F482844
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 835 | 390 | 835 | 371 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10000106|Ga0265325_100001069 |
| Length | 412 |
| Sequence | MAWGNGPPAGVLVQGEQGSETFSMRNDSTSSAGSILFGTREQVGVGRGLAEFRAGRPIMVTSSEETLLCLPVEGLNKDRLVAFRAVCEPIAPRLVLTSRRARSLGIDANDPVALELRPDVDASRILNIASEATSDHVFVPEPAGRAAVAAIELVKLAQILPAVLVADSDTAVAGTFTPRVITVDAGAVARFRANATQSLTIAGEAYVPLSSGVRTRFVVFRDAFGDDPVAVIVGTPDLSKPVPVRIHSACLTGDVFGSRRCDCGDQLRLALARLQEAGGGVILYLAQEGRGVGLANKMRTYKLQDAGLDTVDANTTLGFDDDERDYGTAVRMLQMLGCTRVVLLTNNPAKLDGLSKAGIEITGRMPIETPVNSDNRRYLTAKASRAGHQLRHVIAALAETPEDDGEKASLAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 6 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 21 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 250 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 267 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 384 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.59 |
| Nodule | 0 |
| Rhizoplane | 9.94 |
| Rhizosphere | 86.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745206 | 2209111006 | Bacteria | 15476 |
| 2 | ARSoilOldRDRAFT_c000055 | 3300000044 | Bacteria | 23615 |
| 3 | ARCol0oldRDRAFT_c00723 | 3300000045 | Bacteria | 2821 |
| 4 | ARCol0yngRDRAFT_1000044 | 3300000652 | Bacteria | 21392 |
| 5 | JGI24032J14994_100612 | 3300001430 | Bacteria | 1859 |
| 6 | JGI24747J21853_1002443 | 3300001978 | Bacteria | 1517 |
| 7 | JGI24739J22299_10002793 | 3300001989 | Bacteria | 6708 |
| 8 | JGI24737J22298_10000342 | 3300001990 | Bacteria | 15658 |
| 9 | JGI24737J22298_10018616 | 3300001990 | Bacteria | 2227 |
| 10 | JGI24750J21931_1000308 | 3300002070 | Bacteria | 8403 |
| 11 | JGI24745J21846_1001695 | 3300002073 | Bacteria | 2174 |
| 12 | JGI24748J21848_1003909 | 3300002074 | Bacteria | 1706 |
| 13 | JGI24738J21930_10000339 | 3300002075 | Bacteria | 12791 |
| 14 | JGI24749J21850_1006261 | 3300002076 | Bacteria | 1659 |
| 15 | JGI24744J21845_10001479 | 3300002077 | Bacteria | 4668 |
| 16 | JGI24744J21845_10003255 | 3300002077 | Bacteria | 3334 |
| 17 | JGI24033J26618_1003260 | 3300002155 | Bacteria | 1704 |
| 18 | JGI24034J26672_10000564 | 3300002239 | Bacteria | 4721 |
| 19 | JGI24742J22300_10000317 | 3300002244 | Bacteria | 7200 |
| 20 | JGI25153J46596_10009559 | 3300003215 | Bacteria | 4485 |
| 21 | JGI25405J52794_10008771 | 3300003911 | Bacteria | 1896 |
| 22 | Ga0065717_1002092 | 3300005276 | Bacteria | 2986 |
| 23 | Ga0065716_1001996 | 3300005277 | Bacteria | 2495 |
| 24 | Ga0065712_10072393 | 3300005290 | Bacteria | 4772 |
| 25 | Ga0065712_10096990 | 3300005290 | Bacteria | 2165 |
| 26 | Ga0065715_10000671 | 3300005293 | Bacteria | 11029 |
| 27 | Ga0065707_10116717 | 3300005295 | Bacteria | 2228 |
| 28 | Ga0070658_10056357 | 3300005327 | Bacteria | 3193 |
| 29 | Ga0070676_10000016 | 3300005328 | Bacteria | 52098 |
| 30 | Ga0070676_10044116 | 3300005328 | Bacteria | 2594 |
| 31 | Ga0070683_100000075 | 3300005329 | Bacteria | 67998 |
| 32 | Ga0070690_100000713 | 3300005330 | Bacteria | 17071 |
| 33 | Ga0070690_100001770 | 3300005330 | Bacteria | 11417 |
| 34 | Ga0070690_100008341 | 3300005330 | Bacteria | 5962 |
| 35 | Ga0070690_100026952 | 3300005330 | Bacteria | 3550 |
| 36 | Ga0070690_100211054 | 3300005330 | Bacteria | 1356 |
| 37 | Ga0070670_100003906 | 3300005331 | Bacteria | 12433 |
| 38 | Ga0070670_100010481 | 3300005331 | Bacteria | 7912 |
| 39 | Ga0070677_10000005 | 3300005333 | Bacteria | 79035 |
| 40 | Ga0070677_10020671 | 3300005333 | Bacteria | 2402 |
| 41 | Ga0068869_100000578 | 3300005334 | Bacteria | 20535 |
| 42 | Ga0068869_100093314 | 3300005334 | Bacteria | 2267 |
| 43 | Ga0070666_10004550 | 3300005335 | Bacteria | 8453 |
| 44 | Ga0070666_10011843 | 3300005335 | Bacteria | 5485 |
| 45 | Ga0070680_100000526 | 3300005336 | Bacteria | 26129 |
| 46 | Ga0070680_100013741 | 3300005336 | Bacteria | 6315 |
| 47 | Ga0070680_100017732 | 3300005336 | Bacteria | 5615 |
| 48 | Ga0070680_100099422 | 3300005336 | Bacteria | 2414 |
| 49 | Ga0070680_100334758 | 3300005336 | Bacteria | 1286 |
| 50 | Ga0070682_100000144 | 3300005337 | Bacteria | 56618 |
| 51 | Ga0068868_100007091 | 3300005338 | Bacteria | 7966 |
| 52 | Ga0068868_100224248 | 3300005338 | Bacteria | 1574 |
| 53 | Ga0070660_100000153 | 3300005339 | Bacteria | 44533 |
| 54 | Ga0070689_100000563 | 3300005340 | Bacteria | 22227 |
| 55 | Ga0070689_100002363 | 3300005340 | Bacteria | 12295 |
| 56 | Ga0070689_100014436 | 3300005340 | Bacteria | 5738 |
| 57 | Ga0070689_100047315 | 3300005340 | Bacteria | 3317 |
| 58 | Ga0070691_10000030 | 3300005341 | Bacteria | 39784 |
| 59 | Ga0070691_10024288 | 3300005341 | Bacteria | 2817 |
| 60 | Ga0070687_100000016 | 3300005343 | Bacteria | 55051 |
| 61 | Ga0070687_100000523 | 3300005343 | Bacteria | 12899 |
| 62 | Ga0070687_100058316 | 3300005343 | Bacteria | 2028 |
| 63 | Ga0070687_100060447 | 3300005343 | Bacteria | 1999 |
| 64 | Ga0070661_100000249 | 3300005344 | Bacteria | 44246 |
| 65 | Ga0070692_10002752 | 3300005345 | Bacteria | 6918 |
| 66 | Ga0070692_10034075 | 3300005345 | Bacteria | 2569 |
| 67 | Ga0070668_100009086 | 3300005347 | Bacteria | 7380 |
| 68 | Ga0070668_100011400 | 3300005347 | Bacteria | 6623 |
| 69 | Ga0070668_100057949 | 3300005347 | Bacteria | 2995 |
| 70 | Ga0070669_100000145 | 3300005353 | Bacteria | 63377 |
| 71 | Ga0070675_100000081 | 3300005354 | Bacteria | 56087 |
| 72 | Ga0070675_100006337 | 3300005354 | Bacteria | 9082 |
| 73 | Ga0070671_100000267 | 3300005355 | Bacteria | 35238 |
| 74 | Ga0070671_100043196 | 3300005355 | Bacteria | 3746 |
| 75 | Ga0070671_100101011 | 3300005355 | Bacteria | 2420 |
| 76 | Ga0070671_100150959 | 3300005355 | Bacteria | 1962 |
| 77 | Ga0070674_100037837 | 3300005356 | Bacteria | 3248 |
| 78 | Ga0070674_100268633 | 3300005356 | Bacteria | 1347 |
| 79 | Ga0070673_100000125 | 3300005364 | Bacteria | 35606 |
| 80 | Ga0070673_100245620 | 3300005364 | Bacteria | 1558 |
| 81 | Ga0070688_100000075 | 3300005365 | Bacteria | 49279 |
| 82 | Ga0070688_100009829 | 3300005365 | Bacteria | 5257 |
| 83 | Ga0070688_100012438 | 3300005365 | Bacteria | 4770 |
| 84 | Ga0070688_100029833 | 3300005365 | Bacteria | 3269 |
| 85 | Ga0070659_100000144 | 3300005366 | Bacteria | 55051 |
| 86 | Ga0070659_100061626 | 3300005366 | Bacteria | 2964 |
| 87 | Ga0070659_100081479 | 3300005366 | Bacteria | 2585 |
| 88 | Ga0070667_100001956 | 3300005367 | Bacteria | 18291 |
| 89 | Ga0070667_100009767 | 3300005367 | Bacteria | 7956 |
| 90 | Ga0070667_100055136 | 3300005367 | Bacteria | 3357 |
| 91 | Ga0070703_10001239 | 3300005406 | Bacteria | 7783 |
| 92 | Ga0070709_10090603 | 3300005434 | Bacteria | 2016 |
| 93 | Ga0070709_10130240 | 3300005434 | Bacteria | 1717 |
| 94 | Ga0070714_100013260 | 3300005435 | Bacteria | 6599 |
| 95 | Ga0070714_100140036 | 3300005435 | Bacteria | 2170 |
| 96 | Ga0070710_10027434 | 3300005437 | Bacteria | 3036 |
| 97 | Ga0070710_10075895 | 3300005437 | Bacteria | 1949 |
| 98 | Ga0070701_10000058 | 3300005438 | Bacteria | 29228 |
| 99 | Ga0070701_10001508 | 3300005438 | Bacteria | 8628 |
| 100 | Ga0070701_10022221 | 3300005438 | Bacteria | 3039 |
| 101 | Ga0070711_100120613 | 3300005439 | Bacteria | 1939 |
| 102 | Ga0070705_100000926 | 3300005440 | Bacteria | 16411 |
| 103 | Ga0070700_100000100 | 3300005441 | Bacteria | 54110 |
| 104 | Ga0070700_100010505 | 3300005441 | Bacteria | 5115 |
| 105 | Ga0070700_100038892 | 3300005441 | Bacteria | 2902 |
| 106 | Ga0070694_100000041 | 3300005444 | Bacteria | 59039 |
| 107 | Ga0070694_100035205 | 3300005444 | Bacteria | 3308 |
| 108 | Ga0070708_100004960 | 3300005445 | Bacteria | 10518 |
| 109 | Ga0070663_100000071 | 3300005455 | Bacteria | 44246 |
| 110 | Ga0070663_100014182 | 3300005455 | Bacteria | 5109 |
| 111 | Ga0070678_100000239 | 3300005456 | Bacteria | 25186 |
| 112 | Ga0070678_100028854 | 3300005456 | Bacteria | 3791 |
| 113 | Ga0070678_100083113 | 3300005456 | Bacteria | 2433 |
| 114 | Ga0070678_100318403 | 3300005456 | Bacteria | 1327 |
| 115 | Ga0070662_100010549 | 3300005457 | Bacteria | 6070 |
| 116 | Ga0070662_100011560 | 3300005457 | Bacteria | 5825 |
| 117 | Ga0070662_100184016 | 3300005457 | Bacteria | 1649 |
| 118 | Ga0070681_10053662 | 3300005458 | Bacteria | 4017 |
| 119 | Ga0070681_10095556 | 3300005458 | Bacteria | 2920 |
| 120 | Ga0068867_100005147 | 3300005459 | Bacteria | 9242 |
| 121 | Ga0070685_10000994 | 3300005466 | Bacteria | 15225 |
| 122 | Ga0070685_10036941 | 3300005466 | Bacteria | 2764 |
| 123 | Ga0070679_100000464 | 3300005530 | Bacteria | 34507 |
| 124 | Ga0070679_100036186 | 3300005530 | Bacteria | 4898 |
| 125 | Ga0070679_100099308 | 3300005530 | Bacteria | 2898 |
| 126 | Ga0070679_100114627 | 3300005530 | Bacteria | 2681 |
| 127 | Ga0070679_100172886 | 3300005530 | Bacteria | 2133 |
| 128 | Ga0070684_100010477 | 3300005535 | Bacteria | 7346 |
| 129 | Ga0070684_100023560 | 3300005535 | Bacteria | 5153 |
| 130 | Ga0070697_100057257 | 3300005536 | Bacteria | 3172 |
| 131 | Ga0070697_100324573 | 3300005536 | Bacteria | 1326 |
| 132 | Ga0068853_100001732 | 3300005539 | Bacteria | 15993 |
| 133 | Ga0070672_100000035 | 3300005543 | Bacteria | 60570 |
| 134 | Ga0070686_100000086 | 3300005544 | Bacteria | 65438 |
| 135 | Ga0070686_100003387 | 3300005544 | Bacteria | 8737 |
| 136 | Ga0070686_100005194 | 3300005544 | Bacteria | 7192 |
| 137 | Ga0070686_100083193 | 3300005544 | Bacteria | 2124 |
| 138 | Ga0070695_100000036 | 3300005545 | Bacteria | 51060 |
| 139 | Ga0070695_100014019 | 3300005545 | Bacteria | 4826 |
| 140 | Ga0070696_100003543 | 3300005546 | Bacteria | 10392 |
| 141 | Ga0070696_100225253 | 3300005546 | Bacteria | 1408 |
| 142 | Ga0070693_100000310 | 3300005547 | Bacteria | 22583 |
| 143 | Ga0070693_100012712 | 3300005547 | Bacteria | 4268 |
| 144 | Ga0070665_100011985 | 3300005548 | Bacteria | 8752 |
| 145 | Ga0070704_100011024 | 3300005549 | Bacteria | 5516 |
| 146 | Ga0070704_100078764 | 3300005549 | Bacteria | 2419 |
| 147 | Ga0068855_100015219 | 3300005563 | Bacteria | 9262 |
| 148 | Ga0068855_100088285 | 3300005563 | Bacteria | 3582 |
| 149 | Ga0068855_100246579 | 3300005563 | Bacteria | 1993 |
| 150 | Ga0070664_100004564 | 3300005564 | Bacteria | 11111 |
| 151 | Ga0070664_100022839 | 3300005564 | Bacteria | 5160 |
| 152 | Ga0070664_100023143 | 3300005564 | Bacteria | 5129 |
| 153 | Ga0068857_100000122 | 3300005577 | Bacteria | 46603 |
| 154 | Ga0068857_100114445 | 3300005577 | Bacteria | 2426 |
| 155 | Ga0068854_100000410 | 3300005578 | Bacteria | 26884 |
| 156 | Ga0068856_100001112 | 3300005614 | Bacteria | 28418 |
| 157 | Ga0068856_100064233 | 3300005614 | Bacteria | 3627 |
| 158 | Ga0068856_100193400 | 3300005614 | Bacteria | 2048 |
| 159 | Ga0068852_100013184 | 3300005616 | Bacteria | 6317 |
| 160 | Ga0068852_100016621 | 3300005616 | Bacteria | 5747 |
| 161 | Ga0068852_100044248 | 3300005616 | Bacteria | 3780 |
| 162 | Ga0068859_100000365 | 3300005617 | Bacteria | 45011 |
| 163 | Ga0068859_100047840 | 3300005617 | Bacteria | 4297 |
| 164 | Ga0068859_100412923 | 3300005617 | Bacteria | 1446 |
| 165 | Ga0068864_100000271 | 3300005618 | Bacteria | 46062 |
| 166 | Ga0068864_100008822 | 3300005618 | Bacteria | 8313 |
| 167 | Ga0068864_100114845 | 3300005618 | Bacteria | 2401 |
| 168 | Ga0068864_100320760 | 3300005618 | Bacteria | 1455 |
| 169 | Ga0068866_10000213 | 3300005718 | Bacteria | 27527 |
| 170 | Ga0068866_10022761 | 3300005718 | Bacteria | 2904 |
| 171 | Ga0068861_100000340 | 3300005719 | Bacteria | 26546 |
| 172 | Ga0068851_10042084 | 3300005834 | Bacteria | 2299 |
| 173 | Ga0068870_10000079 | 3300005840 | Bacteria | 31219 |
| 174 | Ga0068870_10028939 | 3300005840 | Bacteria | 2786 |
| 175 | Ga0068863_100000372 | 3300005841 | Bacteria | 45645 |
| 176 | Ga0068863_100018999 | 3300005841 | Bacteria | 6577 |
| 177 | Ga0068858_100000809 | 3300005842 | Bacteria | 32733 |
| 178 | Ga0068858_100075189 | 3300005842 | Bacteria | 3137 |
| 179 | Ga0068860_100000709 | 3300005843 | Bacteria | 38176 |
| 180 | Ga0068860_100020845 | 3300005843 | Bacteria | 6350 |
| 181 | Ga0068860_100035563 | 3300005843 | Bacteria | 4777 |
| 182 | Ga0068862_100000512 | 3300005844 | Bacteria | 41177 |
| 183 | Ga0068862_100004009 | 3300005844 | Bacteria | 12486 |
| 184 | Ga0068862_100076488 | 3300005844 | Bacteria | 2897 |
| 185 | Ga0068862_100203993 | 3300005844 | Bacteria | 1784 |
| 186 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 187 | Ga0081455_10005639 | 3300005937 | Bacteria | 13672 |
| 188 | Ga0081538_10029783 | 3300005981 | Bacteria | 3721 |
| 189 | Ga0081540_1024073 | 3300005983 | Bacteria | 3542 |
| 190 | Ga0070717_10018110 | 3300006028 | Bacteria | 5494 |
| 191 | Ga0070717_10022929 | 3300006028 | Unclassified | 4940 |
| 192 | Ga0070717_10128784 | 3300006028 | Bacteria | 2175 |
| 193 | Ga0075365_10007934 | 3300006038 | Bacteria | 5984 |
| 194 | Ga0075365_10018478 | 3300006038 | Bacteria | 4288 |
| 195 | Ga0075365_10152320 | 3300006038 | Bacteria | 1609 |
| 196 | Ga0075368_10037512 | 3300006042 | Bacteria | 1895 |
| 197 | Ga0075364_10096848 | 3300006051 | Bacteria | 1962 |
| 198 | Ga0075364_10135245 | 3300006051 | Bacteria | 1656 |
| 199 | Ga0075432_10000890 | 3300006058 | Bacteria | 9398 |
| 200 | Ga0070715_10003805 | 3300006163 | Bacteria | 4871 |
| 201 | Ga0070715_10063039 | 3300006163 | Bacteria | 1633 |
| 202 | Ga0070716_100020144 | 3300006173 | Bacteria | 3498 |
| 203 | Ga0070716_100044437 | 3300006173 | Bacteria | 2489 |
| 204 | Ga0070712_100001284 | 3300006175 | Bacteria | 15170 |
| 205 | Ga0070712_100055031 | 3300006175 | Bacteria | 2784 |
| 206 | Ga0075367_10044338 | 3300006178 | Bacteria | 2606 |
| 207 | Ga0075367_10129676 | 3300006178 | Bacteria | 1558 |
| 208 | Ga0075366_10001684 | 3300006195 | Bacteria | 11097 |
| 209 | Ga0097621_100000047 | 3300006237 | Bacteria | 63910 |
| 210 | Ga0075370_10028682 | 3300006353 | Bacteria | 3095 |
| 211 | Ga0075370_10096283 | 3300006353 | Bacteria | 1710 |
| 212 | Ga0068871_100000721 | 3300006358 | Bacteria | 22411 |
| 213 | Ga0075428_100000945 | 3300006844 | Bacteria | 30758 |
| 214 | Ga0075428_100005796 | 3300006844 | Bacteria | 13717 |
| 215 | Ga0075428_100038586 | 3300006844 | Bacteria | 5257 |
| 216 | Ga0075428_100067105 | 3300006844 | Bacteria | 3928 |
| 217 | Ga0075428_100339283 | 3300006844 | Bacteria | 1614 |
| 218 | Ga0075430_100000770 | 3300006846 | Bacteria | 24728 |
| 219 | Ga0075430_100012439 | 3300006846 | Bacteria | 7242 |
