F482758

General Info

Members Datasets Scaffolds Average Seq Length
833 420 782 545

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0005958|Ga0495638_0005958_3372_5198
Length 608
Sequence MSTVCADLRPDVVAVASFAALQRSGVVHRGRSVEIDQGSSSATDHPAVIAQAMKPVRHVLAGCTAREFHMADLSTLKKFEALSPFEIKDELINLAKANSKRTQSAFLNAGRGNPNWVATTPREGFFLLGQFAISESKRVMEHPAGIGGMPQAKGIAGRFEAWLAKHADMPGASFLSEMLPYAVKTFSFEPDAFVHELVDSIIGDNYPVPDRMLVHNEKIVHEYLMWAVCGAPRPSGKFDIYAVEGGTAAMCYIFKSLKANRLLLPGDTIALGTPIFTPYIEMTHLEDYDLKVVQIKAPQENRFQFTDEEIKKLEDPKIKAFFIVNPANPSGMGVSPETIAKLTNLVKTKRPDLMLLTDDVYGTFVHGFRSLLGELPHNTIGVYSYSKYFGCTGWRLGAIAIHEDNIFDKMIAKLPDAAVKALDKRYGPLTLEPRKLKMIDRIVADSRDVALNHTAGLSLPQQVMMSLFSLSEMLDEKKAYQAACMEIVNKRLWSLLDGLGLADKLTPNPNYDAYYGLIDFEFWARKNIGDEAVDYLKKNVHPLDLAFRLAEAHGIVLLNGGGFDAPEWSLRVSLANLSDDVYDDIGRGVRAIARGYRDAYQAAKGGTG

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
9 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
10 2643221618 Ensifer sp. Root231 Isolate Unclassified
11 2643221626 Ensifer sp. Root31 Isolate Unclassified
12 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
13 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
14 2643221655 Ensifer sp. Root1252 Isolate Unclassified
15 2643221659 Ensifer sp. Root127 Isolate Unclassified
16 2643221698 Ensifer sp. Root142 Isolate Unclassified
17 2643221712 Ensifer sp. Root258 Isolate Unclassified
18 2643221733 Bosea sp. Root381 Isolate Unclassified
19 2643221736 Bosea sp. Root483D1 Isolate Unclassified
20 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543024 Aminobacter sp. AP02 Isolate Unclassified
23 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
24 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
25 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
26 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
27 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
28 2844163670 Ensifer sp. 1H6 Isolate Unclassified
29 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
30 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
31 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
32 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
33 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
34 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
35 2904699407
36 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
37 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
38 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
39 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
40 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
41 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
42 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
43 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
44 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
45 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
46 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
47 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
48 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
49 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
50 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
54 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
58 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
62 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
84 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
85 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
86 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
89 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
96 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
121 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
122 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
170 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
175 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
258 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
271 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
272 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
292 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
293 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
294 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
317 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
318 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
319 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
325 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
404 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
410 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
419 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
420 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.59
Metatranscriptomes 2.4
Isolates 6.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.84
Nodule 2.28
Rhizoplane 4.08
Rhizosphere 85.35
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000057 3300000545 Bacteria 21758
2 rootH2_10007600 3300003320 Bacteria 24379
3 rootH2_10055935 3300003320 Bacteria 4867
4 rootH1_10010931 3300003323 Bacteria 10602
5 JGI26128J50194_1000456 3300003347 Bacteria 2241
6 JGI26145J50221_1000801 3300003371 Bacteria 2572
7 Ga0055526_1000276 3300003771 Bacteria 43379
8 Ga0055524_1003976 3300003775 Bacteria 6986
9 Ga0055543_1010238 3300004625 Bacteria 1974
10 Ga0058861_12067306 3300004800 Bacteria 2118
11 Ga0058861_12074013 3300004800 Bacteria 6407
12 Ga0058862_10036173 3300004803 Bacteria 4274
13 Ga0058862_10052075 3300004803 Bacteria 6237
14 Ga0065165_1000162 3300005262 Bacteria 116822
15 Ga0065165_1000972 3300005262 Bacteria 35758
16 Ga0065712_10077866 3300005290 Bacteria 3431
17 Ga0065715_10094129 3300005293 Bacteria 4403
18 Ga0065707_10001246 3300005295 Bacteria 8340
19 Ga0070658_10058520 3300005327 Bacteria 3137
20 Ga0070676_10004147 3300005328 Bacteria 7609
21 Ga0070676_10011011 3300005328 Bacteria 4914
22 Ga0070676_10034638 3300005328 Bacteria 2900
23 Ga0070683_100013742 3300005329 Bacteria 7068
24 Ga0070683_100035061 3300005329 Bacteria 4587
25 Ga0070683_100070044 3300005329 Bacteria 3271
26 Ga0070690_100009374 3300005330 Bacteria 5670
27 Ga0070690_100027442 3300005330 Bacteria 3520
28 Ga0070670_100002242 3300005331 Bacteria 15894
29 Ga0070670_100004697 3300005331 Bacteria 11462
30 Ga0070670_100046479 3300005331 Bacteria 3733
31 Ga0070670_100060623 3300005331 Bacteria 3249
32 Ga0070677_10002249 3300005333 Bacteria 6158
33 Ga0068869_100000833 3300005334 Bacteria 17604
34 Ga0068869_100006008 3300005334 Bacteria 7678
35 Ga0068869_100050537 3300005334 Bacteria 3014
36 Ga0070666_10005944 3300005335 Bacteria 7492
37 Ga0070680_100000715 3300005336 Bacteria 23059
38 Ga0070680_100002629 3300005336 Bacteria 13308
39 Ga0070680_100010034 3300005336 Bacteria 7295
40 Ga0070680_100123770 3300005336 Bacteria 2160
41 Ga0070660_100001964 3300005339 Bacteria 14177
42 Ga0070660_100027495 3300005339 Bacteria 4246
43 Ga0070660_100033219 3300005339 Bacteria 3887
44 Ga0070689_100001133 3300005340 Bacteria 16809
45 Ga0070689_100025513 3300005340 Bacteria 4441
46 Ga0070689_100037406 3300005340 Bacteria 3711
47 Ga0070661_100024325 3300005344 Bacteria 4344
48 Ga0070661_100033996 3300005344 Bacteria 3696
49 Ga0070668_100074847 3300005347 Bacteria 2643
50 Ga0070669_100138926 3300005353 Bacteria 1871
51 Ga0070675_100001879 3300005354 Bacteria 15492
52 Ga0070675_100014324 3300005354 Bacteria 6252
53 Ga0070675_100025831 3300005354 Bacteria 4709
54 Ga0070675_100032787 3300005354 Bacteria 4205
55 Ga0070675_100102579 3300005354 Bacteria 2411
56 Ga0070675_100183794 3300005354 Bacteria 1808
57 Ga0070671_100000304 3300005355 Bacteria 33410
58 Ga0070671_100009413 3300005355 Bacteria 7844
59 Ga0070671_100026958 3300005355 Bacteria 4727
60 Ga0070674_100001037 3300005356 Bacteria 14538
61 Ga0070674_100084412 3300005356 Bacteria 2277
62 Ga0070673_100000114 3300005364 Bacteria 37125
63 Ga0070673_100008549 3300005364 Bacteria 6811
64 Ga0070673_100016251 3300005364 Bacteria 5257
65 Ga0070667_100050429 3300005367 Bacteria 3508
66 Ga0070709_10004238 3300005434 Bacteria 7736
67 Ga0070714_100062618 3300005435 Bacteria 3197
68 Ga0070714_100091087 3300005435 Bacteria 2671
69 Ga0070713_100002486 3300005436 Bacteria 12035
70 Ga0070713_100018183 3300005436 Bacteria 5340
71 Ga0070713_100022397 3300005436 Bacteria 4883
72 Ga0070713_100065627 3300005436 Bacteria 3050
73 Ga0070701_10013249 3300005438 Bacteria 3746
74 Ga0070711_100001996 3300005439 Bacteria 11478
75 Ga0070705_100025693 3300005440 Bacteria 3196
76 Ga0070700_100003815 3300005441 Bacteria 7810
77 Ga0070700_100012604 3300005441 Bacteria 4724
78 Ga0070700_100069947 3300005441 Bacteria 2236
79 Ga0070694_100004983 3300005444 Bacteria 8005
80 Ga0070678_100002007 3300005456 Bacteria 10995
81 Ga0070678_100058855 3300005456 Bacteria 2822
82 Ga0070662_100001647 3300005457 Bacteria 13752
83 Ga0070681_10004445 3300005458 Bacteria 13354
84 Ga0070681_10005791 3300005458 Bacteria 11956
85 Ga0070681_10012013 3300005458 Bacteria 8585
86 Ga0070681_10012807 3300005458 Bacteria 8325
87 Ga0070681_10017468 3300005458 Bacteria 7171
88 Ga0070681_10076439 3300005458 Bacteria 3307
89 Ga0068867_100007147 3300005459 Bacteria 7889
90 Ga0068867_100068370 3300005459 Bacteria 2651
91 Ga0068867_100077400 3300005459 Bacteria 2499
92 Ga0070685_10001172 3300005466 Bacteria 14028
93 Ga0070685_10083734 3300005466 Bacteria 1917
94 Ga0070699_100115352 3300005518 Bacteria 2360
95 Ga0070679_100008257 3300005530 Bacteria 9794
96 Ga0070679_100010067 3300005530 Bacteria 8957
97 Ga0070679_100017173 3300005530 Bacteria 7000
98 Ga0070679_100027279 3300005530 Bacteria 5619
99 Ga0070684_100001210 3300005535 Bacteria 18541
100 Ga0068853_100000967 3300005539 Bacteria 20209
101 Ga0068853_100002561 3300005539 Bacteria 13657
102 Ga0068853_100003101 3300005539 Bacteria 12705
103 Ga0068853_100123661 3300005539 Bacteria 2310
104 Ga0070672_100001618 3300005543 Bacteria 13999
105 Ga0070672_100013051 3300005543 Bacteria 5854
106 Ga0070672_100015376 3300005543 Bacteria 5447
107 Ga0070672_100039589 3300005543 Bacteria 3612
108 Ga0070672_100080762 3300005543 Bacteria 2605
109 Ga0070686_100005382 3300005544 Bacteria 7081
110 Ga0070686_100031109 3300005544 Bacteria 3261
111 Ga0070686_100035732 3300005544 Bacteria 3070
112 Ga0070695_100000676 3300005545 Bacteria 18236
113 Ga0070696_100015471 3300005546 Bacteria 5124
114 Ga0070696_100049752 3300005546 Bacteria 2912
115 Ga0070693_100003292 3300005547 Bacteria 7505
116 Ga0070693_100063562 3300005547 Bacteria 2152
117 Ga0070665_100006978 3300005548 Bacteria 11481
118 Ga0070665_100017868 3300005548 Bacteria 7120
119 Ga0070665_100022014 3300005548 Bacteria 6413
120 Ga0068855_100005891 3300005563 Bacteria 14940
121 Ga0068855_100008023 3300005563 Bacteria 12752
122 Ga0068855_100008354 3300005563 Bacteria 12520
123 Ga0068855_100062241 3300005563 Bacteria 4357
124 Ga0068855_100091501 3300005563 Bacteria 3509
125 Ga0070664_100007952 3300005564 Bacteria 8567
126 Ga0070664_100010431 3300005564 Bacteria 7533
127 Ga0068857_100006177 3300005577 Bacteria 10240
128 Ga0068857_100012233 3300005577 Bacteria 7467
129 Ga0068854_100070598 3300005578 Bacteria 2553
130 Ga0068856_100000181 3300005614 Bacteria 65631
131 Ga0068856_100009519 3300005614 Bacteria 9438
132 Ga0068856_100057362 3300005614 Bacteria 3844
133 Ga0070702_100002103 3300005615 Bacteria 8455
134 Ga0070702_100008363 3300005615 Bacteria 5008
135 Ga0068852_100000929 3300005616 Bacteria 19377
136 Ga0068852_100003731 3300005616 Bacteria 10684
137 Ga0068852_100014481 3300005616 Bacteria 6073
138 Ga0068852_100024417 3300005616 Bacteria 4884
139 Ga0068859_100005614 3300005617 Bacteria 12783
140 Ga0068866_10000727 3300005718 Bacteria 14929
141 Ga0068861_100009840 3300005719 Bacteria 6613
142 Ga0068861_100042311 3300005719 Bacteria 3414
143 Ga0068861_100043433 3300005719 Bacteria 3374
144 Ga0068861_100089355 3300005719 Bacteria 2428
145 Ga0068851_10005754 3300005834 Bacteria 5644
