ga0496114_0300504 Ga0496114_0300504_173_1315 373
362 3300049582 Ga0501048_0204323 Ga0501048_0204323_208_1350 373
363 3300049590 Ga0501074_0164344 Ga0501074_0164344_141_1283 373
364 3300049591 Ga0501075_0255217 Ga0501075_0255217_43_1200 373
365 3300049592 Ga0501076_0072897 Ga0501076_0072897_638_1795 373
366 3300049824 Ga0501045_0203981 Ga0501045_0203981_214_1371 373
367 3300050512 nmdc:mga0n895_60015_c1 nmdc:mga0n895_60015_c1_1677_2819 373
368 3300053077 Ga0495601_0202313 Ga0495601_0202313_57_1205 373
369 3300054114 Ga0501084_0079471 Ga0501084_0079471_586_1728 373
370 3300005937 Ga0081455_10005639 Ga0081455_100056399 374
371 3300031711 Ga0265314_10005765 Ga0265314_100057654 374
372 3300005530 Ga0070679_100114627 Ga0070679_1001146273 375
373 3300006042 Ga0075368_10037512 Ga0075368_100375122 375
374 3300006051 Ga0075364_10096848 Ga0075364_100968482 375
375 3300006178 Ga0075367_10129676 Ga0075367_101296761 375
376 3300006353 Ga0075370_10028682 Ga0075370_100286823 375
377 3300006353 Ga0075370_10096283 Ga0075370_100962831 375
378 3300009147 Ga0114129_10006806 Ga0114129_100068065 375
379 3300025921 Ga0207652_10245066 Ga0207652_102450662 375
380 3300049570 Ga0501033_0045901 Ga0501033_0045901_686_1849 375
381 3300049823 Ga0501044_0012272 Ga0501044_0012272_536_1699 375
382 3300050490 nmdc:mga03n38_42337_c1 nmdc:mga03n38_42337_c1_304_1473 375
383 3300050494 nmdc:mga06z11_26901_c1 nmdc:mga06z11_26901_c1_1258_2427 375
384 3300050507 nmdc:mga05p37_4104_c1 nmdc:mga05p37_4104_c1_5810_6979 375
385 3300050508 nmdc:mga09592_2402_c1 nmdc:mga09592_2402_c1_12143_13312 375
386 3300050509 nmdc:mga0qj67_3470_c1 nmdc:mga0qj67_3470_c1_8848_10017 375
387 3300050510 nmdc:mga06r32_15_c1 nmdc:mga06r32_15_c1_94417_95586 375
388 3300050511 nmdc:mga08y16_91_c4 nmdc:mga08y16_91_c4_1301_2470 375
389 3300053119 Ga0500595_005762 Ga0500595_005762_459_1616 375
390 3300053153 Ga0500616_0019864 Ga0500616_0019864_1175_2329 375
391 2209111006 2214745206 2213754706 376
392 3300000044 ARSoilOldRDRAFT_c000055 ARSoilOldRDRAFT_00005510 376
393 3300000045 ARCol0oldRDRAFT_c00723 ARCol0oldRDRAFT_007232 376
394 3300000652 ARCol0yngRDRAFT_1000044 ARCol0yngRDRAFT_100004413 376
395 3300001430 JGI24032J14994_100612 JGI24032J14994_1006122 376
396 3300001978 JGI24747J21853_1002443 JGI24747J21853_10024431 376
397 3300001989 JGI24739J22299_10002793 JGI24739J22299_100027936 376
398 3300001990 JGI24737J22298_10000342 JGI24737J22298_100003426 376
399 3300001990 JGI24737J22298_10018616 JGI24737J22298_100186161 376
400 3300002070 JGI24750J21931_1000308 JGI24750J21931_10003082 376
401 3300002073 JGI24745J21846_1001695 JGI24745J21846_10016952 376
402 3300002074 JGI24748J21848_1003909 JGI24748J21848_10039092 376
403 3300002075 JGI24738J21930_10000339 JGI24738J21930_100003398 376
404 3300002076 JGI24749J21850_1006261 JGI24749J21850_10062611 376
405 3300002155 JGI24033J26618_1003260 JGI24033J26618_10032601 376
406 3300002239 JGI24034J26672_10000564 JGI24034J26672_100005644 376
407 3300002244 JGI24742J22300_10000317 JGI24742J22300_100003173 376
408 3300003215 JGI25153J46596_10009559 JGI25153J46596_100095592 376
409 3300003911 JGI25405J52794_10008771 JGI25405J52794_100087711 376
410 3300005276 Ga0065717_1002092 Ga0065717_10020922 376
411 3300005277 Ga0065716_1001996 Ga0065716_10019962 376
412 3300005290 Ga0065712_10072393 Ga0065712_100723934 376
413 3300005290 Ga0065712_10096990 Ga0065712_100969902 376
414 3300005293 Ga0065715_10000671 Ga0065715_100006717 376
415 3300005295 Ga0065707_10116717 Ga0065707_101167172 376
416 3300005327 Ga0070658_10056357 Ga0070658_100563573 376
417 3300005328 Ga0070676_10000016 Ga0070676_1000001632 376
418 3300005328 Ga0070676_10044116 Ga0070676_100441163 376
419 3300005329 Ga0070683_100000075 Ga0070683_10000007540 376
420 3300005330 Ga0070690_100000713 Ga0070690_10000071314 376
421 3300005330 Ga0070690_100001770 Ga0070690_1000017709 376