| 220 | Ga0075430_100130940 | 3300006846 | Bacteria | 2091 |
| 221 | Ga0075430_100145136 | 3300006846 | Bacteria | 1977 |
| 222 | Ga0075431_100000399 | 3300006847 | Bacteria | 35027 |
| 223 | Ga0075431_100000864 | 3300006847 | Bacteria | 26611 |
| 224 | Ga0075431_100002340 | 3300006847 | Bacteria | 18197 |
| 225 | Ga0075431_100019719 | 3300006847 | Bacteria | 6882 |
| 226 | Ga0075431_100035827 | 3300006847 | Bacteria | 5109 |
| 227 | Ga0075431_100090910 | 3300006847 | Bacteria | 3151 |
| 228 | Ga0075433_10000374 | 3300006852 | Bacteria | 28158 |
| 229 | Ga0075433_10002587 | 3300006852 | Bacteria | 13788 |
| 230 | Ga0075433_10105325 | 3300006852 | Bacteria | 2499 |
| 231 | Ga0075434_100001558 | 3300006871 | Bacteria | 19441 |
| 232 | Ga0075434_100021991 | 3300006871 | Bacteria | 6208 |
| 233 | Ga0075434_100045630 | 3300006871 | Bacteria | 4348 |
| 234 | Ga0075434_100075588 | 3300006871 | Bacteria | 3362 |
| 235 | Ga0075429_100002444 | 3300006880 | Bacteria | 15642 |
| 236 | Ga0075429_100016146 | 3300006880 | Bacteria | 6469 |
| 237 | Ga0075429_100042323 | 3300006880 | Bacteria | 3964 |
| 238 | Ga0068865_100000415 | 3300006881 | Bacteria | 23798 |
| 239 | Ga0068865_100015689 | 3300006881 | Bacteria | 4834 |
| 240 | Ga0075436_100062929 | 3300006914 | Bacteria | 2565 |
| 241 | Ga0075436_100216097 | 3300006914 | Bacteria | 1360 |
| 242 | Ga0097620_100000365 | 3300006931 | Bacteria | 45011 |
| 243 | Ga0097620_100047843 | 3300006931 | Bacteria | 4297 |
| 244 | Ga0097620_100412883 | 3300006931 | Bacteria | 1446 |
| 245 | Ga0075435_100004974 | 3300007076 | Bacteria | 9226 |
| 246 | Ga0075435_100165546 | 3300007076 | Bacteria | 1864 |
| 247 | Ga0105240_10032816 | 3300009093 | Bacteria | 6717 |
| 248 | Ga0105240_10139901 | 3300009093 | Bacteria | 2894 |
| 249 | Ga0105240_10304265 | 3300009093 | Bacteria | 1823 |
| 250 | Ga0105240_10403803 | 3300009093 | Bacteria | 1538 |
| 251 | Ga0111539_10000185 | 3300009094 | Bacteria | 72688 |
| 252 | Ga0111539_10001287 | 3300009094 | Bacteria | 33486 |
| 253 | Ga0111539_10001763 | 3300009094 | Bacteria | 28733 |
| 254 | Ga0111539_10064483 | 3300009094 | Bacteria | 4333 |
| 255 | Ga0111539_10256160 | 3300009094 | Bacteria | 2038 |
| 256 | Ga0111539_10598327 | 3300009094 | Bacteria | 1284 |
| 257 | Ga0105245_10000213 | 3300009098 | Bacteria | 55096 |
| 258 | Ga0105245_10054347 | 3300009098 | Bacteria | 3596 |
| 259 | Ga0105247_10002058 | 3300009101 | Bacteria | 13924 |
| 260 | Ga0105247_10012021 | 3300009101 | Bacteria | 5199 |
| 261 | Ga0105247_10092998 | 3300009101 | Bacteria | 1916 |
| 262 | Ga0114129_10001337 | 3300009147 | Bacteria | 33051 |
| 263 | Ga0114129_10001978 | 3300009147 | Bacteria | 28018 |
| 264 | Ga0114129_10006361 | 3300009147 | Bacteria | 16744 |
| 265 | Ga0114129_10006806 | 3300009147 | Bacteria | 16234 |
| 266 | Ga0114129_10139264 | 3300009147 | Bacteria | 3328 |
| 267 | Ga0105243_10000175 | 3300009148 | Bacteria | 73728 |
| 268 | Ga0105243_10003796 | 3300009148 | Bacteria | 12086 |
| 269 | Ga0105241_10000734 | 3300009174 | Bacteria | 24869 |
| 270 | Ga0105242_10000170 | 3300009176 | Bacteria | 49285 |
| 271 | Ga0105248_10003499 | 3300009177 | Bacteria | 17428 |
| 272 | Ga0105248_10006875 | 3300009177 | Bacteria | 12467 |
| 273 | Ga0105248_10013011 | 3300009177 | Bacteria | 9171 |
| 274 | Ga0105237_10003191 | 3300009545 | Bacteria | 19674 |
| 275 | Ga0105237_10007504 | 3300009545 | Bacteria | 11926 |
| 276 | Ga0105237_10023530 | 3300009545 | Bacteria | 6311 |
| 277 | Ga0105237_10111179 | 3300009545 | Bacteria | 2731 |
| 278 | Ga0105238_10096307 | 3300009551 | Bacteria | 2945 |
| 279 | Ga0105238_10302396 | 3300009551 | Bacteria | 1583 |
| 280 | Ga0105249_10000200 | 3300009553 | Bacteria | 68748 |
| 281 | Ga0105249_10007192 | 3300009553 | Bacteria | 9721 |
| 282 | Ga0105249_10042898 | 3300009553 | Bacteria | 4115 |
| 283 | Ga0099796_10022992 | 3300010159 | Bacteria | 1941 |
| 284 | Ga0105239_10000834 | 3300010375 | Bacteria | 43762 |
| 285 | Ga0105239_10007410 | 3300010375 | Bacteria | 12587 |
| 286 | Ga0105239_10030237 | 3300010375 | Bacteria | 5953 |
| 287 | Ga0105239_10141445 | 3300010375 | Bacteria | 2682 |
| 288 | Ga0105246_10000050 | 3300011119 | Bacteria | 46833 |
| 289 | Ga0157373_10061392 | 3300013100 | Bacteria | 2662 |
| 290 | Ga0157374_10002488 | 3300013296 | Bacteria | 15565 |
| 291 | Ga0157374_10121362 | 3300013296 | Bacteria | 2523 |
| 292 | Ga0157378_10000581 | 3300013297 | Bacteria | 34391 |
| 293 | Ga0157378_10074159 | 3300013297 | Bacteria | 3061 |
| 294 | Ga0157378_10124457 | 3300013297 | Bacteria | 2380 |
| 295 | Ga0163162_10000222 | 3300013306 | Bacteria | 52141 |
| 296 | Ga0163162_10029144 | 3300013306 | Bacteria | 5461 |
| 297 | Ga0157372_10001777 | 3300013307 | Bacteria | 23400 |
| 298 | Ga0157375_10001098 | 3300013308 | Bacteria | 23463 |
| 299 | Ga0157375_10015199 | 3300013308 | Bacteria | 6887 |
| 300 | Ga0157375_10167137 | 3300013308 | Bacteria | 2345 |
| 301 | Ga0163163_10000693 | 3300014325 | Bacteria | 28657 |
| 302 | Ga0163163_10005957 | 3300014325 | Bacteria | 10607 |
| 303 | Ga0163163_10008982 | 3300014325 | Bacteria | 8906 |
| 304 | Ga0163163_10032794 | 3300014325 | Bacteria | 5019 |
| 305 | Ga0163163_10044003 | 3300014325 | Bacteria | 4379 |
| 306 | Ga0157380_10000361 | 3300014326 | Bacteria | 27316 |
| 307 | Ga0157380_10156665 | 3300014326 | Bacteria | 1975 |
| 308 | Ga0157377_10000204 | 3300014745 | Bacteria | 32705 |
| 309 | Ga0157377_10017981 | 3300014745 | Bacteria | 3667 |
| 310 | Ga0157377_10124970 | 3300014745 | Bacteria | 1564 |
| 311 | Ga0157379_10000036 | 3300014968 | Bacteria | 81888 |
| 312 | Ga0157379_10019284 | 3300014968 | Bacteria | 6023 |
| 313 | Ga0157376_10000062 | 3300014969 | Bacteria | 89308 |
| 314 | Ga0163161_10000363 | 3300017792 | Bacteria | 37872 |
| 315 | Ga0163161_10015961 | 3300017792 | Bacteria | 5241 |
| 316 | Ga0207666_1000015 | 3300025271 | Bacteria | 41241 |
| 317 | Ga0207666_1002258 | 3300025271 | Bacteria | 2311 |
| 318 | Ga0207673_1000067 | 3300025290 | Bacteria | 8932 |
| 319 | Ga0209758_1000063 | 3300025297 | Bacteria | 315999 |
| 320 | Ga0209758_1015119 | 3300025297 | Bacteria | 4027 |
| 321 | Ga0207697_10000088 | 3300025315 | Bacteria | 41270 |
| 322 | Ga0207697_10020214 | 3300025315 | Bacteria | 2726 |
| 323 | Ga0207653_10000413 | 3300025885 | Bacteria | 18224 |
| 324 | Ga0207682_10000004 | 3300025893 | Bacteria | 104760 |
| 325 | Ga0207692_10089732 | 3300025898 | Bacteria | 1664 |
| 326 | Ga0207642_10000291 | 3300025899 | Bacteria | 14980 |
| 327 | Ga0207642_10037070 | 3300025899 | Bacteria | 2098 |
| 328 | Ga0207710_10001511 | 3300025900 | Bacteria | 11534 |
| 329 | Ga0207688_10000042 | 3300025901 | Bacteria | 44479 |
| 330 | Ga0207688_10000735 | 3300025901 | Bacteria | 16242 |
| 331 | Ga0207680_10000311 | 3300025903 | Bacteria | 23202 |
| 332 | Ga0207647_10000417 | 3300025904 | Bacteria | 35010 |
| 333 | Ga0207647_10009783 | 3300025904 | Bacteria | 6800 |
| 334 | Ga0207647_10074921 | 3300025904 | Bacteria | 2038 |
| 335 | Ga0207685_10027824 | 3300025905 | Bacteria | 1983 |
| 336 | Ga0207645_10000061 | 3300025907 | Bacteria | 77457 |
| 337 | Ga0207645_10009017 | 3300025907 | Bacteria | 6921 |
| 338 | Ga0207643_10000012 | 3300025908 | Bacteria | 133318 |
| 339 | Ga0207643_10000820 | 3300025908 | Bacteria | 18861 |
| 340 | Ga0207654_10001794 | 3300025911 | Bacteria | 11151 |
| 341 | Ga0207707_10006621 | 3300025912 | Bacteria | 10109 |
| 342 | Ga0207707_10150646 | 3300025912 | Bacteria | 2034 |
| 343 | Ga0207707_10275037 | 3300025912 | Bacteria | 1459 |
| 344 | Ga0207695_10151269 | 3300025913 | Bacteria | 2260 |
| 345 | Ga0207671_10004932 | 3300025914 | Bacteria | 12520 |
| 346 | Ga0207671_10011350 | 3300025914 | Bacteria | 7258 |
| 347 | Ga0207671_10220962 | 3300025914 | Bacteria | 1484 |
| 348 | Ga0207693_10002503 | 3300025915 | Bacteria | 15983 |
| 349 | Ga0207693_10004962 | 3300025915 | Bacteria | 11175 |
| 350 | Ga0207660_10000008 | 3300025917 | Bacteria | 98521 |
| 351 | Ga0207660_10059606 | 3300025917 | Bacteria | 2741 |
| 352 | Ga0207660_10173842 | 3300025917 | Bacteria | 1669 |
| 353 | Ga0207662_10000097 | 3300025918 | Bacteria | 41243 |
| 354 | Ga0207662_10001103 | 3300025918 | Bacteria | 12684 |
| 355 | Ga0207657_10000503 | 3300025919 | Bacteria | 41249 |
| 356 | Ga0207657_10002293 | 3300025919 | Bacteria | 20727 |
| 357 | Ga0207649_10000099 | 3300025920 | Bacteria | 71350 |
| 358 | Ga0207652_10001041 | 3300025921 | Bacteria | 25403 |
| 359 | Ga0207652_10045826 | 3300025921 | Bacteria | 3728 |
| 360 | Ga0207652_10195128 | 3300025921 | Bacteria | 1821 |
| 361 | Ga0207652_10245066 | 3300025921 | Bacteria | 1616 |
| 362 | Ga0207681_10000141 | 3300025923 | Bacteria | 59951 |
| 363 | Ga0207681_10035982 | 3300025923 | Bacteria | 3264 |
| 364 | Ga0207681_10209316 | 3300025923 | Bacteria | 1502 |
| 365 | Ga0207694_10076058 | 3300025924 | Bacteria | 2629 |
| 366 | Ga0207650_10007055 | 3300025925 | Bacteria | 7659 |
| 367 | Ga0207650_10007962 | 3300025925 | Bacteria | 7224 |
| 368 | Ga0207650_10017621 | 3300025925 | Bacteria | 5002 |
| 369 | Ga0207650_10039576 | 3300025925 | Bacteria | 3445 |
| 370 | Ga0207659_10000023 | 3300025926 | Bacteria | 142947 |
| 371 | Ga0207659_10189377 | 3300025926 | Bacteria | 1636 |
| 372 | Ga0207687_10000319 | 3300025927 | Bacteria | 32748 |
| 373 | Ga0207687_10015396 | 3300025927 | Bacteria | 5014 |
| 374 | Ga0207700_10007483 | 3300025928 | Bacteria | 6677 |
| 375 | Ga0207700_10014366 | 3300025928 | Bacteria | 5186 |
| 376 | Ga0207664_10077228 | 3300025929 | Unclassified | 2698 |
| 377 | Ga0207664_10084933 | 3300025929 | Bacteria | 2583 |
| 378 | Ga0207644_10015130 | 3300025931 | Bacteria | 5175 |
| 379 | Ga0207644_10119075 | 3300025931 | Bacteria | 2007 |
| 380 | Ga0207690_10000105 | 3300025932 | Bacteria | 68515 |
| 381 | Ga0207690_10034446 | 3300025932 | Bacteria | 3263 |
| 382 | Ga0207706_10000438 | 3300025933 | Bacteria | 44481 |
| 383 | Ga0207706_10005437 | 3300025933 | Bacteria | 11870 |
| 384 | Ga0207706_10010940 | 3300025933 | Bacteria | 8276 |
| 385 | Ga0207686_10000140 | 3300025934 | Bacteria | 56605 |
| 386 | Ga0207686_10031116 | 3300025934 | Bacteria | 3166 |
| 387 | Ga0207709_10000264 | 3300025935 | Bacteria | 62258 |
| 388 | Ga0207709_10005146 | 3300025935 | Bacteria | 7460 |
| 389 | Ga0207670_10000108 | 3300025936 | Bacteria | 56906 |
| 390 | Ga0207670_10003337 | 3300025936 | Bacteria | 8514 |
| 391 | Ga0207670_10073327 | 3300025936 | Bacteria | 2373 |
| 392 | Ga0207669_10000110 | 3300025937 | Bacteria | 40953 |
| 393 | Ga0207669_10044617 | 3300025937 | Bacteria | 2606 |
| 394 | Ga0207704_10000171 | 3300025938 | Bacteria | 34340 |
| 395 | Ga0207665_10001690 | 3300025939 | Bacteria | 14832 |
| 396 | Ga0207665_10070355 | 3300025939 | Bacteria | 2387 |
| 397 | Ga0207691_10001108 | 3300025940 | Bacteria | 26807 |
| 398 | Ga0207691_10002227 | 3300025940 | Bacteria | 18970 |
| 399 | Ga0207711_10002682 | 3300025941 | Bacteria | 15745 |
| 400 | Ga0207711_10083012 | 3300025941 | Bacteria | 2802 |
| 401 | Ga0207689_10000008 | 3300025942 | Bacteria | 127942 |
| 402 | Ga0207689_10018552 | 3300025942 | Bacteria | 5869 |
| 403 | Ga0207661_10000053 | 3300025944 | Bacteria | 90600 |
| 404 | Ga0207679_10000053 | 3300025945 | Bacteria | 109038 |
| 405 | Ga0207679_10046497 | 3300025945 | Bacteria | 3146 |
| 406 | Ga0207667_10008564 | 3300025949 | Bacteria | 12140 |
| 407 | Ga0207651_10000052 | 3300025960 | Bacteria | 53826 |
| 408 | Ga0207651_10192522 | 3300025960 | Bacteria | 1628 |
| 409 | Ga0207651_10301061 | 3300025960 | Bacteria | 1333 |
| 410 | Ga0207712_10000156 | 3300025961 | Bacteria | 70300 |
| 411 | Ga0207668_10000160 | 3300025972 | Bacteria | 47008 |
| 412 | Ga0207668_10015910 | 3300025972 | Bacteria | 4683 |
| 413 | Ga0207668_10032006 | 3300025972 | Bacteria | 3471 |
| 414 | Ga0207640_10000325 | 3300025981 | Bacteria | 31933 |
| 415 | Ga0207640_10113109 | 3300025981 | Bacteria | 1929 |
| 416 | Ga0207658_10021600 | 3300025986 | Bacteria | 4472 |
| 417 | Ga0207658_10036051 | 3300025986 | Bacteria | 3545 |
| 418 | Ga0207658_10057895 | 3300025986 | Bacteria | 2882 |
| 419 | Ga0207658_10094028 | 3300025986 | Bacteria | 2332 |
| 420 | Ga0207703_10001510 | 3300026035 | Bacteria | 21203 |
| 421 | Ga0207703_10022564 | 3300026035 | Bacteria | 4938 |
| 422 | Ga0207703_10038453 | 3300026035 | Bacteria | 3818 |
| 423 | Ga0207639_10001511 | 3300026041 | Bacteria | 15635 |
| 424 | Ga0207678_10000185 | 3300026067 | Bacteria | 53359 |
| 425 | Ga0207678_10031346 | 3300026067 | Bacteria | 4638 |
| 426 | Ga0207708_10000263 | 3300026075 | Bacteria | 41243 |
| 427 | Ga0207708_10001344 | 3300026075 | Bacteria | 18498 |
| 428 | Ga0207708_10005439 | 3300026075 | Bacteria | 9392 |
| 429 | Ga0207702_10000297 | 3300026078 | Bacteria | 57296 |
| 430 | Ga0207641_10067239 | 3300026088 | Bacteria | 3069 |
| 431 | Ga0207648_10000469 | 3300026089 | Bacteria | 45034 |
| 432 | Ga0207648_10038076 | 3300026089 | Bacteria | 4233 |
| 433 | Ga0207648_10132054 | 3300026089 | Bacteria | 2198 |
| 434 | Ga0207676_10001235 | 3300026095 | Bacteria | 19009 |
| 435 | Ga0207674_10001208 | 3300026116 | Bacteria | 33667 |
| 436 | Ga0207675_100000342 | 3300026118 | Bacteria | 44471 |
| 437 | Ga0207675_100002754 | 3300026118 | Bacteria | 17280 |
| 438 | Ga0207675_100033440 | 3300026118 | Bacteria | 4791 |
| 439 | Ga0207683_10000006 | 3300026121 | Bacteria | 181260 |
| 440 | Ga0207683_10009722 | 3300026121 | Bacteria | 8202 |
| 441 | Ga0207683_10024092 | 3300026121 | Bacteria | 5238 |
| 442 | Ga0207683_10139099 | 3300026121 | Bacteria | 2187 |
| 443 | Ga0207698_10000236 | 3300026142 | Bacteria | 34581 |
| 444 | Ga0207698_10269963 | 3300026142 | Bacteria | 1568 |
| 445 | Ga0207698_10337831 | 3300026142 | Bacteria | 1417 |
| 446 | Ga0209995_1004032 | 3300027471 | Bacteria | 2345 |
| 447 | Ga0209971_1003649 | 3300027682 | Bacteria | 3644 |
| 448 | Ga0209966_1001615 | 3300027695 | Bacteria | 3857 |
| 449 | Ga0209998_10001431 | 3300027717 | Bacteria | 5774 |
| 450 | Ga0209998_10004020 | 3300027717 | Bacteria | 3148 |
| 451 | Ga0209974_10002024 | 3300027876 | Bacteria | 7403 |
| 452 | Ga0207428_10000112 | 3300027907 | Bacteria | 110733 |
| 453 | Ga0207428_10000417 | 3300027907 | Bacteria | 52860 |
| 454 | Ga0207428_10000480 | 3300027907 | Bacteria | 48240 |
| 455 | Ga0268266_10017509 | 3300028379 | Bacteria | 6113 |
| 456 | Ga0268266_10028193 | 3300028379 | Bacteria | 4774 |
| 457 | Ga0268265_10000257 | 3300028380 | Bacteria | 60485 |