146 Ga0068863_100003910 3300005841 Bacteria 14712
147 Ga0068863_100058217 3300005841 Bacteria 3657
148 Ga0068860_100055521 3300005843 Bacteria 3765
149 Ga0068862_100126870 3300005844 Bacteria 2253
150 Ga0081455_10003206 3300005937 Bacteria 18939
151 Ga0081538_10007650 3300005981 Bacteria 9315
152 Ga0081540_1003133 3300005983 Bacteria 13221
153 Ga0081540_1003514 3300005983 Bacteria 12369
154 Ga0081539_10003759 3300005985 Bacteria 18004
155 Ga0070717_10120328 3300006028 Bacteria 2249
156 Ga0075368_10000428 3300006042 Bacteria 12424
157 Ga0075363_100002557 3300006048 Bacteria 7474
158 Ga0075364_10006874 3300006051 Bacteria 6715
159 Ga0070712_100004514 3300006175 Bacteria 8593
160 Ga0075367_10000343 3300006178 Bacteria 16566
161 Ga0075367_10056492 3300006178 Bacteria 2332
162 Ga0097621_100009194 3300006237 Bacteria 7166
163 Ga0097621_100019032 3300006237 Bacteria 5262
164 Ga0097621_100029715 3300006237 Bacteria 4319
165 Ga0097621_100084007 3300006237 Bacteria 2654
166 Ga0075370_10023289 3300006353 Bacteria 3409
167 Ga0068871_100055951 3300006358 Bacteria 3205
168 Ga0068871_100067460 3300006358 Bacteria 2935
169 Ga0068871_100117763 3300006358 Bacteria 2241
170 Ga0075428_100013889 3300006844 Bacteria 8968
171 Ga0075428_100015388 3300006844 Bacteria 8484
172 Ga0075428_100044000 3300006844 Bacteria 4908
173 Ga0075428_100081280 3300006844 Bacteria 3536
174 Ga0075428_100114611 3300006844 Bacteria 2936
175 Ga0075428_100141868 3300006844 Bacteria 2612
176 Ga0075431_100006638 3300006847 Bacteria 11491
177 Ga0075431_100183915 3300006847 Bacteria 2144
178 Ga0075433_10000045 3300006852 Bacteria 51204
179 Ga0075433_10012921 3300006852 Bacteria 6768
180 Ga0075434_100000014 3300006871 Bacteria 80310
181 Ga0075434_100035715 3300006871 Bacteria 4914
182 Ga0075434_100149194 3300006871 Bacteria 2358
183 Ga0075429_100009232 3300006880 Bacteria 8561
184 Ga0075429_100029737 3300006880 Bacteria 4746
185 Ga0068865_100008745 3300006881 Bacteria 6262
186 Ga0097620_100005614 3300006931 Bacteria 12783
187 Ga0097620_100084703 3300006931 Bacteria 3215
188 Ga0075435_100004145 3300007076 Bacteria 9936
189 Ga0075435_100071219 3300007076 Bacteria 2839
190 Ga0099795_10009302 3300007788 Bacteria 2845
191 Ga0105240_10002009 3300009093 Bacteria 33547
192 Ga0105240_10003096 3300009093 Bacteria 26156
193 Ga0105240_10071166 3300009093 Bacteria 4302
194 Ga0105240_10071421 3300009093 Bacteria 4293
195 Ga0105240_10082635 3300009093 Bacteria 3944
196 Ga0105240_10111444 3300009093 Bacteria 3310
197 Ga0105240_10149486 3300009093 Bacteria 2784
198 Ga0111539_10006379 3300009094 Bacteria 15213
199 Ga0111539_10010470 3300009094 Bacteria 11668
200 Ga0111539_10115319 3300009094 Bacteria 3151
201 Ga0111539_10233718 3300009094 Bacteria 2140
202 Ga0105245_10002145 3300009098 Bacteria 17871
203 Ga0105245_10009740 3300009098 Bacteria 8376
204 Ga0114129_10005646 3300009147 Bacteria 17708
205 Ga0114129_10008086 3300009147 Bacteria 14985
206 Ga0114129_10065995 3300009147 Bacteria 5048
207 Ga0114129_10257263 3300009147 Bacteria 2341
208 Ga0105243_10019893 3300009148 Bacteria 5091
209 Ga0105243_10029177 3300009148 Bacteria 4242
210 Ga0105243_10032071 3300009148 Bacteria 4056
211 Ga0105241_10005162 3300009174 Bacteria 9634
212 Ga0105241_10012748 3300009174 Bacteria 6168
213 Ga0105241_10032532 3300009174 Bacteria 3911
214 Ga0105241_10063574 3300009174 Bacteria 2848
215 Ga0105242_10016585 3300009176 Bacteria 5728
216 Ga0105248_10047454 3300009177 Bacteria 4816
217 Ga0105248_10053684 3300009177 Bacteria 4521
218 Ga0105237_10002350 3300009545 Bacteria 23518
219 Ga0105237_10008152 3300009545 Bacteria 11375
220 Ga0105237_10015439 3300009545 Bacteria 7949
221 Ga0105237_10033182 3300009545 Bacteria 5230
222 Ga0105237_10103535 3300009545 Bacteria 2838
223 Ga0105238_10000408 3300009551 Bacteria 45693
224 Ga0105238_10005614 3300009551 Bacteria 12397
225 Ga0099796_10002246 3300010159 Bacteria 4190
226 Ga0105239_10009835 3300010375 Bacteria 10744
227 Ga0157373_10000932 3300013100 Bacteria 22591
228 Ga0157373_10006363 3300013100 Bacteria 8820
229 Ga0157373_10022198 3300013100 Bacteria 4605
230 Ga0157373_10024396 3300013100 Bacteria 4381
231 Ga0157371_10000221 3300013102 Bacteria 83267
232 Ga0157370_10006437 3300013104 Bacteria 12957
233 Ga0157369_10000685 3300013105 Bacteria 43830
234 Ga0157369_10003494 3300013105 Bacteria 18658
235 Ga0157369_10004094 3300013105 Bacteria 17270
236 Ga0157369_10021093 3300013105 Bacteria 7282
237 Ga0157369_10050094 3300013105 Bacteria 4525
238 Ga0157369_10095468 3300013105 Bacteria 3173
239 Ga0157369_10159845 3300013105 Bacteria 2378
240 Ga0171462_1034 3300013250 Bacteria 85441
241 Ga0157374_10001774 3300013296 Bacteria 18148
242 Ga0157374_10002246 3300013296 Bacteria 16261
243 Ga0157374_10030972 3300013296 Bacteria 4858
244 Ga0157374_10111446 3300013296 Bacteria 2632
245 Ga0157374_10153429 3300013296 Bacteria 2240
246 Ga0157378_10002321 3300013297 Bacteria 16917
247 Ga0157378_10005007 3300013297 Bacteria 11625
248 Ga0157378_10018200 3300013297 Bacteria 6169
249 Ga0157378_10032559 3300013297 Bacteria 4606
250 Ga0163162_10000003 3300013306 Bacteria 698280
251 Ga0163162_10002786 3300013306 Bacteria 16611
252 Ga0163162_10006774 3300013306 Bacteria 11116
253 Ga0163162_10014356 3300013306 Bacteria 7741
254 Ga0163162_10139152 3300013306 Bacteria 2539
255 Ga0163162_10154283 3300013306 Bacteria 2415
256 Ga0163162_10168610 3300013306 Bacteria 2313
257 Ga0157372_10014377 3300013307 Bacteria 8464
258 Ga0157372_10036013 3300013307 Bacteria 5452
259 Ga0157372_10043861 3300013307 Bacteria 4955
260 Ga0157372_10060940 3300013307 Bacteria 4223
261 Ga0157372_10089521 3300013307 Bacteria 3497
262 Ga0157372_10116949 3300013307 Bacteria 3057
263 Ga0157372_10119531 3300013307 Bacteria 3025
264 Ga0157372_10173751 3300013307 Bacteria 2493
265 Ga0157375_10000187 3300013308 Bacteria 58157
266 Ga0157375_10002337 3300013308 Bacteria 16394
267 Ga0157375_10006693 3300013308 Bacteria 10037
268 Ga0157375_10037256 3300013308 Bacteria 4658
269 Ga0163163_10016100 3300014325 Bacteria 6936
270 Ga0163163_10022104 3300014325 Bacteria 6016
271 Ga0157380_10051083 3300014326 Bacteria 3268
272 Ga0157380_10109202 3300014326 Bacteria 2321
273 Ga0182008_10001734 3300014497 Bacteria 14317
274 Ga0157379_10002071 3300014968 Bacteria 16653
275 Ga0157376_10002637 3300014969 Bacteria 12201
276 Ga0157376_10008786 3300014969 Bacteria 7308
277 Ga0157376_10013053 3300014969 Bacteria 6187
278 Ga0157376_10019723 3300014969 Bacteria 5203
279 Ga0157376_10068798 3300014969 Bacteria 3000
280 Ga0182007_10003243 3300015262 Bacteria 7742
281 Ga0182005_1003229 3300015265 Bacteria 5572
282 Ga0163161_10067888 3300017792 Bacteria 2604
283 Ga0197907_10380380 3300020069 Bacteria 2262
284 Ga0206356_10784946 3300020070 Bacteria 1946
285 Ga0206356_11293394 3300020070 Bacteria 2753
286 Ga0206355_1226068 3300020076 Bacteria 1967
287 Ga0206352_10204954 3300020078 Bacteria 6443
288 Ga0206350_10435960 3300020080 Bacteria 4244
289 Ga0206350_11179710 3300020080 Bacteria 2185
290 Ga0206354_10968831 3300020081 Bacteria 2451
291 Ga0224712_10022092 3300022467 Bacteria 2188
292 Ga0209677_100369 3300025253 Bacteria 27555
293 Ga0209148_1000274 3300025254 Bacteria 81201
294 Ga0209455_1002264 3300025272 Bacteria 7570
295 Ga0209025_1002328 3300025294 Bacteria 20520
296 Ga0209564_1000023 3300025295 Bacteria 555102
297 Ga0209256_1000128 3300025299 Bacteria 163833
298 Ga0207426_1000598 3300025302 Bacteria 47559
299 Ga0207697_10021428 3300025315 Bacteria 2645
300 Ga0207656_10006700 3300025321 Bacteria 4159
301 Ga0207642_10001979 3300025899 Bacteria 6319
302 Ga0207688_10010093 3300025901 Bacteria 5136
303 Ga0207680_10074032 3300025903 Bacteria 2120
304 Ga0207699_10020361 3300025906 Bacteria 3554
305 Ga0207645_10007037 3300025907 Bacteria 8008
306 Ga0207645_10011990 3300025907 Bacteria 5895
307 Ga0207645_10025507 3300025907 Bacteria 3825
308 Ga0207645_10052568 3300025907 Bacteria 2603
309 Ga0207705_10096207 3300025909 Bacteria 2174
310 Ga0207684_10022621 3300025910 Bacteria 5366
311 Ga0207654_10011484 3300025911 Bacteria 4520
312 Ga0207707_10000126 3300025912 Bacteria 78954
313 Ga0207707_10002151 3300025912 Bacteria 17819
314 Ga0207707_10003761 3300025912 Bacteria 13449
315 Ga0207707_10003896 3300025912 Bacteria 13234
316 Ga0207707_10010718 3300025912 Bacteria 7963
317 Ga0207707_10041173 3300025912 Bacteria 4035
318 Ga0207695_10000015 3300025913 Bacteria 803205
319 Ga0207695_10021629 3300025913 Bacteria 7332
320 Ga0207695_10025608 3300025913 Bacteria 6599
321 Ga0207671_10007097 3300025914 Bacteria 9793
322 Ga0207671_10019093 3300025914 Bacteria 5251
323 Ga0207671_10112472 3300025914 Bacteria 2073
324 Ga0207693_10000589 3300025915 Bacteria 32554
325 Ga0207663_10001397 3300025916 Bacteria 11207
326 Ga0207660_10002234 3300025917 Bacteria 12798
327 Ga0207660_10008952 3300025917 Bacteria 6476
328 Ga0207660_10025203 3300025917 Bacteria 4035
329 Ga0207660_10056828 3300025917 Bacteria 2801
330 Ga0207657_10000261 3300025919 Bacteria 55977
331 Ga0207657_10000596 3300025919 Bacteria 38318
332 Ga0207657_10000821 3300025919 Bacteria 32805
333 Ga0207657_10014459 3300025919 Bacteria 7705
334 Ga0207657_10137726 3300025919 Bacteria 1996
335 Ga0207649_10006405 3300025920 Bacteria 6395
336 Ga0207649_10009926 3300025920 Bacteria 5218
337 Ga0207649_10062187 3300025920 Bacteria 2353
338 Ga0207652_10007822 3300025921 Bacteria 8584
339 Ga0207652_10012243 3300025921 Bacteria 6929
340 Ga0207652_10118624 3300025921 Bacteria 2352
341 Ga0207681_10015819 3300025923 Bacteria 4709
342 Ga0207681_10022455 3300025923 Bacteria 4025
343 Ga0207681_10032737 3300025923 Bacteria 3405
344 Ga0207694_10002220 3300025924 Bacteria 15932
345 Ga0207694_10004726 3300025924 Bacteria 10595
346 Ga0207694_10045696 3300025924 Bacteria 3383
347 Ga0207650_10003657 3300025925 Bacteria 10519
348 Ga0207650_10047792 3300025925 Bacteria 3154
349 Ga0207659_10002574 3300025926 Bacteria 10800
350 Ga0207659_10014368 3300025926 Bacteria 5104
351 Ga0207659_10043717 3300025926 Bacteria 3148
352 Ga0207659_10076642 3300025926 Bacteria 2459
353 Ga0207687_10001005 3300025927 Bacteria 19137
354 Ga0207687_10002597 3300025927 Bacteria 12262
355 Ga0207687_10007925 3300025927 Bacteria 6959
356 Ga0207687_10057206 3300025927 Bacteria 2738
357 Ga0207700_10003680 3300025928 Bacteria 8940
358 Ga0207700_10043983 3300025928 Bacteria 3284
359 Ga0207664_10018344 3300025929 Bacteria 5149
360 Ga0207644_10003083 3300025931 Bacteria 10727
361 Ga0207644_10007121 3300025931 Bacteria 7291
362 Ga0207644_10017480 3300025931 Bacteria 4844
363 Ga0207644_10043689 3300025931 Bacteria 3181
364 Ga0207690_10001205 3300025932 Bacteria 16328
365 Ga0207690_10008982 3300025932 Bacteria 5931
366 Ga0207706_10000074 3300025933 Bacteria 103144
367 Ga0207706_10004802 3300025933 Bacteria 12657
368 Ga0207706_10016672 3300025933 Bacteria 6630
369 Ga0207706_10146150 3300025933 Bacteria 2080
370 Ga0207686_10000342 3300025934 Bacteria 33514
371 Ga0207686_10001013 3300025934 Bacteria 16644
372 Ga0207686_10008067 3300025934 Bacteria 5681
373 Ga0207686_10011466 3300025934 Bacteria 4855
374 Ga0207709_10010227 3300025935 Bacteria 5168
375 Ga0207670_10015063 3300025936 Bacteria 4609
376 Ga0207670_10077777 3300025936 Bacteria 2312
377 Ga0207669_10008584 3300025937 Bacteria 4806
378 Ga0207704_10005242 3300025938 Bacteria 5972
379 Ga0207704_10006848 3300025938 Bacteria 5343
380 Ga0207704_10010238 3300025938 Bacteria 4564
381 Ga0207704_10015550 3300025938 Bacteria 3881
382 Ga0207704_10054131 3300025938 Bacteria 2444
383 Ga0207665_10024852 3300025939 Bacteria 3951
384 Ga0207665_10029745 3300025939 Bacteria 3609
385 Ga0207665_10054887 3300025939 Bacteria 2687
386 Ga0207691_10002268 3300025940 Bacteria 18840
387 Ga0207691_10003838 3300025940 Bacteria 14581
388 Ga0207691_10006478 3300025940 Bacteria 11306
389 Ga0207691_10012608 3300025940 Bacteria 8102
390 Ga0207691_10014367 3300025940 Bacteria 7548