422 3300005330 Ga0070690_100026952 Ga0070690_1000269521 376
423 3300005330 Ga0070690_100211054 Ga0070690_1002110541 376
424 3300005331 Ga0070670_100003906 Ga0070670_1000039065 376
425 3300005333 Ga0070677_10000005 Ga0070677_1000000538 376
426 3300005334 Ga0068869_100000578 Ga0068869_1000005781 376
427 3300005335 Ga0070666_10004550 Ga0070666_100045502 376
428 3300005336 Ga0070680_100000526 Ga0070680_10000052611 376
429 3300005336 Ga0070680_100013741 Ga0070680_1000137412 376
430 3300005336 Ga0070680_100017732 Ga0070680_1000177321 376
431 3300005336 Ga0070680_100099422 Ga0070680_1000994221 376
432 3300005336 Ga0070680_100334758 Ga0070680_1003347581 376
433 3300005337 Ga0070682_100000144 Ga0070682_1000001443 376
434 3300005338 Ga0068868_100224248 Ga0068868_1002242482 376
435 3300005339 Ga0070660_100000153 Ga0070660_10000015330 376
436 3300005340 Ga0070689_100000563 Ga0070689_1000005631 376
437 3300005340 Ga0070689_100014436 Ga0070689_1000144365 376
438 3300005340 Ga0070689_100047315 Ga0070689_1000473153 376
439 3300005341 Ga0070691_10000030 Ga0070691_1000003028 376
440 3300005341 Ga0070691_10024288 Ga0070691_100242883 376
441 3300005343 Ga0070687_100000016 Ga0070687_1000000161 376
442 3300005343 Ga0070687_100000523 Ga0070687_10000052311 376
443 3300005343 Ga0070687_100058316 Ga0070687_1000583162 376
444 3300005344 Ga0070661_100000249 Ga0070661_1000002491 376
445 3300005345 Ga0070692_10002752 Ga0070692_100027524 376
446 3300005345 Ga0070692_10034075 Ga0070692_100340752 376
447 3300005347 Ga0070668_100009086 Ga0070668_1000090861 376
448 3300005347 Ga0070668_100011400 Ga0070668_1000114005 376
449 3300005353 Ga0070669_100000145 Ga0070669_10000014539 376
450 3300005354 Ga0070675_100000081 Ga0070675_1000000811 376
451 3300005355 Ga0070671_100000267 Ga0070671_10000026716 376
452 3300005356 Ga0070674_100037837 Ga0070674_1000378373 376
453 3300005356 Ga0070674_100268633 Ga0070674_1002686331 376
454 3300005364 Ga0070673_100000125 Ga0070673_10000012526 376
455 3300005364 Ga0070673_100245620 Ga0070673_1002456201 376
456 3300005365 Ga0070688_100000075 Ga0070688_10000007515 376
457 3300005365 Ga0070688_100012438 Ga0070688_1000124384 376
458 3300005366 Ga0070659_100000144 Ga0070659_1000001441 376
459 3300005366 Ga0070659_100061626 Ga0070659_1000616262 376
460 3300005366 Ga0070659_100081479 Ga0070659_1000814791 376
461 3300005367 Ga0070667_100001956 Ga0070667_1000019561 376
462 3300005367 Ga0070667_100055136 Ga0070667_1000551363 376
463 3300005406 Ga0070703_10001239 Ga0070703_100012396 376
464 3300005435 Ga0070714_100140036 Ga0070714_1001400362 376
465 3300005438 Ga0070701_10000058 Ga0070701_100000586 376
466 3300005438 Ga0070701_10001508 Ga0070701_100015086 376
467 3300005440 Ga0070705_100000926 Ga0070705_1000009266 376
468 3300005441 Ga0070700_100000100 Ga0070700_1000001001 376
469 3300005441 Ga0070700_100010505 Ga0070700_1000105053 376
470 3300005444 Ga0070694_100000041 Ga0070694_10000004113 376
471 3300005444 Ga0070694_100035205 Ga0070694_1000352053 376
472 3300005445 Ga0070708_100004960 Ga0070708_1000049609 376
473 3300005455 Ga0070663_100000071 Ga0070663_1000000711 376
474 3300005456 Ga0070678_100000239 Ga0070678_10000023915 376
475 3300005456 Ga0070678_100028854 Ga0070678_1000288543 376
476 3300005456 Ga0070678_100318403 Ga0070678_1003184031 376
477 3300005457 Ga0070662_100010549 Ga0070662_1000105495 376
478 3300005457 Ga0070662_100011560 Ga0070662_1000115601 376
479 3300005458 Ga0070681_10053662 Ga0070681_100536624 376
480 3300005458 Ga0070681_10095556 Ga0070681_100955563 376
481 3300005459 Ga0068867_100005147 Ga0068867_1000051478 376
482 3300005466 Ga0070685_10000994 Ga0070685_100009946 376
483 3300005530 Ga0070679_100000464 Ga0070679_10000046416 376
484 3300005530 Ga0070679_100036186 Ga0070679_1000361862 376
485 3300005530 Ga0070679_100099308 Ga0070679_1000993083 376
486 3300005530 Ga0070679_100172886 Ga0070679_1001728862 376