| 458 | Ga0268265_10037761 | 3300028380 | Bacteria | 3547 |
| 459 | Ga0268264_10000579 | 3300028381 | Bacteria | 44364 |
| 460 | Ga0268264_10046931 | 3300028381 | Bacteria | 3590 |
| 461 | Ga0265330_10045863 | 3300031235 | Bacteria | 1927 |
| 462 | Ga0265332_10014392 | 3300031238 | Bacteria | 3499 |
| 463 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 464 | Ga0265325_10000106 | 3300031241 | Bacteria | 59197 |
| 465 | Ga0265325_10019773 | 3300031241 | Bacteria | 3718 |
| 466 | Ga0265325_10028908 | 3300031241 | Bacteria | 2984 |
| 467 | Ga0265340_10013567 | 3300031247 | Bacteria | 4278 |
| 468 | Ga0265340_10014025 | 3300031247 | Bacteria | 4198 |
| 469 | Ga0265331_10024375 | 3300031250 | Bacteria | 3061 |
| 470 | Ga0265331_10036762 | 3300031250 | Bacteria | 2402 |
| 471 | Ga0265316_10144407 | 3300031344 | Bacteria | 1785 |
| 472 | Ga0265313_10011012 | 3300031595 | Bacteria | 5653 |
| 473 | Ga0265314_10005765 | 3300031711 | Bacteria | 11114 |
| 474 | Ga0265342_10012693 | 3300031712 | Bacteria | 5697 |
| 475 | Ga0373930_0000160 | 3300034816 | Bacteria | 7781 |
| 476 | Ga0373958_0000508 | 3300034819 | Bacteria | 4829 |
| 477 | Ga0373958_0000865 | 3300034819 | Bacteria | 3891 |
| 478 | Ga0373959_0000573 | 3300034820 | Bacteria | 6467 |
| 479 | Ga0373938_0000090 | 3300034957 | Bacteria | 12290 |
| 480 | Ga0373938_0001252 | 3300034957 | Bacteria | 4089 |
| 481 | Ga0373926_0001790 | 3300035083 | Bacteria | 6673 |
| 482 | Ga0373926_0064737 | 3300035083 | Bacteria | 1336 |
| 483 | Ga0373928_0000536 | 3300035084 | Bacteria | 7378 |
| 484 | Ga0373929_0000741 | 3300035085 | Bacteria | 6324 |
| 485 | Ga0373929_0003008 | 3300035085 | Bacteria | 3069 |
| 486 | Ga0373929_0011677 | 3300035085 | Bacteria | 1658 |
| 487 | Ga0373929_0011950 | 3300035085 | Bacteria | 1643 |
| 488 | Ga0373934_0002928 | 3300035086 | Bacteria | 6245 |
| 489 | Ga0373934_0050861 | 3300035086 | Bacteria | 1642 |
| 490 | Ga0373940_0000074 | 3300035088 | Bacteria | 11657 |
| 491 | Ga0373949_0000489 | 3300035090 | Bacteria | 13482 |
| 492 | Ga0373949_0001646 | 3300035090 | Bacteria | 6231 |
| 493 | Ga0373951_0001485 | 3300035091 | Bacteria | 6116 |
| 494 | Ga0373951_0003044 | 3300035091 | Bacteria | 4146 |
| 495 | Ga0373952_0000166 | 3300035092 | Bacteria | 10016 |
| 496 | Ga0373952_0001370 | 3300035092 | Bacteria | 4459 |
| 497 | Ga0373923_0009157 | 3300035111 | Bacteria | 3561 |
| 498 | Ga0373932_0001675 | 3300035112 | Bacteria | 6050 |
| 499 | Ga0373939_0000873 | 3300035114 | Bacteria | 7470 |
| 500 | Ga0373939_0001847 | 3300035114 | Bacteria | 5085 |
| 501 | Ga0373941_0000030 | 3300035115 | Bacteria | 21511 |
| 502 | Ga0373941_0001773 | 3300035115 | Bacteria | 4647 |
| 503 | Ga0373945_0019356 | 3300035116 | Bacteria | 2324 |
| 504 | Ga0373953_0000578 | 3300035117 | Bacteria | 10189 |
| 505 | Ga0373953_0002486 | 3300035117 | Bacteria | 5578 |
| 506 | Ga0373954_0001627 | 3300035118 | Bacteria | 9195 |
| 507 | Ga0373954_0040916 | 3300035118 | Bacteria | 2160 |
| 508 | Ga0373956_0001905 | 3300035119 | Bacteria | 8610 |
| 509 | Ga0373957_0000887 | 3300035120 | Bacteria | 7827 |
| 510 | Ga0373960_0000108 | 3300035121 | Bacteria | 13171 |
| 511 | Ga0373960_0014890 | 3300035121 | Bacteria | 1977 |
| 512 | Ga0373943_0025977 | 3300035170 | Bacteria | 2740 |
| 513 | Ga0373943_0090527 | 3300035170 | Bacteria | 1584 |
| 514 | Ga0373943_0099870 | 3300035170 | Bacteria | 1516 |
| 515 | Ga0373946_0032273 | 3300035171 | Bacteria | 2102 |
| 516 | Ga0373955_0000175 | 3300035172 | Bacteria | 26347 |
| 517 | Ga0373955_0013942 | 3300035172 | Bacteria | 3901 |
| 518 | Ga0373942_0000232 | 3300035207 | Bacteria | 14790 |
| 519 | Ga0373942_0001290 | 3300035207 | Bacteria | 6558 |
| 520 | Ga0373961_0000666 | 3300035241 | Bacteria | 12175 |
| 521 | Ga0373961_0001000 | 3300035241 | Bacteria | 9283 |
| 522 | Ga0373924_0000864 | 3300035410 | Bacteria | 9547 |
| 523 | Ga0373924_0054220 | 3300035410 | Bacteria | 1667 |
| 524 | Ga0373924_0058362 | 3300035410 | Bacteria | 1611 |
| 525 | Ga0373931_0000084 | 3300035691 | Bacteria | 44377 |
| 526 | Ga0373931_0000494 | 3300035691 | Bacteria | 16104 |
| 527 | Ga0373931_0007939 | 3300035691 | Bacteria | 5021 |
| 528 | Ga0373931_0018612 | 3300035691 | Bacteria | 3457 |
| 529 | Ga0373935_0084039 | 3300035692 | Bacteria | 2073 |
| 530 | Ga0373935_0251671 | 3300035692 | Bacteria | 1236 |
| 531 | Ga0373927_0007901 | 3300035695 | Bacteria | 7188 |
| 532 | Ga0373927_0008654 | 3300035695 | Bacteria | 6840 |
| 533 | Ga0373947_0027758 | 3300035725 | Bacteria | 3314 |
| 534 | Ga0373947_0113242 | 3300035725 | Bacteria | 1717 |
| 535 | Ga0373937_0025710 | 3300036401 | Bacteria | 5317 |
| 536 | Ga0373937_0028847 | 3300036401 | Bacteria | 5024 |
| 537 | Ga0373937_0091616 | 3300036401 | Unclassified | 2817 |
| 538 | Ga0373937_0122848 | 3300036401 | Bacteria | 2421 |
| 539 | Ga0373937_0324634 | 3300036401 | Bacteria | 1456 |
| 540 | Ga0373925_0003332 | 3300037068 | Bacteria | 12485 |
| 541 | Ga0373925_0020865 | 3300037068 | Bacteria | 4775 |
| 542 | Ga0373925_0034015 | 3300037068 | Bacteria | 3756 |
| 543 | Ga0373925_0045279 | 3300037068 | Bacteria | 3268 |
| 544 | Ga0373925_0092277 | 3300037068 | Bacteria | 2316 |
| 545 | Ga0395900_0050508 | 3300037418 | Bacteria | 4283 |
| 546 | Ga0395898_0021789 | 3300037466 | Bacteria | 6492 |
| 547 | Ga0395901_0003398 | 3300038443 | Bacteria | 16036 |
| 548 | Ga0395901_0014946 | 3300038443 | Bacteria | 7888 |
| 549 | Ga0436362_0393363 | 3300039453 | Bacteria | 1186 |
| 550 | Ga0439455_0001935 | 3300042012 | Bacteria | 3643 |
| 551 | Ga0466966_0040567 | 3300044684 | Unclassified | 2996 |
| 552 | Ga0453684_0078254 | 3300044712 | Bacteria | 4139 |
| 553 | Ga0466959_0005260 | 3300045049 | Bacteria | 8839 |
| 554 | Ga0495592_0001017 | 3300046454 | Bacteria | 19452 |
| 555 | Ga0495592_0007899 | 3300046454 | Bacteria | 7978 |
| 556 | Ga0495603_0001247 | 3300046455 | Bacteria | 14873 |
| 557 | Ga0495603_0021569 | 3300046455 | Bacteria | 3901 |
| 558 | Ga0495603_0109076 | 3300046455 | Bacteria | 1615 |
| 559 | Ga0495629_0001052 | 3300046459 | Bacteria | 22061 |
| 560 | Ga0495629_0001205 | 3300046459 | Bacteria | 20378 |
| 561 | Ga0495641_0013443 | 3300046461 | Bacteria | 4499 |
| 562 | Ga0495641_0072818 | 3300046461 | Bacteria | 1541 |
| 563 | Ga0495651_0037434 | 3300046462 | Bacteria | 3776 |
| 564 | Ga0495653_0008098 | 3300046463 | Bacteria | 8610 |
| 565 | Ga0495653_0060993 | 3300046463 | Bacteria | 2855 |
| 566 | Ga0495580_0036343 | 3300046472 | Bacteria | 3536 |
| 567 | Ga0495582_0000221 | 3300046473 | Bacteria | 31591 |
| 568 | Ga0495582_0002529 | 3300046473 | Bacteria | 10175 |
| 569 | Ga0495582_0011254 | 3300046473 | Bacteria | 4930 |
| 570 | Ga0495582_0105981 | 3300046473 | Bacteria | 1576 |
| 571 | Ga0495639_0001053 | 3300046475 | Bacteria | 12441 |
| 572 | Ga0495662_0005160 | 3300046476 | Bacteria | 6548 |
| 573 | Ga0495584_0064495 | 3300046491 | Bacteria | 1842 |
| 574 | Ga0495584_0067001 | 3300046491 | Bacteria | 1806 |
| 575 | Ga0495584_0080323 | 3300046491 | Bacteria | 1641 |
| 576 | Ga0495585_0017904 | 3300046492 | Bacteria | 4089 |
| 577 | Ga0495594_0003526 | 3300046499 | Bacteria | 8057 |
| 578 | Ga0495594_0007017 | 3300046499 | Bacteria | 5791 |
| 579 | Ga0495607_0095057 | 3300046501 | Bacteria | 1607 |
| 580 | Ga0495618_0085903 | 3300046514 | Bacteria | 2011 |
| 581 | Ga0495628_0001389 | 3300046516 | Bacteria | 22209 |
| 582 | Ga0495630_0002234 | 3300046517 | Bacteria | 13474 |
| 583 | Ga0495632_0043518 | 3300046519 | Bacteria | 2244 |
| 584 | Ga0495666_0034071 | 3300046526 | Bacteria | 2485 |
| 585 | Ga0495666_0042705 | 3300046526 | Bacteria | 2191 |
| 586 | Ga0495665_0000755 | 3300046531 | Bacteria | 16775 |
| 587 | Ga0495640_0014178 | 3300046533 | Bacteria | 6042 |
| 588 | Ga0495640_0046151 | 3300046533 | Bacteria | 3020 |
| 589 | Ga0495587_0005876 | 3300046536 | Bacteria | 7995 |
| 590 | Ga0495598_0008275 | 3300046537 | Bacteria | 2416 |
| 591 | Ga0495598_0074145 | 3300046537 | Bacteria | 1078 |
| 592 | Ga0495645_0000359 | 3300046543 | Bacteria | 31690 |
| 593 | Ga0495645_0113424 | 3300046543 | Bacteria | 1916 |
| 594 | Ga0495622_0016865 | 3300046557 | Bacteria | 3400 |
| 595 | Ga0495667_0008233 | 3300046559 | Bacteria | 7073 |
| 596 | Ga0495667_0064630 | 3300046559 | Bacteria | 2393 |
| 597 | Ga0495656_0100005 | 3300046615 | Bacteria | 1340 |
| 598 | Ga0495668_0100798 | 3300046616 | Bacteria | 1580 |
| 599 | Ga0495634_0003584 | 3300046642 | Bacteria | 12413 |
| 600 | Ga0495634_0006941 | 3300046642 | Bacteria | 8552 |
| 601 | Ga0495635_0010668 | 3300046663 | Bacteria | 6431 |
| 602 | Ga0495635_0011640 | 3300046663 | Bacteria | 6165 |
| 603 | Ga0495661_0080219 | 3300046665 | Bacteria | 1884 |
| 604 | Ga0495588_0027388 | 3300046674 | Bacteria | 2848 |
| 605 | Ga0495657_0010478 | 3300046675 | Bacteria | 6974 |
| 606 | Ga0495599_0004983 | 3300046678 | Bacteria | 7898 |
| 607 | Ga0495599_0047473 | 3300046678 | Bacteria | 2691 |
| 608 | Ga0495623_0022892 | 3300046679 | Bacteria | 4034 |
| 609 | Ga0495646_0016189 | 3300046680 | Bacteria | 4733 |
| 610 | Ga0495647_0001581 | 3300046681 | Bacteria | 7034 |
| 611 | Ga0495613_0000393 | 3300046689 | Bacteria | 37458 |
| 612 | Ga0495613_0002804 | 3300046689 | Bacteria | 13079 |
| 613 | Ga0495613_0123852 | 3300046689 | Bacteria | 1854 |
| 614 | Ga0495624_0000182 | 3300046690 | Bacteria | 46968 |
| 615 | Ga0495624_0036468 | 3300046690 | Bacteria | 3169 |
| 616 | Ga0495649_0060592 | 3300046694 | Bacteria | 2036 |
| 617 | Ga0495600_0001577 | 3300046809 | Bacteria | 12681 |
| 618 | Ga0495581_0000093 | 3300047315 | Bacteria | 36772 |
| 619 | Ga0495604_0017879 | 3300047317 | Bacteria | 5672 |
| 620 | Ga0495674_0005687 | 3300047319 | Bacteria | 11939 |
| 621 | Ga0495674_0095353 | 3300047319 | Bacteria | 2537 |
| 622 | Ga0495674_0232056 | 3300047319 | Bacteria | 1523 |
| 623 | Ga0495674_0252583 | 3300047319 | Bacteria | 1451 |
| 624 | Ga0495676_0024359 | 3300047321 | Bacteria | 5241 |
| 625 | Ga0495676_0040682 | 3300047321 | Bacteria | 3833 |
| 626 | Ga0495680_0022292 | 3300047322 | Bacteria | 5281 |
| 627 | Ga0495680_0027232 | 3300047322 | Bacteria | 4698 |
| 628 | Ga0495675_0018960 | 3300047444 | Bacteria | 4369 |
| 629 | Ga0495685_067404 | 3300047447 | Bacteria | 1202 |
| 630 | Ga0495684_0000820 | 3300047471 | Bacteria | 25141 |
| 631 | Ga0495593_0000827 | 3300047673 | Bacteria | 17976 |
| 632 | Ga0495626_0051454 | 3300048091 | Bacteria | 1900 |
| 633 | Ga0496100_0000764 | 3300048903 | Bacteria | 15274 |
| 634 | Ga0496100_0035775 | 3300048903 | Bacteria | 3126 |
| 635 | Ga0496100_0148799 | 3300048903 | Bacteria | 1668 |
| 636 | Ga0496100_0149559 | 3300048903 | Bacteria | 1664 |
| 637 | Ga0496100_0211998 | 3300048903 | Bacteria | 1417 |
| 638 | Ga0496100_0254855 | 3300048903 | Bacteria | 1299 |
| 639 | Ga0496101_0003468 | 3300048904 | Bacteria | 9842 |
| 640 | Ga0496101_0014395 | 3300048904 | Bacteria | 5314 |
| 641 | Ga0496101_0031669 | 3300048904 | Bacteria | 3719 |
| 642 | Ga0496101_0067460 | 3300048904 | Bacteria | 2612 |
| 643 | Ga0496101_0099022 | 3300048904 | Bacteria | 2179 |
| 644 | Ga0496102_0007474 | 3300048905 | Bacteria | 9338 |
| 645 | Ga0496102_0022873 | 3300048905 | Bacteria | 5543 |
| 646 | Ga0496102_0030198 | 3300048905 | Bacteria | 4850 |
| 647 | Ga0496102_0041352 | 3300048905 | Bacteria | 4173 |
| 648 | Ga0496102_0104173 | 3300048905 | Bacteria | 2639 |
| 649 | Ga0496102_0206151 | 3300048905 | Bacteria | 1854 |
| 650 | Ga0496103_0001517 | 3300048906 | Bacteria | 15519 |
| 651 | Ga0496103_0066124 | 3300048906 | Bacteria | 2256 |
| 652 | Ga0496103_0100997 | 3300048906 | Bacteria | 1826 |
| 653 | Ga0496104_0000086 | 3300048907 | Bacteria | 89916 |
| 654 | Ga0496104_0004926 | 3300048907 | Bacteria | 11648 |
| 655 | Ga0496104_0008501 | 3300048907 | Bacteria | 9130 |
| 656 | Ga0496104_0040247 | 3300048907 | Bacteria | 4380 |
| 657 | Ga0496104_0042897 | 3300048907 | Bacteria | 4248 |
| 658 | Ga0496104_0081606 | 3300048907 | Bacteria | 3084 |
| 659 | Ga0496104_0108990 | 3300048907 | Bacteria | 2654 |
| 660 | Ga0496104_0340744 | 3300048907 | Bacteria | 1412 |
| 661 | Ga0496105_0000126 | 3300048908 | Bacteria | 51169 |
| 662 | Ga0496105_0014861 | 3300048908 | Bacteria | 6198 |
| 663 | Ga0496105_0205299 | 3300048908 | Bacteria | 1607 |
| 664 | Ga0496106_0000679 | 3300048909 | Bacteria | 24408 |
| 665 | Ga0496106_0054199 | 3300048909 | Bacteria | 3029 |
| 666 | Ga0496106_0148270 | 3300048909 | Bacteria | 1849 |
| 667 | Ga0496106_0198217 | 3300048909 | Bacteria | 1597 |
| 668 | Ga0496107_0000078 | 3300048910 | Bacteria | 46997 |
| 669 | Ga0496107_0047175 | 3300048910 | Bacteria | 3102 |
| 670 | Ga0496107_0171249 | 3300048910 | Bacteria | 1611 |
| 671 | Ga0496108_0002072 | 3300048911 | Bacteria | 16038 |
| 672 | Ga0496108_0022206 | 3300048911 | Bacteria | 5217 |
| 673 | Ga0496108_0065772 | 3300048911 | Bacteria | 3056 |
| 674 | Ga0496109_0000406 | 3300048912 | Bacteria | 38388 |
| 675 | Ga0496109_0001673 | 3300048912 | Bacteria | 18482 |
| 676 | Ga0496109_0004222 | 3300048912 | Bacteria | 11987 |
| 677 | Ga0496109_0028801 | 3300048912 | Bacteria | 4971 |
| 678 | Ga0496109_0063539 | 3300048912 | Bacteria | 3377 |
| 679 | Ga0496109_0077972 | 3300048912 | Bacteria | 3049 |
| 680 | Ga0496109_0174413 | 3300048912 | Bacteria | 2018 |
| 681 | Ga0496110_0012691 | 3300048913 | Bacteria | 6934 |
| 682 | Ga0496110_0012834 | 3300048913 | Bacteria | 6902 |
| 683 | Ga0496110_0033216 | 3300048913 | Bacteria | 4461 |
| 684 | Ga0496110_0065237 | 3300048913 | Bacteria | 3219 |
| 685 | Ga0496110_0095429 | 3300048913 | Bacteria | 2663 |
| 686 | Ga0496110_0247160 | 3300048913 | Bacteria | 1623 |
| 687 | Ga0496110_0249396 | 3300048913 | Bacteria | 1616 |
| 688 | Ga0496110_0386640 | 3300048913 | Bacteria | 1275 |
| 689 | Ga0496111_0025158 | 3300048914 | Bacteria | 4198 |
| 690 | Ga0496111_0036370 | 3300048914 | Bacteria | 3520 |
| 691 | Ga0496111_0041711 | 3300048914 | Bacteria | 3294 |
| 692 | Ga0496111_0044673 | 3300048914 | Bacteria | 3185 |
| 693 | Ga0496111_0099634 | 3300048914 | Bacteria | 2134 |
| 694 | Ga0496111_0120539 | 3300048914 | Bacteria | 1937 |
| 695 | Ga0496112_0019395 | 3300048915 | Bacteria | 6419 |
| 696 | Ga0496112_0096078 | 3300048915 | Bacteria | 2934 |
| 697 | Ga0496112_0097332 | 3300048915 | Bacteria | 2913 |
| 698 | Ga0496112_0485709 | 3300048915 | Bacteria | 1171 |
| 699 | Ga0496113_0001460 | 3300048916 | Bacteria | 13167 |
| 700 | Ga0496113_0017355 | 3300048916 | Bacteria | 4994 |