391 Ga0207691_10026399 3300025940 Bacteria 5449
392 Ga0207691_10038344 3300025940 Bacteria 4435
393 Ga0207691_10050422 3300025940 Bacteria 3811
394 Ga0207691_10069760 3300025940 Bacteria 3175
395 Ga0207691_10094608 3300025940 Bacteria 2673
396 Ga0207711_10000157 3300025941 Bacteria 73266
397 Ga0207711_10009043 3300025941 Bacteria 8325
398 Ga0207711_10049236 3300025941 Bacteria 3608
399 Ga0207689_10001067 3300025942 Bacteria 26397
400 Ga0207661_10011440 3300025944 Bacteria 6430
401 Ga0207661_10016684 3300025944 Bacteria 5421
402 Ga0207661_10126659 3300025944 Bacteria 2182
403 Ga0207679_10003974 3300025945 Bacteria 9191
404 Ga0207679_10010306 3300025945 Bacteria 6014
405 Ga0207679_10021331 3300025945 Bacteria 4391
406 Ga0207679_10023460 3300025945 Bacteria 4220
407 Ga0207679_10032346 3300025945 Bacteria 3671
408 Ga0207667_10002291 3300025949 Bacteria 24060
409 Ga0207667_10005359 3300025949 Bacteria 15636
410 Ga0207667_10075529 3300025949 Bacteria 3499
411 Ga0207667_10092225 3300025949 Bacteria 3129
412 Ga0207667_10092814 3300025949 Bacteria 3118
413 Ga0207667_10119852 3300025949 Bacteria 2711
414 Ga0207667_10244383 3300025949 Bacteria 1836
415 Ga0207651_10000499 3300025960 Bacteria 16468
416 Ga0207651_10011198 3300025960 Bacteria 5009
417 Ga0207651_10028518 3300025960 Bacteria 3523
418 Ga0207651_10042466 3300025960 Bacteria 3026
419 Ga0207658_10005604 3300025986 Bacteria 8587
420 Ga0207677_10001200 3300026023 Bacteria 14049
421 Ga0207639_10013813 3300026041 Bacteria 5662
422 Ga0207639_10027184 3300026041 Bacteria 4164
423 Ga0207708_10000806 3300026075 Bacteria 23595
424 Ga0207708_10000850 3300026075 Bacteria 22983
425 Ga0207708_10010197 3300026075 Bacteria 6975
426 Ga0207708_10053405 3300026075 Bacteria 3079
427 Ga0207702_10002345 3300026078 Bacteria 18078
428 Ga0207702_10012439 3300026078 Bacteria 7084
429 Ga0207702_10033819 3300026078 Bacteria 4272
430 Ga0207702_10045703 3300026078 Bacteria 3684
431 Ga0207641_10005017 3300026088 Bacteria 11348
432 Ga0207641_10012757 3300026088 Bacteria 6890
433 Ga0207641_10048705 3300026088 Bacteria 3578
434 Ga0207641_10126097 3300026088 Bacteria 2292
435 Ga0207648_10002900 3300026089 Bacteria 18152
436 Ga0207648_10002986 3300026089 Bacteria 17877
437 Ga0207648_10013379 3300026089 Bacteria 7635
438 Ga0207648_10029560 3300026089 Bacteria 4859
439 Ga0207676_10000054 3300026095 Bacteria 128222
440 Ga0207674_10000084 3300026116 Bacteria 101302
441 Ga0207674_10074818 3300026116 Bacteria 3398
442 Ga0207675_100000430 3300026118 Bacteria 40671
443 Ga0207675_100018551 3300026118 Bacteria 6491
444 Ga0207675_100020525 3300026118 Bacteria 6159
445 Ga0207675_100067703 3300026118 Bacteria 3338
446 Ga0207675_100124027 3300026118 Bacteria 2446
447 Ga0207675_100240073 3300026118 Unclassified 1751
448 Ga0207683_10000492 3300026121 Bacteria 36479
449 Ga0207683_10013950 3300026121 Bacteria 6852
450 Ga0207683_10090489 3300026121 Bacteria 2725
451 Ga0207698_10010802 3300026142 Bacteria 5890
452 Ga0207698_10022413 3300026142 Bacteria 4388
453 Ga0207698_10029927 3300026142 Bacteria 3907
454 Ga0207698_10066523 3300026142 Bacteria 2837
455 Ga0209969_1002196 3300027360 Bacteria 2688
456 Ga0209996_1002284 3300027395 Bacteria 2366
457 Ga0209968_1001505 3300027526 Bacteria 3544
458 Ga0209982_1002111 3300027552 Bacteria 2764
459 Ga0209970_1004448 3300027614 Bacteria 2328
460 Ga0210002_1000255 3300027617 Bacteria 7615
461 Ga0209983_1001474 3300027665 Bacteria 5228
462 Ga0209983_1002433 3300027665 Bacteria 4077
463 Ga0209588_1012263 3300027671 Bacteria 2599
464 Ga0209971_1000009 3300027682 Bacteria 101488
465 Ga0209966_1000125 3300027695 Bacteria 33588
466 Ga0209998_10000047 3300027717 Bacteria 50238
467 Ga0209813_10002462 3300027866 Bacteria 4239
468 Ga0209974_10001404 3300027876 Bacteria 8708
469 Ga0209974_10002285 3300027876 Bacteria 6959
470 Ga0207428_10019525 3300027907 Bacteria 5776
471 Ga0268266_10003458 3300028379 Bacteria 15754
472 Ga0268266_10005821 3300028379 Bacteria 11410
473 Ga0268265_10026927 3300028380 Bacteria 4096
474 Ga0268264_10001476 3300028381 Bacteria 21939
475 Ga0268264_10112325 3300028381 Bacteria 2389
476 Ga0265338_10017055 3300028800 Bacteria 7853
477 Ga0265339_10010845 3300031249 Bacteria 5637
478 Ga0307408_100033723 3300031548 Bacteria 3579
479 Ga0307408_100034480 3300031548 Bacteria 3546
480 Ga0307405_10004741 3300031731 Bacteria 6475
481 Ga0307405_10050494 3300031731 Bacteria 2576
482 Ga0307413_10028407 3300031824 Bacteria 3115
483 Ga0307410_10001696 3300031852 Bacteria 10146
484 Ga0307406_10016372 3300031901 Bacteria 4308
485 Ga0307407_10003024 3300031903 Bacteria 6764
486 Ga0307412_10061541 3300031911 Bacteria 2524
487 Ga0307409_100002813 3300031995 Bacteria 9202
488 Ga0307409_100096994 3300031995 Bacteria 2434
489 Ga0307409_100146331 3300031995 Bacteria 2044
490 Ga0307409_100174111 3300031995 Bacteria 1897
491 Ga0307416_100003810 3300032002 Bacteria 8960
492 Ga0307416_100080094 3300032002 Bacteria 2755
493 Ga0307411_10000915 3300032005 Bacteria 11221
494 Ga0307510_10002057 3300033180 Bacteria 22728
495 Ga0315911_1000002 3300033442 Bacteria 926833
496 Ga0373950_0000004 3300034818 Bacteria 527382
497 Ga0373928_0014678 3300035084 Bacteria 1587
498 Ga0373934_0001038 3300035086 Bacteria 10021
499 Ga0373934_0002734 3300035086 Bacteria 6477
500 Ga0373934_0010611 3300035086 Bacteria 3459
501 Ga0373934_0020770 3300035086 Bacteria 2526
502 Ga0373953_0036209 3300035117 Bacteria 1943
503 Ga0373954_0000128 3300035118 Bacteria 25913
504 Ga0373954_0000493 3300035118 Bacteria 14821
505 Ga0373956_0015558 3300035119 Bacteria 3187
506 Ga0373943_0030289 3300035170 Bacteria 2560
507 Ga0373955_0002077 3300035172 Bacteria 8633
508 Ga0373931_0003093 3300035691 Bacteria 7443
509 Ga0373935_0035720 3300035692 Bacteria 3103
510 Ga0373933_0001000 3300035724 Bacteria 17250
511 Ga0373933_0001768 3300035724 Bacteria 12506
512 Ga0373933_0002421 3300035724 Bacteria 10529
513 Ga0373947_0040953 3300035725 Bacteria 2761
514 Ga0373937_0003233 3300036401 Bacteria 13655
515 Ga0373937_0006557 3300036401 Bacteria 10054
516 Ga0373937_0009073 3300036401 Bacteria 8631
517 Ga0373937_0009564 3300036401 Bacteria 8434
518 Ga0373937_0012074 3300036401 Bacteria 7581
519 Ga0373937_0020254 3300036401 Bacteria 5962
520 Ga0373937_0022329 3300036401 Bacteria 5689
521 Ga0373937_0043322 3300036401 Bacteria 4107
522 Ga0373925_0108187 3300037068 Bacteria 2145
523 Ga0395899_0016911 3300037312 Bacteria 5559
524 Ga0395899_0058489 3300037312 Bacteria 2843
525 Ga0395900_0036729 3300037418 Bacteria 5050
526 Ga0395900_0039923 3300037418 Bacteria 4837
527 Ga0395900_0085466 3300037418 Bacteria 3242
528 Ga0395900_0127850 3300037418 Bacteria 2605
529 Ga0395898_0128242 3300037466 Bacteria 2430
530 Ga0395901_0029678 3300038443 Bacteria 5631
531 Ga0436360_1016720 3300039438 Bacteria 2610
532 Ga0436360_1099428 3300039438 Bacteria 5248
533 Ga0436363_1339296 3300039450 Bacteria 15991
534 Ga0439448_0017551 3300042005 Bacteria 2186
535 Ga0439435_0000452 3300042436 Bacteria 6456
536 Ga0439464_0000278 3300042439 Bacteria 9611
537 Ga0451577_0012128 3300042876 Bacteria 8107
538 Ga0451577_0069457 3300042876 Bacteria 3141
539 Ga0453683_0016414 3300044673 Bacteria 4778
540 Ga0451576_0021579 3300045051 Bacteria 6999
541 Ga0495590_0036535 3300046457 Bacteria 1714
542 Ga0495629_0055551 3300046459 Bacteria 2768
543 Ga0495638_0005958 3300046460 Bacteria 8945
544 Ga0495651_0004773 3300046462 Bacteria 10373
545 Ga0495651_0010804 3300046462 Bacteria 7018
546 Ga0495651_0050496 3300046462 Bacteria 3208
547 Ga0495651_0124773 3300046462 Bacteria 1886
548 Ga0495653_0084118 3300046463 Bacteria 2344
549 Ga0495653_0095444 3300046463 Bacteria 2165
550 Ga0495582_0000764 3300046473 Bacteria 17782
551 Ga0495662_0002087 3300046476 Bacteria 10022
552 Ga0495662_0048790 3300046476 Bacteria 2044
553 Ga0495584_0016121 3300046491 Bacteria 3812
554 Ga0495585_0008846 3300046492 Bacteria 6077
555 Ga0495594_0047002 3300046499 Bacteria 2370
556 Ga0495594_0060106 3300046499 Bacteria 2102
557 Ga0495606_0006293 3300046507 Bacteria 11004
558 Ga0495606_0022584 3300046507 Bacteria 4578
559 Ga0495606_0074514 3300046507 Bacteria 2126
560 Ga0495608_0034348 3300046511 Bacteria 3424
561 Ga0495608_0040779 3300046511 Bacteria 3109
562 Ga0495608_0047235 3300046511 Bacteria 2862
563 Ga0495620_0025561 3300046515 Bacteria 2791
564 Ga0495630_0000001 3300046517 Bacteria 1687293
565 Ga0495630_0007013 3300046517 Bacteria 8032
566 Ga0495631_0023956 3300046518 Bacteria 2824
567 Ga0495643_0003854 3300046522 Bacteria 10798
568 Ga0495586_0015659 3300046535 Bacteria 4035
569 Ga0495587_0003660 3300046536 Bacteria 10234
570 Ga0495587_0046712 3300046536 Bacteria 2569
571 Ga0495598_0002310 3300046537 Bacteria 3921
572 Ga0495645_0019365 3300046543 Bacteria 4899
573 Ga0495667_0002542 3300046559 Bacteria 12178
574 Ga0495667_0005025 3300046559 Bacteria 8939
575 Ga0495667_0021596 3300046559 Bacteria 4343
576 Ga0495656_0019344 3300046615 Bacteria 2628
577 Ga0495668_0030109 3300046616 Bacteria 3066
578 Ga0495668_0064029 3300046616 Bacteria 2025
579 Ga0495625_0112980 3300046660 Bacteria 1855
580 Ga0495635_0049589 3300046663 Bacteria 2893
581 Ga0495635_0051579 3300046663 Bacteria 2834
582 Ga0495661_0038485 3300046665 Bacteria 2979
583 Ga0495657_0051197 3300046675 Bacteria 2773
584 Ga0495599_0028643 3300046678 Bacteria 3490
585 Ga0495623_0048001 3300046679 Bacteria 2709
586 Ga0495623_0065837 3300046679 Bacteria 2265
587 Ga0495613_0044355 3300046689 Bacteria 3290
588 Ga0495581_0083315 3300047315 Bacteria 1852
589 Ga0495604_0001655 3300047317 Bacteria 18324
590 Ga0495604_0058062 3300047317 Bacteria 2973
591 Ga0495674_0014701 3300047319 Bacteria 7325
592 Ga0495674_0119231 3300047319 Bacteria 2230
593 Ga0495675_0006140 3300047444 Bacteria 7358
594 Ga0495684_0002042 3300047471 Bacteria 16246
595 Ga0495684_0003890 3300047471 Bacteria 11633
596 Ga0495684_0074111 3300047471 Bacteria 2586
597 Ga0495684_0113864 3300047471 Bacteria 2039
598 Ga0495686_0081486 3300047472 Bacteria 1976
599 Ga0495593_0006970 3300047673 Bacteria 6623
600 Ga0495602_0014795 3300048088 Bacteria 7902
601 Ga0496100_0022742 3300048903 Bacteria 3797
602 Ga0496101_0008040 3300048904 Bacteria 6876
603 Ga0496101_0031087 3300048904 Bacteria 3750
604 Ga0496101_0085910 3300048904 Unclassified 2332
605 Ga0496102_0017251 3300048905 Bacteria 6323
606 Ga0496103_0015676 3300048906 Bacteria 4518
607 Ga0496104_0000011 3300048907 Bacteria 459358
608 Ga0496104_0003162 3300048907 Bacteria 14174
609 Ga0496104_0077923 3300048907 Bacteria 3158
610 Ga0496105_0000014 3300048908 Bacteria 220911
611 Ga0496105_0008988 3300048908 Bacteria 7794
612 Ga0496106_0003590 3300048909 Bacteria 11563
613 Ga0496106_0014750 3300048909 Bacteria 5777
614 Ga0496106_0018996 3300048909 Bacteria 5094
615 Ga0496107_0011333 3300048910 Bacteria 6205
616 Ga0496107_0030480 3300048910 Bacteria 3845
617 Ga0496107_0046080 3300048910 Bacteria 3138
618 Ga0496108_0001362 3300048911 Bacteria 19210
619 Ga0496109_0004451 3300048912 Bacteria 11701
620 Ga0496109_0006154 3300048912 Bacteria 10087
621 Ga0496109_0067323 3300048912 Bacteria 3280
622 Ga0496111_0001111 3300048914 Bacteria 14909
623 Ga0496112_0001433 3300048915 Bacteria 18299
624 Ga0496112_0027792 3300048915 Bacteria 5457
625 Ga0496112_0049418 3300048915 Bacteria 4123
626 Ga0496112_0097163 3300048915 Bacteria 2916
627 Ga0496112_0121431 3300048915 Bacteria 2583
628 Ga0496113_0001251 3300048916 Bacteria 13990
629 Ga0496113_0163284 3300048916 Bacteria 1762
630 Ga0496114_0000605 3300048917 Bacteria 26516
631 Ga0496115_0004711 3300048918 Bacteria 9892
632 Ga0496115_0021418 3300048918 Bacteria 4994
633 Ga0496118_0006767 3300048921 Bacteria 12467
634 Ga0496121_0027871 3300048924 Bacteria 5275
635 Ga0496124_0036705 3300048927 Bacteria 4271
636 Ga0496126_0037232 3300048929 Bacteria 4542
637 Ga0496126_0068448 3300048929 Bacteria 3170