487 3300005535 Ga0070684_100010477 Ga0070684_1000104776 376
488 3300005536 Ga0070697_100057257 Ga0070697_1000572573 376
489 3300005536 Ga0070697_100324573 Ga0070697_1003245731 376
490 3300005539 Ga0068853_100001732 Ga0068853_10000173210 376
491 3300005543 Ga0070672_100000035 Ga0070672_1000000356 376
492 3300005544 Ga0070686_100000086 Ga0070686_1000000862 376
493 3300005544 Ga0070686_100003387 Ga0070686_1000033879 376
494 3300005544 Ga0070686_100083193 Ga0070686_1000831932 376
495 3300005545 Ga0070695_100000036 Ga0070695_1000000361 376
496 3300005545 Ga0070695_100014019 Ga0070695_1000140191 376
497 3300005546 Ga0070696_100003543 Ga0070696_1000035436 376
498 3300005547 Ga0070693_100000310 Ga0070693_10000031019 376
499 3300005547 Ga0070693_100012712 Ga0070693_1000127123 376
500 3300005548 Ga0070665_100011985 Ga0070665_1000119853 376
501 3300005549 Ga0070704_100011024 Ga0070704_1000110245 376
502 3300005563 Ga0068855_100015219 Ga0068855_1000152196 376
503 3300005563 Ga0068855_100088285 Ga0068855_1000882852 376
504 3300005563 Ga0068855_100246579 Ga0068855_1002465791 376
505 3300005564 Ga0070664_100004564 Ga0070664_1000045641 376
506 3300005564 Ga0070664_100022839 Ga0070664_1000228392 376
507 3300005577 Ga0068857_100000122 Ga0068857_10000012212 376
508 3300005577 Ga0068857_100114445 Ga0068857_1001144452 376
509 3300005578 Ga0068854_100000410 Ga0068854_1000004101 376
510 3300005614 Ga0068856_100001112 Ga0068856_1000011127 376
511 3300005614 Ga0068856_100064233 Ga0068856_1000642332 376
512 3300005614 Ga0068856_100193400 Ga0068856_1001934002 376
513 3300005616 Ga0068852_100013184 Ga0068852_1000131844 376
514 3300005616 Ga0068852_100016621 Ga0068852_1000166212 376
515 3300005616 Ga0068852_100044248 Ga0068852_1000442481 376
516 3300005617 Ga0068859_100000365 Ga0068859_10000036524 376
517 3300005617 Ga0068859_100047840 Ga0068859_1000478401 376
518 3300005617 Ga0068859_100412923 Ga0068859_1004129231 376
519 3300005618 Ga0068864_100000271 Ga0068864_10000027112 376
520 3300005618 Ga0068864_100114845 Ga0068864_1001148451 376
521 3300005618 Ga0068864_100320760 Ga0068864_1003207601 376
522 3300005718 Ga0068866_10000213 Ga0068866_1000021328 376
523 3300005719 Ga0068861_100000340 Ga0068861_1000003405 376
524 3300005834 Ga0068851_10042084 Ga0068851_100420842 376
525 3300005840 Ga0068870_10000079 Ga0068870_100000794 376
526 3300005841 Ga0068863_100000372 Ga0068863_10000037230 376
527 3300005842 Ga0068858_100000809 Ga0068858_1000008094 376
528 3300005843 Ga0068860_100000709 Ga0068860_10000070931 376
529 3300005843 Ga0068860_100035563 Ga0068860_1000355634 376
530 3300005844 Ga0068862_100000512 Ga0068862_10000051230 376
531 3300005844 Ga0068862_100004009 Ga0068862_1000040098 376
532 3300005937 Ga0081455_10000007 Ga0081455_10000007122 376
533 3300006028 Ga0070717_10022929 Ga0070717_100229294 376
534 3300006028 Ga0070717_10128784 Ga0070717_101287842 376
535 3300006058 Ga0075432_10000890 Ga0075432_1000089010 376
536 3300006173 Ga0070716_100044437 Ga0070716_1000444371 376
537 3300006175 Ga0070712_100055031 Ga0070712_1000550312 376
538 3300006178 Ga0075367_10044338 Ga0075367_100443382 376
539 3300006195 Ga0075366_10001684 Ga0075366_100016849 376
540 3300006237 Ga0097621_100000047 Ga0097621_10000004742 376
541 3300006358 Ga0068871_100000721 Ga0068871_10000072116 376
542 3300006844 Ga0075428_100005796 Ga0075428_1000057962 376
543 3300006846 Ga0075430_100000770 Ga0075430_10000077013 376
544 3300006846 Ga0075430_100145136 Ga0075430_1001451362 376
545 3300006847 Ga0075431_100000399 Ga0075431_10000039914 376
546 3300006852 Ga0075433_10000374 Ga0075433_1000037416 376
547 3300006852 Ga0075433_10002587 Ga0075433_100025879 376
548 3300006871 Ga0075434_100001558 Ga0075434_10000155813 376
549 3300006871 Ga0075434_100021991 Ga0075434_1000219912 376
550 3300006880 Ga0075429_100002444 Ga0075429_1000024442 376