| 701 | Ga0496113_0043809 | 3300048916 | Bacteria | 3313 |
| 702 | Ga0496113_0107228 | 3300048916 | Bacteria | 2170 |
| 703 | Ga0496113_0136034 | 3300048916 | Bacteria | 1931 |
| 704 | Ga0496113_0193901 | 3300048916 | Bacteria | 1613 |
| 705 | Ga0496114_0005590 | 3300048917 | Bacteria | 9855 |
| 706 | Ga0496114_0008843 | 3300048917 | Bacteria | 7982 |
| 707 | Ga0496114_0029110 | 3300048917 | Bacteria | 4537 |
| 708 | Ga0496114_0071714 | 3300048917 | Bacteria | 2911 |
| 709 | Ga0496114_0078697 | 3300048917 | Bacteria | 2782 |
| 710 | Ga0496114_0300504 | 3300048917 | Bacteria | 1417 |
| 711 | Ga0496115_0004237 | 3300048918 | Bacteria | 10369 |
| 712 | Ga0496115_0007631 | 3300048918 | Bacteria | 7971 |
| 713 | Ga0496115_0058356 | 3300048918 | Bacteria | 3106 |
| 714 | Ga0496115_0092834 | 3300048918 | Bacteria | 2468 |
| 715 | Ga0496115_0095640 | 3300048918 | Bacteria | 2432 |
| 716 | Ga0501033_0022816 | 3300049570 | Bacteria | 4718 |
| 717 | Ga0501033_0045901 | 3300049570 | Bacteria | 3250 |
| 718 | Ga0501034_0073053 | 3300049571 | Bacteria | 3438 |
| 719 | Ga0501036_0010943 | 3300049572 | Bacteria | 7499 |
| 720 | Ga0501037_0013366 | 3300049573 | Bacteria | 6047 |
| 721 | Ga0501038_0010259 | 3300049574 | Bacteria | 8571 |
| 722 | Ga0501038_0180510 | 3300049574 | Bacteria | 1703 |
| 723 | Ga0501039_0007484 | 3300049575 | Bacteria | 8337 |
| 724 | Ga0501039_0153845 | 3300049575 | Bacteria | 1807 |
| 725 | Ga0501042_0116411 | 3300049578 | Bacteria | 1924 |
| 726 | Ga0501043_0025254 | 3300049579 | Bacteria | 4661 |
| 727 | Ga0501046_0013958 | 3300049580 | Bacteria | 6785 |
| 728 | Ga0501047_0078028 | 3300049581 | Bacteria | 3185 |
| 729 | Ga0501048_0001781 | 3300049582 | Bacteria | 16367 |
| 730 | Ga0501048_0204323 | 3300049582 | Bacteria | 1401 |
| 731 | Ga0501067_0014605 | 3300049583 | Bacteria | 4347 |
| 732 | Ga0501068_0017660 | 3300049584 | Bacteria | 4128 |
| 733 | Ga0501068_0131683 | 3300049584 | Bacteria | 1564 |
| 734 | Ga0501069_0031721 | 3300049585 | Bacteria | 2908 |
| 735 | Ga0501070_0020533 | 3300049586 | Bacteria | 5540 |
| 736 | Ga0501071_0005688 | 3300049587 | Bacteria | 8042 |
| 737 | Ga0501071_0064510 | 3300049587 | Bacteria | 2657 |
| 738 | Ga0501072_0048450 | 3300049588 | Bacteria | 3346 |
| 739 | Ga0501072_0282925 | 3300049588 | Bacteria | 1319 |
| 740 | Ga0501073_0028888 | 3300049589 | Bacteria | 3962 |
| 741 | Ga0501074_0164344 | 3300049590 | Bacteria | 1585 |
| 742 | Ga0501075_0082700 | 3300049591 | Bacteria | 2432 |
| 743 | Ga0501075_0255217 | 3300049591 | Bacteria | 1336 |
| 744 | Ga0501076_0072897 | 3300049592 | Bacteria | 2749 |
| 745 | Ga0501076_0084933 | 3300049592 | Bacteria | 2543 |
| 746 | Ga0501076_0135108 | 3300049592 | Bacteria | 2002 |
| 747 | Ga0501077_0115300 | 3300049593 | Bacteria | 1703 |
| 748 | Ga0501077_0153567 | 3300049593 | Bacteria | 1461 |
| 749 | Ga0501077_0159680 | 3300049593 | Bacteria | 1431 |
| 750 | Ga0501079_0025644 | 3300049741 | Bacteria | 4519 |
| 751 | Ga0501079_0141339 | 3300049741 | Bacteria | 1875 |
| 752 | Ga0501081_0091331 | 3300049743 | Bacteria | 2141 |
| 753 | Ga0501083_0015718 | 3300049744 | Bacteria | 5297 |
| 754 | Ga0501083_0029748 | 3300049744 | Bacteria | 3754 |
| 755 | Ga0501035_0008784 | 3300049822 | Bacteria | 9407 |
| 756 | Ga0501035_0018830 | 3300049822 | Bacteria | 6361 |
| 757 | Ga0501044_0000361 | 3300049823 | Bacteria | 56979 |
| 758 | Ga0501044_0012272 | 3300049823 | Bacteria | 9275 |
| 759 | Ga0501044_0033572 | 3300049823 | Bacteria | 5391 |
| 760 | Ga0501044_0049843 | 3300049823 | Bacteria | 4322 |
| 761 | Ga0501045_0129268 | 3300049824 | Bacteria | 1877 |
| 762 | Ga0501045_0203981 | 3300049824 | Bacteria | 1473 |
| 763 | nmdc:mga03683_26217_c1 | 3300050489 | Bacteria | 2298 |
| 764 | nmdc:mga03n38_42337_c1 | 3300050490 | Bacteria | 1990 |
| 765 | nmdc:mga0yw44_45643_c1 | 3300050492 | Bacteria | 2628 |
| 766 | nmdc:mga0yw44_94441_c1 | 3300050492 | Bacteria | 1895 |
| 767 | nmdc:mga0yw44_9643_c1 | 3300050492 | Bacteria | 4897 |
| 768 | nmdc:mga0k408_24125_c1 | 3300050493 | Bacteria | 3436 |
| 769 | nmdc:mga06z11_26901_c1 | 3300050494 | Bacteria | 2744 |
| 770 | nmdc:mga06z11_28752_c1 | 3300050494 | Bacteria | 2670 |
| 771 | nmdc:mga06z11_30625_c1 | 3300050494 | Bacteria | 2605 |
| 772 | nmdc:mga06z11_52236_c1 | 3300050494 | Bacteria | 2096 |
| 773 | nmdc:mga05p37_16000_c2 | 3300050507 | Bacteria | 6104 |
| 774 | nmdc:mga05p37_27070_c1 | 3300050507 | Bacteria | 6978 |
| 775 | nmdc:mga05p37_365352_c1 | 3300050507 | Bacteria | 1695 |
| 776 | nmdc:mga05p37_4104_c1 | 3300050507 | Bacteria | 17023 |
| 777 | nmdc:mga05p37_531_c1 | 3300050507 | Bacteria | 42040 |
| 778 | nmdc:mga05p37_6362_c1 | 3300050507 | Bacteria | 13917 |
| 779 | nmdc:mga05p37_694042_c1 | 3300050507 | Unclassified | 1132 |
| 780 | nmdc:mga09592_1318_c1 | 3300050508 | Bacteria | 19917 |
| 781 | nmdc:mga09592_2402_c1 | 3300050508 | Bacteria | 15117 |
| 782 | nmdc:mga0qj67_16803_c1 | 3300050509 | Bacteria | 5557 |
| 783 | nmdc:mga0qj67_3470_c1 | 3300050509 | Bacteria | 11358 |
| 784 | nmdc:mga0qj67_413_c1 | 3300050509 | Bacteria | 29228 |
| 785 | nmdc:mga06r32_105143_c1 | 3300050510 | Unclassified | 2773 |
| 786 | nmdc:mga06r32_1369_c1 | 3300050510 | Bacteria | 22022 |
| 787 | nmdc:mga06r32_15_c1 | 3300050510 | Bacteria | 106010 |
| 788 | nmdc:mga06r32_1915_c1 | 3300050510 | Bacteria | 18535 |
| 789 | nmdc:mga06r32_299562_c1 | 3300050510 | Bacteria | 1594 |
| 790 | nmdc:mga06r32_81997_c1 | 3300050510 | Bacteria | 3141 |
| 791 | nmdc:mga08y16_132617_c1 | 3300050511 | Bacteria | 2590 |
| 792 | nmdc:mga08y16_2163_c1 | 3300050511 | Bacteria | 20157 |
| 793 | nmdc:mga08y16_2892_c1 | 3300050511 | Bacteria | 17659 |
| 794 | nmdc:mga08y16_29359_c1 | 3300050511 | Bacteria | 5794 |
| 795 | nmdc:mga08y16_3734_c1 | 3300050511 | Bacteria | 15850 |
| 796 | nmdc:mga08y16_502150_c1 | 3300050511 | Bacteria | 1232 |
| 797 | nmdc:mga08y16_88647_c1 | 3300050511 | Bacteria | 3224 |
| 798 | nmdc:mga08y16_91_c4 | 3300050511 | Bacteria | 3465 |
| 799 | nmdc:mga0n895_111610_c1 | 3300050512 | Bacteria | 2750 |
| 800 | nmdc:mga0n895_137945_c1 | 3300050512 | Bacteria | 2466 |
| 801 | nmdc:mga0n895_141275_c1 | 3300050512 | Bacteria | 2436 |
| 802 | nmdc:mga0n895_209_c1 | 3300050512 | Bacteria | 36635 |
| 803 | nmdc:mga0n895_232792_c1 | 3300050512 | Bacteria | 1870 |
| 804 | nmdc:mga0n895_4169_c1 | 3300050512 | Bacteria | 11801 |
| 805 | nmdc:mga0n895_60015_c1 | 3300050512 | Bacteria | 3752 |
| 806 | nmdc:mga0n895_82182_c1 | 3300050512 | Bacteria | 3211 |
| 807 | nmdc:mga0rr50_37915_c1 | 3300050513 | Bacteria | 3483 |
| 808 | nmdc:mga0rr50_591_c1 | 3300050513 | Bacteria | 19417 |
| 809 | nmdc:mga0a205_12176_c1 | 3300050515 | Bacteria | 7953 |
| 810 | nmdc:mga0a205_306300_c1 | 3300050515 | Bacteria | 1461 |
| 811 | nmdc:mga0a205_82673_c1 | 3300050515 | Bacteria | 3102 |
| 812 | nmdc:mga0a205_9124_c1 | 3300050515 | Bacteria | 9052 |
| 813 | Ga0495601_0000137 | 3300053077 | Bacteria | 41334 |
| 814 | Ga0495601_0022124 | 3300053077 | Bacteria | 3901 |
| 815 | Ga0495601_0079273 | 3300053077 | Bacteria | 2105 |
| 816 | Ga0495601_0202313 | 3300053077 | Bacteria | 1297 |
| 817 | Ga0495612_0000679 | 3300053078 | Bacteria | 13704 |
| 818 | Ga0495595_0001498 | 3300053084 | Bacteria | 9126 |
| 819 | Ga0495595_0001994 | 3300053084 | Bacteria | 7944 |
| 820 | Ga0495619_0099834 | 3300053085 | Bacteria | 1974 |
| 821 | Ga0495619_0132323 | 3300053085 | Bacteria | 1714 |
| 822 | Ga0500554_058796 | 3300053102 | Bacteria | 1228 |
| 823 | Ga0500595_005762 | 3300053119 | Bacteria | 5359 |
| 824 | Ga0500603_000736 | 3300053150 | Bacteria | 7974 |
| 825 | Ga0500616_0019864 | 3300053153 | Bacteria | 3782 |
| 826 | Ga0500616_0040270 | 3300053153 | Bacteria | 2514 |
| 827 | Ga0500637_0152687 | 3300053178 | Bacteria | 1333 |
| 828 | Ga0501084_0002309 | 3300054114 | Bacteria | 15309 |
| 829 | Ga0501084_0079471 | 3300054114 | Bacteria | 2749 |
| 830 | Ga0501084_0096575 | 3300054114 | Bacteria | 2481 |
| 831 | Ga0501084_0179675 | 3300054114 | Bacteria | 1786 |
| 832 | Ga0501082_0032278 | 3300060353 | Bacteria | 4516 |
| 833 | Ga0501082_0232485 | 3300060353 | Bacteria | 1604 |
| 834 | Ga0501082_0269410 | 3300060353 | Bacteria | 1482 |
| 835 | Ga0530510_0186571 | 3300061734 | Bacteria | 1539 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049593 | Ga0501077_0153567 | Ga0501077_0153567_54_1007 | 305 |
| 2 | 3300046537 | Ga0495598_0074145 | Ga0495598_0074145_40_1056 | 316 |
| 3 | 3300047319 | Ga0495674_0232056 | Ga0495674_0232056_13_984 | 316 |
| 4 | 3300050494 | nmdc:mga06z11_30625_c1 | nmdc:mga06z11_30625_c1_1496_2542 | 322 |
| 5 | 3300035170 | Ga0373943_0099870 | Ga0373943_0099870_438_1484 | 324 |
| 6 | 3300060353 | Ga0501082_0232485 | Ga0501082_0232485_605_1582 | 324 |
| 7 | 3300009098 | Ga0105245_10054347 | Ga0105245_100543474 | 325 |
| 8 | 3300009101 | Ga0105247_10012021 | Ga0105247_100120213 | 325 |
| 9 | 3300009177 | Ga0105248_10006875 | Ga0105248_1000687512 | 325 |
| 10 | 3300009545 | Ga0105237_10023530 | Ga0105237_100235303 | 325 |
| 11 | 3300010375 | Ga0105239_10141445 | Ga0105239_101414454 | 325 |
| 12 | 3300013296 | Ga0157374_10121362 | Ga0157374_101213621 | 325 |
| 13 | 3300013308 | Ga0157375_10015199 | Ga0157375_100151994 | 325 |
| 14 | 3300014325 | Ga0163163_10032794 | Ga0163163_100327943 | 325 |
| 15 | 3300014745 | Ga0157377_10017981 | Ga0157377_100179813 | 325 |
| 16 | 3300014968 | Ga0157379_10019284 | Ga0157379_100192847 | 325 |
| 17 | 3300047447 | Ga0495685_067404 | Ga0495685_067404_12_1058 | 325 |
| 18 | 3300048904 | Ga0496101_0014395 | Ga0496101_0014395_569_1615 | 325 |
| 19 | 3300048905 | Ga0496102_0007474 | Ga0496102_0007474_4928_5974 | 325 |
| 20 | 3300048909 | Ga0496106_0054199 | Ga0496106_0054199_1684_2730 | 325 |
| 21 | 3300048912 | Ga0496109_0077972 | Ga0496109_0077972_1857_2903 | 325 |
| 22 | 3300048913 | Ga0496110_0247160 | Ga0496110_0247160_147_1193 | 325 |
| 23 | 3300048914 | Ga0496111_0099634 | Ga0496111_0099634_812_1858 | 325 |
| 24 | 3300048915 | Ga0496112_0019395 | Ga0496112_0019395_2342_3388 | 325 |
| 25 | 3300048918 | Ga0496115_0007631 | Ga0496115_0007631_4300_5346 | 325 |
| 26 | 3300009551 | Ga0105238_10096307 | Ga0105238_100963073 | 326 |
| 27 | 3300046501 | Ga0495607_0095057 | Ga0495607_0095057_420_1466 | 326 |
| 28 | 3300046519 | Ga0495632_0043518 | Ga0495632_0043518_892_1938 | 326 |
| 29 | 3300046615 | Ga0495656_0100005 | Ga0495656_0100005_221_1267 | 326 |
| 30 | 3300046616 | Ga0495668_0100798 | Ga0495668_0100798_260_1306 | 326 |
| 31 | 3300046694 | Ga0495649_0060592 | Ga0495649_0060592_284_1330 | 326 |
| 32 | 3300048091 | Ga0495626_0051454 | Ga0495626_0051454_166_1212 | 326 |
| 33 | 3300048917 | Ga0496114_0008843 | Ga0496114_0008843_3352_4398 | 326 |
| 34 | 3300035083 | Ga0373926_0064737 | Ga0373926_0064737_155_1222 | 331 |
| 35 | 3300037068 | Ga0373925_0020865 | Ga0373925_0020865_2061_3128 | 331 |
| 36 | 3300039453 | Ga0436362_0393363 | Ga0436362_0393363_110_1123 | 331 |
| 37 | 3300048903 | Ga0496100_0148799 | Ga0496100_0148799_501_1526 | 331 |
| 38 | 3300048917 | Ga0496114_0005590 | Ga0496114_0005590_8479_9504 | 331 |
| 39 | 3300049584 | Ga0501068_0131683 | Ga0501068_0131683_17_1015 | 331 |
| 40 | 3300053085 | Ga0495619_0099834 | Ga0495619_0099834_932_1957 | 331 |
| 41 | 3300009093 | Ga0105240_10032816 | Ga0105240_100328163 | 333 |
| 42 | 3300009545 | Ga0105237_10007504 | Ga0105237_1000750411 | 333 |
| 43 | 3300010375 | Ga0105239_10007410 | Ga0105239_1000741012 | 333 |
| 44 | 3300025914 | Ga0207671_10004932 | Ga0207671_100049323 | 333 |
| 45 | 3300050507 | nmdc:mga05p37_694042_c1 | nmdc:mga05p37_694042_c1_67_1089 | 333 |
| 46 | 3300046537 | Ga0495598_0008275 | Ga0495598_0008275_1305_2351 | 336 |
| 47 | 3300050492 | nmdc:mga0yw44_94441_c1 | nmdc:mga0yw44_94441_c1_261_1301 | 339 |
| 48 | 3300009101 | Ga0105247_10092998 | Ga0105247_100929982 | 341 |
| 49 | 3300009147 | Ga0114129_10001337 | Ga0114129_1000133724 | 341 |
| 50 | 3300013297 | Ga0157378_10124457 | Ga0157378_101244573 | 341 |
| 51 | 3300014325 | Ga0163163_10008982 | Ga0163163_100089827 | 341 |
| 52 | 3300025921 | Ga0207652_10001041 | Ga0207652_1000104119 | 341 |
| 53 | 3300035170 | Ga0373943_0025977 | Ga0373943_0025977_1208_2254 | 341 |
| 54 | 3300035171 | Ga0373946_0032273 | Ga0373946_0032273_479_1525 | 341 |
| 55 | 3300035692 | Ga0373935_0251671 | Ga0373935_0251671_76_1122 | 341 |
| 56 | 3300035695 | Ga0373927_0008654 | Ga0373927_0008654_2409_3455 | 341 |
| 57 | 3300035725 | Ga0373947_0027758 | Ga0373947_0027758_1446_2492 | 341 |
| 58 | 3300037068 | Ga0373925_0092277 | Ga0373925_0092277_1151_2197 | 341 |
| 59 | 3300046455 | Ga0495603_0021569 | Ga0495603_0021569_1726_2772 | 341 |
| 60 | 3300046461 | Ga0495641_0072818 | Ga0495641_0072818_238_1284 | 341 |
| 61 | 3300046473 | Ga0495582_0011254 | Ga0495582_0011254_2727_3773 | 341 |
| 62 | 3300046473 | Ga0495582_0105981 | Ga0495582_0105981_105_1151 | 341 |
| 63 | 3300046492 | Ga0495585_0017904 | Ga0495585_0017904_592_1638 | 341 |
| 64 | 3300046499 | Ga0495594_0007017 | Ga0495594_0007017_3779_4825 | 341 |
| 65 | 3300046665 | Ga0495661_0080219 | Ga0495661_0080219_100_1146 | 341 |
| 66 | 3300046689 | Ga0495613_0123852 | Ga0495613_0123852_416_1462 | 341 |
| 67 | 3300046690 | Ga0495624_0036468 | Ga0495624_0036468_1883_2929 | 341 |
| 68 | 3300047321 | Ga0495676_0040682 | Ga0495676_0040682_1608_2654 | 341 |
| 69 | 3300048903 | Ga0496100_0254855 | Ga0496100_0254855_207_1253 | 341 |
| 70 | 3300048904 | Ga0496101_0099022 | Ga0496101_0099022_403_1449 | 341 |
| 71 | 3300048906 | Ga0496103_0066124 | Ga0496103_0066124_976_2022 | 341 |
| 72 | 3300048907 | Ga0496104_0008501 | Ga0496104_0008501_4540_5586 | 341 |
| 73 | 3300048908 | Ga0496105_0014861 | Ga0496105_0014861_2376_3422 | 341 |
| 74 | 3300048910 | Ga0496107_0047175 | Ga0496107_0047175_955_2001 | 341 |
| 75 | 3300048911 | Ga0496108_0022206 | Ga0496108_0022206_61_1107 | 341 |
| 76 | 3300048912 | Ga0496109_0001673 | Ga0496109_0001673_7178_8224 | 341 |
| 77 | 3300048913 | Ga0496110_0095429 | Ga0496110_0095429_240_1286 | 341 |
| 78 | 3300048913 | Ga0496110_0249396 | Ga0496110_0249396_172_1218 | 341 |
| 79 | 3300048914 | Ga0496111_0025158 | Ga0496111_0025158_2499_3545 | 341 |
| 80 | 3300048916 | Ga0496113_0001460 | Ga0496113_0001460_8860_9906 | 341 |
| 81 | 3300048917 | Ga0496114_0029110 | Ga0496114_0029110_2886_3932 | 341 |
| 82 | 3300050492 | nmdc:mga0yw44_45643_c1 | nmdc:mga0yw44_45643_c1_770_1816 | 341 |
| 83 | 3300050494 | nmdc:mga06z11_28752_c1 | nmdc:mga06z11_28752_c1_416_1462 | 341 |