638 Ga0496126_0089746 3300048929 Unclassified 2705
639 Ga0496126_0107717 3300048929 Bacteria 2430
640 Ga0501033_0012779 3300049570 Bacteria 6402
641 Ga0501034_0019802 3300049571 Bacteria 6876
642 Ga0501034_0091799 3300049571 Bacteria 3034
643 Ga0501036_0003473 3300049572 Bacteria 12596
644 Ga0501036_0017501 3300049572 Bacteria 5993
645 Ga0501036_0061746 3300049572 Bacteria 3174
646 Ga0501036_0068608 3300049572 Bacteria 3000
647 Ga0501037_0030911 3300049573 Bacteria 3955
648 Ga0501038_0002013 3300049574 Bacteria 18771
649 Ga0501038_0131447 3300049574 Bacteria 2055
650 Ga0501039_0019011 3300049575 Bacteria 5273
651 Ga0501039_0026867 3300049575 Bacteria 4424
652 Ga0501039_0096725 3300049575 Bacteria 2302
653 Ga0501039_0098805 3300049575 Bacteria 2277
654 Ga0501040_0000723 3300049576 Bacteria 20393
655 Ga0501040_0000999 3300049576 Bacteria 17899
656 Ga0501040_0020551 3300049576 Bacteria 4401
657 Ga0501040_0038713 3300049576 Bacteria 3241
658 Ga0501041_0000056 3300049577 Bacteria 40879
659 Ga0501041_0003865 3300049577 Bacteria 8618
660 Ga0501041_0033269 3300049577 Bacteria 3118
661 Ga0501042_0001793 3300049578 Bacteria 12844
662 Ga0501042_0079205 3300049578 Bacteria 2353
663 Ga0501042_0087351 3300049578 Bacteria 2237
664 Ga0501042_0095105 3300049578 Bacteria 2140
665 Ga0501043_0041938 3300049579 Bacteria 3595
666 Ga0501043_0110221 3300049579 Bacteria 2161
667 Ga0501046_0000308 3300049580 Bacteria 49533
668 Ga0501046_0008050 3300049580 Bacteria 9214
669 Ga0501046_0115879 3300049580 Bacteria 2043
670 Ga0501047_0027549 3300049581 Bacteria 5475
671 Ga0501047_0042761 3300049581 Bacteria 4377
672 Ga0501047_0043135 3300049581 Bacteria 4357
673 Ga0501047_0055629 3300049581 Bacteria 3826
674 Ga0501048_0003052 3300049582 Bacteria 12759
675 Ga0501048_0061790 3300049582 Bacteria 2652
676 Ga0501048_0071828 3300049582 Bacteria 2443
677 Ga0501067_0000047 3300049583 Bacteria 71799
678 Ga0501067_0004765 3300049583 Bacteria 7514
679 Ga0501068_0038906 3300049584 Bacteria 2850
680 Ga0501069_0012595 3300049585 Bacteria 4498
681 Ga0501069_0026725 3300049585 Bacteria 3161
682 Ga0501070_0000004 3300049586 Bacteria 254956
683 Ga0501070_0003413 3300049586 Bacteria 13775
684 Ga0501070_0042848 3300049586 Bacteria 3769
685 Ga0501071_0000181 3300049587 Bacteria 27971
686 Ga0501071_0020444 3300049587 Bacteria 4601
687 Ga0501072_0002081 3300049588 Bacteria 14893
688 Ga0501072_0002955 3300049588 Bacteria 12802
689 Ga0501072_0045364 3300049588 Bacteria 3456
690 Ga0501073_0000116 3300049589 Bacteria 51190
691 Ga0501073_0001796 3300049589 Bacteria 15963
692 Ga0501073_0002310 3300049589 Bacteria 14268
693 Ga0501073_0055121 3300049589 Bacteria 2782
694 Ga0501074_0010501 3300049590 Bacteria 6721
695 Ga0501074_0039374 3300049590 Bacteria 3424
696 Ga0501074_0051281 3300049590 Bacteria 2978
697 Ga0501074_0098150 3300049590 Bacteria 2097
698 Ga0501075_0000781 3300049591 Bacteria 19885
699 Ga0501075_0027282 3300049591 Bacteria 4208
700 Ga0501075_0089627 3300049591 Bacteria 2332
701 Ga0501076_0000164 3300049592 Bacteria 38475
702 Ga0501076_0017555 3300049592 Bacteria 5440
703 Ga0501077_0000214 3300049593 Bacteria 33816
704 Ga0501077_0065327 3300049593 Bacteria 2307
705 Ga0501079_0002624 3300049741 Bacteria 13071
706 Ga0501079_0034966 3300049741 Bacteria 3866
707 Ga0501080_0009120 3300049742 Bacteria 9031
708 Ga0501080_0068992 3300049742 Bacteria 3288
709 Ga0501080_0080503 3300049742 Bacteria 3027
710 Ga0501081_0000077 3300049743 Bacteria 38611
711 Ga0501081_0001401 3300049743 Bacteria 14718
712 Ga0501083_0014521 3300049744 Bacteria 5507
713 Ga0501083_0032970 3300049744 Bacteria 3548
714 Ga0501083_0033459 3300049744 Bacteria 3520
715 Ga0501083_0040862 3300049744 Bacteria 3147
716 Ga0501035_0011181 3300049822 Bacteria 8312
717 Ga0501044_0013237 3300049823 Bacteria 8931
718 Ga0501045_0000175 3300049824 Bacteria 35180
719 Ga0501045_0036296 3300049824 Bacteria 3579
720 Ga0501045_0095911 3300049824 Bacteria 2194
721 nmdc:mga0yw44_25663_c1 3300050492 Bacteria 3355
722 nmdc:mga0yw44_27104_c1 3300050492 Bacteria 3279
723 nmdc:mga06z11_1398_c1 3300050494 Bacteria 8965
724 nmdc:mga04h51_2684_c1 3300050495 Bacteria 4239
725 nmdc:mga07m45_36246_c2 3300050496 Bacteria 2322
726 nmdc:mga05p37_2020_c1 3300050507 Bacteria 23672
727 nmdc:mga05p37_212017_c1 3300050507 Bacteria 2341
728 nmdc:mga05p37_40526_c1 3300050507 Bacteria 5720
729 nmdc:mga05p37_5476_c1 3300050507 Bacteria 14906
730 nmdc:mga09592_5547_c1 3300050508 Bacteria 10269
731 nmdc:mga0qj67_181597_c1 3300050509 Bacteria 1709
732 nmdc:mga06r32_109493_c1 3300050510 Bacteria 2717
733 nmdc:mga06r32_44260_c2 3300050510 Bacteria 2718
734 nmdc:mga06r32_4814_c1 3300050510 Bacteria 12152
735 nmdc:mga08y16_145067_c1 3300050511 Bacteria 2468
736 nmdc:mga08y16_153247_c1 3300050511 Bacteria 2395
737 nmdc:mga08y16_181085_c1 3300050511 Bacteria 2188
738 nmdc:mga08y16_325253_c1 3300050511 Bacteria 1582
739 nmdc:mga08y16_3958_c1 3300050511 Bacteria 15428
740 nmdc:mga08y16_47265_c1 3300050511 Bacteria 4504
741 nmdc:mga0n895_21683_c1 3300050512 Bacteria 6012
742 nmdc:mga0n895_34586_c1 3300050512 Bacteria 4865
743 nmdc:mga0n895_520_c1 3300050512 Bacteria 26193
744 nmdc:mga0rr50_105793_c1 3300050513 Bacteria 2219
745 nmdc:mga0rr50_41745_c1 3300050513 Bacteria 3345
746 nmdc:mga0rr50_65178_c1 3300050513 Bacteria 2758
747 nmdc:mga0a205_344_c1 3300050515 Bacteria 35080
748 nmdc:mga0a205_67881_c1 3300050515 Bacteria 3444
749 nmdc:mga0a205_79984_c1 3300050515 Bacteria 3158
750 nmdc:mga0sz30_39604_c1 3300050516 Bacteria 1978
751 Ga0495601_0017121 3300053077 Bacteria 4398
752 Ga0495601_0055372 3300053077 Bacteria 2511
753 Ga0495595_0006034 3300053084 Bacteria 4924
754 Ga0495595_0012285 3300053084 Bacteria 3596
755 Ga0495619_0009996 3300053085 Bacteria 5975
756 Ga0495619_0035508 3300053085 Bacteria 3242
757 Ga0500651_0020089 3300053093 Bacteria 4156
758 Ga0500641_0010728 3300053096 Bacteria 3318
759 Ga0500562_002576 3300053108 Bacteria 4518
760 Ga0500569_004620 3300053109 Bacteria 2905
761 Ga0500595_016042 3300053119 Bacteria 2797
762 Ga0500622_0004599 3300053156 Bacteria 8578
763 Ga0500599_002793 3300053736 Bacteria 2110
764 Ga0501084_0002013 3300054114 Bacteria 16235
765 Ga0501084_0004719 3300054114 Bacteria 11134
766 Ga0501084_0095650 3300054114 Bacteria 2495
767 Ga0501084_0096375 3300054114 Bacteria 2485
768 Ga0590071_014223 3300059421 Bacteria 1866
769 Ga0587066_000021 3300059490 Bacteria 7155
770 Ga0587070_000288 3300059491 Bacteria 3763
771 Ga0587082_000047 3300059504 Bacteria 6105
772 Ga0587088_000091 3300059508 Bacteria 4924
773 Ga0587092_000171 3300059512 Bacteria 4226
774 Ga0587067_000080 3300059640 Bacteria 5744
775 Ga0587071_000045 3300060344 Bacteria 7142
776 Ga0501082_0001219 3300060353 Bacteria 22593
777 Ga0501082_0002918 3300060353 Bacteria 14920
778 Ga0501082_0009373 3300060353 Bacteria 8432
779 Ga0501082_0012080 3300060353 Bacteria 7421
780 Ga0501082_0028888 3300060353 Bacteria 4777
781 Ga0530510_0000438 3300061734 Bacteria 26867
782 Ga0530510_0023838 3300061734 Bacteria 4363

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_181597_c1 nmdc:mga0qj67_181597_c1_309_1688 456
2 3300035086 Ga0373934_0020770 Ga0373934_0020770_1040_2503 458
3 3300048929 Ga0496126_0068448 Ga0496126_0068448_17_1432 459
4 3300026118 Ga0207675_100240073 Ga0207675_1002400732 463
5 3300050511 nmdc:mga08y16_325253_c1 nmdc:mga08y16_325253_c1_25_1431 465
6 3300046462 Ga0495651_0124773 Ga0495651_0124773_417_1853 468
7 3300048904 Ga0496101_0085910 Ga0496101_0085910_55_1503 474
8 3300049744 Ga0501083_0014521 Ga0501083_0014521_37_1521 475
9 3300049579 Ga0501043_0110221 Ga0501043_0110221_669_2126 477
10 3300009093 Ga0105240_10111444 Ga0105240_101114441 481
11 3300048929 Ga0496126_0089746 Ga0496126_0089746_47_1570 498
12 3300009093 Ga0105240_10071421 Ga0105240_100714212 504
13 3300009551 Ga0105238_10005614 Ga0105238_100056148 504
14 3300025924 Ga0207694_10004726 Ga0207694_100047266 504
15 3300005354 Ga0070675_100102579 Ga0070675_1001025792 505
16 3300025944 Ga0207661_10126659 Ga0207661_101266592 505
17 3300050511 nmdc:mga08y16_47265_c1 nmdc:mga08y16_47265_c1_2090_3772 505
18 3300013296 Ga0157374_10153429 Ga0157374_101534292 506
19 3300049586 Ga0501070_0042848 Ga0501070_0042848_236_1864 507
20 3300035084 Ga0373928_0014678 Ga0373928_0014678_39_1574 508
21 3300049570 Ga0501033_0012779 Ga0501033_0012779_3203_4885 512
22 3300049572 Ga0501036_0003473 Ga0501036_0003473_2343_4025 512
23 3300049574 Ga0501038_0002013 Ga0501038_0002013_3931_5613 512
24 3300049575 Ga0501039_0026867 Ga0501039_0026867_2217_3899 512
25 3300049576 Ga0501040_0000999 Ga0501040_0000999_14735_16417 512
26 3300049577 Ga0501041_0000056 Ga0501041_0000056_30542_32224 512
27 3300049578 Ga0501042_0001793 Ga0501042_0001793_7016_8698 512
28 3300049580 Ga0501046_0008050 Ga0501046_0008050_370_2052 512
29 3300049582 Ga0501048_0003052 Ga0501048_0003052_9658_11340 512
30 3300049587 Ga0501071_0000181 Ga0501071_0000181_5205_6887 512
31 3300049588 Ga0501072_0002955 Ga0501072_0002955_1108_2790 512
32 3300049590 Ga0501074_0039374 Ga0501074_0039374_1415_3097 512
33 3300049591 Ga0501075_0000781 Ga0501075_0000781_13943_15625 512
34 3300049592 Ga0501076_0000164 Ga0501076_0000164_6299_7981 512
35 3300049593 Ga0501077_0000214 Ga0501077_0000214_31452_33134 512
36 3300049741 Ga0501079_0002624 Ga0501079_0002624_8198_9880 512
37 3300049742 Ga0501080_0009120 Ga0501080_0009120_7339_9021 512
38 3300049743 Ga0501081_0000077 Ga0501081_0000077_30036_31718 512
39 3300049744 Ga0501083_0040862 Ga0501083_0040862_307_1989 512
40 3300049822 Ga0501035_0011181 Ga0501035_0011181_5377_7059 512
41 3300054114 Ga0501084_0004719 Ga0501084_0004719_8742_10424 512
42 3300060353 Ga0501082_0001219 Ga0501082_0001219_14792_16474 512
43 3300061734 Ga0530510_0000438 Ga0530510_0000438_7911_9593 512
44 3300048915 Ga0496112_0027792 Ga0496112_0027792_2370_4022 516
45 3300005548 Ga0070665_100022014 Ga0070665_1000220147 522
46 3300014969 Ga0157376_10019723 Ga0157376_100197232 522
47 3300028379 Ga0268266_10003458 Ga0268266_1000345811 522
48 3300049574 Ga0501038_0131447 Ga0501038_0131447_87_1700 523
49 3300049575 Ga0501039_0019011 Ga0501039_0019011_2284_3897 523
50 3300049578 Ga0501042_0095105 Ga0501042_0095105_476_2089 523
51 3300049587 Ga0501071_0020444 Ga0501071_0020444_607_2220 523
52 3300049592 Ga0501076_0017555 Ga0501076_0017555_2439_4052 523
53 3300049824 Ga0501045_0036296 Ga0501045_0036296_235_1848 523
54 iso_pu_bacteria 2929921140 2929926546 523
55 3300005543 Ga0070672_100039589 Ga0070672_1000395893 524
56 3300013306 Ga0163162_10154283 Ga0163162_101542831 524
57 3300025923 Ga0207681_10022455 Ga0207681_100224552 524
58 3300025940 Ga0207691_10038344 Ga0207691_100383442 524
59 3300026118 Ga0207675_100020525 Ga0207675_1000205252 524
60 3300039438 Ga0436360_1016720 Ga0436360_1016720_724_2346 524
61 3300042436 Ga0439435_0000452 Ga0439435_0000452_3903_5534 524
62 3300049571 Ga0501034_0019802 Ga0501034_0019802_4665_6398 524
63 3300049573 Ga0501037_0030911 Ga0501037_0030911_470_2092 524
64 3300049582 Ga0501048_0071828 Ga0501048_0071828_696_2429 524
65 3300049583 Ga0501067_0004765 Ga0501067_0004765_1492_3225 524
66 3300049584 Ga0501068_0038906 Ga0501068_0038906_134_1867 524
67 3300049585 Ga0501069_0026725 Ga0501069_0026725_48_1670 524
68 3300049589 Ga0501073_0002310 Ga0501073_0002310_7333_9066 524
69 3300049744 Ga0501083_0032970 Ga0501083_0032970_479_2212 524
70 3300060353 Ga0501082_0028888 Ga0501082_0028888_715_2448 524
71 3300046517 Ga0495630_0007013 Ga0495630_0007013_5525_7165 525
72 3300046535 Ga0495586_0015659 Ga0495586_0015659_444_2084 525
73 3300046663 Ga0495635_0051579 Ga0495635_0051579_126_1775 525
74 3300047319 Ga0495674_0014701 Ga0495674_0014701_5501_7141 525
75 3300049575 Ga0501039_0098805 Ga0501039_0098805_329_2047 525
76 3300049576 Ga0501040_0038713 Ga0501040_0038713_321_2039 525
77 3300049590 Ga0501074_0098150 Ga0501074_0098150_146_1864 525