551 3300006881 Ga0068865_100000415 Ga0068865_10000041513 376
552 3300006914 Ga0075436_100062929 Ga0075436_1000629293 376
553 3300006914 Ga0075436_100216097 Ga0075436_1002160971 376
554 3300006931 Ga0097620_100000365 Ga0097620_10000036520 376
555 3300006931 Ga0097620_100047843 Ga0097620_1000478431 376
556 3300006931 Ga0097620_100412883 Ga0097620_1004128831 376
557 3300007076 Ga0075435_100004974 Ga0075435_1000049743 376
558 3300007076 Ga0075435_100165546 Ga0075435_1001655462 376
559 3300009093 Ga0105240_10139901 Ga0105240_101399011 376
560 3300009093 Ga0105240_10304265 Ga0105240_103042652 376
561 3300009093 Ga0105240_10403803 Ga0105240_104038031 376
562 3300009094 Ga0111539_10000185 Ga0111539_1000018544 376
563 3300009094 Ga0111539_10001287 Ga0111539_1000128723 376
564 3300009094 Ga0111539_10001763 Ga0111539_1000176314 376
565 3300009094 Ga0111539_10256160 Ga0111539_102561601 376
566 3300009094 Ga0111539_10598327 Ga0111539_105983271 376
567 3300009098 Ga0105245_10000213 Ga0105245_1000021312 376
568 3300009101 Ga0105247_10002058 Ga0105247_100020583 376
569 3300009147 Ga0114129_10001978 Ga0114129_1000197814 376
570 3300009148 Ga0105243_10000175 Ga0105243_1000017546 376
571 3300009148 Ga0105243_10003796 Ga0105243_100037968 376
572 3300009174 Ga0105241_10000734 Ga0105241_100007344 376
573 3300009176 Ga0105242_10000170 Ga0105242_1000017031 376
574 3300009177 Ga0105248_10003499 Ga0105248_100034992 376
575 3300009545 Ga0105237_10003191 Ga0105237_100031912 376
576 3300009545 Ga0105237_10111179 Ga0105237_101111791 376
577 3300009553 Ga0105249_10000200 Ga0105249_1000020041 376
578 3300009553 Ga0105249_10007192 Ga0105249_100071927 376
579 3300010375 Ga0105239_10000834 Ga0105239_1000083430 376
580 3300010375 Ga0105239_10030237 Ga0105239_100302374 376
581 3300011119 Ga0105246_10000050 Ga0105246_1000005029 376
582 3300013100 Ga0157373_10061392 Ga0157373_100613922 376
583 3300013296 Ga0157374_10002488 Ga0157374_100024887 376
584 3300013297 Ga0157378_10000581 Ga0157378_1000058125 376
585 3300013306 Ga0163162_10000222 Ga0163162_1000022233 376
586 3300013306 Ga0163162_10029144 Ga0163162_100291442 376
587 3300013307 Ga0157372_10001777 Ga0157372_1000177719 376
588 3300013308 Ga0157375_10001098 Ga0157375_100010987 376
589 3300013308 Ga0157375_10167137 Ga0157375_101671372 376
590 3300014325 Ga0163163_10000693 Ga0163163_1000069310 376
591 3300014325 Ga0163163_10005957 Ga0163163_100059577 376
592 3300014325 Ga0163163_10044003 Ga0163163_100440034 376
593 3300014326 Ga0157380_10000361 Ga0157380_1000036110 376
594 3300014326 Ga0157380_10156665 Ga0157380_101566652 376
595 3300014745 Ga0157377_10000204 Ga0157377_1000020424 376
596 3300014745 Ga0157377_10124970 Ga0157377_101249702 376
597 3300014968 Ga0157379_10000036 Ga0157379_1000003616 376
598 3300014969 Ga0157376_10000062 Ga0157376_1000006245 376
599 3300017792 Ga0163161_10000363 Ga0163161_1000036329 376
600 3300025271 Ga0207666_1000015 Ga0207666_100001516 376
601 3300025271 Ga0207666_1002258 Ga0207666_10022582 376
602 3300025290 Ga0207673_1000067 Ga0207673_10000672 376
603 3300025297 Ga0209758_1000063 Ga0209758_100006371 376
604 3300025297 Ga0209758_1015119 Ga0209758_10151191 376
605 3300025315 Ga0207697_10000088 Ga0207697_1000008816 376
606 3300025315 Ga0207697_10020214 Ga0207697_100202142 376
607 3300025885 Ga0207653_10000413 Ga0207653_100004131 376
608 3300025893 Ga0207682_10000004 Ga0207682_1000000451 376
609 3300025899 Ga0207642_10000291 Ga0207642_1000029116 376
610 3300025900 Ga0207710_10001511 Ga0207710_100015113 376
611 3300025901 Ga0207688_10000042 Ga0207688_1000004216 376
612 3300025903 Ga0207680_10000311 Ga0207680_1000031122 376
613 3300025904 Ga0207647_10000417 Ga0207647_1000041724 376
614 3300025904 Ga0207647_10009783 Ga0207647_100097832 376
615 3300025907 Ga0207645_10000061 Ga0207645_1000006120 376
616 3300025908 Ga0207643_10000012 Ga0207643_1000001279 376
617 3300025911 Ga0207654_10001794 Ga0207654_100017947 376