| 84 | 3300050507 | nmdc:mga05p37_16000_c2 | nmdc:mga05p37_16000_c2_387_1433 | 341 |
| 85 | 3300050510 | nmdc:mga06r32_299562_c1 | nmdc:mga06r32_299562_c1_415_1461 | 341 |
| 86 | 3300050511 | nmdc:mga08y16_502150_c1 | nmdc:mga08y16_502150_c1_48_1094 | 341 |
| 87 | 3300050512 | nmdc:mga0n895_111610_c1 | nmdc:mga0n895_111610_c1_1302_2348 | 341 |
| 88 | 3300053085 | Ga0495619_0132323 | Ga0495619_0132323_545_1591 | 341 |
| 89 | 3300060353 | Ga0501082_0269410 | Ga0501082_0269410_414_1466 | 341 |
| 90 | 3300005347 | Ga0070668_100057949 | Ga0070668_1000579493 | 343 |
| 91 | 3300005365 | Ga0070688_100009829 | Ga0070688_1000098294 | 343 |
| 92 | 3300005435 | Ga0070714_100013260 | Ga0070714_1000132605 | 343 |
| 93 | 3300025923 | Ga0207681_10035982 | Ga0207681_100359822 | 343 |
| 94 | 3300025929 | Ga0207664_10084933 | Ga0207664_100849332 | 343 |
| 95 | 3300026121 | Ga0207683_10139099 | Ga0207683_101390992 | 343 |
| 96 | 3300035086 | Ga0373934_0050861 | Ga0373934_0050861_509_1540 | 343 |
| 97 | 3300035117 | Ga0373953_0002486 | Ga0373953_0002486_2724_3755 | 343 |
| 98 | 3300035118 | Ga0373954_0040916 | Ga0373954_0040916_888_1919 | 343 |
| 99 | 3300035410 | Ga0373924_0054220 | Ga0373924_0054220_408_1439 | 343 |
| 100 | 3300035692 | Ga0373935_0084039 | Ga0373935_0084039_19_1050 | 343 |
| 101 | 3300036401 | Ga0373937_0324634 | Ga0373937_0324634_191_1222 | 343 |
| 102 | 3300037068 | Ga0373925_0045279 | Ga0373925_0045279_1095_2126 | 343 |
| 103 | 3300046454 | Ga0495592_0007899 | Ga0495592_0007899_543_1574 | 343 |
| 104 | 3300046462 | Ga0495651_0037434 | Ga0495651_0037434_434_1465 | 343 |
| 105 | 3300046516 | Ga0495628_0001389 | Ga0495628_0001389_3667_4698 | 343 |
| 106 | 3300046536 | Ga0495587_0005876 | Ga0495587_0005876_164_1195 | 343 |
| 107 | 3300046543 | Ga0495645_0000359 | Ga0495645_0000359_9288_10319 | 343 |
| 108 | 3300046559 | Ga0495667_0064630 | Ga0495667_0064630_84_1115 | 343 |
| 109 | 3300046678 | Ga0495599_0047473 | Ga0495599_0047473_1441_2472 | 343 |
| 110 | 3300046809 | Ga0495600_0001577 | Ga0495600_0001577_10782_11813 | 343 |
| 111 | 3300047319 | Ga0495674_0252583 | Ga0495674_0252583_20_1084 | 343 |
| 112 | 3300047322 | Ga0495680_0027232 | Ga0495680_0027232_797_1828 | 343 |
| 113 | 3300048907 | Ga0496104_0000086 | Ga0496104_0000086_49460_50491 | 343 |
| 114 | 3300048908 | Ga0496105_0000126 | Ga0496105_0000126_43918_44949 | 343 |
| 115 | 3300048917 | Ga0496114_0078697 | Ga0496114_0078697_135_1166 | 343 |
| 116 | 3300048918 | Ga0496115_0058356 | Ga0496115_0058356_1795_2826 | 343 |
| 117 | 3300048918 | Ga0496115_0095640 | Ga0496115_0095640_800_1867 | 343 |
| 118 | 3300049570 | Ga0501033_0022816 | Ga0501033_0022816_1794_2873 | 343 |
| 119 | 3300049571 | Ga0501034_0073053 | Ga0501034_0073053_1150_2229 | 343 |
| 120 | 3300049572 | Ga0501036_0010943 | Ga0501036_0010943_2109_3188 | 343 |
| 121 | 3300049573 | Ga0501037_0013366 | Ga0501037_0013366_1210_2289 | 343 |
| 122 | 3300049574 | Ga0501038_0010259 | Ga0501038_0010259_5897_6976 | 343 |
| 123 | 3300049575 | Ga0501039_0007484 | Ga0501039_0007484_2936_4015 | 343 |
| 124 | 3300049578 | Ga0501042_0116411 | Ga0501042_0116411_739_1818 | 343 |
| 125 | 3300049580 | Ga0501046_0013958 | Ga0501046_0013958_1338_2417 | 343 |
| 126 | 3300049582 | Ga0501048_0001781 | Ga0501048_0001781_5663_6742 | 343 |
| 127 | 3300049583 | Ga0501067_0014605 | Ga0501067_0014605_1391_2470 | 343 |
| 128 | 3300049584 | Ga0501068_0017660 | Ga0501068_0017660_1922_3001 | 343 |
| 129 | 3300049587 | Ga0501071_0005688 | Ga0501071_0005688_5349_6428 | 343 |
| 130 | 3300049589 | Ga0501073_0028888 | Ga0501073_0028888_945_2024 | 343 |
| 131 | 3300049592 | Ga0501076_0135108 | Ga0501076_0135108_826_1905 | 343 |
| 132 | 3300049741 | Ga0501079_0025644 | Ga0501079_0025644_1391_2470 | 343 |
| 133 | 3300049744 | Ga0501083_0015718 | Ga0501083_0015718_426_1505 | 343 |
| 134 | 3300049822 | Ga0501035_0008784 | Ga0501035_0008784_2427_3506 | 343 |
| 135 | 3300049823 | Ga0501044_0000361 | Ga0501044_0000361_43296_44375 | 343 |
| 136 | 3300049823 | Ga0501044_0033572 | Ga0501044_0033572_2975_4054 | 343 |
| 137 | 3300049824 | Ga0501045_0129268 | Ga0501045_0129268_243_1322 | 343 |
| 138 | 3300053077 | Ga0495601_0000137 | Ga0495601_0000137_38099_39130 | 343 |
| 139 | 3300053078 | Ga0495612_0000679 | Ga0495612_0000679_1598_2629 | 343 |
| 140 | 3300053084 | Ga0495595_0001994 | Ga0495595_0001994_2855_3886 | 343 |
| 141 | 3300054114 | Ga0501084_0002309 | Ga0501084_0002309_11332_12411 | 343 |
| 142 | 3300060353 | Ga0501082_0032278 | Ga0501082_0032278_2403_3482 | 343 |
| 143 | 3300005434 | Ga0070709_10090603 | Ga0070709_100906032 | 346 |
| 144 | 3300006844 | Ga0075428_100000945 | Ga0075428_10000094527 | 346 |
| 145 | 3300006846 | Ga0075430_100012439 | Ga0075430_1000124397 | 346 |
| 146 | 3300006847 | Ga0075431_100000864 | Ga0075431_10000086413 | 346 |
| 147 | 3300006880 | Ga0075429_100042323 | Ga0075429_1000423232 | 346 |
| 148 | 3300006844 | Ga0075428_100339283 | Ga0075428_1003392831 | 349 |
| 149 | 3300031241 | Ga0265325_10019773 | Ga0265325_100197733 | 349 |
| 150 | 3300031250 | Ga0265331_10036762 | Ga0265331_100367621 | 349 |
| 151 | 3300031344 | Ga0265316_10144407 | Ga0265316_101444072 | 349 |
| 152 | 3300031712 | Ga0265342_10012693 | Ga0265342_100126932 | 349 |
| 153 | 3300035725 | Ga0373947_0113242 | Ga0373947_0113242_146_1276 | 349 |
| 154 | 3300050510 | nmdc:mga06r32_81997_c1 | nmdc:mga06r32_81997_c1_595_1734 | 349 |
| 155 | 3300050507 | nmdc:mga05p37_365352_c1 | nmdc:mga05p37_365352_c1_23_1123 | 350 |
| 156 | 3300050489 | nmdc:mga03683_26217_c1 | nmdc:mga03683_26217_c1_595_1692 | 351 |
| 157 | 3300050494 | nmdc:mga06z11_52236_c1 | nmdc:mga06z11_52236_c1_924_2021 | 351 |
| 158 | 3300005844 | Ga0068862_100203993 | Ga0068862_1002039931 | 352 |
| 159 | 3300048915 | Ga0496112_0485709 | Ga0496112_0485709_69_1148 | 352 |
| 160 | 3300049575 | Ga0501039_0153845 | Ga0501039_0153845_556_1635 | 352 |
| 161 | 3300049588 | Ga0501072_0282925 | Ga0501072_0282925_38_1132 | 352 |
| 162 | 3300049592 | Ga0501076_0084933 | Ga0501076_0084933_1178_2257 | 352 |
| 163 | 3300049741 | Ga0501079_0141339 | Ga0501079_0141339_601_1680 | 352 |
| 164 | 3300049587 | Ga0501071_0064510 | Ga0501071_0064510_767_1834 | 354 |
| 165 | 3300049593 | Ga0501077_0159680 | Ga0501077_0159680_327_1394 | 354 |
| 166 | 3300061734 | Ga0530510_0186571 | Ga0530510_0186571_199_1266 | 354 |
| 167 | 3300031235 | Ga0265330_10045863 | Ga0265330_100458632 | 356 |
| 168 | 3300031250 | Ga0265331_10024375 | Ga0265331_100243752 | 356 |
| 169 | 3300049574 | Ga0501038_0180510 | Ga0501038_0180510_439_1602 | 356 |
| 170 | 3300049579 | Ga0501043_0025254 | Ga0501043_0025254_2978_4141 | 356 |
| 171 | 3300049581 | Ga0501047_0078028 | Ga0501047_0078028_1360_2523 | 356 |
| 172 | 3300049586 | Ga0501070_0020533 | Ga0501070_0020533_1074_2237 | 356 |
| 173 | 3300049743 | Ga0501081_0091331 | Ga0501081_0091331_476_1618 | 356 |
| 174 | 3300049822 | Ga0501035_0018830 | Ga0501035_0018830_4700_5863 | 356 |
| 175 | 3300049823 | Ga0501044_0049843 | Ga0501044_0049843_3132_4295 | 356 |
| 176 | 3300050511 | nmdc:mga08y16_88647_c1 | nmdc:mga08y16_88647_c1_904_2013 | 356 |
| 177 | 3300002077 | JGI24744J21845_10001479 | JGI24744J21845_100014793 | 357 |
| 178 | 3300005330 | Ga0070690_100008341 | Ga0070690_1000083416 | 357 |
| 179 | 3300005331 | Ga0070670_100010481 | Ga0070670_1000104812 | 357 |
| 180 | 3300005334 | Ga0068869_100093314 | Ga0068869_1000933142 | 357 |
| 181 | 3300005335 | Ga0070666_10011843 | Ga0070666_100118436 | 357 |
| 182 | 3300005338 | Ga0068868_100007091 | Ga0068868_1000070918 | 357 |
| 183 | 3300005340 | Ga0070689_100002363 | Ga0070689_1000023634 | 357 |
| 184 | 3300005343 | Ga0070687_100060447 | Ga0070687_1000604472 | 357 |
| 185 | 3300005354 | Ga0070675_100006337 | Ga0070675_10000633710 | 357 |
| 186 | 3300005355 | Ga0070671_100043196 | Ga0070671_1000431962 | 357 |
| 187 | 3300005365 | Ga0070688_100029833 | Ga0070688_1000298334 | 357 |
| 188 | 3300005367 | Ga0070667_100009767 | Ga0070667_1000097675 | 357 |
| 189 | 3300005438 | Ga0070701_10022221 | Ga0070701_100222212 | 357 |
| 190 | 3300005439 | Ga0070711_100120613 | Ga0070711_1001206132 | 357 |
| 191 | 3300005441 | Ga0070700_100038892 | Ga0070700_1000388923 | 357 |
| 192 | 3300005455 | Ga0070663_100014182 | Ga0070663_1000141822 | 357 |
| 193 | 3300005456 | Ga0070678_100083113 | Ga0070678_1000831131 | 357 |
| 194 | 3300005457 | Ga0070662_100184016 | Ga0070662_1001840161 | 357 |
| 195 | 3300005466 | Ga0070685_10036941 | Ga0070685_100369412 | 357 |
| 196 | 3300005535 | Ga0070684_100023560 | Ga0070684_1000235604 | 357 |
| 197 | 3300005544 | Ga0070686_100005194 | Ga0070686_1000051946 | 357 |
| 198 | 3300005549 | Ga0070704_100078764 | Ga0070704_1000787642 | 357 |
| 199 | 3300005564 | Ga0070664_100023143 | Ga0070664_1000231436 | 357 |
| 200 | 3300005618 | Ga0068864_100008822 | Ga0068864_1000088226 | 357 |
| 201 | 3300005718 | Ga0068866_10022761 | Ga0068866_100227612 | 357 |
| 202 | 3300005840 | Ga0068870_10028939 | Ga0068870_100289393 | 357 |
| 203 | 3300005841 | Ga0068863_100018999 | Ga0068863_1000189992 | 357 |
| 204 | 3300005842 | Ga0068858_100075189 | Ga0068858_1000751894 | 357 |
| 205 | 3300005843 | Ga0068860_100020845 | Ga0068860_1000208457 | 357 |
| 206 | 3300005844 | Ga0068862_100076488 | Ga0068862_1000764882 | 357 |
| 207 | 3300006163 | Ga0070715_10063039 | Ga0070715_100630392 | 357 |
| 208 | 3300006881 | Ga0068865_100015689 | Ga0068865_1000156894 | 357 |
| 209 | 3300025898 | Ga0207692_10089732 | Ga0207692_100897322 | 357 |
| 210 | 3300025899 | Ga0207642_10037070 | Ga0207642_100370702 | 357 |
| 211 | 3300025901 | Ga0207688_10000735 | Ga0207688_100007357 | 357 |
| 212 | 3300025905 | Ga0207685_10027824 | Ga0207685_100278242 | 357 |
| 213 | 3300025907 | Ga0207645_10009017 | Ga0207645_100090177 | 357 |
| 214 | 3300025908 | Ga0207643_10000820 | Ga0207643_100008204 | 357 |
| 215 | 3300025918 | Ga0207662_10001103 | Ga0207662_100011038 | 357 |
| 216 | 3300025925 | Ga0207650_10007962 | Ga0207650_100079625 | 357 |
| 217 | 3300025927 | Ga0207687_10015396 | Ga0207687_100153964 | 357 |
| 218 | 3300025931 | Ga0207644_10119075 | Ga0207644_101190752 | 357 |
| 219 | 3300025932 | Ga0207690_10034446 | Ga0207690_100344464 | 357 |
| 220 | 3300025933 | Ga0207706_10010940 | Ga0207706_100109402 | 357 |
| 221 | 3300025934 | Ga0207686_10031116 | Ga0207686_100311164 | 357 |
| 222 | 3300025940 | Ga0207691_10001108 | Ga0207691_1000110820 | 357 |
| 223 | 3300025941 | Ga0207711_10083012 | Ga0207711_100830123 | 357 |
| 224 | 3300025972 | Ga0207668_10015910 | Ga0207668_100159105 | 357 |
| 225 | 3300025986 | Ga0207658_10021600 | Ga0207658_100216005 | 357 |
| 226 | 3300026035 | Ga0207703_10038453 | Ga0207703_100384531 | 357 |
| 227 | 3300026075 | Ga0207708_10005439 | Ga0207708_100054395 | 357 |
| 228 | 3300026088 | Ga0207641_10067239 | Ga0207641_100672394 | 357 |
| 229 | 3300026118 | Ga0207675_100002754 | Ga0207675_10000275415 | 357 |
| 230 | 3300026121 | Ga0207683_10009722 | Ga0207683_100097224 | 357 |
| 231 | 3300028379 | Ga0268266_10028193 | Ga0268266_100281934 | 357 |
| 232 | 3300028380 | Ga0268265_10037761 | Ga0268265_100377614 | 357 |
| 233 | 3300005333 | Ga0070677_10020671 | Ga0070677_100206711 | 358 |
| 234 | 3300009551 | Ga0105238_10302396 | Ga0105238_103023961 | 358 |
| 235 | 3300017792 | Ga0163161_10015961 | Ga0163161_100159614 | 358 |
| 236 | 3300025924 | Ga0207694_10076058 | Ga0207694_100760582 | 358 |
| 237 | 3300025942 | Ga0207689_10018552 | Ga0207689_100185522 | 358 |
| 238 | 3300009553 | Ga0105249_10042898 | Ga0105249_100428981 | 359 |
| 239 | 3300037418 | Ga0395900_0050508 | Ga0395900_0050508_2162_3262 | 359 |
| 240 | 3300037466 | Ga0395898_0021789 | Ga0395898_0021789_4243_5343 | 359 |
| 241 | 3300038443 | Ga0395901_0014946 | Ga0395901_0014946_6428_7528 | 359 |
| 242 | 3300049591 | Ga0501075_0082700 | Ga0501075_0082700_221_1402 | 359 |
| 243 | 3300054114 | Ga0501084_0179675 | Ga0501084_0179675_437_1618 | 359 |
| 244 | 3300002077 | JGI24744J21845_10003255 | JGI24744J21845_100032554 | 362 |
| 245 | 3300006846 | Ga0075430_100130940 | Ga0075430_1001309402 | 362 |
| 246 | 3300006847 | Ga0075431_100035827 | Ga0075431_1000358272 | 362 |
| 247 | 3300038443 | Ga0395901_0003398 | Ga0395901_0003398_13165_14274 | 362 |
| 248 | 3300049585 | Ga0501069_0031721 | Ga0501069_0031721_582_1745 | 362 |
| 249 | 3300049744 | Ga0501083_0029748 | Ga0501083_0029748_982_2145 | 362 |
| 250 | 3300050509 | nmdc:mga0qj67_16803_c1 | nmdc:mga0qj67_16803_c1_4274_5383 | 362 |
| 251 | 3300050511 | nmdc:mga08y16_132617_c1 | nmdc:mga08y16_132617_c1_1322_2458 | 362 |
| 252 | 3300050512 | nmdc:mga0n895_141275_c1 | nmdc:mga0n895_141275_c1_502_1614 | 362 |
| 253 | 3300005983 | Ga0081540_1024073 | Ga0081540_10240733 | 364 |
| 254 | 3300006847 | Ga0075431_100090910 | Ga0075431_1000909102 | 364 |
| 255 | 3300006852 | Ga0075433_10105325 | Ga0075433_101053252 | 364 |
| 256 | 3300006871 | Ga0075434_100045630 | Ga0075434_1000456304 | 364 |
| 257 | 3300046491 | Ga0495584_0067001 | Ga0495584_0067001_384_1523 | 364 |
| 258 | 3300050512 | nmdc:mga0n895_232792_c1 | nmdc:mga0n895_232792_c1_413_1627 | 364 |
| 259 | 3300006871 | Ga0075434_100075588 | Ga0075434_1000755884 | 365 |
| 260 | 3300042012 | Ga0439455_0001935 | Ga0439455_0001935_32_1129 | 365 |
| 261 | 3300048913 | Ga0496110_0033216 | Ga0496110_0033216_3138_4256 | 365 |
| 262 | 3300048914 | Ga0496111_0041711 | Ga0496111_0041711_1905_3023 | 365 |
| 263 | 3300050512 | nmdc:mga0n895_137945_c1 | nmdc:mga0n895_137945_c1_1141_2259 | 365 |
| 264 | 3300050515 | nmdc:mga0a205_306300_c1 | nmdc:mga0a205_306300_c1_185_1303 | 365 |
| 265 | 3300005355 | Ga0070671_100150959 | Ga0070671_1001509592 | 366 |
| 266 | 3300009177 | Ga0105248_10013011 | Ga0105248_100130117 | 366 |
| 267 | 3300013297 | Ga0157378_10074159 | Ga0157378_100741592 | 366 |
| 268 | 3300035085 | Ga0373929_0011950 | Ga0373929_0011950_425_1591 | 366 |
| 269 | 3300035691 | Ga0373931_0018612 | Ga0373931_0018612_320_1486 | 366 |
| 270 | 3300048903 | Ga0496100_0035775 | Ga0496100_0035775_1864_3030 | 366 |
| 271 | 3300048904 | Ga0496101_0031669 | Ga0496101_0031669_482_1648 | 366 |
| 272 | 3300048905 | Ga0496102_0022873 | Ga0496102_0022873_4149_5324 | 366 |
| 273 | 3300048907 | Ga0496104_0108990 | Ga0496104_0108990_610_1776 | 366 |
| 274 | 3300048908 | Ga0496105_0205299 | Ga0496105_0205299_416_1582 | 366 |
| 275 | 3300048911 | Ga0496108_0065772 | Ga0496108_0065772_283_1449 | 366 |