78 3300053077 Ga0495601_0055372 Ga0495601_0055372_809_2449 525
79 3300061734 Ga0530510_0023838 Ga0530510_0023838_2248_3966 525
80 3300046522 Ga0495643_0003854 Ga0495643_0003854_5594_7222 526
81 3300048915 Ga0496112_0097163 Ga0496112_0097163_482_2095 526
82 3300049585 Ga0501069_0012595 Ga0501069_0012595_31_1659 526
83 3300053096 Ga0500641_0010728 Ga0500641_0010728_13_1701 526
84 3300034818 Ga0373950_0000004 Ga0373950_0000004_372205_373914 527
85 3300035086 Ga0373934_0001038 Ga0373934_0001038_80_1723 527
86 3300036401 Ga0373937_0009564 Ga0373937_0009564_4822_6465 527
87 3300046462 Ga0495651_0004773 Ga0495651_0004773_460_2103 527
88 3300049572 Ga0501036_0017501 Ga0501036_0017501_4017_5669 527
89 3300049583 Ga0501067_0000047 Ga0501067_0000047_65039_66736 527
90 3300049589 Ga0501073_0000116 Ga0501073_0000116_42025_43722 527
91 3300049590 Ga0501074_0010501 Ga0501074_0010501_4174_5799 527
92 iso_pu_bacteria 2929177148 2929179244 527
93 iso_pu_bacteria 2945977869 2945981649 527
94 iso_pu_bacteria 2946013367 2946018948 527
95 3300003320 rootH2_10007600 rootH2_100076009 528
96 3300005339 Ga0070660_100033219 Ga0070660_1000332192 528
97 3300005344 Ga0070661_100033996 Ga0070661_1000339962 528
98 3300005355 Ga0070671_100026958 Ga0070671_1000269582 528
99 3300005367 Ga0070667_100050429 Ga0070667_1000504292 528
100 3300005458 Ga0070681_10076439 Ga0070681_100764392 528
101 3300005539 Ga0068853_100123661 Ga0068853_1001236611 528
102 3300006844 Ga0075428_100044000 Ga0075428_1000440002 528
103 3300006847 Ga0075431_100006638 Ga0075431_1000066383 528
104 3300006852 Ga0075433_10012921 Ga0075433_100129212 528
105 3300006871 Ga0075434_100149194 Ga0075434_1001491942 528
106 3300006880 Ga0075429_100009232 Ga0075429_1000092322 528
107 3300007076 Ga0075435_100071219 Ga0075435_1000712192 528
108 3300009093 Ga0105240_10071166 Ga0105240_100711663 528
109 3300009094 Ga0111539_10010470 Ga0111539_100104707 528
110 3300009147 Ga0114129_10005646 Ga0114129_100056468 528
111 3300009174 Ga0105241_10032532 Ga0105241_100325322 528
112 3300009177 Ga0105248_10053684 Ga0105248_100536842 528
113 3300009545 Ga0105237_10015439 Ga0105237_100154393 528
114 3300010375 Ga0105239_10009835 Ga0105239_100098352 528
115 3300013100 Ga0157373_10024396 Ga0157373_100243962 528
116 3300013296 Ga0157374_10030972 Ga0157374_100309722 528
117 3300013297 Ga0157378_10032559 Ga0157378_100325592 528
118 3300014497 Ga0182008_10001734 Ga0182008_100017342 528
119 3300014969 Ga0157376_10008786 Ga0157376_100087865 528
120 3300015262 Ga0182007_10003243 Ga0182007_100032432 528
121 3300015265 Ga0182005_1003229 Ga0182005_10032293 528
122 3300020070 Ga0206356_11293394 Ga0206356_112933942 528
123 3300020078 Ga0206352_10204954 Ga0206352_102049542 528
124 3300020080 Ga0206350_10435960 Ga0206350_104359602 528
125 3300025919 Ga0207657_10000821 Ga0207657_1000082126 528
126 3300025920 Ga0207649_10009926 Ga0207649_100099262 528
127 3300025932 Ga0207690_10008982 Ga0207690_100089823 528
128 3300025941 Ga0207711_10049236 Ga0207711_100492362 528
129 3300025949 Ga0207667_10119852 Ga0207667_101198522 528
130 3300026088 Ga0207641_10126097 Ga0207641_101260972 528
131 3300027907 Ga0207428_10019525 Ga0207428_100195254 528
132 3300035086 Ga0373934_0002734 Ga0373934_0002734_2697_4346 528
133 3300035724 Ga0373933_0002421 Ga0373933_0002421_7043_8692 528
134 3300036401 Ga0373937_0022329 Ga0373937_0022329_2208_3857 528
135 3300046462 Ga0495651_0010804 Ga0495651_0010804_5024_6673 528
136 3300046463 Ga0495653_0095444 Ga0495653_0095444_365_2014 528
137 3300046499 Ga0495594_0047002 Ga0495594_0047002_490_2139 528
138 3300046536 Ga0495587_0046712 Ga0495587_0046712_780_2429 528
139 3300046679 Ga0495623_0048001 Ga0495623_0048001_16_1665 528
140 3300047317 Ga0495604_0001655 Ga0495604_0001655_1035_2684 528
141 3300047471 Ga0495684_0074111 Ga0495684_0074111_16_1665 528
142 3300047471 Ga0495684_0113864 Ga0495684_0113864_307_1950 528
143 3300048088 Ga0495602_0014795 Ga0495602_0014795_2068_3717 528
144 3300048909 Ga0496106_0018996 Ga0496106_0018996_2452_4101 528
145 3300048912 Ga0496109_0067323 Ga0496109_0067323_843_2492 528
146 3300049586 Ga0501070_0000004 Ga0501070_0000004_186774_188408 528
147 3300049742 Ga0501080_0068992 Ga0501080_0068992_473_2107 528
148 3300050507 nmdc:mga05p37_2020_c1 nmdc:mga05p37_2020_c1_2778_4403 528
149 3300050508 nmdc:mga09592_5547_c1 nmdc:mga09592_5547_c1_2154_3779 528
150 3300050510 nmdc:mga06r32_4814_c1 nmdc:mga06r32_4814_c1_5266_6891 528
151 3300050511 nmdc:mga08y16_3958_c1 nmdc:mga08y16_3958_c1_11374_13002 528
152 3300050512 nmdc:mga0n895_21683_c1 nmdc:mga0n895_21683_c1_516_2165 528
153 3300050513 nmdc:mga0rr50_65178_c1 nmdc:mga0rr50_65178_c1_612_2261 528
154 3300050515 nmdc:mga0a205_67881_c1 nmdc:mga0a205_67881_c1_299_1948 528
155 3300053085 Ga0495619_0035508 Ga0495619_0035508_1466_3109 528
156 3300059490 Ga0587066_000021 Ga0587066_000021_3377_5026 528
157 3300059491 Ga0587070_000288 Ga0587070_000288_717_2366 528
158 3300059504 Ga0587082_000047 Ga0587082_000047_2125_3774 528
159 3300059508 Ga0587088_000091 Ga0587088_000091_1390_3039 528
160 3300059512 Ga0587092_000171 Ga0587092_000171_1861_3510 528
161 3300059640 Ga0587067_000080 Ga0587067_000080_717_2366 528
162 3300060344 Ga0587071_000045 Ga0587071_000045_3345_4994 528
163 3300060353 Ga0501082_0002918 Ga0501082_0002918_1586_3220 528
164 iso_pu_bacteria 2643221618 2644105858 528
165 iso_pu_bacteria 2643221626 2644147176 528
166 iso_pu_bacteria 2643221643 2644238259 528
167 iso_pu_bacteria 2643221655 2644310470 528
168 iso_pu_bacteria 2643221659 2644334745 528
169 iso_pu_bacteria 2643221698 2644545061 528
170 iso_pu_bacteria 2643221712 2644612572 528
171 iso_pu_bacteria 2844163670 2844165554 528
172 iso_pu_bacteria 2884791551 2884794051 528
173 iso_pu_bacteria 2939669807 2939672450 528
174 3300005331 Ga0070670_100046479 Ga0070670_1000464792 529
175 3300005354 Ga0070675_100014324 Ga0070675_1000143242 529
176 3300025926 Ga0207659_10002574 Ga0207659_100025749 529
177 iso_pu_bacteria 2513237104 2513718892 529
178 iso_pu_bacteria 2513237141 2513894834 529
179 iso_pu_bacteria 2582581283 2585169276 529
180 iso_pu_bacteria 2643221636 2644203035 529
181 iso_pu_bacteria 2767802442 2770197260 529
182 iso_pu_bacteria 2885409591 2885410029 529
183 iso_pu_bacteria 2894652903 2894657144 529
184 3300037068 Ga0373925_0108187 Ga0373925_0108187_489_2126 530
185 3300048915 Ga0496112_0121431 Ga0496112_0121431_371_2074 530
186 3300048927 Ga0496124_0036705 Ga0496124_0036705_1047_2648 530
187 iso_pu_bacteria 2528768022 2528851707 530
188 iso_pu_bacteria 2738543024 2739308502 530
189 iso_pu_bacteria 2816332527 2818236018 530
190 iso_pu_bacteria 2840764183 2840764809 530
191 iso_pu_bacteria 2841911363 2841913048 530
192 iso_pu_bacteria 2841917233 2841918795 530
193 iso_pu_bacteria 2917699015 2917701680 530
194 iso_pu_bacteria 2941531003 2941537654 530
195 iso_pu_bacteria 2996336353 2996339273 530
196 iso_pu_bacteria 3005710791 3005712874 530
197 3300003320 rootH2_10055935 rootH2_100559353 531
198 3300003323 rootH1_10010931 rootH1_100109313 531
199 3300005577 Ga0068857_100012233 Ga0068857_1000122332 531
200 3300026116 Ga0207674_10074818 Ga0207674_100748182 531
201 3300031249 Ga0265339_10010845 Ga0265339_100108454 531
202 3300046492 Ga0495585_0008846 Ga0495585_0008846_1712_3316 531
203 3300046507 Ga0495606_0074514 Ga0495606_0074514_236_1840 531
204 3300046515 Ga0495620_0025561 Ga0495620_0025561_1149_2753 531
205 3300046518 Ga0495631_0023956 Ga0495631_0023956_646_2250 531
206 3300046616 Ga0495668_0030109 Ga0495668_0030109_205_1809 531
207 3300046660 Ga0495625_0112980 Ga0495625_0112980_151_1755 531
208 3300046665 Ga0495661_0038485 Ga0495661_0038485_1033_2637 531
209 3300047472 Ga0495686_0081486 Ga0495686_0081486_208_1812 531
210 3300048929 Ga0496126_0107717 Ga0496126_0107717_616_2232 531
211 iso_pu_bacteria 2643221736 2644744949 531
212 3300004625 Ga0055543_1010238 Ga0055543_10102382 532
213 3300005262 Ga0065165_1000162 Ga0065165_10001622 532
214 3300005262 Ga0065165_1000972 Ga0065165_100097235 532
215 3300005329 Ga0070683_100035061 Ga0070683_1000350612 532
216 3300005347 Ga0070668_100074847 Ga0070668_1000748472 532
217 3300005441 Ga0070700_100069947 Ga0070700_1000699472 532
218 3300005456 Ga0070678_100058855 Ga0070678_1000588552 532
219 3300005543 Ga0070672_100013051 Ga0070672_1000130512 532
220 3300005544 Ga0070686_100035732 Ga0070686_1000357322 532
221 3300005616 Ga0068852_100000929 Ga0068852_1000009298 532
222 3300009174 Ga0105241_10012748 Ga0105241_100127482 532
223 3300009545 Ga0105237_10008152 Ga0105237_100081523 532
224 3300025254 Ga0209148_1000274 Ga0209148_100027456 532
225 3300025272 Ga0209455_1002264 Ga0209455_10022641 532
226 3300025302 Ga0207426_1000598 Ga0207426_100059845 532
227 3300025911 Ga0207654_10011484 Ga0207654_100114842 532
228 3300025913 Ga0207695_10000015 Ga0207695_10000015555 532
229 3300025914 Ga0207671_10019093 Ga0207671_100190933 532
230 3300025923 Ga0207681_10015819 Ga0207681_100158194 532
231 3300025937 Ga0207669_10008584 Ga0207669_100085844 532
232 3300025938 Ga0207704_10054131 Ga0207704_100541312 532
233 3300025940 Ga0207691_10003838 Ga0207691_1000383811 532
234 3300025944 Ga0207661_10011440 Ga0207661_100114403 532
235 3300026075 Ga0207708_10000806 Ga0207708_1000080621 532
236 3300026121 Ga0207683_10090489 Ga0207683_100904892 532
237 3300026142 Ga0207698_10022413 Ga0207698_100224131 532
238 3300033180 Ga0307510_10002057 Ga0307510_100020573 532
239 3300046460 Ga0495638_0005958 Ga0495638_0005958_3372_5198 532
240 3300046507 Ga0495606_0022584 Ga0495606_0022584_1645_3471 532
241 3300046615 Ga0495656_0019344 Ga0495656_0019344_544_2151 532
242 3300046616 Ga0495668_0064029 Ga0495668_0064029_77_1696 532
243 3300047317 Ga0495604_0058062 Ga0495604_0058062_1275_2894 532
244 3300048904 Ga0496101_0008040 Ga0496101_0008040_2192_3850 532
245 3300048910 Ga0496107_0046080 Ga0496107_0046080_1387_3045 532
246 3300048917 Ga0496114_0000605 Ga0496114_0000605_12512_14170 532
247 3300050492 nmdc:mga0yw44_27104_c1 nmdc:mga0yw44_27104_c1_788_2407 532
248 3300053108 Ga0500562_002576 Ga0500562_002576_1614_3440 532
249 3300053156 Ga0500622_0004599 Ga0500622_0004599_368_2194 532
250 3300053736 Ga0500599_002793 Ga0500599_002793_274_1893 532
251 iso_pu_bacteria 2513237096 2513656914 532
252 iso_pu_bacteria 2513237137 2513855992 532
253 iso_pu_bacteria 2513237145 2513918654 532
254 iso_pu_bacteria 2517572143 2517891900 532
255 iso_pu_bacteria 2885374607 2885382589 532
256 iso_pu_bacteria 2903748898 2903749486 532
257 iso_pu_bacteria 2906635258 2906643510 532
258 iso_pu_bacteria 2906660503 2906662268 532
259 iso_pu_bacteria 2935959822 2935963265 532
260 iso_pu_bacteria 3005474847 3005476695 532
261 3300003771 Ga0055526_1000276 Ga0055526_100027620 533
262 3300005328 Ga0070676_10011011 Ga0070676_100110113 533
263 3300005328 Ga0070676_10034638 Ga0070676_100346382 533
264 3300005330 Ga0070690_100027442 Ga0070690_1000274422 533
265 3300005333 Ga0070677_10002249 Ga0070677_100022492 533
266 3300005339 Ga0070660_100027495 Ga0070660_1000274952 533
267 3300005340 Ga0070689_100025513 Ga0070689_1000255132 533
268 3300005344 Ga0070661_100024325 Ga0070661_1000243252 533
269 3300005356 Ga0070674_100001037 Ga0070674_10000103711 533
270 3300005364 Ga0070673_100016251 Ga0070673_1000162514 533
271 3300005435 Ga0070714_100062618 Ga0070714_1000626181 533
272 3300005435 Ga0070714_100091087 Ga0070714_1000910871 533
273 3300005436 Ga0070713_100018183 Ga0070713_1000181831 533
274 3300005456 Ga0070678_100002007 Ga0070678_1000020077 533
275 3300005457 Ga0070662_100001647 Ga0070662_1000016475 533
276 3300005458 Ga0070681_10004445 Ga0070681_1000444511 533
277 3300005466 Ga0070685_10083734 Ga0070685_100837341 533
278 3300005530 Ga0070679_100010067 Ga0070679_1000100673 533
279 3300005539 Ga0068853_100000967 Ga0068853_1000009673 533
280 3300005539 Ga0068853_100002561 Ga0068853_1000025616 533