618 3300025912 Ga0207707_10006621 Ga0207707_100066211 376
619 3300025912 Ga0207707_10150646 Ga0207707_101506462 376
620 3300025912 Ga0207707_10275037 Ga0207707_102750371 376
621 3300025913 Ga0207695_10151269 Ga0207695_101512692 376
622 3300025914 Ga0207671_10011350 Ga0207671_100113502 376
623 3300025914 Ga0207671_10220962 Ga0207671_102209622 376
624 3300025917 Ga0207660_10000008 Ga0207660_1000000841 376
625 3300025917 Ga0207660_10059606 Ga0207660_100596064 376
626 3300025917 Ga0207660_10173842 Ga0207660_101738421 376
627 3300025918 Ga0207662_10000097 Ga0207662_1000009716 376
628 3300025919 Ga0207657_10000503 Ga0207657_1000050316 376
629 3300025919 Ga0207657_10002293 Ga0207657_100022936 376
630 3300025920 Ga0207649_10000099 Ga0207649_1000009928 376
631 3300025921 Ga0207652_10045826 Ga0207652_100458261 376
632 3300025921 Ga0207652_10195128 Ga0207652_101951282 376
633 3300025923 Ga0207681_10000141 Ga0207681_1000014119 376
634 3300025923 Ga0207681_10209316 Ga0207681_102093161 376
635 3300025925 Ga0207650_10007055 Ga0207650_100070556 376
636 3300025925 Ga0207650_10039576 Ga0207650_100395762 376
637 3300025926 Ga0207659_10000023 Ga0207659_1000002341 376
638 3300025926 Ga0207659_10189377 Ga0207659_101893771 376
639 3300025927 Ga0207687_10000319 Ga0207687_1000031921 376
640 3300025928 Ga0207700_10014366 Ga0207700_100143666 376
641 3300025929 Ga0207664_10077228 Ga0207664_100772282 376
642 3300025931 Ga0207644_10015130 Ga0207644_100151301 376
643 3300025932 Ga0207690_10000105 Ga0207690_1000010547 376
644 3300025933 Ga0207706_10000438 Ga0207706_1000043816 376
645 3300025933 Ga0207706_10005437 Ga0207706_100054377 376
646 3300025934 Ga0207686_10000140 Ga0207686_1000014033 376
647 3300025935 Ga0207709_10000264 Ga0207709_1000026452 376
648 3300025935 Ga0207709_10005146 Ga0207709_100051464 376
649 3300025936 Ga0207670_10000108 Ga0207670_1000010812 376
650 3300025936 Ga0207670_10003337 Ga0207670_100033377 376
651 3300025936 Ga0207670_10073327 Ga0207670_100733272 376
652 3300025937 Ga0207669_10000110 Ga0207669_1000011028 376
653 3300025937 Ga0207669_10044617 Ga0207669_100446171 376
654 3300025938 Ga0207704_10000171 Ga0207704_100001711 376
655 3300025939 Ga0207665_10070355 Ga0207665_100703553 376
656 3300025940 Ga0207691_10002227 Ga0207691_1000222716 376
657 3300025941 Ga0207711_10002682 Ga0207711_100026829 376
658 3300025942 Ga0207689_10000008 Ga0207689_1000000865 376
659 3300025944 Ga0207661_10000053 Ga0207661_1000005341 376
660 3300025945 Ga0207679_10000053 Ga0207679_1000005354 376
661 3300025945 Ga0207679_10046497 Ga0207679_100464973 376
662 3300025949 Ga0207667_10008564 Ga0207667_100085647 376
663 3300025960 Ga0207651_10000052 Ga0207651_100000521 376
664 3300025960 Ga0207651_10192522 Ga0207651_101925221 376
665 3300025960 Ga0207651_10301061 Ga0207651_103010611 376
666 3300025961 Ga0207712_10000156 Ga0207712_1000015661 376
667 3300025972 Ga0207668_10000160 Ga0207668_1000016012 376
668 3300025972 Ga0207668_10032006 Ga0207668_100320062 376
669 3300025981 Ga0207640_10000325 Ga0207640_1000032511 376
670 3300025981 Ga0207640_10113109 Ga0207640_101131092 376
671 3300025986 Ga0207658_10036051 Ga0207658_100360514 376
672 3300025986 Ga0207658_10057895 Ga0207658_100578953 376
673 3300025986 Ga0207658_10094028 Ga0207658_100940283 376
674 3300026035 Ga0207703_10001510 Ga0207703_100015104 376
675 3300026035 Ga0207703_10022564 Ga0207703_100225644 376
676 3300026041 Ga0207639_10001511 Ga0207639_100015116 376
677 3300026067 Ga0207678_10000185 Ga0207678_1000018527 376
678 3300026067 Ga0207678_10031346 Ga0207678_100313463 376
679 3300026075 Ga0207708_10000263 Ga0207708_1000026324 376
680 3300026075 Ga0207708_10001344 Ga0207708_1000134414 376
681 3300026078 Ga0207702_10000297 Ga0207702_100002973 376
682 3300026089 Ga0207648_10000469 Ga0207648_1000046924 376
683 3300026089 Ga0207648_10038076 Ga0207648_100380762 376