| 276 | 3300048912 | Ga0496109_0028801 | Ga0496109_0028801_2558_3724 | 366 |
| 277 | 3300048913 | Ga0496110_0012691 | Ga0496110_0012691_1193_2359 | 366 |
| 278 | 3300048914 | Ga0496111_0120539 | Ga0496111_0120539_300_1466 | 366 |
| 279 | 3300048916 | Ga0496113_0107228 | Ga0496113_0107228_440_1606 | 366 |
| 280 | 3300048917 | Ga0496114_0071714 | Ga0496114_0071714_697_1863 | 366 |
| 281 | 3300009147 | Ga0114129_10006361 | Ga0114129_100063613 | 367 |
| 282 | 3300036401 | Ga0373937_0091616 | Ga0373937_0091616_67_1233 | 367 |
| 283 | 3300050507 | nmdc:mga05p37_6362_c1 | nmdc:mga05p37_6362_c1_1430_2575 | 367 |
| 284 | 3300009094 | Ga0111539_10064483 | Ga0111539_100644834 | 368 |
| 285 | 3300035086 | Ga0373934_0002928 | Ga0373934_0002928_1877_3022 | 368 |
| 286 | 3300035111 | Ga0373923_0009157 | Ga0373923_0009157_2189_3334 | 368 |
| 287 | 3300035117 | Ga0373953_0000578 | Ga0373953_0000578_5571_6716 | 368 |
| 288 | 3300035118 | Ga0373954_0001627 | Ga0373954_0001627_1241_2386 | 368 |
| 289 | 3300035119 | Ga0373956_0001905 | Ga0373956_0001905_5031_6176 | 368 |
| 290 | 3300035120 | Ga0373957_0000887 | Ga0373957_0000887_4302_5447 | 368 |
| 291 | 3300035172 | Ga0373955_0000175 | Ga0373955_0000175_12340_13485 | 368 |
| 292 | 3300035410 | Ga0373924_0000864 | Ga0373924_0000864_5781_6926 | 368 |
| 293 | 3300035691 | Ga0373931_0007939 | Ga0373931_0007939_2787_3935 | 368 |
| 294 | 3300036401 | Ga0373937_0028847 | Ga0373937_0028847_1241_2386 | 368 |
| 295 | 3300046454 | Ga0495592_0001017 | Ga0495592_0001017_14347_15492 | 368 |
| 296 | 3300046459 | Ga0495629_0001205 | Ga0495629_0001205_4658_5803 | 368 |
| 297 | 3300046463 | Ga0495653_0008098 | Ga0495653_0008098_3377_4522 | 368 |
| 298 | 3300046533 | Ga0495640_0014178 | Ga0495640_0014178_3199_4344 | 368 |
| 299 | 3300046559 | Ga0495667_0008233 | Ga0495667_0008233_1670_2815 | 368 |
| 300 | 3300046642 | Ga0495634_0006941 | Ga0495634_0006941_5972_7117 | 368 |
| 301 | 3300046663 | Ga0495635_0010668 | Ga0495635_0010668_3365_4510 | 368 |
| 302 | 3300046675 | Ga0495657_0010478 | Ga0495657_0010478_1571_2716 | 368 |
| 303 | 3300046678 | Ga0495599_0004983 | Ga0495599_0004983_3348_4493 | 368 |
| 304 | 3300046679 | Ga0495623_0022892 | Ga0495623_0022892_1241_2386 | 368 |
| 305 | 3300046680 | Ga0495646_0016189 | Ga0495646_0016189_1698_2843 | 368 |
| 306 | 3300046689 | Ga0495613_0002804 | Ga0495613_0002804_9469_10614 | 368 |
| 307 | 3300047317 | Ga0495604_0017879 | Ga0495604_0017879_2694_3839 | 368 |
| 308 | 3300047322 | Ga0495680_0022292 | Ga0495680_0022292_2566_3711 | 368 |
| 309 | 3300047444 | Ga0495675_0018960 | Ga0495675_0018960_2250_3395 | 368 |
| 310 | 3300047471 | Ga0495684_0000820 | Ga0495684_0000820_4996_6141 | 368 |
| 311 | 3300048907 | Ga0496104_0042897 | Ga0496104_0042897_101_1249 | 368 |
| 312 | 3300048918 | Ga0496115_0092834 | Ga0496115_0092834_938_2086 | 368 |
| 313 | 3300053077 | Ga0495601_0079273 | Ga0495601_0079273_946_2091 | 368 |
| 314 | 3300053084 | Ga0495595_0001498 | Ga0495595_0001498_4635_5780 | 368 |
| 315 | 3300010159 | Ga0099796_10022992 | Ga0099796_100229922 | 370 |
| 316 | 3300046491 | Ga0495584_0064495 | Ga0495584_0064495_250_1440 | 370 |
| 317 | 3300046491 | Ga0495584_0080323 | Ga0495584_0080323_236_1426 | 370 |
| 318 | 3300005981 | Ga0081538_10029783 | Ga0081538_100297833 | 372 |
| 319 | 3300006038 | Ga0075365_10007934 | Ga0075365_100079342 | 372 |
| 320 | 3300006038 | Ga0075365_10018478 | Ga0075365_100184782 | 372 |
| 321 | 3300006844 | Ga0075428_100038586 | Ga0075428_1000385863 | 372 |
| 322 | 3300006844 | Ga0075428_100067105 | Ga0075428_1000671052 | 372 |
| 323 | 3300006847 | Ga0075431_100002340 | Ga0075431_1000023409 | 372 |
| 324 | 3300006847 | Ga0075431_100019719 | Ga0075431_1000197192 | 372 |
| 325 | 3300006880 | Ga0075429_100016146 | Ga0075429_1000161464 | 372 |
| 326 | 3300009147 | Ga0114129_10139264 | Ga0114129_101392643 | 372 |
| 327 | 3300044684 | Ga0466966_0040567 | Ga0466966_0040567_903_2075 | 372 |
| 328 | 3300045049 | Ga0466959_0005260 | Ga0466959_0005260_1626_2798 | 372 |
| 329 | 3300049588 | Ga0501072_0048450 | Ga0501072_0048450_851_2005 | 372 |
| 330 | 3300050492 | nmdc:mga0yw44_9643_c1 | nmdc:mga0yw44_9643_c1_3576_4715 | 372 |
| 331 | 3300050507 | nmdc:mga05p37_27070_c1 | nmdc:mga05p37_27070_c1_1982_3160 | 372 |
| 332 | 3300050510 | nmdc:mga06r32_1369_c1 | nmdc:mga06r32_1369_c1_4712_5854 | 372 |
| 333 | 3300054114 | Ga0501084_0096575 | Ga0501084_0096575_1238_2392 | 372 |
| 334 | 3300005355 | Ga0070671_100101011 | Ga0070671_1001010112 | 373 |
| 335 | 3300005434 | Ga0070709_10130240 | Ga0070709_101302401 | 373 |
| 336 | 3300005437 | Ga0070710_10027434 | Ga0070710_100274342 | 373 |
| 337 | 3300005437 | Ga0070710_10075895 | Ga0070710_100758952 | 373 |
| 338 | 3300005546 | Ga0070696_100225253 | Ga0070696_1002252532 | 373 |
| 339 | 3300006028 | Ga0070717_10018110 | Ga0070717_100181102 | 373 |
| 340 | 3300006038 | Ga0075365_10152320 | Ga0075365_101523202 | 373 |
| 341 | 3300006051 | Ga0075364_10135245 | Ga0075364_101352451 | 373 |
| 342 | 3300006163 | Ga0070715_10003805 | Ga0070715_100038052 | 373 |
| 343 | 3300006173 | Ga0070716_100020144 | Ga0070716_1000201442 | 373 |
| 344 | 3300006175 | Ga0070712_100001284 | Ga0070712_1000012843 | 373 |
| 345 | 3300025904 | Ga0207647_10074921 | Ga0207647_100749212 | 373 |
| 346 | 3300025915 | Ga0207693_10002503 | Ga0207693_100025033 | 373 |
| 347 | 3300025915 | Ga0207693_10004962 | Ga0207693_100049629 | 373 |
| 348 | 3300025925 | Ga0207650_10017621 | Ga0207650_100176212 | 373 |
| 349 | 3300025928 | Ga0207700_10007483 | Ga0207700_100074835 | 373 |
| 350 | 3300025939 | Ga0207665_10001690 | Ga0207665_100016907 | 373 |
| 351 | 3300048903 | Ga0496100_0149559 | Ga0496100_0149559_93_1235 | 373 |
| 352 | 3300048903 | Ga0496100_0211998 | Ga0496100_0211998_149_1291 | 373 |
| 353 | 3300048904 | Ga0496101_0067460 | Ga0496101_0067460_1178_2320 | 373 |
| 354 | 3300048905 | Ga0496102_0104173 | Ga0496102_0104173_288_1430 | 373 |
| 355 | 3300048907 | Ga0496104_0004926 | Ga0496104_0004926_6111_7253 | 373 |
| 356 | 3300048907 | Ga0496104_0040247 | Ga0496104_0040247_904_2046 | 373 |
| 357 | 3300048909 | Ga0496106_0148270 | Ga0496106_0148270_278_1420 | 373 |
| 358 | 3300048909 | Ga0496106_0198217 | Ga0496106_0198217_104_1246 | 373 |
| 359 | 3300048912 | Ga0496109_0174413 | Ga0496109_0174413_111_1253 | 373 |
| 360 | 3300048916 | Ga0496113_0193901 | Ga0496113_0193901_355_1497 | 373 |
| 361 | 3300048917 | Ga0496114_0300504 | Ga0496114_0300504_173_1315 | 373 |
| 362 | 3300049582 | Ga0501048_0204323 | Ga0501048_0204323_208_1350 | 373 |
| 363 | 3300049590 | Ga0501074_0164344 | Ga0501074_0164344_141_1283 | 373 |
| 364 | 3300049591 | Ga0501075_0255217 | Ga0501075_0255217_43_1200 | 373 |
| 365 | 3300049592 | Ga0501076_0072897 | Ga0501076_0072897_638_1795 | 373 |
| 366 | 3300049824 | Ga0501045_0203981 | Ga0501045_0203981_214_1371 | 373 |
| 367 | 3300050512 | nmdc:mga0n895_60015_c1 | nmdc:mga0n895_60015_c1_1677_2819 | 373 |
| 368 | 3300053077 | Ga0495601_0202313 | Ga0495601_0202313_57_1205 | 373 |
| 369 | 3300054114 | Ga0501084_0079471 | Ga0501084_0079471_586_1728 | 373 |
| 370 | 3300005937 | Ga0081455_10005639 | Ga0081455_100056399 | 374 |
| 371 | 3300031711 | Ga0265314_10005765 | Ga0265314_100057654 | 374 |
| 372 | 3300005530 | Ga0070679_100114627 | Ga0070679_1001146273 | 375 |
| 373 | 3300006042 | Ga0075368_10037512 | Ga0075368_100375122 | 375 |
| 374 | 3300006051 | Ga0075364_10096848 | Ga0075364_100968482 | 375 |
| 375 | 3300006178 | Ga0075367_10129676 | Ga0075367_101296761 | 375 |
| 376 | 3300006353 | Ga0075370_10028682 | Ga0075370_100286823 | 375 |
| 377 | 3300006353 | Ga0075370_10096283 | Ga0075370_100962831 | 375 |
| 378 | 3300009147 | Ga0114129_10006806 | Ga0114129_100068065 | 375 |
| 379 | 3300025921 | Ga0207652_10245066 | Ga0207652_102450662 | 375 |
| 380 | 3300049570 | Ga0501033_0045901 | Ga0501033_0045901_686_1849 | 375 |
| 381 | 3300049823 | Ga0501044_0012272 | Ga0501044_0012272_536_1699 | 375 |
| 382 | 3300050490 | nmdc:mga03n38_42337_c1 | nmdc:mga03n38_42337_c1_304_1473 | 375 |
| 383 | 3300050494 | nmdc:mga06z11_26901_c1 | nmdc:mga06z11_26901_c1_1258_2427 | 375 |
| 384 | 3300050507 | nmdc:mga05p37_4104_c1 | nmdc:mga05p37_4104_c1_5810_6979 | 375 |
| 385 | 3300050508 | nmdc:mga09592_2402_c1 | nmdc:mga09592_2402_c1_12143_13312 | 375 |
| 386 | 3300050509 | nmdc:mga0qj67_3470_c1 | nmdc:mga0qj67_3470_c1_8848_10017 | 375 |
| 387 | 3300050510 | nmdc:mga06r32_15_c1 | nmdc:mga06r32_15_c1_94417_95586 | 375 |
| 388 | 3300050511 | nmdc:mga08y16_91_c4 | nmdc:mga08y16_91_c4_1301_2470 | 375 |
| 389 | 3300053119 | Ga0500595_005762 | Ga0500595_005762_459_1616 | 375 |
| 390 | 3300053153 | Ga0500616_0019864 | Ga0500616_0019864_1175_2329 | 375 |
| 391 | 2209111006 | 2214745206 | 2213754706 | 376 |
| 392 | 3300000044 | ARSoilOldRDRAFT_c000055 | ARSoilOldRDRAFT_00005510 | 376 |
| 393 | 3300000045 | ARCol0oldRDRAFT_c00723 | ARCol0oldRDRAFT_007232 | 376 |
| 394 | 3300000652 | ARCol0yngRDRAFT_1000044 | ARCol0yngRDRAFT_100004413 | 376 |
| 395 | 3300001430 | JGI24032J14994_100612 | JGI24032J14994_1006122 | 376 |
| 396 | 3300001978 | JGI24747J21853_1002443 | JGI24747J21853_10024431 | 376 |
| 397 | 3300001989 | JGI24739J22299_10002793 | JGI24739J22299_100027936 | 376 |
| 398 | 3300001990 | JGI24737J22298_10000342 | JGI24737J22298_100003426 | 376 |
| 399 | 3300001990 | JGI24737J22298_10018616 | JGI24737J22298_100186161 | 376 |
| 400 | 3300002070 | JGI24750J21931_1000308 | JGI24750J21931_10003082 | 376 |
| 401 | 3300002073 | JGI24745J21846_1001695 | JGI24745J21846_10016952 | 376 |
| 402 | 3300002074 | JGI24748J21848_1003909 | JGI24748J21848_10039092 | 376 |
| 403 | 3300002075 | JGI24738J21930_10000339 | JGI24738J21930_100003398 | 376 |
| 404 | 3300002076 | JGI24749J21850_1006261 | JGI24749J21850_10062611 | 376 |
| 405 | 3300002155 | JGI24033J26618_1003260 | JGI24033J26618_10032601 | 376 |
| 406 | 3300002239 | JGI24034J26672_10000564 | JGI24034J26672_100005644 | 376 |
| 407 | 3300002244 | JGI24742J22300_10000317 | JGI24742J22300_100003173 | 376 |
| 408 | 3300003215 | JGI25153J46596_10009559 | JGI25153J46596_100095592 | 376 |
| 409 | 3300003911 | JGI25405J52794_10008771 | JGI25405J52794_100087711 | 376 |
| 410 | 3300005276 | Ga0065717_1002092 | Ga0065717_10020922 | 376 |
| 411 | 3300005277 | Ga0065716_1001996 | Ga0065716_10019962 | 376 |
| 412 | 3300005290 | Ga0065712_10072393 | Ga0065712_100723934 | 376 |
| 413 | 3300005290 | Ga0065712_10096990 | Ga0065712_100969902 | 376 |
| 414 | 3300005293 | Ga0065715_10000671 | Ga0065715_100006717 | 376 |
| 415 | 3300005295 | Ga0065707_10116717 | Ga0065707_101167172 | 376 |
| 416 | 3300005327 | Ga0070658_10056357 | Ga0070658_100563573 | 376 |
| 417 | 3300005328 | Ga0070676_10000016 | Ga0070676_1000001632 | 376 |
| 418 | 3300005328 | Ga0070676_10044116 | Ga0070676_100441163 | 376 |
| 419 | 3300005329 | Ga0070683_100000075 | Ga0070683_10000007540 | 376 |
| 420 | 3300005330 | Ga0070690_100000713 | Ga0070690_10000071314 | 376 |
| 421 | 3300005330 | Ga0070690_100001770 | Ga0070690_1000017709 | 376 |
| 422 | 3300005330 | Ga0070690_100026952 | Ga0070690_1000269521 | 376 |
| 423 | 3300005330 | Ga0070690_100211054 | Ga0070690_1002110541 | 376 |
| 424 | 3300005331 | Ga0070670_100003906 | Ga0070670_1000039065 | 376 |
| 425 | 3300005333 | Ga0070677_10000005 | Ga0070677_1000000538 | 376 |
| 426 | 3300005334 | Ga0068869_100000578 | Ga0068869_1000005781 | 376 |
| 427 | 3300005335 | Ga0070666_10004550 | Ga0070666_100045502 | 376 |
| 428 | 3300005336 | Ga0070680_100000526 | Ga0070680_10000052611 | 376 |
| 429 | 3300005336 | Ga0070680_100013741 | Ga0070680_1000137412 | 376 |
| 430 | 3300005336 | Ga0070680_100017732 | Ga0070680_1000177321 | 376 |
| 431 | 3300005336 | Ga0070680_100099422 | Ga0070680_1000994221 | 376 |
| 432 | 3300005336 | Ga0070680_100334758 | Ga0070680_1003347581 | 376 |
| 433 | 3300005337 | Ga0070682_100000144 | Ga0070682_1000001443 | 376 |
| 434 | 3300005338 | Ga0068868_100224248 | Ga0068868_1002242482 | 376 |
| 435 | 3300005339 | Ga0070660_100000153 | Ga0070660_10000015330 | 376 |
| 436 | 3300005340 | Ga0070689_100000563 | Ga0070689_1000005631 | 376 |
| 437 | 3300005340 | Ga0070689_100014436 | Ga0070689_1000144365 | 376 |
| 438 | 3300005340 | Ga0070689_100047315 | Ga0070689_1000473153 | 376 |
| 439 | 3300005341 | Ga0070691_10000030 | Ga0070691_1000003028 | 376 |
| 440 | 3300005341 | Ga0070691_10024288 | Ga0070691_100242883 | 376 |
| 441 | 3300005343 | Ga0070687_100000016 | Ga0070687_1000000161 | 376 |
| 442 | 3300005343 | Ga0070687_100000523 | Ga0070687_10000052311 | 376 |
| 443 | 3300005343 | Ga0070687_100058316 | Ga0070687_1000583162 | 376 |
| 444 | 3300005344 | Ga0070661_100000249 | Ga0070661_1000002491 | 376 |
| 445 | 3300005345 | Ga0070692_10002752 | Ga0070692_100027524 | 376 |
| 446 | 3300005345 | Ga0070692_10034075 | Ga0070692_100340752 | 376 |
| 447 | 3300005347 | Ga0070668_100009086 | Ga0070668_1000090861 | 376 |
| 448 | 3300005347 | Ga0070668_100011400 | Ga0070668_1000114005 | 376 |
| 449 | 3300005353 | Ga0070669_100000145 | Ga0070669_10000014539 | 376 |
| 450 | 3300005354 | Ga0070675_100000081 | Ga0070675_1000000811 | 376 |
| 451 | 3300005355 | Ga0070671_100000267 | Ga0070671_10000026716 | 376 |
| 452 | 3300005356 | Ga0070674_100037837 | Ga0070674_1000378373 | 376 |
| 453 | 3300005356 | Ga0070674_100268633 | Ga0070674_1002686331 | 376 |
| 454 | 3300005364 | Ga0070673_100000125 | Ga0070673_10000012526 | 376 |
| 455 | 3300005364 | Ga0070673_100245620 | Ga0070673_1002456201 | 376 |
| 456 | 3300005365 | Ga0070688_100000075 | Ga0070688_10000007515 | 376 |
| 457 | 3300005365 | Ga0070688_100012438 | Ga0070688_1000124384 | 376 |
| 458 | 3300005366 | Ga0070659_100000144 | Ga0070659_1000001441 | 376 |
| 459 | 3300005366 | Ga0070659_100061626 | Ga0070659_1000616262 | 376 |
| 460 | 3300005366 | Ga0070659_100081479 | Ga0070659_1000814791 | 376 |
| 461 | 3300005367 | Ga0070667_100001956 | Ga0070667_1000019561 | 376 |
| 462 | 3300005367 | Ga0070667_100055136 | Ga0070667_1000551363 | 376 |
| 463 | 3300005406 | Ga0070703_10001239 | Ga0070703_100012396 | 376 |
| 464 | 3300005435 | Ga0070714_100140036 | Ga0070714_1001400362 | 376 |
| 465 | 3300005438 | Ga0070701_10000058 | Ga0070701_100000586 | 376 |
| 466 | 3300005438 | Ga0070701_10001508 | Ga0070701_100015086 | 376 |
| 467 | 3300005440 | Ga0070705_100000926 | Ga0070705_1000009266 | 376 |
| 468 | 3300005441 | Ga0070700_100000100 | Ga0070700_1000001001 | 376 |
| 469 | 3300005441 | Ga0070700_100010505 | Ga0070700_1000105053 | 376 |