281 3300005543 Ga0070672_100015376 Ga0070672_1000153762 533
282 3300005563 Ga0068855_100005891 Ga0068855_1000058916 533
283 3300005563 Ga0068855_100008354 Ga0068855_1000083542 533
284 3300005564 Ga0070664_100010431 Ga0070664_1000104313 533
285 3300005578 Ga0068854_100070598 Ga0068854_1000705982 533
286 3300005614 Ga0068856_100000181 Ga0068856_10000018144 533
287 3300005616 Ga0068852_100003731 Ga0068852_1000037312 533
288 3300005719 Ga0068861_100042311 Ga0068861_1000423111 533
289 3300005719 Ga0068861_100089355 Ga0068861_1000893552 533
290 3300005937 Ga0081455_10003206 Ga0081455_100032065 533
291 3300005981 Ga0081538_10007650 Ga0081538_100076504 533
292 3300005985 Ga0081539_10003759 Ga0081539_1000375912 533
293 3300006042 Ga0075368_10000428 Ga0075368_100004283 533
294 3300006048 Ga0075363_100002557 Ga0075363_1000025575 533
295 3300006051 Ga0075364_10006874 Ga0075364_100068745 533
296 3300006178 Ga0075367_10000343 Ga0075367_1000034312 533
297 3300006844 Ga0075428_100114611 Ga0075428_1001146112 533
298 3300009093 Ga0105240_10002009 Ga0105240_1000200928 533
299 3300009094 Ga0111539_10115319 Ga0111539_101153191 533
300 3300009147 Ga0114129_10065995 Ga0114129_100659952 533
301 3300009545 Ga0105237_10033182 Ga0105237_100331822 533
302 3300010159 Ga0099796_10002246 Ga0099796_100022462 533
303 3300013100 Ga0157373_10000932 Ga0157373_1000093215 533
304 3300013100 Ga0157373_10022198 Ga0157373_100221982 533
305 3300013102 Ga0157371_10000221 Ga0157371_1000022137 533
306 3300013105 Ga0157369_10003494 Ga0157369_1000349414 533
307 3300013250 Ga0171462_1034 Ga0171462_103460 533
308 3300013296 Ga0157374_10111446 Ga0157374_101114462 533
309 3300013297 Ga0157378_10018200 Ga0157378_100182005 533
310 3300013306 Ga0163162_10168610 Ga0163162_101686102 533
311 3300013307 Ga0157372_10116949 Ga0157372_101169492 533
312 3300013308 Ga0157375_10037256 Ga0157375_100372562 533
313 3300014326 Ga0157380_10109202 Ga0157380_101092022 533
314 3300014969 Ga0157376_10068798 Ga0157376_100687982 533
315 3300025295 Ga0209564_1000023 Ga0209564_1000023427 533
316 3300025901 Ga0207688_10010093 Ga0207688_100100933 533
317 3300025907 Ga0207645_10011990 Ga0207645_100119902 533
318 3300025907 Ga0207645_10052568 Ga0207645_100525682 533
319 3300025912 Ga0207707_10002151 Ga0207707_100021515 533
320 3300025913 Ga0207695_10021629 Ga0207695_100216294 533
321 3300025914 Ga0207671_10112472 Ga0207671_101124721 533
322 3300025919 Ga0207657_10000596 Ga0207657_100005962 533
323 3300025919 Ga0207657_10014459 Ga0207657_100144591 533
324 3300025920 Ga0207649_10006405 Ga0207649_100064054 533
325 3300025921 Ga0207652_10007822 Ga0207652_100078221 533
326 3300025921 Ga0207652_10118624 Ga0207652_101186242 533
327 3300025923 Ga0207681_10032737 Ga0207681_100327372 533
328 3300025924 Ga0207694_10002220 Ga0207694_100022202 533
329 3300025925 Ga0207650_10047792 Ga0207650_100477922 533
330 3300025926 Ga0207659_10014368 Ga0207659_100143683 533
331 3300025929 Ga0207664_10018344 Ga0207664_100183442 533
332 3300025931 Ga0207644_10017480 Ga0207644_100174804 533
333 3300025931 Ga0207644_10043689 Ga0207644_100436892 533
334 3300025932 Ga0207690_10001205 Ga0207690_100012055 533
335 3300025933 Ga0207706_10000074 Ga0207706_1000007445 533
336 3300025936 Ga0207670_10077777 Ga0207670_100777772 533
337 3300025939 Ga0207665_10029745 Ga0207665_100297454 533
338 3300025940 Ga0207691_10006478 Ga0207691_100064783 533
339 3300025945 Ga0207679_10003974 Ga0207679_100039743 533
340 3300025949 Ga0207667_10002291 Ga0207667_100022914 533
341 3300025949 Ga0207667_10075529 Ga0207667_100755292 533
342 3300025960 Ga0207651_10011198 Ga0207651_100111981 533
343 3300026041 Ga0207639_10013813 Ga0207639_100138135 533
344 3300026078 Ga0207702_10002345 Ga0207702_1000234516 533
345 3300026078 Ga0207702_10033819 Ga0207702_100338192 533
346 3300026116 Ga0207674_10000084 Ga0207674_1000008439 533
347 3300026118 Ga0207675_100124027 Ga0207675_1001240272 533
348 3300026121 Ga0207683_10000492 Ga0207683_1000049223 533
349 3300027671 Ga0209588_1012263 Ga0209588_10122631 533
350 3300027866 Ga0209813_10002462 Ga0209813_100024622 533
351 3300035691 Ga0373931_0003093 Ga0373931_0003093_3575_5191 533
352 3300039438 Ga0436360_1099428 Ga0436360_1099428_522_2144 533
353 3300046491 Ga0495584_0016121 Ga0495584_0016121_247_1863 533
354 3300046507 Ga0495606_0006293 Ga0495606_0006293_6199_7815 533
355 3300046537 Ga0495598_0002310 Ga0495598_0002310_1724_3340 533
356 3300047315 Ga0495581_0083315 Ga0495581_0083315_224_1840 533
357 3300048905 Ga0496102_0017251 Ga0496102_0017251_3886_5625 533
358 3300048906 Ga0496103_0015676 Ga0496103_0015676_19_1758 533
359 3300048907 Ga0496104_0003162 Ga0496104_0003162_11852_13468 533
360 3300048908 Ga0496105_0008988 Ga0496105_0008988_2695_4311 533
361 3300048909 Ga0496106_0003590 Ga0496106_0003590_2906_4645 533
362 3300048910 Ga0496107_0011333 Ga0496107_0011333_990_2729 533
363 3300048911 Ga0496108_0001362 Ga0496108_0001362_6429_8045 533
364 3300048912 Ga0496109_0004451 Ga0496109_0004451_9547_11163 533
365 3300048914 Ga0496111_0001111 Ga0496111_0001111_2618_4234 533
366 3300048916 Ga0496113_0001251 Ga0496113_0001251_1992_3608 533
367 3300048916 Ga0496113_0163284 Ga0496113_0163284_103_1713 533
368 3300048929 Ga0496126_0037232 Ga0496126_0037232_1709_3328 533
369 3300049581 Ga0501047_0043135 Ga0501047_0043135_138_1841 533
370 3300049586 Ga0501070_0003413 Ga0501070_0003413_374_2077 533
371 3300049588 Ga0501072_0002081 Ga0501072_0002081_4531_6234 533
372 3300049589 Ga0501073_0001796 Ga0501073_0001796_983_2686 533
373 3300049744 Ga0501083_0033459 Ga0501083_0033459_26_1729 533
374 3300050492 nmdc:mga0yw44_25663_c1 nmdc:mga0yw44_25663_c1_1070_2686 533
375 3300050494 nmdc:mga06z11_1398_c1 nmdc:mga06z11_1398_c1_6555_8171 533
376 3300050495 nmdc:mga04h51_2684_c1 nmdc:mga04h51_2684_c1_2081_3697 533
377 3300050511 nmdc:mga08y16_153247_c1 nmdc:mga08y16_153247_c1_428_2044 533
378 3300053119 Ga0500595_016042 Ga0500595_016042_668_2326 533
379 iso_pu_bacteria 2524023228 2524535359 533
380 iso_pu_bacteria 2667528175 2671117463 533
381 iso_pu_bacteria 2904690495 2904698596 533
382 iso_pu_bacteria 2904699407 2904707302 533
383 iso_pu_bacteria 2908756301 2908762394 533
384 iso_pu_bacteria 8006933436 8006935070 533
385 iso_pu_bacteria 8006973647 8006975039 533
386 3300003371 JGI26145J50221_1000801 JGI26145J50221_10008012 534
387 3300003775 Ga0055524_1003976 Ga0055524_10039763 534
388 3300005340 Ga0070689_100001133 Ga0070689_1000011332 534
389 3300005353 Ga0070669_100138926 Ga0070669_1001389261 534
390 3300007788 Ga0099795_10009302 Ga0099795_100093022 534
391 3300009147 Ga0114129_10008086 Ga0114129_1000808611 534
392 3300013308 Ga0157375_10006693 Ga0157375_100066937 534
393 3300025299 Ga0209256_1000128 Ga0209256_100012846 534
394 3300025931 Ga0207644_10007121 Ga0207644_100071212 534
395 3300025936 Ga0207670_10015063 Ga0207670_100150632 534
396 3300025941 Ga0207711_10009043 Ga0207711_100090437 534
397 3300026088 Ga0207641_10048705 Ga0207641_100487052 534
398 3300031995 Ga0307409_100174111 Ga0307409_1001741111 534
399 3300033442 Ga0315911_1000002 Ga0315911_1000002676 534
400 3300035118 Ga0373954_0000128 Ga0373954_0000128_15320_16939 534
401 3300035119 Ga0373956_0015558 Ga0373956_0015558_803_2422 534
402 3300035724 Ga0373933_0001000 Ga0373933_0001000_5453_7189 534
403 3300036401 Ga0373937_0020254 Ga0373937_0020254_2107_3843 534
404 3300042876 Ga0451577_0012128 Ga0451577_0012128_6406_8091 534
405 3300046457 Ga0495590_0036535 Ga0495590_0036535_18_1646 534
406 3300046459 Ga0495629_0055551 Ga0495629_0055551_828_2447 534
407 3300046462 Ga0495651_0050496 Ga0495651_0050496_1312_2931 534
408 3300046476 Ga0495662_0048790 Ga0495662_0048790_139_1758 534
409 3300046511 Ga0495608_0047235 Ga0495608_0047235_1228_2847 534
410 3300046559 Ga0495667_0002542 Ga0495667_0002542_4759_6378 534
411 3300046689 Ga0495613_0044355 Ga0495613_0044355_1631_3250 534
412 3300047471 Ga0495684_0003890 Ga0495684_0003890_1447_3066 534
413 3300047673 Ga0495593_0006970 Ga0495593_0006970_3347_4966 534
414 3300049581 Ga0501047_0055629 Ga0501047_0055629_1862_3487 534
415 3300049742 Ga0501080_0080503 Ga0501080_0080503_1180_2805 534
416 3300049823 Ga0501044_0013237 Ga0501044_0013237_1779_3404 534
417 3300053084 Ga0495595_0012285 Ga0495595_0012285_1088_2707 534
418 iso_pu_bacteria 2643221733 2644729537 534
419 iso_pu_bacteria 2738543013 2739248990 534
420 3300004800 Ga0058861_12067306 Ga0058861_120673062 535
421 3300004800 Ga0058861_12074013 Ga0058861_120740133 535
422 3300004803 Ga0058862_10036173 Ga0058862_100361731 535
423 3300004803 Ga0058862_10052075 Ga0058862_100520751 535
424 3300005327 Ga0070658_10058520 Ga0070658_100585202 535
425 3300005329 Ga0070683_100013742 Ga0070683_1000137422 535
426 3300005336 Ga0070680_100000715 Ga0070680_10000071513 535
427 3300005336 Ga0070680_100010034 Ga0070680_1000100346 535
428 3300005339 Ga0070660_100001964 Ga0070660_1000019642 535
429 3300005354 Ga0070675_100032787 Ga0070675_1000327872 535
430 3300005434 Ga0070709_10004238 Ga0070709_100042384 535
431 3300005436 Ga0070713_100022397 Ga0070713_1000223972 535
432 3300005458 Ga0070681_10012807 Ga0070681_100128076 535
433 3300005458 Ga0070681_10017468 Ga0070681_100174684 535
434 3300005518 Ga0070699_100115352 Ga0070699_1001153523 535
435 3300005530 Ga0070679_100027279 Ga0070679_1000272792 535
436 3300005535 Ga0070684_100001210 Ga0070684_1000012104 535
437 3300005539 Ga0068853_100003101 Ga0068853_1000031014 535
438 3300005563 Ga0068855_100008023 Ga0068855_10000802316 535
439 3300005563 Ga0068855_100062241 Ga0068855_1000622415 535
440 3300005577 Ga0068857_100006177 Ga0068857_1000061776 535
441 3300005616 Ga0068852_100014481 Ga0068852_1000144815 535
442 3300005834 Ga0068851_10005754 Ga0068851_100057543 535
443 3300005983 Ga0081540_1003514 Ga0081540_10035144 535
444 3300006028 Ga0070717_10120328 Ga0070717_101203282 535
445 3300006844 Ga0075428_100013889 Ga0075428_1000138893 535
446 3300006871 Ga0075434_100035715 Ga0075434_1000357152 535
447 3300009093 Ga0105240_10003096 Ga0105240_1000309623 535
448 3300009093 Ga0105240_10082635 Ga0105240_100826352 535
449 3300009093 Ga0105240_10149486 Ga0105240_101494862 535
450 3300009094 Ga0111539_10006379 Ga0111539_100063794 535
451 3300009545 Ga0105237_10002350 Ga0105237_1000235013 535
452 3300009545 Ga0105237_10103535 Ga0105237_101035352 535
453 3300009551 Ga0105238_10000408 Ga0105238_1000040833 535
454 3300013105 Ga0157369_10000685 Ga0157369_1000068532 535
455 3300013105 Ga0157369_10004094 Ga0157369_1000409426 535
456 3300013105 Ga0157369_10021093 Ga0157369_100210932 535
457 3300013105 Ga0157369_10050094 Ga0157369_100500942 535
458 3300013105 Ga0157369_10159845 Ga0157369_101598452 535
459 3300013307 Ga0157372_10060940 Ga0157372_100609403 535
460 3300013307 Ga0157372_10173751 Ga0157372_101737512 535
461 3300020069 Ga0197907_10380380 Ga0197907_103803801 535
462 3300020070 Ga0206356_10784946 Ga0206356_107849461 535
463 3300020076 Ga0206355_1226068 Ga0206355_12260682 535
464 3300020080 Ga0206350_11179710 Ga0206350_111797102 535
465 3300020081 Ga0206354_10968831 Ga0206354_109688312 535
466 3300022467 Ga0224712_10022092 Ga0224712_100220921 535
467 3300025294 Ga0209025_1002328 Ga0209025_10023288 535
468 3300025321 Ga0207656_10006700 Ga0207656_100067003 535
469 3300025909 Ga0207705_10096207 Ga0207705_100962071 535
470 3300025912 Ga0207707_10000126 Ga0207707_1000012627 535
471 3300025912 Ga0207707_10003896 Ga0207707_100038966 535
472 3300025912 Ga0207707_10010718 Ga0207707_100107183 535
473 3300025913 Ga0207695_10025608 Ga0207695_1002560811 535
474 3300025914 Ga0207671_10007097 Ga0207671_1000709710 535
475 3300025917 Ga0207660_10002234 Ga0207660_100022341 535
476 3300025917 Ga0207660_10008952 Ga0207660_100089525 535
477 3300025919 Ga0207657_10000261 Ga0207657_1000026138 535
478 3300025921 Ga0207652_10012243 Ga0207652_100122432 535