684 3300026089 Ga0207648_10132054 Ga0207648_101320542 376
685 3300026095 Ga0207676_10001235 Ga0207676_1000123522 376
686 3300026116 Ga0207674_10001208 Ga0207674_1000120824 376
687 3300026118 Ga0207675_100000342 Ga0207675_10000034216 376
688 3300026118 Ga0207675_100033440 Ga0207675_1000334401 376
689 3300026121 Ga0207683_10000006 Ga0207683_1000000644 376
690 3300026121 Ga0207683_10024092 Ga0207683_100240923 376
691 3300026142 Ga0207698_10000236 Ga0207698_1000023630 376
692 3300026142 Ga0207698_10269963 Ga0207698_102699631 376
693 3300026142 Ga0207698_10337831 Ga0207698_103378311 376
694 3300027471 Ga0209995_1004032 Ga0209995_10040322 376
695 3300027682 Ga0209971_1003649 Ga0209971_10036491 376
696 3300027695 Ga0209966_1001615 Ga0209966_10016151 376
697 3300027717 Ga0209998_10001431 Ga0209998_100014315 376
698 3300027717 Ga0209998_10004020 Ga0209998_100040202 376
699 3300027876 Ga0209974_10002024 Ga0209974_100020244 376
700 3300027907 Ga0207428_10000112 Ga0207428_1000011255 376
701 3300027907 Ga0207428_10000417 Ga0207428_1000041732 376
702 3300027907 Ga0207428_10000480 Ga0207428_1000048033 376
703 3300028379 Ga0268266_10017509 Ga0268266_100175096 376
704 3300028380 Ga0268265_10000257 Ga0268265_1000025741 376
705 3300028381 Ga0268264_10000579 Ga0268264_1000057939 376
706 3300028381 Ga0268264_10046931 Ga0268264_100469313 376
707 3300031238 Ga0265332_10014392 Ga0265332_100143922 376
708 3300031241 Ga0265325_10000004 Ga0265325_10000004133 376
709 3300031241 Ga0265325_10000106 Ga0265325_100001069 376
710 3300031241 Ga0265325_10028908 Ga0265325_100289084 376
711 3300031247 Ga0265340_10013567 Ga0265340_100135673 376
712 3300031247 Ga0265340_10014025 Ga0265340_100140253 376
713 3300031595 Ga0265313_10011012 Ga0265313_100110123 376
714 3300034816 Ga0373930_0000160 Ga0373930_0000160_2001_3131 376
715 3300034819 Ga0373958_0000508 Ga0373958_0000508_1162_2292 376
716 3300034819 Ga0373958_0000865 Ga0373958_0000865_2703_3833 376
717 3300034820 Ga0373959_0000573 Ga0373959_0000573_2734_3864 376
718 3300034957 Ga0373938_0000090 Ga0373938_0000090_7284_8414 376
719 3300034957 Ga0373938_0001252 Ga0373938_0001252_734_1864 376
720 3300035083 Ga0373926_0001790 Ga0373926_0001790_837_1967 376
721 3300035084 Ga0373928_0000536 Ga0373928_0000536_4567_5697 376
722 3300035085 Ga0373929_0000741 Ga0373929_0000741_4433_5563 376
723 3300035085 Ga0373929_0003008 Ga0373929_0003008_1210_2340 376
724 3300035085 Ga0373929_0011677 Ga0373929_0011677_456_1622 376
725 3300035088 Ga0373940_0000074 Ga0373940_0000074_7540_8670 376
726 3300035090 Ga0373949_0000489 Ga0373949_0000489_7469_8599 376
727 3300035090 Ga0373949_0001646 Ga0373949_0001646_3866_4996 376
728 3300035091 Ga0373951_0001485 Ga0373951_0001485_1288_2418 376
729 3300035091 Ga0373951_0003044 Ga0373951_0003044_2973_4103 376
730 3300035092 Ga0373952_0000166 Ga0373952_0000166_4090_5220 376
731 3300035092 Ga0373952_0001370 Ga0373952_0001370_174_1304 376
732 3300035112 Ga0373932_0001675 Ga0373932_0001675_3785_4915 376
733 3300035114 Ga0373939_0000873 Ga0373939_0000873_4913_6043 376
734 3300035114 Ga0373939_0001847 Ga0373939_0001847_1304_2434 376
735 3300035115 Ga0373941_0000030 Ga0373941_0000030_9338_10468 376
736 3300035115 Ga0373941_0001773 Ga0373941_0001773_883_2013 376
737 3300035116 Ga0373945_0019356 Ga0373945_0019356_1040_2170 376
738 3300035121 Ga0373960_0000108 Ga0373960_0000108_2820_3950 376
739 3300035121 Ga0373960_0014890 Ga0373960_0014890_246_1412 376
740 3300035170 Ga0373943_0090527 Ga0373943_0090527_256_1386 376
741 3300035172 Ga0373955_0013942 Ga0373955_0013942_1291_2421 376
742 3300035207 Ga0373942_0000232 Ga0373942_0000232_2855_3985 376
743 3300035207 Ga0373942_0001290 Ga0373942_0001290_2345_3475 376
744 3300035241 Ga0373961_0000666 Ga0373961_0000666_1650_2780 376
745 3300035241 Ga0373961_0001000 Ga0373961_0001000_901_2031 376
746 3300035410 Ga0373924_0058362 Ga0373924_0058362_163_1293 376
747 3300035691 Ga0373931_0000084 Ga0373931_0000084_21330_22460 376
748 3300035691 Ga0373931_0000494 Ga0373931_0000494_6545_7711 376
749 3300035695 Ga0373927_0007901 Ga0373927_0007901_1736_2866 376
750 3300036401 Ga0373937_0025710 Ga0373937_0025710_2383_3513 376
751 3300036401 Ga0373937_0122848 Ga0373937_0122848_1171_2319 376
752 3300037068 Ga0373925_0003332 Ga0373925_0003332_11125_12255 376
753 3300037068 Ga0373925_0034015 Ga0373925_0034015_1279_2409 376
754 3300044712 Ga0453684_0078254 Ga0453684_0078254_2067_3197 376
755 3300046455 Ga0495603_0001247 Ga0495603_0001247_2092_3222 376
756 3300046455 Ga0495603_0109076 Ga0495603_0109076_338_1468 376
757 3300046459 Ga0495629_0001052 Ga0495629_0001052_18345_19475 376
758 3300046461 Ga0495641_0013443 Ga0495641_0013443_1816_2946 376
759 3300046463 Ga0495653_0060993 Ga0495653_0060993_105_1235 376
760 3300046472 Ga0495580_0036343 Ga0495580_0036343_60_1190 376
761 3300046473 Ga0495582_0000221 Ga0495582_0000221_2337_3467 376
762 3300046473 Ga0495582_0002529 Ga0495582_0002529_6547_7677 376
763 3300046475 Ga0495639_0001053 Ga0495639_0001053_1934_3064 376
764 3300046476 Ga0495662_0005160 Ga0495662_0005160_1799_2929 376
765 3300046499 Ga0495594_0003526 Ga0495594_0003526_1628_2758 376
766 3300046514 Ga0495618_0085903 Ga0495618_0085903_871_2001 376
767 3300046517 Ga0495630_0002234 Ga0495630_0002234_323_1453 376
768 3300046526 Ga0495666_0034071 Ga0495666_0034071_1231_2361 376
769 3300046526 Ga0495666_0042705 Ga0495666_0042705_1051_2181 376
770 3300046531 Ga0495665_0000755 Ga0495665_0000755_9378_10508 376
771 3300046533 Ga0495640_0046151 Ga0495640_0046151_1776_2906 376
772 3300046543 Ga0495645_0113424 Ga0495645_0113424_653_1783 376
773 3300046557 Ga0495622_0016865 Ga0495622_0016865_270_1400 376
774 3300046642 Ga0495634_0003584 Ga0495634_0003584_323_1453 376
775 3300046663 Ga0495635_0011640 Ga0495635_0011640_2730_3860 376
776 3300046674 Ga0495588_0027388 Ga0495588_0027388_1478_2608 376
777 3300046681 Ga0495647_0001581 Ga0495647_0001581_553_1683 376
778 3300046689 Ga0495613_0000393 Ga0495613_0000393_34230_35360 376
779 3300046690 Ga0495624_0000182 Ga0495624_0000182_2416_3546 376
780 3300047315 Ga0495581_0000093 Ga0495581_0000093_2859_3989 376
781 3300047319 Ga0495674_0005687 Ga0495674_0005687_1808_2938 376
782 3300047319 Ga0495674_0095353 Ga0495674_0095353_878_2008 376
783 3300047321 Ga0495676_0024359 Ga0495676_0024359_4033_5163 376
784 3300047673 Ga0495593_0000827 Ga0495593_0000827_7644_8774 376
785 3300048903 Ga0496100_0000764 Ga0496100_0000764_4979_6109 376
786 3300048904 Ga0496101_0003468 Ga0496101_0003468_2349_3479 376
787 3300048905 Ga0496102_0030198 Ga0496102_0030198_2349_3479 376
788 3300048905 Ga0496102_0041352 Ga0496102_0041352_2703_3833 376
789 3300048905 Ga0496102_0206151 Ga0496102_0206151_218_1348 376
790 3300048906 Ga0496103_0001517 Ga0496103_0001517_11913_13043 376
791 3300048906 Ga0496103_0100997 Ga0496103_0100997_424_1554 376
792 3300048907 Ga0496104_0081606 Ga0496104_0081606_493_1623 376
793 3300048907 Ga0496104_0340744 Ga0496104_0340744_113_1243 376
794 3300048909 Ga0496106_0000679 Ga0496106_0000679_20173_21303 376
795 3300048910 Ga0496107_0000078 Ga0496107_0000078_44622_45752 376
796 3300048910 Ga0496107_0171249 Ga0496107_0171249_24_1154 376
797 3300048911 Ga0496108_0002072 Ga0496108_0002072_12995_14125 376
798 3300048912 Ga0496109_0000406 Ga0496109_0000406_32637_33767 376
799 3300048912 Ga0496109_0004222 Ga0496109_0004222_6961_8091 376
800 3300048912 Ga0496109_0063539 Ga0496109_0063539_1429_2595 376
801 3300048913 Ga0496110_0012834 Ga0496110_0012834_1865_2995 376
802 3300048913 Ga0496110_0065237 Ga0496110_0065237_686_1816 376
803 3300048913 Ga0496110_0386640 Ga0496110_0386640_52_1182 376
804 3300048914 Ga0496111_0036370 Ga0496111_0036370_2053_3183 376
805 3300048914 Ga0496111_0044673 Ga0496111_0044673_1967_3097 376
806 3300048915 Ga0496112_0096078 Ga0496112_0096078_1350_2585 376
807 3300048915 Ga0496112_0097332 Ga0496112_0097332_205_1335 376
808 3300048916 Ga0496113_0017355 Ga0496113_0017355_1644_2774 376
809 3300048916 Ga0496113_0043809 Ga0496113_0043809_1869_2999 376
810 3300048916 Ga0496113_0136034 Ga0496113_0136034_332_1498 376
811 3300048918 Ga0496115_0004237 Ga0496115_0004237_5870_7000 376
812 3300049593 Ga0501077_0115300 Ga0501077_0115300_250_1380 376
813 3300050493 nmdc:mga0k408_24125_c1 nmdc:mga0k408_24125_c1_301_1461 376
814 3300050507 nmdc:mga05p37_531_c1 nmdc:mga05p37_531_c1_26377_27507 376
815 3300050508 nmdc:mga09592_1318_c1 nmdc:mga09592_1318_c1_14699_15829 376
816 3300050509 nmdc:mga0qj67_413_c1 nmdc:mga0qj67_413_c1_6206_7336 376
817 3300050510 nmdc:mga06r32_105143_c1 nmdc:mga06r32_105143_c1_683_1822 376
818 3300050510 nmdc:mga06r32_1915_c1 nmdc:mga06r32_1915_c1_16831_17961 376
819 3300050511 nmdc:mga08y16_2163_c1 nmdc:mga08y16_2163_c1_4494_5624 376
820 3300050511 nmdc:mga08y16_2892_c1 nmdc:mga08y16_2892_c1_15952_17082 376
821 3300050511 nmdc:mga08y16_29359_c1 nmdc:mga08y16_29359_c1_2574_3740 376
822 3300050511 nmdc:mga08y16_3734_c1 nmdc:mga08y16_3734_c1_4748_5878 376
823 3300050512 nmdc:mga0n895_209_c1 nmdc:mga0n895_209_c1_14893_16023 376
824 3300050512 nmdc:mga0n895_4169_c1 nmdc:mga0n895_4169_c1_10133_11263 376
825 3300050512 nmdc:mga0n895_82182_c1 nmdc:mga0n895_82182_c1_928_2058 376
826 3300050513 nmdc:mga0rr50_37915_c1 nmdc:mga0rr50_37915_c1_1881_3011 376
827 3300050513 nmdc:mga0rr50_591_c1 nmdc:mga0rr50_591_c1_12532_13662 376
828 3300050515 nmdc:mga0a205_12176_c1 nmdc:mga0a205_12176_c1_5901_7031 376
829 3300050515 nmdc:mga0a205_82673_c1 nmdc:mga0a205_82673_c1_1896_3026 376
830 3300050515 nmdc:mga0a205_9124_c1 nmdc:mga0a205_9124_c1_2476_3606 376
831 3300053077 Ga0495601_0022124 Ga0495601_0022124_2478_3608 376
832 3300053102 Ga0500554_058796 Ga0500554_058796_52_1182 376
833 3300053150 Ga0500603_000736 Ga0500603_000736_1778_2908 376
834 3300053153 Ga0500616_0040270 Ga0500616_0040270_962_2122 376
835 3300053178 Ga0500637_0152687 Ga0500637_0152687_17_1147 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00925

GTP_cyclohydro2

GTP cyclohydrolase II

200

366

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.9143 173 343
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.9028 173 343
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.899 173 343
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.8882 173 343
4rl4-assembly1.cif.gz_A crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695 0.8563 172 346
ID Description Score Start End Superfamily
af_Q2FXG1_205_373_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.9239 176 345 3.40.50.10990
af_Q2FXG1_205_373_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.9083 176 345 3.40.50.10990
4i14B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8977 175 342 3.40.50.10990
af_Q5A1Y2_80_302_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.895 178 341 3.40.50.10990
2bz0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8931 173 345 3.40.50.10990
ID Description Score Start End GO Terms
AF-A0A537PR85-F1-model_v4 GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cyclohydrolase II) 0.9471 10 368 GO:0003935
GO:0005525
GO:0005829
GO:0008270
GO:0009231
AF-A0A537N2B2-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9392 10 303 GO:0003935
GO:0005525
GO:0005829
GO:0009231
AF-X0WX33-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9347 215 363 GO:0003935
GO:0005525
GO:0005829
GO:0009231
AF-A0A3M0YTJ5-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9318 172 363 GO:0003935
GO:0005525
GO:0005829
GO:0008686
GO:0009231
AF-A0A537RXJ8-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9317 4 330 GO:0003935
GO:0005525
GO:0005829
GO:0009231

Feature Viewer

pLDDT pTM Quality
87.09 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map