| 470 | 3300005444 | Ga0070694_100000041 | Ga0070694_10000004113 | 376 |
| 471 | 3300005444 | Ga0070694_100035205 | Ga0070694_1000352053 | 376 |
| 472 | 3300005445 | Ga0070708_100004960 | Ga0070708_1000049609 | 376 |
| 473 | 3300005455 | Ga0070663_100000071 | Ga0070663_1000000711 | 376 |
| 474 | 3300005456 | Ga0070678_100000239 | Ga0070678_10000023915 | 376 |
| 475 | 3300005456 | Ga0070678_100028854 | Ga0070678_1000288543 | 376 |
| 476 | 3300005456 | Ga0070678_100318403 | Ga0070678_1003184031 | 376 |
| 477 | 3300005457 | Ga0070662_100010549 | Ga0070662_1000105495 | 376 |
| 478 | 3300005457 | Ga0070662_100011560 | Ga0070662_1000115601 | 376 |
| 479 | 3300005458 | Ga0070681_10053662 | Ga0070681_100536624 | 376 |
| 480 | 3300005458 | Ga0070681_10095556 | Ga0070681_100955563 | 376 |
| 481 | 3300005459 | Ga0068867_100005147 | Ga0068867_1000051478 | 376 |
| 482 | 3300005466 | Ga0070685_10000994 | Ga0070685_100009946 | 376 |
| 483 | 3300005530 | Ga0070679_100000464 | Ga0070679_10000046416 | 376 |
| 484 | 3300005530 | Ga0070679_100036186 | Ga0070679_1000361862 | 376 |
| 485 | 3300005530 | Ga0070679_100099308 | Ga0070679_1000993083 | 376 |
| 486 | 3300005530 | Ga0070679_100172886 | Ga0070679_1001728862 | 376 |
| 487 | 3300005535 | Ga0070684_100010477 | Ga0070684_1000104776 | 376 |
| 488 | 3300005536 | Ga0070697_100057257 | Ga0070697_1000572573 | 376 |
| 489 | 3300005536 | Ga0070697_100324573 | Ga0070697_1003245731 | 376 |
| 490 | 3300005539 | Ga0068853_100001732 | Ga0068853_10000173210 | 376 |
| 491 | 3300005543 | Ga0070672_100000035 | Ga0070672_1000000356 | 376 |
| 492 | 3300005544 | Ga0070686_100000086 | Ga0070686_1000000862 | 376 |
| 493 | 3300005544 | Ga0070686_100003387 | Ga0070686_1000033879 | 376 |
| 494 | 3300005544 | Ga0070686_100083193 | Ga0070686_1000831932 | 376 |
| 495 | 3300005545 | Ga0070695_100000036 | Ga0070695_1000000361 | 376 |
| 496 | 3300005545 | Ga0070695_100014019 | Ga0070695_1000140191 | 376 |
| 497 | 3300005546 | Ga0070696_100003543 | Ga0070696_1000035436 | 376 |
| 498 | 3300005547 | Ga0070693_100000310 | Ga0070693_10000031019 | 376 |
| 499 | 3300005547 | Ga0070693_100012712 | Ga0070693_1000127123 | 376 |
| 500 | 3300005548 | Ga0070665_100011985 | Ga0070665_1000119853 | 376 |
| 501 | 3300005549 | Ga0070704_100011024 | Ga0070704_1000110245 | 376 |
| 502 | 3300005563 | Ga0068855_100015219 | Ga0068855_1000152196 | 376 |
| 503 | 3300005563 | Ga0068855_100088285 | Ga0068855_1000882852 | 376 |
| 504 | 3300005563 | Ga0068855_100246579 | Ga0068855_1002465791 | 376 |
| 505 | 3300005564 | Ga0070664_100004564 | Ga0070664_1000045641 | 376 |
| 506 | 3300005564 | Ga0070664_100022839 | Ga0070664_1000228392 | 376 |
| 507 | 3300005577 | Ga0068857_100000122 | Ga0068857_10000012212 | 376 |
| 508 | 3300005577 | Ga0068857_100114445 | Ga0068857_1001144452 | 376 |
| 509 | 3300005578 | Ga0068854_100000410 | Ga0068854_1000004101 | 376 |
| 510 | 3300005614 | Ga0068856_100001112 | Ga0068856_1000011127 | 376 |
| 511 | 3300005614 | Ga0068856_100064233 | Ga0068856_1000642332 | 376 |
| 512 | 3300005614 | Ga0068856_100193400 | Ga0068856_1001934002 | 376 |
| 513 | 3300005616 | Ga0068852_100013184 | Ga0068852_1000131844 | 376 |
| 514 | 3300005616 | Ga0068852_100016621 | Ga0068852_1000166212 | 376 |
| 515 | 3300005616 | Ga0068852_100044248 | Ga0068852_1000442481 | 376 |
| 516 | 3300005617 | Ga0068859_100000365 | Ga0068859_10000036524 | 376 |
| 517 | 3300005617 | Ga0068859_100047840 | Ga0068859_1000478401 | 376 |
| 518 | 3300005617 | Ga0068859_100412923 | Ga0068859_1004129231 | 376 |
| 519 | 3300005618 | Ga0068864_100000271 | Ga0068864_10000027112 | 376 |
| 520 | 3300005618 | Ga0068864_100114845 | Ga0068864_1001148451 | 376 |
| 521 | 3300005618 | Ga0068864_100320760 | Ga0068864_1003207601 | 376 |
| 522 | 3300005718 | Ga0068866_10000213 | Ga0068866_1000021328 | 376 |
| 523 | 3300005719 | Ga0068861_100000340 | Ga0068861_1000003405 | 376 |
| 524 | 3300005834 | Ga0068851_10042084 | Ga0068851_100420842 | 376 |
| 525 | 3300005840 | Ga0068870_10000079 | Ga0068870_100000794 | 376 |
| 526 | 3300005841 | Ga0068863_100000372 | Ga0068863_10000037230 | 376 |
| 527 | 3300005842 | Ga0068858_100000809 | Ga0068858_1000008094 | 376 |
| 528 | 3300005843 | Ga0068860_100000709 | Ga0068860_10000070931 | 376 |
| 529 | 3300005843 | Ga0068860_100035563 | Ga0068860_1000355634 | 376 |
| 530 | 3300005844 | Ga0068862_100000512 | Ga0068862_10000051230 | 376 |
| 531 | 3300005844 | Ga0068862_100004009 | Ga0068862_1000040098 | 376 |
| 532 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007122 | 376 |
| 533 | 3300006028 | Ga0070717_10022929 | Ga0070717_100229294 | 376 |
| 534 | 3300006028 | Ga0070717_10128784 | Ga0070717_101287842 | 376 |
| 535 | 3300006058 | Ga0075432_10000890 | Ga0075432_1000089010 | 376 |
| 536 | 3300006173 | Ga0070716_100044437 | Ga0070716_1000444371 | 376 |
| 537 | 3300006175 | Ga0070712_100055031 | Ga0070712_1000550312 | 376 |
| 538 | 3300006178 | Ga0075367_10044338 | Ga0075367_100443382 | 376 |
| 539 | 3300006195 | Ga0075366_10001684 | Ga0075366_100016849 | 376 |
| 540 | 3300006237 | Ga0097621_100000047 | Ga0097621_10000004742 | 376 |
| 541 | 3300006358 | Ga0068871_100000721 | Ga0068871_10000072116 | 376 |
| 542 | 3300006844 | Ga0075428_100005796 | Ga0075428_1000057962 | 376 |
| 543 | 3300006846 | Ga0075430_100000770 | Ga0075430_10000077013 | 376 |
| 544 | 3300006846 | Ga0075430_100145136 | Ga0075430_1001451362 | 376 |
| 545 | 3300006847 | Ga0075431_100000399 | Ga0075431_10000039914 | 376 |
| 546 | 3300006852 | Ga0075433_10000374 | Ga0075433_1000037416 | 376 |
| 547 | 3300006852 | Ga0075433_10002587 | Ga0075433_100025879 | 376 |
| 548 | 3300006871 | Ga0075434_100001558 | Ga0075434_10000155813 | 376 |
| 549 | 3300006871 | Ga0075434_100021991 | Ga0075434_1000219912 | 376 |
| 550 | 3300006880 | Ga0075429_100002444 | Ga0075429_1000024442 | 376 |
| 551 | 3300006881 | Ga0068865_100000415 | Ga0068865_10000041513 | 376 |
| 552 | 3300006914 | Ga0075436_100062929 | Ga0075436_1000629293 | 376 |
| 553 | 3300006914 | Ga0075436_100216097 | Ga0075436_1002160971 | 376 |
| 554 | 3300006931 | Ga0097620_100000365 | Ga0097620_10000036520 | 376 |
| 555 | 3300006931 | Ga0097620_100047843 | Ga0097620_1000478431 | 376 |
| 556 | 3300006931 | Ga0097620_100412883 | Ga0097620_1004128831 | 376 |
| 557 | 3300007076 | Ga0075435_100004974 | Ga0075435_1000049743 | 376 |
| 558 | 3300007076 | Ga0075435_100165546 | Ga0075435_1001655462 | 376 |
| 559 | 3300009093 | Ga0105240_10139901 | Ga0105240_101399011 | 376 |
| 560 | 3300009093 | Ga0105240_10304265 | Ga0105240_103042652 | 376 |
| 561 | 3300009093 | Ga0105240_10403803 | Ga0105240_104038031 | 376 |
| 562 | 3300009094 | Ga0111539_10000185 | Ga0111539_1000018544 | 376 |
| 563 | 3300009094 | Ga0111539_10001287 | Ga0111539_1000128723 | 376 |
| 564 | 3300009094 | Ga0111539_10001763 | Ga0111539_1000176314 | 376 |
| 565 | 3300009094 | Ga0111539_10256160 | Ga0111539_102561601 | 376 |
| 566 | 3300009094 | Ga0111539_10598327 | Ga0111539_105983271 | 376 |
| 567 | 3300009098 | Ga0105245_10000213 | Ga0105245_1000021312 | 376 |
| 568 | 3300009101 | Ga0105247_10002058 | Ga0105247_100020583 | 376 |
| 569 | 3300009147 | Ga0114129_10001978 | Ga0114129_1000197814 | 376 |
| 570 | 3300009148 | Ga0105243_10000175 | Ga0105243_1000017546 | 376 |
| 571 | 3300009148 | Ga0105243_10003796 | Ga0105243_100037968 | 376 |
| 572 | 3300009174 | Ga0105241_10000734 | Ga0105241_100007344 | 376 |
| 573 | 3300009176 | Ga0105242_10000170 | Ga0105242_1000017031 | 376 |
| 574 | 3300009177 | Ga0105248_10003499 | Ga0105248_100034992 | 376 |
| 575 | 3300009545 | Ga0105237_10003191 | Ga0105237_100031912 | 376 |
| 576 | 3300009545 | Ga0105237_10111179 | Ga0105237_101111791 | 376 |
| 577 | 3300009553 | Ga0105249_10000200 | Ga0105249_1000020041 | 376 |
| 578 | 3300009553 | Ga0105249_10007192 | Ga0105249_100071927 | 376 |
| 579 | 3300010375 | Ga0105239_10000834 | Ga0105239_1000083430 | 376 |
| 580 | 3300010375 | Ga0105239_10030237 | Ga0105239_100302374 | 376 |
| 581 | 3300011119 | Ga0105246_10000050 | Ga0105246_1000005029 | 376 |
| 582 | 3300013100 | Ga0157373_10061392 | Ga0157373_100613922 | 376 |
| 583 | 3300013296 | Ga0157374_10002488 | Ga0157374_100024887 | 376 |
| 584 | 3300013297 | Ga0157378_10000581 | Ga0157378_1000058125 | 376 |
| 585 | 3300013306 | Ga0163162_10000222 | Ga0163162_1000022233 | 376 |
| 586 | 3300013306 | Ga0163162_10029144 | Ga0163162_100291442 | 376 |
| 587 | 3300013307 | Ga0157372_10001777 | Ga0157372_1000177719 | 376 |
| 588 | 3300013308 | Ga0157375_10001098 | Ga0157375_100010987 | 376 |
| 589 | 3300013308 | Ga0157375_10167137 | Ga0157375_101671372 | 376 |
| 590 | 3300014325 | Ga0163163_10000693 | Ga0163163_1000069310 | 376 |
| 591 | 3300014325 | Ga0163163_10005957 | Ga0163163_100059577 | 376 |
| 592 | 3300014325 | Ga0163163_10044003 | Ga0163163_100440034 | 376 |
| 593 | 3300014326 | Ga0157380_10000361 | Ga0157380_1000036110 | 376 |
| 594 | 3300014326 | Ga0157380_10156665 | Ga0157380_101566652 | 376 |
| 595 | 3300014745 | Ga0157377_10000204 | Ga0157377_1000020424 | 376 |
| 596 | 3300014745 | Ga0157377_10124970 | Ga0157377_101249702 | 376 |
| 597 | 3300014968 | Ga0157379_10000036 | Ga0157379_1000003616 | 376 |
| 598 | 3300014969 | Ga0157376_10000062 | Ga0157376_1000006245 | 376 |
| 599 | 3300017792 | Ga0163161_10000363 | Ga0163161_1000036329 | 376 |
| 600 | 3300025271 | Ga0207666_1000015 | Ga0207666_100001516 | 376 |
| 601 | 3300025271 | Ga0207666_1002258 | Ga0207666_10022582 | 376 |
| 602 | 3300025290 | Ga0207673_1000067 | Ga0207673_10000672 | 376 |
| 603 | 3300025297 | Ga0209758_1000063 | Ga0209758_100006371 | 376 |
| 604 | 3300025297 | Ga0209758_1015119 | Ga0209758_10151191 | 376 |
| 605 | 3300025315 | Ga0207697_10000088 | Ga0207697_1000008816 | 376 |
| 606 | 3300025315 | Ga0207697_10020214 | Ga0207697_100202142 | 376 |
| 607 | 3300025885 | Ga0207653_10000413 | Ga0207653_100004131 | 376 |
| 608 | 3300025893 | Ga0207682_10000004 | Ga0207682_1000000451 | 376 |
| 609 | 3300025899 | Ga0207642_10000291 | Ga0207642_1000029116 | 376 |
| 610 | 3300025900 | Ga0207710_10001511 | Ga0207710_100015113 | 376 |
| 611 | 3300025901 | Ga0207688_10000042 | Ga0207688_1000004216 | 376 |
| 612 | 3300025903 | Ga0207680_10000311 | Ga0207680_1000031122 | 376 |
| 613 | 3300025904 | Ga0207647_10000417 | Ga0207647_1000041724 | 376 |
| 614 | 3300025904 | Ga0207647_10009783 | Ga0207647_100097832 | 376 |
| 615 | 3300025907 | Ga0207645_10000061 | Ga0207645_1000006120 | 376 |
| 616 | 3300025908 | Ga0207643_10000012 | Ga0207643_1000001279 | 376 |
| 617 | 3300025911 | Ga0207654_10001794 | Ga0207654_100017947 | 376 |
| 618 | 3300025912 | Ga0207707_10006621 | Ga0207707_100066211 | 376 |
| 619 | 3300025912 | Ga0207707_10150646 | Ga0207707_101506462 | 376 |
| 620 | 3300025912 | Ga0207707_10275037 | Ga0207707_102750371 | 376 |
| 621 | 3300025913 | Ga0207695_10151269 | Ga0207695_101512692 | 376 |
| 622 | 3300025914 | Ga0207671_10011350 | Ga0207671_100113502 | 376 |
| 623 | 3300025914 | Ga0207671_10220962 | Ga0207671_102209622 | 376 |
| 624 | 3300025917 | Ga0207660_10000008 | Ga0207660_1000000841 | 376 |
| 625 | 3300025917 | Ga0207660_10059606 | Ga0207660_100596064 | 376 |
| 626 | 3300025917 | Ga0207660_10173842 | Ga0207660_101738421 | 376 |
| 627 | 3300025918 | Ga0207662_10000097 | Ga0207662_1000009716 | 376 |
| 628 | 3300025919 | Ga0207657_10000503 | Ga0207657_1000050316 | 376 |
| 629 | 3300025919 | Ga0207657_10002293 | Ga0207657_100022936 | 376 |
| 630 | 3300025920 | Ga0207649_10000099 | Ga0207649_1000009928 | 376 |
| 631 | 3300025921 | Ga0207652_10045826 | Ga0207652_100458261 | 376 |
| 632 | 3300025921 | Ga0207652_10195128 | Ga0207652_101951282 | 376 |
| 633 | 3300025923 | Ga0207681_10000141 | Ga0207681_1000014119 | 376 |
| 634 | 3300025923 | Ga0207681_10209316 | Ga0207681_102093161 | 376 |
| 635 | 3300025925 | Ga0207650_10007055 | Ga0207650_100070556 | 376 |
| 636 | 3300025925 | Ga0207650_10039576 | Ga0207650_100395762 | 376 |
| 637 | 3300025926 | Ga0207659_10000023 | Ga0207659_1000002341 | 376 |
| 638 | 3300025926 | Ga0207659_10189377 | Ga0207659_101893771 | 376 |
| 639 | 3300025927 | Ga0207687_10000319 | Ga0207687_1000031921 | 376 |
| 640 | 3300025928 | Ga0207700_10014366 | Ga0207700_100143666 | 376 |
| 641 | 3300025929 | Ga0207664_10077228 | Ga0207664_100772282 | 376 |
| 642 | 3300025931 | Ga0207644_10015130 | Ga0207644_100151301 | 376 |
| 643 | 3300025932 | Ga0207690_10000105 | Ga0207690_1000010547 | 376 |
| 644 | 3300025933 | Ga0207706_10000438 | Ga0207706_1000043816 | 376 |
| 645 | 3300025933 | Ga0207706_10005437 | Ga0207706_100054377 | 376 |
| 646 | 3300025934 | Ga0207686_10000140 | Ga0207686_1000014033 | 376 |
| 647 | 3300025935 | Ga0207709_10000264 | Ga0207709_1000026452 | 376 |
| 648 | 3300025935 | Ga0207709_10005146 | Ga0207709_100051464 | 376 |
| 649 | 3300025936 | Ga0207670_10000108 | Ga0207670_1000010812 | 376 |
| 650 | 3300025936 | Ga0207670_10003337 | Ga0207670_100033377 | 376 |
| 651 | 3300025936 | Ga0207670_10073327 | Ga0207670_100733272 | 376 |
| 652 | 3300025937 | Ga0207669_10000110 | Ga0207669_1000011028 | 376 |
| 653 | 3300025937 | Ga0207669_10044617 | Ga0207669_100446171 | 376 |
| 654 | 3300025938 | Ga0207704_10000171 | Ga0207704_100001711 | 376 |
| 655 | 3300025939 | Ga0207665_10070355 | Ga0207665_100703553 | 376 |
| 656 | 3300025940 | Ga0207691_10002227 | Ga0207691_1000222716 | 376 |
| 657 | 3300025941 | Ga0207711_10002682 | Ga0207711_100026829 | 376 |
| 658 | 3300025942 | Ga0207689_10000008 | Ga0207689_1000000865 | 376 |
| 659 | 3300025944 | Ga0207661_10000053 | Ga0207661_1000005341 | 376 |
| 660 | 3300025945 | Ga0207679_10000053 | Ga0207679_1000005354 | 376 |
| 661 | 3300025945 | Ga0207679_10046497 | Ga0207679_100464973 | 376 |
| 662 | 3300025949 | Ga0207667_10008564 | Ga0207667_100085647 | 376 |
| 663 | 3300025960 | Ga0207651_10000052 | Ga0207651_100000521 | 376 |
| 664 | 3300025960 | Ga0207651_10192522 | Ga0207651_101925221 | 376 |
| 665 | 3300025960 | Ga0207651_10301061 | Ga0207651_103010611 | 376 |
| 666 | 3300025961 | Ga0207712_10000156 | Ga0207712_1000015661 | 376 |
| 667 | 3300025972 | Ga0207668_10000160 | Ga0207668_1000016012 | 376 |
| 668 | 3300025972 | Ga0207668_10032006 | Ga0207668_100320062 | 376 |
| 669 | 3300025981 | Ga0207640_10000325 | Ga0207640_1000032511 | 376 |
| 670 | 3300025981 | Ga0207640_10113109 | Ga0207640_101131092 | 376 |
| 671 | 3300025986 | Ga0207658_10036051 | Ga0207658_100360514 | 376 |