479 3300025949 Ga0207667_10005359 Ga0207667_100053597 535
480 3300025949 Ga0207667_10244383 Ga0207667_102443831 535
481 3300026041 Ga0207639_10027184 Ga0207639_100271841 535
482 3300026142 Ga0207698_10010802 Ga0207698_100108022 535
483 3300036401 Ga0373937_0006557 Ga0373937_0006557_363_1991 535
484 3300037312 Ga0395899_0016911 Ga0395899_0016911_409_2031 535
485 3300037312 Ga0395899_0058489 Ga0395899_0058489_744_2366 535
486 3300037418 Ga0395900_0036729 Ga0395900_0036729_2237_3859 535
487 3300037418 Ga0395900_0039923 Ga0395900_0039923_1383_3005 535
488 3300037418 Ga0395900_0085466 Ga0395900_0085466_1436_3058 535
489 3300037418 Ga0395900_0127850 Ga0395900_0127850_498_2120 535
490 3300037466 Ga0395898_0128242 Ga0395898_0128242_472_2094 535
491 3300038443 Ga0395901_0029678 Ga0395901_0029678_2082_3704 535
492 3300050512 nmdc:mga0n895_34586_c1 nmdc:mga0n895_34586_c1_1646_3283 535
493 3300050516 nmdc:mga0sz30_39604_c1 nmdc:mga0sz30_39604_c1_80_1726 535
494 3300053084 Ga0495595_0006034 Ga0495595_0006034_865_2493 535
495 3300053085 Ga0495619_0009996 Ga0495619_0009996_179_1807 535
496 3300053109 Ga0500569_004620 Ga0500569_004620_308_1942 535
497 3300005336 Ga0070680_100123770 Ga0070680_1001237702 536
498 3300006844 Ga0075428_100141868 Ga0075428_1001418682 536
499 3300006847 Ga0075431_100183915 Ga0075431_1001839152 536
500 3300025253 Ga0209677_100369 Ga0209677_10036924 536
501 3300031852 Ga0307410_10001696 Ga0307410_100016966 536
502 3300032002 Ga0307416_100080094 Ga0307416_1000800942 536
503 3300044673 Ga0453683_0016414 Ga0453683_0016414_2708_4390 536
504 3300046463 Ga0495653_0084118 Ga0495653_0084118_682_2325 536
505 3300046511 Ga0495608_0034348 Ga0495608_0034348_773_2416 536
506 3300046536 Ga0495587_0003660 Ga0495587_0003660_965_2608 536
507 3300046559 Ga0495667_0005025 Ga0495667_0005025_6874_8517 536
508 3300046675 Ga0495657_0051197 Ga0495657_0051197_111_1754 536
509 3300046678 Ga0495599_0028643 Ga0495599_0028643_186_1829 536
510 3300046679 Ga0495623_0065837 Ga0495623_0065837_401_2044 536
511 3300047444 Ga0495675_0006140 Ga0495675_0006140_2763_4457 536
512 3300048921 Ga0496118_0006767 Ga0496118_0006767_1836_3470 536
513 3300048924 Ga0496121_0027871 Ga0496121_0027871_3623_5257 536
514 3300049588 Ga0501072_0045364 Ga0501072_0045364_163_1788 536
515 3300050507 nmdc:mga05p37_5476_c1 nmdc:mga05p37_5476_c1_845_2467 536
516 3300050510 nmdc:mga06r32_44260_c2 nmdc:mga06r32_44260_c2_714_2447 536
517 3300050513 nmdc:mga0rr50_105793_c1 nmdc:mga0rr50_105793_c1_334_1950 536
518 3300053077 Ga0495601_0017121 Ga0495601_0017121_2331_3974 536
519 3300025933 Ga0207706_10146150 Ga0207706_101461502 537
520 3300025940 Ga0207691_10014367 Ga0207691_100143674 537
521 3300031901 Ga0307406_10016372 Ga0307406_100163722 537
522 3300036401 Ga0373937_0009073 Ga0373937_0009073_1988_3619 537
523 3300039450 Ga0436363_1339296 Ga0436363_1339296_10259_11917 537
524 3300046499 Ga0495594_0060106 Ga0495594_0060106_357_1982 537
525 3300049571 Ga0501034_0091799 Ga0501034_0091799_260_1918 537
526 3300050515 nmdc:mga0a205_79984_c1 nmdc:mga0a205_79984_c1_41_1675 537
527 3300059421 Ga0590071_014223 Ga0590071_014223_58_1695 537
528 3300017792 Ga0163161_10067888 Ga0163161_100678882 538
529 3300025927 Ga0207687_10057206 Ga0207687_100572061 538
530 3300031731 Ga0307405_10050494 Ga0307405_100504942 538
531 3300049572 Ga0501036_0061746 Ga0501036_0061746_277_1917 538
532 3300049575 Ga0501039_0096725 Ga0501039_0096725_463_2103 538
533 3300049824 Ga0501045_0095911 Ga0501045_0095911_246_1886 538
534 3300005336 Ga0070680_100002629 Ga0070680_1000026298 539
535 3300005458 Ga0070681_10005791 Ga0070681_1000579111 539
536 3300005543 Ga0070672_100001618 Ga0070672_1000016189 539
537 3300005548 Ga0070665_100006978 Ga0070665_1000069783 539
538 3300006844 Ga0075428_100015388 Ga0075428_1000153882 539
539 3300006880 Ga0075429_100029737 Ga0075429_1000297375 539
540 3300009147 Ga0114129_10257263 Ga0114129_102572631 539
541 3300009174 Ga0105241_10063574 Ga0105241_100635743 539
542 3300013307 Ga0157372_10036013 Ga0157372_100360133 539
543 3300025315 Ga0207697_10021428 Ga0207697_100214282 539
544 3300025903 Ga0207680_10074032 Ga0207680_100740322 539
545 3300025912 Ga0207707_10003761 Ga0207707_1000376112 539
546 3300025917 Ga0207660_10056828 Ga0207660_100568282 539
547 3300025919 Ga0207657_10137726 Ga0207657_101377261 539
548 3300025934 Ga0207686_10011466 Ga0207686_100114662 539
549 3300025940 Ga0207691_10012608 Ga0207691_100126083 539
550 3300025945 Ga0207679_10032346 Ga0207679_100323463 539
551 3300025949 Ga0207667_10092225 Ga0207667_100922252 539
552 3300025960 Ga0207651_10028518 Ga0207651_100285182 539
553 3300026078 Ga0207702_10045703 Ga0207702_100457035 539
554 3300026118 Ga0207675_100018551 Ga0207675_1000185513 539
555 3300026142 Ga0207698_10066523 Ga0207698_100665232 539
556 3300028379 Ga0268266_10005821 Ga0268266_100058213 539
557 3300031731 Ga0307405_10004741 Ga0307405_100047413 539
558 3300031903 Ga0307407_10003024 Ga0307407_100030243 539
559 3300031995 Ga0307409_100002813 Ga0307409_1000028133 539
560 3300042005 Ga0439448_0017551 Ga0439448_0017551_14_1717 539
561 3300042439 Ga0439464_0000278 Ga0439464_0000278_757_2460 539
562 3300050507 nmdc:mga05p37_212017_c1 nmdc:mga05p37_212017_c1_175_1809 539
563 3300050511 nmdc:mga08y16_181085_c1 nmdc:mga08y16_181085_c1_147_1781 539
564 3300005356 Ga0070674_100084412 Ga0070674_1000844122 540
565 3300005436 Ga0070713_100065627 Ga0070713_1000656272 540
566 3300005459 Ga0068867_100077400 Ga0068867_1000774002 540
567 3300005614 Ga0068856_100057362 Ga0068856_1000573622 540
568 3300005719 Ga0068861_100043433 Ga0068861_1000434332 540
569 3300005983 Ga0081540_1003133 Ga0081540_10031333 540
570 3300006178 Ga0075367_10056492 Ga0075367_100564922 540
571 3300009148 Ga0105243_10029177 Ga0105243_100291773 540
572 3300025928 Ga0207700_10043983 Ga0207700_100439832 540
573 3300025933 Ga0207706_10004802 Ga0207706_100048021 540
574 3300025938 Ga0207704_10010238 Ga0207704_100102382 540
575 3300025939 Ga0207665_10024852 Ga0207665_100248522 540
576 3300026075 Ga0207708_10053405 Ga0207708_100534052 540
577 3300027552 Ga0209982_1002111 Ga0209982_10021112 540
578 3300027617 Ga0210002_1000255 Ga0210002_10002555 540
579 3300027876 Ga0209974_10001404 Ga0209974_100014047 540
580 3300031548 Ga0307408_100033723 Ga0307408_1000337232 540
581 3300031824 Ga0307413_10028407 Ga0307413_100284071 540
582 3300031911 Ga0307412_10061541 Ga0307412_100615412 540
583 3300032002 Ga0307416_100003810 Ga0307416_1000038108 540
584 3300032005 Ga0307411_10000915 Ga0307411_100009156 540
585 3300035170 Ga0373943_0030289 Ga0373943_0030289_292_1986 540
586 3300046543 Ga0495645_0019365 Ga0495645_0019365_464_2170 540
587 3300047319 Ga0495674_0119231 Ga0495674_0119231_267_1973 540
588 3300048907 Ga0496104_0077923 Ga0496104_0077923_1381_3087 540
589 3300048918 Ga0496115_0004711 Ga0496115_0004711_3475_5181 540
590 3300049590 Ga0501074_0051281 Ga0501074_0051281_374_2065 540
591 3300005330 Ga0070690_100009374 Ga0070690_1000093743 541
592 3300005334 Ga0068869_100006008 Ga0068869_1000060086 541
593 3300005340 Ga0070689_100037406 Ga0070689_1000374062 541
594 3300005438 Ga0070701_10013249 Ga0070701_100132492 541
595 3300005440 Ga0070705_100025693 Ga0070705_1000256932 541
596 3300005441 Ga0070700_100003815 Ga0070700_1000038153 541
597 3300005459 Ga0068867_100007147 Ga0068867_1000071475 541
598 3300005544 Ga0070686_100005382 Ga0070686_1000053822 541
599 3300005546 Ga0070696_100049752 Ga0070696_1000497522 541
600 3300005615 Ga0070702_100008363 Ga0070702_1000083633 541
601 3300005718 Ga0068866_10000727 Ga0068866_100007278 541
602 3300005719 Ga0068861_100009840 Ga0068861_1000098405 541
603 3300006237 Ga0097621_100009194 Ga0097621_1000091942 541
604 3300006237 Ga0097621_100084007 Ga0097621_1000840072 541
605 3300006358 Ga0068871_100067460 Ga0068871_1000674602 541
606 3300006358 Ga0068871_100117763 Ga0068871_1001177632 541
607 3300009098 Ga0105245_10002145 Ga0105245_100021456 541
608 3300009148 Ga0105243_10019893 Ga0105243_100198932 541
609 3300009177 Ga0105248_10047454 Ga0105248_100474542 541
610 3300013105 Ga0157369_10095468 Ga0157369_100954682 541
611 3300013297 Ga0157378_10002321 Ga0157378_100023213 541
612 3300014326 Ga0157380_10051083 Ga0157380_100510832 541
613 3300025899 Ga0207642_10001979 Ga0207642_100019795 541
614 3300025906 Ga0207699_10020361 Ga0207699_100203612 541
615 3300025920 Ga0207649_10062187 Ga0207649_100621872 541
616 3300025927 Ga0207687_10007925 Ga0207687_100079254 541
617 3300025934 Ga0207686_10000342 Ga0207686_100003426 541
618 3300025935 Ga0207709_10010227 Ga0207709_100102272 541
619 3300025938 Ga0207704_10015550 Ga0207704_100155502 541
620 3300025940 Ga0207691_10094608 Ga0207691_100946081 541
621 3300025942 Ga0207689_10001067 Ga0207689_1000106715 541
622 3300025945 Ga0207679_10023460 Ga0207679_100234601 541
623 3300025949 Ga0207667_10092814 Ga0207667_100928142 541
624 3300026075 Ga0207708_10000850 Ga0207708_100008507 541
625 3300026089 Ga0207648_10002986 Ga0207648_100029868 541
626 3300026118 Ga0207675_100000430 Ga0207675_10000043013 541
627 3300028380 Ga0268265_10026927 Ga0268265_100269272 541
628 3300049578 Ga0501042_0087351 Ga0501042_0087351_37_1698 541
629 3300049582 Ga0501048_0061790 Ga0501048_0061790_859_2520 541
630 3300049591 Ga0501075_0089627 Ga0501075_0089627_510_2171 541
631 3300054114 Ga0501084_0096375 Ga0501084_0096375_729_2390 541
632 3300005459 Ga0068867_100068370 Ga0068867_1000683701 542
633 3300005530 Ga0070679_100008257 Ga0070679_1000082573 542
634 3300005563 Ga0068855_100091501 Ga0068855_1000915012 542
635 3300005615 Ga0070702_100002103 Ga0070702_1000021034 542
636 3300006852 Ga0075433_10000045 Ga0075433_100000455 542
637 3300006871 Ga0075434_100000014 Ga0075434_10000001445 542
638 3300007076 Ga0075435_100004145 Ga0075435_1000041457 542
639 3300013306 Ga0163162_10000003 Ga0163162_1000000325 542
640 3300013306 Ga0163162_10139152 Ga0163162_101391523 542
641 3300025910 Ga0207684_10022621 Ga0207684_100226212 542
642 3300025917 Ga0207660_10025203 Ga0207660_100252033 542
643 3300025926 Ga0207659_10043717 Ga0207659_100437172 542
644 3300026118 Ga0207675_100067703 Ga0207675_1000677032 542
645 3300036401 Ga0373937_0003233 Ga0373937_0003233_9865_11502 542
646 3300046476 Ga0495662_0002087 Ga0495662_0002087_6086_7729 542
647 3300046517 Ga0495630_0000001 Ga0495630_0000001_722474_724117 542
648 3300050511 nmdc:mga08y16_145067_c1 nmdc:mga08y16_145067_c1_682_2346 542
649 3300050512 nmdc:mga0n895_520_c1 nmdc:mga0n895_520_c1_21662_23308 542
650 3300050513 nmdc:mga0rr50_41745_c1 nmdc:mga0rr50_41745_c1_1055_2701 542
651 3300050515 nmdc:mga0a205_344_c1 nmdc:mga0a205_344_c1_15097_16743 542
652 3300005290 Ga0065712_10077866 Ga0065712_100778662 543
653 3300005295 Ga0065707_10001246 Ga0065707_100012463 543
654 3300005331 Ga0070670_100004697 Ga0070670_1000046977 543
655 3300005335 Ga0070666_10005944 Ga0070666_100059442 543
656 3300005354 Ga0070675_100001879 Ga0070675_10000187911 543
657 3300005354 Ga0070675_100183794 Ga0070675_1001837941 543
658 3300005355 Ga0070671_100000304 Ga0070671_10000030424 543
659 3300005844 Ga0068862_100126870 Ga0068862_1001268701 543
660 3300006358 Ga0068871_100055951 Ga0068871_1000559512 543
661 3300006844 Ga0075428_100081280 Ga0075428_1000812802 543
662 3300013296 Ga0157374_10002246 Ga0157374_100022463 543
663 3300013306 Ga0163162_10002786 Ga0163162_1000278611 543
664 3300013308 Ga0157375_10000187 Ga0157375_1000018737 543
665 3300025925 Ga0207650_10003657 Ga0207650_100036573 543
666 3300025931 Ga0207644_10003083 Ga0207644_100030839 543
667 3300025940 Ga0207691_10050422 Ga0207691_100504223 543
668 3300025960 Ga0207651_10042466 Ga0207651_100424662 543
669 3300035692 Ga0373935_0035720 Ga0373935_0035720_928_2667 543
670 3300045051 Ga0451576_0021579 Ga0451576_0021579_2082_3725 543
671 3300048903 Ga0496100_0022742 Ga0496100_0022742_713_2452 543
672 3300048904 Ga0496101_0031087 Ga0496101_0031087_187_1926 543
673 3300048909 Ga0496106_0014750 Ga0496106_0014750_1194_2933 543
674 3300048915 Ga0496112_0001433 Ga0496112_0001433_4941_6581 543
675 3300048915 Ga0496112_0049418 Ga0496112_0049418_1196_2935 543
676 3300048918 Ga0496115_0021418 Ga0496115_0021418_2926_4665 543
677 3300050507 nmdc:mga05p37_40526_c1 nmdc:mga05p37_40526_c1_1236_2885 543
678 3300050510 nmdc:mga06r32_109493_c1 nmdc:mga06r32_109493_c1_279_1928 543
679 3300005293 Ga0065715_10094129 Ga0065715_100941294 544
680 3300005331 Ga0070670_100002242 Ga0070670_10000224210 544
681 3300005543 Ga0070672_100080762 Ga0070672_1000807622 544
682 3300005616 Ga0068852_100024417 Ga0068852_1000244173 544
683 3300006931 Ga0097620_100084703 Ga0097620_1000847032 544
684 3300009094 Ga0111539_10233718 Ga0111539_102337182 544
685 3300013307 Ga0157372_10119531 Ga0157372_101195312 544
686 3300014325 Ga0163163_10022104 Ga0163163_100221045 544
687 3300025907 Ga0207645_10025507 Ga0207645_100255072 544
688 3300025940 Ga0207691_10002268 Ga0207691_100022683 544
689 3300025940 Ga0207691_10026399 Ga0207691_100263994 544
690 3300026089 Ga0207648_10013379 Ga0207648_100133796 544
691 3300027665 Ga0209983_1002433 Ga0209983_10024332 544
692 3300035117 Ga0373953_0036209 Ga0373953_0036209_195_1862 544
693 3300046473 Ga0495582_0000764 Ga0495582_0000764_13849_15495 544
694 3300046511 Ga0495608_0040779 Ga0495608_0040779_1431_3086 544
695 3300046559 Ga0495667_0021596 Ga0495667_0021596_1976_3631 544
696 3300047471 Ga0495684_0002042 Ga0495684_0002042_5973_7619 544
697 3300049572 Ga0501036_0068608 Ga0501036_0068608_171_1817 544
698 3300049576 Ga0501040_0020551 Ga0501040_0020551_2545_4191 544
699 3300049577 Ga0501041_0033269 Ga0501041_0033269_747_2393 544
700 3300049578 Ga0501042_0079205 Ga0501042_0079205_508_2154 544
701 3300049579 Ga0501043_0041938 Ga0501043_0041938_1172_2818 544
702 3300049580 Ga0501046_0115879 Ga0501046_0115879_45_1691 544
703 3300049581 Ga0501047_0042761 Ga0501047_0042761_1513_3159 544
704 3300049589 Ga0501073_0055121 Ga0501073_0055121_52_1698 544
705 3300053093 Ga0500651_0020089 Ga0500651_0020089_386_2032 544
706 3300054114 Ga0501084_0095650 Ga0501084_0095650_401_2047 544
707 3300060353 Ga0501082_0012080 Ga0501082_0012080_4213_5859 544
708 3300003347 JGI26128J50194_1000456 JGI26128J50194_10004561 545
709 3300005328 Ga0070676_10004147 Ga0070676_100041472 545
710 3300005331 Ga0070670_100060623 Ga0070670_1000606232 545
711 3300005334 Ga0068869_100000833 Ga0068869_10000083312 545
712 3300005334 Ga0068869_100050537 Ga0068869_1000505372 545
713 3300005354 Ga0070675_100025831 Ga0070675_1000258313 545
714 3300005364 Ga0070673_100000114 Ga0070673_10000011431 545
715 3300005364 Ga0070673_100008549 Ga0070673_1000085495 545
716 3300005436 Ga0070713_100002486 Ga0070713_1000024867 545
717 3300005439 Ga0070711_100001996 Ga0070711_1000019964 545
718 3300005441 Ga0070700_100012604 Ga0070700_1000126043 545
719 3300005444 Ga0070694_100004983 Ga0070694_1000049835 545
720 3300005466 Ga0070685_10001172 Ga0070685_1000117212 545
721 3300005544 Ga0070686_100031109 Ga0070686_1000311092 545
722 3300005545 Ga0070695_100000676 Ga0070695_10000067614 545
723 3300005547 Ga0070693_100063562 Ga0070693_1000635621 545
724 3300005548 Ga0070665_100017868 Ga0070665_1000178684 545
725 3300005614 Ga0068856_100009519 Ga0068856_1000095194 545
726 3300005617 Ga0068859_100005614 Ga0068859_1000056147 545
727 3300005841 Ga0068863_100003910 Ga0068863_1000039107 545
728 3300005841 Ga0068863_100058217 Ga0068863_1000582172 545
729 3300005843 Ga0068860_100055521 Ga0068860_1000555213 545
730 3300006175 Ga0070712_100004514 Ga0070712_1000045143 545
731 3300006237 Ga0097621_100029715 Ga0097621_1000297153 545
732 3300006881 Ga0068865_100008745 Ga0068865_1000087453 545
733 3300006931 Ga0097620_100005614 Ga0097620_1000056147 545
734 3300009098 Ga0105245_10009740 Ga0105245_100097403 545
735 3300009148 Ga0105243_10032071 Ga0105243_100320713 545
736 3300009176 Ga0105242_10016585 Ga0105242_100165853 545
737 3300013296 Ga0157374_10001774 Ga0157374_100017744 545
738 3300013306 Ga0163162_10014356 Ga0163162_100143563 545
739 3300013307 Ga0157372_10089521 Ga0157372_100895212 545
740 3300013308 Ga0157375_10002337 Ga0157375_1000233713 545
741 3300014968 Ga0157379_10002071 Ga0157379_100020714 545
742 3300014969 Ga0157376_10002637 Ga0157376_100026374 545
743 3300025907 Ga0207645_10007037 Ga0207645_100070373 545
744 3300025915 Ga0207693_10000589 Ga0207693_1000058914 545
745 3300025916 Ga0207663_10001397 Ga0207663_100013974 545
746 3300025924 Ga0207694_10045696 Ga0207694_100456962 545
747 3300025926 Ga0207659_10076642 Ga0207659_100766422 545
748 3300025927 Ga0207687_10001005 Ga0207687_1000100513 545
749 3300025928 Ga0207700_10003680 Ga0207700_100036803 545
750 3300025934 Ga0207686_10008067 Ga0207686_100080671 545
751 3300025938 Ga0207704_10005242 Ga0207704_100052423 545
752 3300025938 Ga0207704_10006848 Ga0207704_100068483 545
753 3300025939 Ga0207665_10054887 Ga0207665_100548872 545
754 3300025941 Ga0207711_10000157 Ga0207711_1000015719 545
755 3300025960 Ga0207651_10000499 Ga0207651_100004997 545
756 3300025986 Ga0207658_10005604 Ga0207658_100056043 545
757 3300026023 Ga0207677_10001200 Ga0207677_100012008 545
758 3300026075 Ga0207708_10010197 Ga0207708_100101976 545
759 3300026078 Ga0207702_10012439 Ga0207702_100124393 545
760 3300026088 Ga0207641_10005017 Ga0207641_100050173 545
761 3300026088 Ga0207641_10012757 Ga0207641_100127574 545
762 3300026089 Ga0207648_10002900 Ga0207648_100029002 545
763 3300026095 Ga0207676_10000054 Ga0207676_10000054113 545
764 3300028381 Ga0268264_10001476 Ga0268264_100014764 545
765 3300028381 Ga0268264_10112325 Ga0268264_101123252 545
766 3300031548 Ga0307408_100034480 Ga0307408_1000344802 545
767 3300031995 Ga0307409_100096994 Ga0307409_1000969942 545
768 3300035086 Ga0373934_0010611 Ga0373934_0010611_1047_2696 545
769 3300035118 Ga0373954_0000493 Ga0373954_0000493_12547_14196 545
770 3300035172 Ga0373955_0002077 Ga0373955_0002077_4654_6303 545
771 3300035724 Ga0373933_0001768 Ga0373933_0001768_7565_9214 545
772 3300036401 Ga0373937_0012074 Ga0373937_0012074_2317_3966 545
773 3300036401 Ga0373937_0043322 Ga0373937_0043322_37_1686 545
774 3300042876 Ga0451577_0069457 Ga0451577_0069457_1047_2738 545
775 3300046663 Ga0495635_0049589 Ga0495635_0049589_617_2266 545
776 3300048907 Ga0496104_0000011 Ga0496104_0000011_6748_8397 545
777 3300048908 Ga0496105_0000014 Ga0496105_0000014_6775_8424 545
778 3300048910 Ga0496107_0030480 Ga0496107_0030480_1859_3508 545
779 3300048912 Ga0496109_0006154 Ga0496109_0006154_220_1869 545
780 3300005329 Ga0070683_100070044 Ga0070683_1000700443 546
781 3300005355 Ga0070671_100009413 Ga0070671_1000094134 546
782 3300005546 Ga0070696_100015471 Ga0070696_1000154714 546
783 3300005547 Ga0070693_100003292 Ga0070693_1000032923 546
784 3300005564 Ga0070664_100007952 Ga0070664_1000079529 546
785 3300006237 Ga0097621_100019032 Ga0097621_1000190322 546
786 3300006353 Ga0075370_10023289 Ga0075370_100232892 546
787 3300009174 Ga0105241_10005162 Ga0105241_100051624 546
788 3300013297 Ga0157378_10005007 Ga0157378_100050076 546
789 3300013306 Ga0163162_10006774 Ga0163162_100067745 546
790 3300013307 Ga0157372_10014377 Ga0157372_100143773 546
791 3300014325 Ga0163163_10016100 Ga0163163_100161003 546
792 3300014969 Ga0157376_10013053 Ga0157376_100130532 546
793 3300025927 Ga0207687_10002597 Ga0207687_100025977 546
794 3300025933 Ga0207706_10016672 Ga0207706_100166725 546
795 3300025934 Ga0207686_10001013 Ga0207686_100010134 546
796 3300025944 Ga0207661_10016684 Ga0207661_100166842 546
797 3300025945 Ga0207679_10010306 Ga0207679_100103063 546
798 3300025945 Ga0207679_10021331 Ga0207679_100213312 546
799 3300026089 Ga0207648_10029560 Ga0207648_100295604 546
800 3300026121 Ga0207683_10013950 Ga0207683_100139502 546
801 3300026142 Ga0207698_10029927 Ga0207698_100299272 546
802 3300027360 Ga0209969_1002196 Ga0209969_10021962 546
803 3300027395 Ga0209996_1002284 Ga0209996_10022842 546
804 3300027526 Ga0209968_1001505 Ga0209968_10015052 546
805 3300027614 Ga0209970_1004448 Ga0209970_10044482 546
806 3300027665 Ga0209983_1001474 Ga0209983_10014743 546
807 3300027682 Ga0209971_1000009 Ga0209971_100000946 546
808 3300027695 Ga0209966_1000125 Ga0209966_10001258 546
809 3300027717 Ga0209998_10000047 Ga0209998_1000004717 546
810 3300027876 Ga0209974_10002285 Ga0209974_100022853 546
811 3300028800 Ga0265338_10017055 Ga0265338_100170553 546
812 3300031995 Ga0307409_100146331 Ga0307409_1001463311 546
813 3300035725 Ga0373947_0040953 Ga0373947_0040953_980_2623 546
814 3300049576 Ga0501040_0000723 Ga0501040_0000723_14504_16195 546
815 3300049577 Ga0501041_0003865 Ga0501041_0003865_4782_6473 546
816 3300049580 Ga0501046_0000308 Ga0501046_0000308_39191_40882 546
817 3300049581 Ga0501047_0027549 Ga0501047_0027549_2568_4259 546
818 3300049591 Ga0501075_0027282 Ga0501075_0027282_2027_3718 546
819 3300049593 Ga0501077_0065327 Ga0501077_0065327_166_1857 546
820 3300049741 Ga0501079_0034966 Ga0501079_0034966_1104_2795 546
821 3300049743 Ga0501081_0001401 Ga0501081_0001401_2985_4676 546
822 3300049824 Ga0501045_0000175 Ga0501045_0000175_30856_32547 546
823 3300050496 nmdc:mga07m45_36246_c2 nmdc:mga07m45_36246_c2_515_2170 546
824 3300054114 Ga0501084_0002013 Ga0501084_0002013_13328_15019 546
825 3300060353 Ga0501082_0009373 Ga0501082_0009373_1326_3017 546
826 3300000545 CNXas_1000057 CNXas_100005719 547
827 3300005458 Ga0070681_10012013 Ga0070681_100120134 547
828 3300005530 Ga0070679_100017173 Ga0070679_1000171733 547
829 3300013100 Ga0157373_10006363 Ga0157373_100063633 547
830 3300013104 Ga0157370_10006437 Ga0157370_100064372 547
831 3300013307 Ga0157372_10043861 Ga0157372_100438612 547
832 3300025912 Ga0207707_10041173 Ga0207707_100411731 547
833 3300025940 Ga0207691_10069760 Ga0207691_100697602 547

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

243

453

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdd-assembly1.cif.gz_A the crystal structure of the pseudomonas dacunhae aspartate-beta-decarboxylase reveals a novel oligomeric assembly for a pyridoxal-5-phosphate dependent enzyme 0.9455 38 526
3fdd-assembly1.cif.gz_A the crystal structure of the pseudomonas dacunhae aspartate-beta-decarboxylase reveals a novel oligomeric assembly for a pyridoxal-5-phosphate dependent enzyme 0.92 38 526
2zy2-assembly1.cif.gz_A dodecameric l-aspartate beta-decarboxylase 0.9165 13 532
2zy2-assembly1.cif.gz_A dodecameric l-aspartate beta-decarboxylase 0.9114 13 532
2zy5-assembly1.cif.gz_F r487a mutant of l-aspartate beta-decarboxylase 0.909 13 531
ID Description Score Start End Superfamily
2zy3A02 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9532 40 153 1.10.20.110
3f6tB02 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9106 40 154 1.10.20.110
3f6tA03 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8986 167 382 3.40.640.10
3f6tA03 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8791 167 382 3.40.640.10
3f6tA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8702 408 526 3.90.1150.10
ID Description Score Start End GO Terms
AF-Q89PK3-F1-model_v4 Aspartate 4-decarboxylase (EC 4.1.1.12) 0.979 3 533 GO:0006520
GO:0006531
GO:0008483
GO:0009058
GO:0030170
GO:0047688
AF-A0A3N5FU08-F1-model_v4 Bifunctional aspartate transaminase/aspartate 4-decarboxylase (EC 2.6.1.1, EC 4.1.1.12) 0.9733 207 531 GO:0004069
GO:0006520
GO:0009058
GO:0030170
GO:0047688
AF-A0A7J4YN08-F1-model_v4 Aspartate 4-decarboxylase (EC 4.1.1.12) 0.9704 6 527 GO:0006520
GO:0008483
GO:0009058
GO:0030170
GO:0047688
AF-A0A2P7BNC4-F1-model_v4 Aspartate 4-decarboxylase (EC 4.1.1.12) 0.9699 3 531 GO:0006531
GO:0008483
GO:0009058
GO:0030170
GO:0047688
AF-A0A3N2N423-F1-model_v4 deleted 0.9696 6 531

Feature Viewer

pLDDT pTM Quality
89.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map