| 672 | 3300025986 | Ga0207658_10057895 | Ga0207658_100578953 | 376 |
| 673 | 3300025986 | Ga0207658_10094028 | Ga0207658_100940283 | 376 |
| 674 | 3300026035 | Ga0207703_10001510 | Ga0207703_100015104 | 376 |
| 675 | 3300026035 | Ga0207703_10022564 | Ga0207703_100225644 | 376 |
| 676 | 3300026041 | Ga0207639_10001511 | Ga0207639_100015116 | 376 |
| 677 | 3300026067 | Ga0207678_10000185 | Ga0207678_1000018527 | 376 |
| 678 | 3300026067 | Ga0207678_10031346 | Ga0207678_100313463 | 376 |
| 679 | 3300026075 | Ga0207708_10000263 | Ga0207708_1000026324 | 376 |
| 680 | 3300026075 | Ga0207708_10001344 | Ga0207708_1000134414 | 376 |
| 681 | 3300026078 | Ga0207702_10000297 | Ga0207702_100002973 | 376 |
| 682 | 3300026089 | Ga0207648_10000469 | Ga0207648_1000046924 | 376 |
| 683 | 3300026089 | Ga0207648_10038076 | Ga0207648_100380762 | 376 |
| 684 | 3300026089 | Ga0207648_10132054 | Ga0207648_101320542 | 376 |
| 685 | 3300026095 | Ga0207676_10001235 | Ga0207676_1000123522 | 376 |
| 686 | 3300026116 | Ga0207674_10001208 | Ga0207674_1000120824 | 376 |
| 687 | 3300026118 | Ga0207675_100000342 | Ga0207675_10000034216 | 376 |
| 688 | 3300026118 | Ga0207675_100033440 | Ga0207675_1000334401 | 376 |
| 689 | 3300026121 | Ga0207683_10000006 | Ga0207683_1000000644 | 376 |
| 690 | 3300026121 | Ga0207683_10024092 | Ga0207683_100240923 | 376 |
| 691 | 3300026142 | Ga0207698_10000236 | Ga0207698_1000023630 | 376 |
| 692 | 3300026142 | Ga0207698_10269963 | Ga0207698_102699631 | 376 |
| 693 | 3300026142 | Ga0207698_10337831 | Ga0207698_103378311 | 376 |
| 694 | 3300027471 | Ga0209995_1004032 | Ga0209995_10040322 | 376 |
| 695 | 3300027682 | Ga0209971_1003649 | Ga0209971_10036491 | 376 |
| 696 | 3300027695 | Ga0209966_1001615 | Ga0209966_10016151 | 376 |
| 697 | 3300027717 | Ga0209998_10001431 | Ga0209998_100014315 | 376 |
| 698 | 3300027717 | Ga0209998_10004020 | Ga0209998_100040202 | 376 |
| 699 | 3300027876 | Ga0209974_10002024 | Ga0209974_100020244 | 376 |
| 700 | 3300027907 | Ga0207428_10000112 | Ga0207428_1000011255 | 376 |
| 701 | 3300027907 | Ga0207428_10000417 | Ga0207428_1000041732 | 376 |
| 702 | 3300027907 | Ga0207428_10000480 | Ga0207428_1000048033 | 376 |
| 703 | 3300028379 | Ga0268266_10017509 | Ga0268266_100175096 | 376 |
| 704 | 3300028380 | Ga0268265_10000257 | Ga0268265_1000025741 | 376 |
| 705 | 3300028381 | Ga0268264_10000579 | Ga0268264_1000057939 | 376 |
| 706 | 3300028381 | Ga0268264_10046931 | Ga0268264_100469313 | 376 |
| 707 | 3300031238 | Ga0265332_10014392 | Ga0265332_100143922 | 376 |
| 708 | 3300031241 | Ga0265325_10000004 | Ga0265325_10000004133 | 376 |
| 709 | 3300031241 | Ga0265325_10000106 | Ga0265325_100001069 | 376 |
| 710 | 3300031241 | Ga0265325_10028908 | Ga0265325_100289084 | 376 |
| 711 | 3300031247 | Ga0265340_10013567 | Ga0265340_100135673 | 376 |
| 712 | 3300031247 | Ga0265340_10014025 | Ga0265340_100140253 | 376 |
| 713 | 3300031595 | Ga0265313_10011012 | Ga0265313_100110123 | 376 |
| 714 | 3300034816 | Ga0373930_0000160 | Ga0373930_0000160_2001_3131 | 376 |
| 715 | 3300034819 | Ga0373958_0000508 | Ga0373958_0000508_1162_2292 | 376 |
| 716 | 3300034819 | Ga0373958_0000865 | Ga0373958_0000865_2703_3833 | 376 |
| 717 | 3300034820 | Ga0373959_0000573 | Ga0373959_0000573_2734_3864 | 376 |
| 718 | 3300034957 | Ga0373938_0000090 | Ga0373938_0000090_7284_8414 | 376 |
| 719 | 3300034957 | Ga0373938_0001252 | Ga0373938_0001252_734_1864 | 376 |
| 720 | 3300035083 | Ga0373926_0001790 | Ga0373926_0001790_837_1967 | 376 |
| 721 | 3300035084 | Ga0373928_0000536 | Ga0373928_0000536_4567_5697 | 376 |
| 722 | 3300035085 | Ga0373929_0000741 | Ga0373929_0000741_4433_5563 | 376 |
| 723 | 3300035085 | Ga0373929_0003008 | Ga0373929_0003008_1210_2340 | 376 |
| 724 | 3300035085 | Ga0373929_0011677 | Ga0373929_0011677_456_1622 | 376 |
| 725 | 3300035088 | Ga0373940_0000074 | Ga0373940_0000074_7540_8670 | 376 |
| 726 | 3300035090 | Ga0373949_0000489 | Ga0373949_0000489_7469_8599 | 376 |
| 727 | 3300035090 | Ga0373949_0001646 | Ga0373949_0001646_3866_4996 | 376 |
| 728 | 3300035091 | Ga0373951_0001485 | Ga0373951_0001485_1288_2418 | 376 |
| 729 | 3300035091 | Ga0373951_0003044 | Ga0373951_0003044_2973_4103 | 376 |
| 730 | 3300035092 | Ga0373952_0000166 | Ga0373952_0000166_4090_5220 | 376 |
| 731 | 3300035092 | Ga0373952_0001370 | Ga0373952_0001370_174_1304 | 376 |
| 732 | 3300035112 | Ga0373932_0001675 | Ga0373932_0001675_3785_4915 | 376 |
| 733 | 3300035114 | Ga0373939_0000873 | Ga0373939_0000873_4913_6043 | 376 |
| 734 | 3300035114 | Ga0373939_0001847 | Ga0373939_0001847_1304_2434 | 376 |
| 735 | 3300035115 | Ga0373941_0000030 | Ga0373941_0000030_9338_10468 | 376 |
| 736 | 3300035115 | Ga0373941_0001773 | Ga0373941_0001773_883_2013 | 376 |
| 737 | 3300035116 | Ga0373945_0019356 | Ga0373945_0019356_1040_2170 | 376 |
| 738 | 3300035121 | Ga0373960_0000108 | Ga0373960_0000108_2820_3950 | 376 |
| 739 | 3300035121 | Ga0373960_0014890 | Ga0373960_0014890_246_1412 | 376 |
| 740 | 3300035170 | Ga0373943_0090527 | Ga0373943_0090527_256_1386 | 376 |
| 741 | 3300035172 | Ga0373955_0013942 | Ga0373955_0013942_1291_2421 | 376 |
| 742 | 3300035207 | Ga0373942_0000232 | Ga0373942_0000232_2855_3985 | 376 |
| 743 | 3300035207 | Ga0373942_0001290 | Ga0373942_0001290_2345_3475 | 376 |
| 744 | 3300035241 | Ga0373961_0000666 | Ga0373961_0000666_1650_2780 | 376 |
| 745 | 3300035241 | Ga0373961_0001000 | Ga0373961_0001000_901_2031 | 376 |
| 746 | 3300035410 | Ga0373924_0058362 | Ga0373924_0058362_163_1293 | 376 |
| 747 | 3300035691 | Ga0373931_0000084 | Ga0373931_0000084_21330_22460 | 376 |
| 748 | 3300035691 | Ga0373931_0000494 | Ga0373931_0000494_6545_7711 | 376 |
| 749 | 3300035695 | Ga0373927_0007901 | Ga0373927_0007901_1736_2866 | 376 |
| 750 | 3300036401 | Ga0373937_0025710 | Ga0373937_0025710_2383_3513 | 376 |
| 751 | 3300036401 | Ga0373937_0122848 | Ga0373937_0122848_1171_2319 | 376 |
| 752 | 3300037068 | Ga0373925_0003332 | Ga0373925_0003332_11125_12255 | 376 |
| 753 | 3300037068 | Ga0373925_0034015 | Ga0373925_0034015_1279_2409 | 376 |
| 754 | 3300044712 | Ga0453684_0078254 | Ga0453684_0078254_2067_3197 | 376 |
| 755 | 3300046455 | Ga0495603_0001247 | Ga0495603_0001247_2092_3222 | 376 |
| 756 | 3300046455 | Ga0495603_0109076 | Ga0495603_0109076_338_1468 | 376 |
| 757 | 3300046459 | Ga0495629_0001052 | Ga0495629_0001052_18345_19475 | 376 |
| 758 | 3300046461 | Ga0495641_0013443 | Ga0495641_0013443_1816_2946 | 376 |
| 759 | 3300046463 | Ga0495653_0060993 | Ga0495653_0060993_105_1235 | 376 |
| 760 | 3300046472 | Ga0495580_0036343 | Ga0495580_0036343_60_1190 | 376 |
| 761 | 3300046473 | Ga0495582_0000221 | Ga0495582_0000221_2337_3467 | 376 |
| 762 | 3300046473 | Ga0495582_0002529 | Ga0495582_0002529_6547_7677 | 376 |
| 763 | 3300046475 | Ga0495639_0001053 | Ga0495639_0001053_1934_3064 | 376 |
| 764 | 3300046476 | Ga0495662_0005160 | Ga0495662_0005160_1799_2929 | 376 |
| 765 | 3300046499 | Ga0495594_0003526 | Ga0495594_0003526_1628_2758 | 376 |
| 766 | 3300046514 | Ga0495618_0085903 | Ga0495618_0085903_871_2001 | 376 |
| 767 | 3300046517 | Ga0495630_0002234 | Ga0495630_0002234_323_1453 | 376 |
| 768 | 3300046526 | Ga0495666_0034071 | Ga0495666_0034071_1231_2361 | 376 |
| 769 | 3300046526 | Ga0495666_0042705 | Ga0495666_0042705_1051_2181 | 376 |
| 770 | 3300046531 | Ga0495665_0000755 | Ga0495665_0000755_9378_10508 | 376 |
| 771 | 3300046533 | Ga0495640_0046151 | Ga0495640_0046151_1776_2906 | 376 |
| 772 | 3300046543 | Ga0495645_0113424 | Ga0495645_0113424_653_1783 | 376 |
| 773 | 3300046557 | Ga0495622_0016865 | Ga0495622_0016865_270_1400 | 376 |
| 774 | 3300046642 | Ga0495634_0003584 | Ga0495634_0003584_323_1453 | 376 |
| 775 | 3300046663 | Ga0495635_0011640 | Ga0495635_0011640_2730_3860 | 376 |
| 776 | 3300046674 | Ga0495588_0027388 | Ga0495588_0027388_1478_2608 | 376 |
| 777 | 3300046681 | Ga0495647_0001581 | Ga0495647_0001581_553_1683 | 376 |
| 778 | 3300046689 | Ga0495613_0000393 | Ga0495613_0000393_34230_35360 | 376 |
| 779 | 3300046690 | Ga0495624_0000182 | Ga0495624_0000182_2416_3546 | 376 |
| 780 | 3300047315 | Ga0495581_0000093 | Ga0495581_0000093_2859_3989 | 376 |
| 781 | 3300047319 | Ga0495674_0005687 | Ga0495674_0005687_1808_2938 | 376 |
| 782 | 3300047319 | Ga0495674_0095353 | Ga0495674_0095353_878_2008 | 376 |
| 783 | 3300047321 | Ga0495676_0024359 | Ga0495676_0024359_4033_5163 | 376 |
| 784 | 3300047673 | Ga0495593_0000827 | Ga0495593_0000827_7644_8774 | 376 |
| 785 | 3300048903 | Ga0496100_0000764 | Ga0496100_0000764_4979_6109 | 376 |
| 786 | 3300048904 | Ga0496101_0003468 | Ga0496101_0003468_2349_3479 | 376 |
| 787 | 3300048905 | Ga0496102_0030198 | Ga0496102_0030198_2349_3479 | 376 |
| 788 | 3300048905 | Ga0496102_0041352 | Ga0496102_0041352_2703_3833 | 376 |
| 789 | 3300048905 | Ga0496102_0206151 | Ga0496102_0206151_218_1348 | 376 |
| 790 | 3300048906 | Ga0496103_0001517 | Ga0496103_0001517_11913_13043 | 376 |
| 791 | 3300048906 | Ga0496103_0100997 | Ga0496103_0100997_424_1554 | 376 |
| 792 | 3300048907 | Ga0496104_0081606 | Ga0496104_0081606_493_1623 | 376 |
| 793 | 3300048907 | Ga0496104_0340744 | Ga0496104_0340744_113_1243 | 376 |
| 794 | 3300048909 | Ga0496106_0000679 | Ga0496106_0000679_20173_21303 | 376 |
| 795 | 3300048910 | Ga0496107_0000078 | Ga0496107_0000078_44622_45752 | 376 |
| 796 | 3300048910 | Ga0496107_0171249 | Ga0496107_0171249_24_1154 | 376 |
| 797 | 3300048911 | Ga0496108_0002072 | Ga0496108_0002072_12995_14125 | 376 |
| 798 | 3300048912 | Ga0496109_0000406 | Ga0496109_0000406_32637_33767 | 376 |
| 799 | 3300048912 | Ga0496109_0004222 | Ga0496109_0004222_6961_8091 | 376 |
| 800 | 3300048912 | Ga0496109_0063539 | Ga0496109_0063539_1429_2595 | 376 |
| 801 | 3300048913 | Ga0496110_0012834 | Ga0496110_0012834_1865_2995 | 376 |
| 802 | 3300048913 | Ga0496110_0065237 | Ga0496110_0065237_686_1816 | 376 |
| 803 | 3300048913 | Ga0496110_0386640 | Ga0496110_0386640_52_1182 | 376 |
| 804 | 3300048914 | Ga0496111_0036370 | Ga0496111_0036370_2053_3183 | 376 |
| 805 | 3300048914 | Ga0496111_0044673 | Ga0496111_0044673_1967_3097 | 376 |
| 806 | 3300048915 | Ga0496112_0096078 | Ga0496112_0096078_1350_2585 | 376 |
| 807 | 3300048915 | Ga0496112_0097332 | Ga0496112_0097332_205_1335 | 376 |
| 808 | 3300048916 | Ga0496113_0017355 | Ga0496113_0017355_1644_2774 | 376 |
| 809 | 3300048916 | Ga0496113_0043809 | Ga0496113_0043809_1869_2999 | 376 |
| 810 | 3300048916 | Ga0496113_0136034 | Ga0496113_0136034_332_1498 | 376 |
| 811 | 3300048918 | Ga0496115_0004237 | Ga0496115_0004237_5870_7000 | 376 |
| 812 | 3300049593 | Ga0501077_0115300 | Ga0501077_0115300_250_1380 | 376 |
| 813 | 3300050493 | nmdc:mga0k408_24125_c1 | nmdc:mga0k408_24125_c1_301_1461 | 376 |
| 814 | 3300050507 | nmdc:mga05p37_531_c1 | nmdc:mga05p37_531_c1_26377_27507 | 376 |
| 815 | 3300050508 | nmdc:mga09592_1318_c1 | nmdc:mga09592_1318_c1_14699_15829 | 376 |
| 816 | 3300050509 | nmdc:mga0qj67_413_c1 | nmdc:mga0qj67_413_c1_6206_7336 | 376 |
| 817 | 3300050510 | nmdc:mga06r32_105143_c1 | nmdc:mga06r32_105143_c1_683_1822 | 376 |
| 818 | 3300050510 | nmdc:mga06r32_1915_c1 | nmdc:mga06r32_1915_c1_16831_17961 | 376 |
| 819 | 3300050511 | nmdc:mga08y16_2163_c1 | nmdc:mga08y16_2163_c1_4494_5624 | 376 |
| 820 | 3300050511 | nmdc:mga08y16_2892_c1 | nmdc:mga08y16_2892_c1_15952_17082 | 376 |
| 821 | 3300050511 | nmdc:mga08y16_29359_c1 | nmdc:mga08y16_29359_c1_2574_3740 | 376 |
| 822 | 3300050511 | nmdc:mga08y16_3734_c1 | nmdc:mga08y16_3734_c1_4748_5878 | 376 |
| 823 | 3300050512 | nmdc:mga0n895_209_c1 | nmdc:mga0n895_209_c1_14893_16023 | 376 |
| 824 | 3300050512 | nmdc:mga0n895_4169_c1 | nmdc:mga0n895_4169_c1_10133_11263 | 376 |
| 825 | 3300050512 | nmdc:mga0n895_82182_c1 | nmdc:mga0n895_82182_c1_928_2058 | 376 |
| 826 | 3300050513 | nmdc:mga0rr50_37915_c1 | nmdc:mga0rr50_37915_c1_1881_3011 | 376 |
| 827 | 3300050513 | nmdc:mga0rr50_591_c1 | nmdc:mga0rr50_591_c1_12532_13662 | 376 |
| 828 | 3300050515 | nmdc:mga0a205_12176_c1 | nmdc:mga0a205_12176_c1_5901_7031 | 376 |
| 829 | 3300050515 | nmdc:mga0a205_82673_c1 | nmdc:mga0a205_82673_c1_1896_3026 | 376 |
| 830 | 3300050515 | nmdc:mga0a205_9124_c1 | nmdc:mga0a205_9124_c1_2476_3606 | 376 |
| 831 | 3300053077 | Ga0495601_0022124 | Ga0495601_0022124_2478_3608 | 376 |
| 832 | 3300053102 | Ga0500554_058796 | Ga0500554_058796_52_1182 | 376 |
| 833 | 3300053150 | Ga0500603_000736 | Ga0500603_000736_1778_2908 | 376 |
| 834 | 3300053153 | Ga0500616_0040270 | Ga0500616_0040270_962_2122 | 376 |
| 835 | 3300053178 | Ga0500637_0152687 | Ga0500637_0152687_17_1147 | 376 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bz0-assembly1.cif.gz_A | crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc | 0.9143 | 173 | 343 |
| 2bz1-assembly1.cif.gz_A-2 | crystal structure of apo e. coli gtp cyclohydrolase ii | 0.9028 | 173 | 343 |
| 2bz0-assembly1.cif.gz_A | crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc | 0.899 | 173 | 343 |
| 2bz1-assembly1.cif.gz_A-2 | crystal structure of apo e. coli gtp cyclohydrolase ii | 0.8882 | 173 | 343 |
| 4rl4-assembly1.cif.gz_A | crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695 | 0.8563 | 172 | 346 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXG1_205_373_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.9239 | 176 | 345 | 3.40.50.10990 |
| af_Q2FXG1_205_373_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.9083 | 176 | 345 | 3.40.50.10990 |
| 4i14B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.8977 | 175 | 342 | 3.40.50.10990 |
| af_Q5A1Y2_80_302_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.895 | 178 | 341 | 3.40.50.10990 |
| 2bz0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.8931 | 173 | 345 | 3.40.50.10990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537PR85-F1-model_v4 | GTP cyclohydrolase-2 (EC 3.5.4.25) (GTP cyclohydrolase II) | 0.9471 | 10 | 368 |
GO:0003935
GO:0005525 GO:0005829 GO:0008270 GO:0009231 |
| AF-A0A537N2B2-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.9392 | 10 | 303 |
GO:0003935
GO:0005525 GO:0005829 GO:0009231 |
| AF-X0WX33-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.9347 | 215 | 363 |
GO:0003935
GO:0005525 GO:0005829 GO:0009231 |
| AF-A0A3M0YTJ5-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.9318 | 172 | 363 |
GO:0003935
GO:0005525 GO:0005829 GO:0008686 GO:0009231 |
| AF-A0A537RXJ8-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.9317 | 4 | 330 |
GO:0003935
GO:0005525 GO:0005829 GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar