F482758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 833 | 420 | 782 | 545 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0005958|Ga0495638_0005958_3372_5198 |
| Length | 608 |
| Sequence | MSTVCADLRPDVVAVASFAALQRSGVVHRGRSVEIDQGSSSATDHPAVIAQAMKPVRHVLAGCTAREFHMADLSTLKKFEALSPFEIKDELINLAKANSKRTQSAFLNAGRGNPNWVATTPREGFFLLGQFAISESKRVMEHPAGIGGMPQAKGIAGRFEAWLAKHADMPGASFLSEMLPYAVKTFSFEPDAFVHELVDSIIGDNYPVPDRMLVHNEKIVHEYLMWAVCGAPRPSGKFDIYAVEGGTAAMCYIFKSLKANRLLLPGDTIALGTPIFTPYIEMTHLEDYDLKVVQIKAPQENRFQFTDEEIKKLEDPKIKAFFIVNPANPSGMGVSPETIAKLTNLVKTKRPDLMLLTDDVYGTFVHGFRSLLGELPHNTIGVYSYSKYFGCTGWRLGAIAIHEDNIFDKMIAKLPDAAVKALDKRYGPLTLEPRKLKMIDRIVADSRDVALNHTAGLSLPQQVMMSLFSLSEMLDEKKAYQAACMEIVNKRLWSLLDGLGLADKLTPNPNYDAYYGLIDFEFWARKNIGDEAVDYLKKNVHPLDLAFRLAEAHGIVLLNGGGFDAPEWSLRVSLANLSDDVYDDIGRGVRAIARGYRDAYQAAKGGTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 8 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 9 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 10 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 11 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 12 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 13 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 14 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 15 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 16 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 17 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 18 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 19 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 20 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 21 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 22 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 23 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 24 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 25 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 26 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 27 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 28 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 29 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 30 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 31 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 32 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 33 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 34 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 35 | 2904699407 | |||
| 36 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 37 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 38 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 39 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 40 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 41 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 42 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 43 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 44 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 45 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 46 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 47 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 48 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 49 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 50 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 51 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 52 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 53 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 54 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 55 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 59 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 60 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 61 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 62 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 71 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 95 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 100 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 107 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 109 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 110 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 111 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 113 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 114 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 115 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 116 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 117 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 118 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 119 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 120 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 121 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 122 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 123 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 124 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 133 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 134 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 135 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 136 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 137 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 138 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 139 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 141 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 153 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 175 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 264 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 265 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 269 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 270 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 271 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 290 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 291 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 292 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 293 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 294 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 402 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 405 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 408 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 410 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 419 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 420 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.59 |
| Metatranscriptomes | 2.4 |
| Isolates | 6.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.84 |
| Nodule | 2.28 |
| Rhizoplane | 4.08 |
| Rhizosphere | 85.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000057 | 3300000545 | Bacteria | 21758 |
| 2 | rootH2_10007600 | 3300003320 | Bacteria | 24379 |
| 3 | rootH2_10055935 | 3300003320 | Bacteria | 4867 |
| 4 | rootH1_10010931 | 3300003323 | Bacteria | 10602 |
| 5 | JGI26128J50194_1000456 | 3300003347 | Bacteria | 2241 |
| 6 | JGI26145J50221_1000801 | 3300003371 | Bacteria | 2572 |
| 7 | Ga0055526_1000276 | 3300003771 | Bacteria | 43379 |
| 8 | Ga0055524_1003976 | 3300003775 | Bacteria | 6986 |
| 9 | Ga0055543_1010238 | 3300004625 | Bacteria | 1974 |
| 10 | Ga0058861_12067306 | 3300004800 | Bacteria | 2118 |
| 11 | Ga0058861_12074013 | 3300004800 | Bacteria | 6407 |
| 12 | Ga0058862_10036173 | 3300004803 | Bacteria | 4274 |
| 13 | Ga0058862_10052075 | 3300004803 | Bacteria | 6237 |
| 14 | Ga0065165_1000162 | 3300005262 | Bacteria | 116822 |
| 15 | Ga0065165_1000972 | 3300005262 | Bacteria | 35758 |
| 16 | Ga0065712_10077866 | 3300005290 | Bacteria | 3431 |
| 17 | Ga0065715_10094129 | 3300005293 | Bacteria | 4403 |
| 18 | Ga0065707_10001246 | 3300005295 | Bacteria | 8340 |
| 19 | Ga0070658_10058520 | 3300005327 | Bacteria | 3137 |
| 20 | Ga0070676_10004147 | 3300005328 | Bacteria | 7609 |
| 21 | Ga0070676_10011011 | 3300005328 | Bacteria | 4914 |
| 22 | Ga0070676_10034638 | 3300005328 | Bacteria | 2900 |
| 23 | Ga0070683_100013742 | 3300005329 | Bacteria | 7068 |
| 24 | Ga0070683_100035061 | 3300005329 | Bacteria | 4587 |
| 25 | Ga0070683_100070044 | 3300005329 | Bacteria | 3271 |
| 26 | Ga0070690_100009374 | 3300005330 | Bacteria | 5670 |
| 27 | Ga0070690_100027442 | 3300005330 | Bacteria | 3520 |
| 28 | Ga0070670_100002242 | 3300005331 | Bacteria | 15894 |
| 29 | Ga0070670_100004697 | 3300005331 | Bacteria | 11462 |
| 30 | Ga0070670_100046479 | 3300005331 | Bacteria | 3733 |
| 31 | Ga0070670_100060623 | 3300005331 | Bacteria | 3249 |
| 32 | Ga0070677_10002249 | 3300005333 | Bacteria | 6158 |
| 33 | Ga0068869_100000833 | 3300005334 | Bacteria | 17604 |
| 34 | Ga0068869_100006008 | 3300005334 | Bacteria | 7678 |
| 35 | Ga0068869_100050537 | 3300005334 | Bacteria | 3014 |
| 36 | Ga0070666_10005944 | 3300005335 | Bacteria | 7492 |
| 37 | Ga0070680_100000715 | 3300005336 | Bacteria | 23059 |
| 38 | Ga0070680_100002629 | 3300005336 | Bacteria | 13308 |
| 39 | Ga0070680_100010034 | 3300005336 | Bacteria | 7295 |
| 40 | Ga0070680_100123770 | 3300005336 | Bacteria | 2160 |
| 41 | Ga0070660_100001964 | 3300005339 | Bacteria | 14177 |
| 42 | Ga0070660_100027495 | 3300005339 | Bacteria | 4246 |
| 43 | Ga0070660_100033219 | 3300005339 | Bacteria | 3887 |
| 44 | Ga0070689_100001133 | 3300005340 | Bacteria | 16809 |
| 45 | Ga0070689_100025513 | 3300005340 | Bacteria | 4441 |
| 46 | Ga0070689_100037406 | 3300005340 | Bacteria | 3711 |
| 47 | Ga0070661_100024325 | 3300005344 | Bacteria | 4344 |
| 48 | Ga0070661_100033996 | 3300005344 | Bacteria | 3696 |
| 49 | Ga0070668_100074847 | 3300005347 | Bacteria | 2643 |
| 50 | Ga0070669_100138926 | 3300005353 | Bacteria | 1871 |
| 51 | Ga0070675_100001879 | 3300005354 | Bacteria | 15492 |
| 52 | Ga0070675_100014324 | 3300005354 | Bacteria | 6252 |
| 53 | Ga0070675_100025831 | 3300005354 | Bacteria | 4709 |
| 54 | Ga0070675_100032787 | 3300005354 | Bacteria | 4205 |
| 55 | Ga0070675_100102579 | 3300005354 | Bacteria | 2411 |
| 56 | Ga0070675_100183794 | 3300005354 | Bacteria | 1808 |
| 57 | Ga0070671_100000304 | 3300005355 | Bacteria | 33410 |
| 58 | Ga0070671_100009413 | 3300005355 | Bacteria | 7844 |
| 59 | Ga0070671_100026958 | 3300005355 | Bacteria | 4727 |
| 60 | Ga0070674_100001037 | 3300005356 | Bacteria | 14538 |
| 61 | Ga0070674_100084412 | 3300005356 | Bacteria | 2277 |
| 62 | Ga0070673_100000114 | 3300005364 | Bacteria | 37125 |
| 63 | Ga0070673_100008549 | 3300005364 | Bacteria | 6811 |
| 64 | Ga0070673_100016251 | 3300005364 | Bacteria | 5257 |
| 65 | Ga0070667_100050429 | 3300005367 | Bacteria | 3508 |
| 66 | Ga0070709_10004238 | 3300005434 | Bacteria | 7736 |
| 67 | Ga0070714_100062618 | 3300005435 | Bacteria | 3197 |
| 68 | Ga0070714_100091087 | 3300005435 | Bacteria | 2671 |
| 69 | Ga0070713_100002486 | 3300005436 | Bacteria | 12035 |
| 70 | Ga0070713_100018183 | 3300005436 | Bacteria | 5340 |
| 71 | Ga0070713_100022397 | 3300005436 | Bacteria | 4883 |
| 72 | Ga0070713_100065627 | 3300005436 | Bacteria | 3050 |
| 73 | Ga0070701_10013249 | 3300005438 | Bacteria | 3746 |
| 74 | Ga0070711_100001996 | 3300005439 | Bacteria | 11478 |
| 75 | Ga0070705_100025693 | 3300005440 | Bacteria | 3196 |
| 76 | Ga0070700_100003815 | 3300005441 | Bacteria | 7810 |
| 77 | Ga0070700_100012604 | 3300005441 | Bacteria | 4724 |
| 78 | Ga0070700_100069947 | 3300005441 | Bacteria | 2236 |
| 79 | Ga0070694_100004983 | 3300005444 | Bacteria | 8005 |
| 80 | Ga0070678_100002007 | 3300005456 | Bacteria | 10995 |
| 81 | Ga0070678_100058855 | 3300005456 | Bacteria | 2822 |
| 82 | Ga0070662_100001647 | 3300005457 | Bacteria | 13752 |
| 83 | Ga0070681_10004445 | 3300005458 | Bacteria | 13354 |
| 84 | Ga0070681_10005791 | 3300005458 | Bacteria | 11956 |
| 85 | Ga0070681_10012013 | 3300005458 | Bacteria | 8585 |
| 86 | Ga0070681_10012807 | 3300005458 | Bacteria | 8325 |
| 87 | Ga0070681_10017468 | 3300005458 | Bacteria | 7171 |
| 88 | Ga0070681_10076439 | 3300005458 | Bacteria | 3307 |
| 89 | Ga0068867_100007147 | 3300005459 | Bacteria | 7889 |
| 90 | Ga0068867_100068370 | 3300005459 | Bacteria | 2651 |
| 91 | Ga0068867_100077400 | 3300005459 | Bacteria | 2499 |
| 92 | Ga0070685_10001172 | 3300005466 | Bacteria | 14028 |
| 93 | Ga0070685_10083734 | 3300005466 | Bacteria | 1917 |
| 94 | Ga0070699_100115352 | 3300005518 | Bacteria | 2360 |
| 95 | Ga0070679_100008257 | 3300005530 | Bacteria | 9794 |
| 96 | Ga0070679_100010067 | 3300005530 | Bacteria | 8957 |
| 97 | Ga0070679_100017173 | 3300005530 | Bacteria | 7000 |
| 98 | Ga0070679_100027279 | 3300005530 | Bacteria | 5619 |
| 99 | Ga0070684_100001210 | 3300005535 | Bacteria | 18541 |
| 100 | Ga0068853_100000967 | 3300005539 | Bacteria | 20209 |
| 101 | Ga0068853_100002561 | 3300005539 | Bacteria | 13657 |
| 102 | Ga0068853_100003101 | 3300005539 | Bacteria | 12705 |
| 103 | Ga0068853_100123661 | 3300005539 | Bacteria | 2310 |
| 104 | Ga0070672_100001618 | 3300005543 | Bacteria | 13999 |
| 105 | Ga0070672_100013051 | 3300005543 | Bacteria | 5854 |
| 106 | Ga0070672_100015376 | 3300005543 | Bacteria | 5447 |
| 107 | Ga0070672_100039589 | 3300005543 | Bacteria | 3612 |
| 108 | Ga0070672_100080762 | 3300005543 | Bacteria | 2605 |
| 109 | Ga0070686_100005382 | 3300005544 | Bacteria | 7081 |
| 110 | Ga0070686_100031109 | 3300005544 | Bacteria | 3261 |
| 111 | Ga0070686_100035732 | 3300005544 | Bacteria | 3070 |
| 112 | Ga0070695_100000676 | 3300005545 | Bacteria | 18236 |
| 113 | Ga0070696_100015471 | 3300005546 | Bacteria | 5124 |
| 114 | Ga0070696_100049752 | 3300005546 | Bacteria | 2912 |
| 115 | Ga0070693_100003292 | 3300005547 | Bacteria | 7505 |
| 116 | Ga0070693_100063562 | 3300005547 | Bacteria | 2152 |
| 117 | Ga0070665_100006978 | 3300005548 | Bacteria | 11481 |
| 118 | Ga0070665_100017868 | 3300005548 | Bacteria | 7120 |
| 119 | Ga0070665_100022014 | 3300005548 | Bacteria | 6413 |
| 120 | Ga0068855_100005891 | 3300005563 | Bacteria | 14940 |
| 121 | Ga0068855_100008023 | 3300005563 | Bacteria | 12752 |
| 122 | Ga0068855_100008354 | 3300005563 | Bacteria | 12520 |
| 123 | Ga0068855_100062241 | 3300005563 | Bacteria | 4357 |
| 124 | Ga0068855_100091501 | 3300005563 | Bacteria | 3509 |
| 125 | Ga0070664_100007952 | 3300005564 | Bacteria | 8567 |
| 126 | Ga0070664_100010431 | 3300005564 | Bacteria | 7533 |
| 127 | Ga0068857_100006177 | 3300005577 | Bacteria | 10240 |
| 128 | Ga0068857_100012233 | 3300005577 | Bacteria | 7467 |
| 129 | Ga0068854_100070598 | 3300005578 | Bacteria | 2553 |
| 130 | Ga0068856_100000181 | 3300005614 | Bacteria | 65631 |
| 131 | Ga0068856_100009519 | 3300005614 | Bacteria | 9438 |
| 132 | Ga0068856_100057362 | 3300005614 | Bacteria | 3844 |
| 133 | Ga0070702_100002103 | 3300005615 | Bacteria | 8455 |
| 134 | Ga0070702_100008363 | 3300005615 | Bacteria | 5008 |
| 135 | Ga0068852_100000929 | 3300005616 | Bacteria | 19377 |
| 136 | Ga0068852_100003731 | 3300005616 | Bacteria | 10684 |
| 137 | Ga0068852_100014481 | 3300005616 | Bacteria | 6073 |
| 138 | Ga0068852_100024417 | 3300005616 | Bacteria | 4884 |
| 139 | Ga0068859_100005614 | 3300005617 | Bacteria | 12783 |
| 140 | Ga0068866_10000727 | 3300005718 | Bacteria | 14929 |
| 141 | Ga0068861_100009840 | 3300005719 | Bacteria | 6613 |
| 142 | Ga0068861_100042311 | 3300005719 | Bacteria | 3414 |
| 143 | Ga0068861_100043433 | 3300005719 | Bacteria | 3374 |
| 144 | Ga0068861_100089355 | 3300005719 | Bacteria | 2428 |
| 145 | Ga0068851_10005754 | 3300005834 | Bacteria | 5644 |
| 146 | Ga0068863_100003910 | 3300005841 | Bacteria | 14712 |
| 147 | Ga0068863_100058217 | 3300005841 | Bacteria | 3657 |
| 148 | Ga0068860_100055521 | 3300005843 | Bacteria | 3765 |
| 149 | Ga0068862_100126870 | 3300005844 | Bacteria | 2253 |
| 150 | Ga0081455_10003206 | 3300005937 | Bacteria | 18939 |
| 151 | Ga0081538_10007650 | 3300005981 | Bacteria | 9315 |
| 152 | Ga0081540_1003133 | 3300005983 | Bacteria | 13221 |
| 153 | Ga0081540_1003514 | 3300005983 | Bacteria | 12369 |
| 154 | Ga0081539_10003759 | 3300005985 | Bacteria | 18004 |
| 155 | Ga0070717_10120328 | 3300006028 | Bacteria | 2249 |
| 156 | Ga0075368_10000428 | 3300006042 | Bacteria | 12424 |
| 157 | Ga0075363_100002557 | 3300006048 | Bacteria | 7474 |
| 158 | Ga0075364_10006874 | 3300006051 | Bacteria | 6715 |
| 159 | Ga0070712_100004514 | 3300006175 | Bacteria | 8593 |
| 160 | Ga0075367_10000343 | 3300006178 | Bacteria | 16566 |
| 161 | Ga0075367_10056492 | 3300006178 | Bacteria | 2332 |
| 162 | Ga0097621_100009194 | 3300006237 | Bacteria | 7166 |
| 163 | Ga0097621_100019032 | 3300006237 | Bacteria | 5262 |
| 164 | Ga0097621_100029715 | 3300006237 | Bacteria | 4319 |
| 165 | Ga0097621_100084007 | 3300006237 | Bacteria | 2654 |
| 166 | Ga0075370_10023289 | 3300006353 | Bacteria | 3409 |
| 167 | Ga0068871_100055951 | 3300006358 | Bacteria | 3205 |
| 168 | Ga0068871_100067460 | 3300006358 | Bacteria | 2935 |
| 169 | Ga0068871_100117763 | 3300006358 | Bacteria | 2241 |
| 170 | Ga0075428_100013889 | 3300006844 | Bacteria | 8968 |
| 171 | Ga0075428_100015388 | 3300006844 | Bacteria | 8484 |
| 172 | Ga0075428_100044000 | 3300006844 | Bacteria | 4908 |
| 173 | Ga0075428_100081280 | 3300006844 | Bacteria | 3536 |
| 174 | Ga0075428_100114611 | 3300006844 | Bacteria | 2936 |
| 175 | Ga0075428_100141868 | 3300006844 | Bacteria | 2612 |
| 176 | Ga0075431_100006638 | 3300006847 | Bacteria | 11491 |
| 177 | Ga0075431_100183915 | 3300006847 | Bacteria | 2144 |
| 178 | Ga0075433_10000045 | 3300006852 | Bacteria | 51204 |
| 179 | Ga0075433_10012921 | 3300006852 | Bacteria | 6768 |
| 180 | Ga0075434_100000014 | 3300006871 | Bacteria | 80310 |
| 181 | Ga0075434_100035715 | 3300006871 | Bacteria | 4914 |
| 182 | Ga0075434_100149194 | 3300006871 | Bacteria | 2358 |
| 183 | Ga0075429_100009232 | 3300006880 | Bacteria | 8561 |
| 184 | Ga0075429_100029737 | 3300006880 | Bacteria | 4746 |
| 185 | Ga0068865_100008745 | 3300006881 | Bacteria | 6262 |
| 186 | Ga0097620_100005614 | 3300006931 | Bacteria | 12783 |
| 187 | Ga0097620_100084703 | 3300006931 | Bacteria | 3215 |
| 188 | Ga0075435_100004145 | 3300007076 | Bacteria | 9936 |
| 189 | Ga0075435_100071219 | 3300007076 | Bacteria | 2839 |
| 190 | Ga0099795_10009302 | 3300007788 | Bacteria | 2845 |
| 191 | Ga0105240_10002009 | 3300009093 | Bacteria | 33547 |
| 192 | Ga0105240_10003096 | 3300009093 | Bacteria | 26156 |
| 193 | Ga0105240_10071166 | 3300009093 | Bacteria | 4302 |
| 194 | Ga0105240_10071421 | 3300009093 | Bacteria | 4293 |
| 195 | Ga0105240_10082635 | 3300009093 | Bacteria | 3944 |
| 196 | Ga0105240_10111444 | 3300009093 | Bacteria | 3310 |
| 197 | Ga0105240_10149486 | 3300009093 | Bacteria | 2784 |
| 198 | Ga0111539_10006379 | 3300009094 | Bacteria | 15213 |
| 199 | Ga0111539_10010470 | 3300009094 | Bacteria | 11668 |
| 200 | Ga0111539_10115319 | 3300009094 | Bacteria | 3151 |
| 201 | Ga0111539_10233718 | 3300009094 | Bacteria | 2140 |
| 202 | Ga0105245_10002145 | 3300009098 | Bacteria | 17871 |
| 203 | Ga0105245_10009740 | 3300009098 | Bacteria | 8376 |
| 204 | Ga0114129_10005646 | 3300009147 | Bacteria | 17708 |
| 205 | Ga0114129_10008086 | 3300009147 | Bacteria | 14985 |
| 206 | Ga0114129_10065995 | 3300009147 | Bacteria | 5048 |
| 207 | Ga0114129_10257263 | 3300009147 | Bacteria | 2341 |
| 208 | Ga0105243_10019893 | 3300009148 | Bacteria | 5091 |
| 209 | Ga0105243_10029177 | 3300009148 | Bacteria | 4242 |
| 210 | Ga0105243_10032071 | 3300009148 | Bacteria | 4056 |
| 211 | Ga0105241_10005162 | 3300009174 | Bacteria | 9634 |
| 212 | Ga0105241_10012748 | 3300009174 | Bacteria | 6168 |
| 213 | Ga0105241_10032532 | 3300009174 | Bacteria | 3911 |
| 214 | Ga0105241_10063574 | 3300009174 | Bacteria | 2848 |
| 215 | Ga0105242_10016585 | 3300009176 | Bacteria | 5728 |
| 216 | Ga0105248_10047454 | 3300009177 | Bacteria | 4816 |
| 217 | Ga0105248_10053684 | 3300009177 | Bacteria | 4521 |
| 218 | Ga0105237_10002350 | 3300009545 | Bacteria | 23518 |
| 219 | Ga0105237_10008152 | 3300009545 | Bacteria | 11375 |
| 220 | Ga0105237_10015439 | 3300009545 | Bacteria | 7949 |
| 221 | Ga0105237_10033182 | 3300009545 | Bacteria | 5230 |
| 222 | Ga0105237_10103535 | 3300009545 | Bacteria | 2838 |
| 223 | Ga0105238_10000408 | 3300009551 | Bacteria | 45693 |
| 224 | Ga0105238_10005614 | 3300009551 | Bacteria | 12397 |
| 225 | Ga0099796_10002246 | 3300010159 | Bacteria | 4190 |
| 226 | Ga0105239_10009835 | 3300010375 | Bacteria | 10744 |
| 227 | Ga0157373_10000932 | 3300013100 | Bacteria | 22591 |
| 228 | Ga0157373_10006363 | 3300013100 | Bacteria | 8820 |
| 229 | Ga0157373_10022198 | 3300013100 | Bacteria | 4605 |
| 230 | Ga0157373_10024396 | 3300013100 | Bacteria | 4381 |
| 231 | Ga0157371_10000221 | 3300013102 | Bacteria | 83267 |
| 232 | Ga0157370_10006437 | 3300013104 | Bacteria | 12957 |
| 233 | Ga0157369_10000685 | 3300013105 | Bacteria | 43830 |
| 234 | Ga0157369_10003494 | 3300013105 | Bacteria | 18658 |
| 235 | Ga0157369_10004094 | 3300013105 | Bacteria | 17270 |
| 236 | Ga0157369_10021093 | 3300013105 | Bacteria | 7282 |
| 237 | Ga0157369_10050094 | 3300013105 | Bacteria | 4525 |
| 238 | Ga0157369_10095468 | 3300013105 | Bacteria | 3173 |
| 239 | Ga0157369_10159845 | 3300013105 | Bacteria | 2378 |
| 240 | Ga0171462_1034 | 3300013250 | Bacteria | 85441 |
| 241 | Ga0157374_10001774 | 3300013296 | Bacteria | 18148 |
| 242 | Ga0157374_10002246 | 3300013296 | Bacteria | 16261 |
| 243 | Ga0157374_10030972 | 3300013296 | Bacteria | 4858 |
| 244 | Ga0157374_10111446 | 3300013296 | Bacteria | 2632 |
| 245 | Ga0157374_10153429 | 3300013296 | Bacteria | 2240 |
| 246 | Ga0157378_10002321 | 3300013297 | Bacteria | 16917 |
| 247 | Ga0157378_10005007 | 3300013297 | Bacteria | 11625 |
| 248 | Ga0157378_10018200 | 3300013297 | Bacteria | 6169 |
| 249 | Ga0157378_10032559 | 3300013297 | Bacteria | 4606 |
| 250 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 251 | Ga0163162_10002786 | 3300013306 | Bacteria | 16611 |
| 252 | Ga0163162_10006774 | 3300013306 | Bacteria | 11116 |
| 253 | Ga0163162_10014356 | 3300013306 | Bacteria | 7741 |
| 254 | Ga0163162_10139152 | 3300013306 | Bacteria | 2539 |
| 255 | Ga0163162_10154283 | 3300013306 | Bacteria | 2415 |
| 256 | Ga0163162_10168610 | 3300013306 | Bacteria | 2313 |
| 257 | Ga0157372_10014377 | 3300013307 | Bacteria | 8464 |
| 258 | Ga0157372_10036013 | 3300013307 | Bacteria | 5452 |
| 259 | Ga0157372_10043861 | 3300013307 | Bacteria | 4955 |
| 260 | Ga0157372_10060940 | 3300013307 | Bacteria | 4223 |
| 261 | Ga0157372_10089521 | 3300013307 | Bacteria | 3497 |
| 262 | Ga0157372_10116949 | 3300013307 | Bacteria | 3057 |
| 263 | Ga0157372_10119531 | 3300013307 | Bacteria | 3025 |
| 264 | Ga0157372_10173751 | 3300013307 | Bacteria | 2493 |
| 265 | Ga0157375_10000187 | 3300013308 | Bacteria | 58157 |
| 266 | Ga0157375_10002337 | 3300013308 | Bacteria | 16394 |
| 267 | Ga0157375_10006693 | 3300013308 | Bacteria | 10037 |
| 268 | Ga0157375_10037256 | 3300013308 | Bacteria | 4658 |
| 269 | Ga0163163_10016100 | 3300014325 | Bacteria | 6936 |
| 270 | Ga0163163_10022104 | 3300014325 | Bacteria | 6016 |
| 271 | Ga0157380_10051083 | 3300014326 | Bacteria | 3268 |
| 272 | Ga0157380_10109202 | 3300014326 | Bacteria | 2321 |
| 273 | Ga0182008_10001734 | 3300014497 | Bacteria | 14317 |
| 274 | Ga0157379_10002071 | 3300014968 | Bacteria | 16653 |
| 275 | Ga0157376_10002637 | 3300014969 | Bacteria | 12201 |
| 276 | Ga0157376_10008786 | 3300014969 | Bacteria | 7308 |
| 277 | Ga0157376_10013053 | 3300014969 | Bacteria | 6187 |
| 278 | Ga0157376_10019723 | 3300014969 | Bacteria | 5203 |
| 279 | Ga0157376_10068798 | 3300014969 | Bacteria | 3000 |
| 280 | Ga0182007_10003243 | 3300015262 | Bacteria | 7742 |
| 281 | Ga0182005_1003229 | 3300015265 | Bacteria | 5572 |
| 282 | Ga0163161_10067888 | 3300017792 | Bacteria | 2604 |
| 283 | Ga0197907_10380380 | 3300020069 | Bacteria | 2262 |
| 284 | Ga0206356_10784946 | 3300020070 | Bacteria | 1946 |
| 285 | Ga0206356_11293394 | 3300020070 | Bacteria | 2753 |
| 286 | Ga0206355_1226068 | 3300020076 | Bacteria | 1967 |
| 287 | Ga0206352_10204954 | 3300020078 | Bacteria | 6443 |
| 288 | Ga0206350_10435960 | 3300020080 | Bacteria | 4244 |
| 289 | Ga0206350_11179710 | 3300020080 | Bacteria | 2185 |
| 290 | Ga0206354_10968831 | 3300020081 | Bacteria | 2451 |
| 291 | Ga0224712_10022092 | 3300022467 | Bacteria | 2188 |
| 292 | Ga0209677_100369 | 3300025253 | Bacteria | 27555 |
| 293 | Ga0209148_1000274 | 3300025254 | Bacteria | 81201 |
| 294 | Ga0209455_1002264 | 3300025272 | Bacteria | 7570 |
| 295 | Ga0209025_1002328 | 3300025294 | Bacteria | 20520 |
| 296 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 297 | Ga0209256_1000128 | 3300025299 | Bacteria | 163833 |
| 298 | Ga0207426_1000598 | 3300025302 | Bacteria | 47559 |
| 299 | Ga0207697_10021428 | 3300025315 | Bacteria | 2645 |
| 300 | Ga0207656_10006700 | 3300025321 | Bacteria | 4159 |
| 301 | Ga0207642_10001979 | 3300025899 | Bacteria | 6319 |
| 302 | Ga0207688_10010093 | 3300025901 | Bacteria | 5136 |
| 303 | Ga0207680_10074032 | 3300025903 | Bacteria | 2120 |
| 304 | Ga0207699_10020361 | 3300025906 | Bacteria | 3554 |
| 305 | Ga0207645_10007037 | 3300025907 | Bacteria | 8008 |
| 306 | Ga0207645_10011990 | 3300025907 | Bacteria | 5895 |
| 307 | Ga0207645_10025507 | 3300025907 | Bacteria | 3825 |
| 308 | Ga0207645_10052568 | 3300025907 | Bacteria | 2603 |
| 309 | Ga0207705_10096207 | 3300025909 | Bacteria | 2174 |
| 310 | Ga0207684_10022621 | 3300025910 | Bacteria | 5366 |
| 311 | Ga0207654_10011484 | 3300025911 | Bacteria | 4520 |
| 312 | Ga0207707_10000126 | 3300025912 | Bacteria | 78954 |
| 313 | Ga0207707_10002151 | 3300025912 | Bacteria | 17819 |
| 314 | Ga0207707_10003761 | 3300025912 | Bacteria | 13449 |
| 315 | Ga0207707_10003896 | 3300025912 | Bacteria | 13234 |
| 316 | Ga0207707_10010718 | 3300025912 | Bacteria | 7963 |
| 317 | Ga0207707_10041173 | 3300025912 | Bacteria | 4035 |
| 318 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 319 | Ga0207695_10021629 | 3300025913 | Bacteria | 7332 |
| 320 | Ga0207695_10025608 | 3300025913 | Bacteria | 6599 |
| 321 | Ga0207671_10007097 | 3300025914 | Bacteria | 9793 |
| 322 | Ga0207671_10019093 | 3300025914 | Bacteria | 5251 |
| 323 | Ga0207671_10112472 | 3300025914 | Bacteria | 2073 |
| 324 | Ga0207693_10000589 | 3300025915 | Bacteria | 32554 |
| 325 | Ga0207663_10001397 | 3300025916 | Bacteria | 11207 |
| 326 | Ga0207660_10002234 | 3300025917 | Bacteria | 12798 |
| 327 | Ga0207660_10008952 | 3300025917 | Bacteria | 6476 |
| 328 | Ga0207660_10025203 | 3300025917 | Bacteria | 4035 |
| 329 | Ga0207660_10056828 | 3300025917 | Bacteria | 2801 |
| 330 | Ga0207657_10000261 | 3300025919 | Bacteria | 55977 |
| 331 | Ga0207657_10000596 | 3300025919 | Bacteria | 38318 |
| 332 | Ga0207657_10000821 | 3300025919 | Bacteria | 32805 |
| 333 | Ga0207657_10014459 | 3300025919 | Bacteria | 7705 |
| 334 | Ga0207657_10137726 | 3300025919 | Bacteria | 1996 |
| 335 | Ga0207649_10006405 | 3300025920 | Bacteria | 6395 |
| 336 | Ga0207649_10009926 | 3300025920 | Bacteria | 5218 |
| 337 | Ga0207649_10062187 | 3300025920 | Bacteria | 2353 |
| 338 | Ga0207652_10007822 | 3300025921 | Bacteria | 8584 |
| 339 | Ga0207652_10012243 | 3300025921 | Bacteria | 6929 |
| 340 | Ga0207652_10118624 | 3300025921 | Bacteria | 2352 |
| 341 | Ga0207681_10015819 | 3300025923 | Bacteria | 4709 |
| 342 | Ga0207681_10022455 | 3300025923 | Bacteria | 4025 |
| 343 | Ga0207681_10032737 | 3300025923 | Bacteria | 3405 |
| 344 | Ga0207694_10002220 | 3300025924 | Bacteria | 15932 |
| 345 | Ga0207694_10004726 | 3300025924 | Bacteria | 10595 |
| 346 | Ga0207694_10045696 | 3300025924 | Bacteria | 3383 |
| 347 | Ga0207650_10003657 | 3300025925 | Bacteria | 10519 |
| 348 | Ga0207650_10047792 | 3300025925 | Bacteria | 3154 |
| 349 | Ga0207659_10002574 | 3300025926 | Bacteria | 10800 |
| 350 | Ga0207659_10014368 | 3300025926 | Bacteria | 5104 |
| 351 | Ga0207659_10043717 | 3300025926 | Bacteria | 3148 |
| 352 | Ga0207659_10076642 | 3300025926 | Bacteria | 2459 |
| 353 | Ga0207687_10001005 | 3300025927 | Bacteria | 19137 |
| 354 | Ga0207687_10002597 | 3300025927 | Bacteria | 12262 |
| 355 | Ga0207687_10007925 | 3300025927 | Bacteria | 6959 |
| 356 | Ga0207687_10057206 | 3300025927 | Bacteria | 2738 |
| 357 | Ga0207700_10003680 | 3300025928 | Bacteria | 8940 |
| 358 | Ga0207700_10043983 | 3300025928 | Bacteria | 3284 |
| 359 | Ga0207664_10018344 | 3300025929 | Bacteria | 5149 |
| 360 | Ga0207644_10003083 | 3300025931 | Bacteria | 10727 |
| 361 | Ga0207644_10007121 | 3300025931 | Bacteria | 7291 |
| 362 | Ga0207644_10017480 | 3300025931 | Bacteria | 4844 |
| 363 | Ga0207644_10043689 | 3300025931 | Bacteria | 3181 |
| 364 | Ga0207690_10001205 | 3300025932 | Bacteria | 16328 |
| 365 | Ga0207690_10008982 | 3300025932 | Bacteria | 5931 |
| 366 | Ga0207706_10000074 | 3300025933 | Bacteria | 103144 |
| 367 | Ga0207706_10004802 | 3300025933 | Bacteria | 12657 |
| 368 | Ga0207706_10016672 | 3300025933 | Bacteria | 6630 |
| 369 | Ga0207706_10146150 | 3300025933 | Bacteria | 2080 |
| 370 | Ga0207686_10000342 | 3300025934 | Bacteria | 33514 |
| 371 | Ga0207686_10001013 | 3300025934 | Bacteria | 16644 |
| 372 | Ga0207686_10008067 | 3300025934 | Bacteria | 5681 |
| 373 | Ga0207686_10011466 | 3300025934 | Bacteria | 4855 |
| 374 | Ga0207709_10010227 | 3300025935 | Bacteria | 5168 |
| 375 | Ga0207670_10015063 | 3300025936 | Bacteria | 4609 |
| 376 | Ga0207670_10077777 | 3300025936 | Bacteria | 2312 |
| 377 | Ga0207669_10008584 | 3300025937 | Bacteria | 4806 |
| 378 | Ga0207704_10005242 | 3300025938 | Bacteria | 5972 |
| 379 | Ga0207704_10006848 | 3300025938 | Bacteria | 5343 |
| 380 | Ga0207704_10010238 | 3300025938 | Bacteria | 4564 |
| 381 | Ga0207704_10015550 | 3300025938 | Bacteria | 3881 |
| 382 | Ga0207704_10054131 | 3300025938 | Bacteria | 2444 |
| 383 | Ga0207665_10024852 | 3300025939 | Bacteria | 3951 |
| 384 | Ga0207665_10029745 | 3300025939 | Bacteria | 3609 |
| 385 | Ga0207665_10054887 | 3300025939 | Bacteria | 2687 |
| 386 | Ga0207691_10002268 | 3300025940 | Bacteria | 18840 |
| 387 | Ga0207691_10003838 | 3300025940 | Bacteria | 14581 |
| 388 | Ga0207691_10006478 | 3300025940 | Bacteria | 11306 |
| 389 | Ga0207691_10012608 | 3300025940 | Bacteria | 8102 |
| 390 | Ga0207691_10014367 | 3300025940 | Bacteria | 7548 |
| 391 | Ga0207691_10026399 | 3300025940 | Bacteria | 5449 |
| 392 | Ga0207691_10038344 | 3300025940 | Bacteria | 4435 |
| 393 | Ga0207691_10050422 | 3300025940 | Bacteria | 3811 |
| 394 | Ga0207691_10069760 | 3300025940 | Bacteria | 3175 |
| 395 | Ga0207691_10094608 | 3300025940 | Bacteria | 2673 |
| 396 | Ga0207711_10000157 | 3300025941 | Bacteria | 73266 |
| 397 | Ga0207711_10009043 | 3300025941 | Bacteria | 8325 |
| 398 | Ga0207711_10049236 | 3300025941 | Bacteria | 3608 |
| 399 | Ga0207689_10001067 | 3300025942 | Bacteria | 26397 |
| 400 | Ga0207661_10011440 | 3300025944 | Bacteria | 6430 |
| 401 | Ga0207661_10016684 | 3300025944 | Bacteria | 5421 |
| 402 | Ga0207661_10126659 | 3300025944 | Bacteria | 2182 |
| 403 | Ga0207679_10003974 | 3300025945 | Bacteria | 9191 |
| 404 | Ga0207679_10010306 | 3300025945 | Bacteria | 6014 |
| 405 | Ga0207679_10021331 | 3300025945 | Bacteria | 4391 |
| 406 | Ga0207679_10023460 | 3300025945 | Bacteria | 4220 |
| 407 | Ga0207679_10032346 | 3300025945 | Bacteria | 3671 |
| 408 | Ga0207667_10002291 | 3300025949 | Bacteria | 24060 |
| 409 | Ga0207667_10005359 | 3300025949 | Bacteria | 15636 |
| 410 | Ga0207667_10075529 | 3300025949 | Bacteria | 3499 |
| 411 | Ga0207667_10092225 | 3300025949 | Bacteria | 3129 |
| 412 | Ga0207667_10092814 | 3300025949 | Bacteria | 3118 |
| 413 | Ga0207667_10119852 | 3300025949 | Bacteria | 2711 |
| 414 | Ga0207667_10244383 | 3300025949 | Bacteria | 1836 |
| 415 | Ga0207651_10000499 | 3300025960 | Bacteria | 16468 |
| 416 | Ga0207651_10011198 | 3300025960 | Bacteria | 5009 |
| 417 | Ga0207651_10028518 | 3300025960 | Bacteria | 3523 |
| 418 | Ga0207651_10042466 | 3300025960 | Bacteria | 3026 |
| 419 | Ga0207658_10005604 | 3300025986 | Bacteria | 8587 |
| 420 | Ga0207677_10001200 | 3300026023 | Bacteria | 14049 |
| 421 | Ga0207639_10013813 | 3300026041 | Bacteria | 5662 |
| 422 | Ga0207639_10027184 | 3300026041 | Bacteria | 4164 |
| 423 | Ga0207708_10000806 | 3300026075 | Bacteria | 23595 |
| 424 | Ga0207708_10000850 | 3300026075 | Bacteria | 22983 |
| 425 | Ga0207708_10010197 | 3300026075 | Bacteria | 6975 |
| 426 | Ga0207708_10053405 | 3300026075 | Bacteria | 3079 |
| 427 | Ga0207702_10002345 | 3300026078 | Bacteria | 18078 |
| 428 | Ga0207702_10012439 | 3300026078 | Bacteria | 7084 |
| 429 | Ga0207702_10033819 | 3300026078 | Bacteria | 4272 |
| 430 | Ga0207702_10045703 | 3300026078 | Bacteria | 3684 |
| 431 | Ga0207641_10005017 | 3300026088 | Bacteria | 11348 |
| 432 | Ga0207641_10012757 | 3300026088 | Bacteria | 6890 |
| 433 | Ga0207641_10048705 | 3300026088 | Bacteria | 3578 |
| 434 | Ga0207641_10126097 | 3300026088 | Bacteria | 2292 |
| 435 | Ga0207648_10002900 | 3300026089 | Bacteria | 18152 |
| 436 | Ga0207648_10002986 | 3300026089 | Bacteria | 17877 |
| 437 | Ga0207648_10013379 | 3300026089 | Bacteria | 7635 |
| 438 | Ga0207648_10029560 | 3300026089 | Bacteria | 4859 |
| 439 | Ga0207676_10000054 | 3300026095 | Bacteria | 128222 |
| 440 | Ga0207674_10000084 | 3300026116 | Bacteria | 101302 |
| 441 | Ga0207674_10074818 | 3300026116 | Bacteria | 3398 |
| 442 | Ga0207675_100000430 | 3300026118 | Bacteria | 40671 |
| 443 | Ga0207675_100018551 | 3300026118 | Bacteria | 6491 |
| 444 | Ga0207675_100020525 | 3300026118 | Bacteria | 6159 |
| 445 | Ga0207675_100067703 | 3300026118 | Bacteria | 3338 |
| 446 | Ga0207675_100124027 | 3300026118 | Bacteria | 2446 |
| 447 | Ga0207675_100240073 | 3300026118 | Unclassified | 1751 |
| 448 | Ga0207683_10000492 | 3300026121 | Bacteria | 36479 |
| 449 | Ga0207683_10013950 | 3300026121 | Bacteria | 6852 |
| 450 | Ga0207683_10090489 | 3300026121 | Bacteria | 2725 |
| 451 | Ga0207698_10010802 | 3300026142 | Bacteria | 5890 |
| 452 | Ga0207698_10022413 | 3300026142 | Bacteria | 4388 |
| 453 | Ga0207698_10029927 | 3300026142 | Bacteria | 3907 |
| 454 | Ga0207698_10066523 | 3300026142 | Bacteria | 2837 |
| 455 | Ga0209969_1002196 | 3300027360 | Bacteria | 2688 |
| 456 | Ga0209996_1002284 | 3300027395 | Bacteria | 2366 |
| 457 | Ga0209968_1001505 | 3300027526 | Bacteria | 3544 |
| 458 | Ga0209982_1002111 | 3300027552 | Bacteria | 2764 |
| 459 | Ga0209970_1004448 | 3300027614 | Bacteria | 2328 |
| 460 | Ga0210002_1000255 | 3300027617 | Bacteria | 7615 |
| 461 | Ga0209983_1001474 | 3300027665 | Bacteria | 5228 |
| 462 | Ga0209983_1002433 | 3300027665 | Bacteria | 4077 |
| 463 | Ga0209588_1012263 | 3300027671 | Bacteria | 2599 |
| 464 | Ga0209971_1000009 | 3300027682 | Bacteria | 101488 |
| 465 | Ga0209966_1000125 | 3300027695 | Bacteria | 33588 |
| 466 | Ga0209998_10000047 | 3300027717 | Bacteria | 50238 |
| 467 | Ga0209813_10002462 | 3300027866 | Bacteria | 4239 |
| 468 | Ga0209974_10001404 | 3300027876 | Bacteria | 8708 |
| 469 | Ga0209974_10002285 | 3300027876 | Bacteria | 6959 |
| 470 | Ga0207428_10019525 | 3300027907 | Bacteria | 5776 |
| 471 | Ga0268266_10003458 | 3300028379 | Bacteria | 15754 |
| 472 | Ga0268266_10005821 | 3300028379 | Bacteria | 11410 |
| 473 | Ga0268265_10026927 | 3300028380 | Bacteria | 4096 |
| 474 | Ga0268264_10001476 | 3300028381 | Bacteria | 21939 |
| 475 | Ga0268264_10112325 | 3300028381 | Bacteria | 2389 |
| 476 | Ga0265338_10017055 | 3300028800 | Bacteria | 7853 |
| 477 | Ga0265339_10010845 | 3300031249 | Bacteria | 5637 |
| 478 | Ga0307408_100033723 | 3300031548 | Bacteria | 3579 |
| 479 | Ga0307408_100034480 | 3300031548 | Bacteria | 3546 |
| 480 | Ga0307405_10004741 | 3300031731 | Bacteria | 6475 |
| 481 | Ga0307405_10050494 | 3300031731 | Bacteria | 2576 |
| 482 | Ga0307413_10028407 | 3300031824 | Bacteria | 3115 |
| 483 | Ga0307410_10001696 | 3300031852 | Bacteria | 10146 |
| 484 | Ga0307406_10016372 | 3300031901 | Bacteria | 4308 |
| 485 | Ga0307407_10003024 | 3300031903 | Bacteria | 6764 |
| 486 | Ga0307412_10061541 | 3300031911 | Bacteria | 2524 |
| 487 | Ga0307409_100002813 | 3300031995 | Bacteria | 9202 |
| 488 | Ga0307409_100096994 | 3300031995 | Bacteria | 2434 |
| 489 | Ga0307409_100146331 | 3300031995 | Bacteria | 2044 |
| 490 | Ga0307409_100174111 | 3300031995 | Bacteria | 1897 |
| 491 | Ga0307416_100003810 | 3300032002 | Bacteria | 8960 |
| 492 | Ga0307416_100080094 | 3300032002 | Bacteria | 2755 |
| 493 | Ga0307411_10000915 | 3300032005 | Bacteria | 11221 |
| 494 | Ga0307510_10002057 | 3300033180 | Bacteria | 22728 |
| 495 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 496 | Ga0373950_0000004 | 3300034818 | Bacteria | 527382 |
| 497 | Ga0373928_0014678 | 3300035084 | Bacteria | 1587 |
| 498 | Ga0373934_0001038 | 3300035086 | Bacteria | 10021 |
| 499 | Ga0373934_0002734 | 3300035086 | Bacteria | 6477 |
| 500 | Ga0373934_0010611 | 3300035086 | Bacteria | 3459 |
| 501 | Ga0373934_0020770 | 3300035086 | Bacteria | 2526 |
| 502 | Ga0373953_0036209 | 3300035117 | Bacteria | 1943 |
| 503 | Ga0373954_0000128 | 3300035118 | Bacteria | 25913 |
| 504 | Ga0373954_0000493 | 3300035118 | Bacteria | 14821 |
| 505 | Ga0373956_0015558 | 3300035119 | Bacteria | 3187 |
| 506 | Ga0373943_0030289 | 3300035170 | Bacteria | 2560 |
| 507 | Ga0373955_0002077 | 3300035172 | Bacteria | 8633 |
| 508 | Ga0373931_0003093 | 3300035691 | Bacteria | 7443 |
| 509 | Ga0373935_0035720 | 3300035692 | Bacteria | 3103 |
| 510 | Ga0373933_0001000 | 3300035724 | Bacteria | 17250 |
| 511 | Ga0373933_0001768 | 3300035724 | Bacteria | 12506 |
| 512 | Ga0373933_0002421 | 3300035724 | Bacteria | 10529 |
| 513 | Ga0373947_0040953 | 3300035725 | Bacteria | 2761 |
| 514 | Ga0373937_0003233 | 3300036401 | Bacteria | 13655 |
| 515 | Ga0373937_0006557 | 3300036401 | Bacteria | 10054 |
| 516 | Ga0373937_0009073 | 3300036401 | Bacteria | 8631 |
| 517 | Ga0373937_0009564 | 3300036401 | Bacteria | 8434 |
| 518 | Ga0373937_0012074 | 3300036401 | Bacteria | 7581 |
| 519 | Ga0373937_0020254 | 3300036401 | Bacteria | 5962 |
| 520 | Ga0373937_0022329 | 3300036401 | Bacteria | 5689 |
| 521 | Ga0373937_0043322 | 3300036401 | Bacteria | 4107 |
| 522 | Ga0373925_0108187 | 3300037068 | Bacteria | 2145 |
| 523 | Ga0395899_0016911 | 3300037312 | Bacteria | 5559 |
| 524 | Ga0395899_0058489 | 3300037312 | Bacteria | 2843 |
| 525 | Ga0395900_0036729 | 3300037418 | Bacteria | 5050 |
| 526 | Ga0395900_0039923 | 3300037418 | Bacteria | 4837 |
| 527 | Ga0395900_0085466 | 3300037418 | Bacteria | 3242 |
| 528 | Ga0395900_0127850 | 3300037418 | Bacteria | 2605 |
| 529 | Ga0395898_0128242 | 3300037466 | Bacteria | 2430 |
| 530 | Ga0395901_0029678 | 3300038443 | Bacteria | 5631 |
| 531 | Ga0436360_1016720 | 3300039438 | Bacteria | 2610 |
| 532 | Ga0436360_1099428 | 3300039438 | Bacteria | 5248 |
| 533 | Ga0436363_1339296 | 3300039450 | Bacteria | 15991 |
| 534 | Ga0439448_0017551 | 3300042005 | Bacteria | 2186 |
| 535 | Ga0439435_0000452 | 3300042436 | Bacteria | 6456 |
| 536 | Ga0439464_0000278 | 3300042439 | Bacteria | 9611 |
| 537 | Ga0451577_0012128 | 3300042876 | Bacteria | 8107 |
| 538 | Ga0451577_0069457 | 3300042876 | Bacteria | 3141 |
| 539 | Ga0453683_0016414 | 3300044673 | Bacteria | 4778 |
| 540 | Ga0451576_0021579 | 3300045051 | Bacteria | 6999 |
| 541 | Ga0495590_0036535 | 3300046457 | Bacteria | 1714 |
| 542 | Ga0495629_0055551 | 3300046459 | Bacteria | 2768 |
| 543 | Ga0495638_0005958 | 3300046460 | Bacteria | 8945 |
| 544 | Ga0495651_0004773 | 3300046462 | Bacteria | 10373 |
| 545 | Ga0495651_0010804 | 3300046462 | Bacteria | 7018 |
| 546 | Ga0495651_0050496 | 3300046462 | Bacteria | 3208 |
| 547 | Ga0495651_0124773 | 3300046462 | Bacteria | 1886 |
| 548 | Ga0495653_0084118 | 3300046463 | Bacteria | 2344 |
| 549 | Ga0495653_0095444 | 3300046463 | Bacteria | 2165 |
| 550 | Ga0495582_0000764 | 3300046473 | Bacteria | 17782 |
| 551 | Ga0495662_0002087 | 3300046476 | Bacteria | 10022 |
| 552 | Ga0495662_0048790 | 3300046476 | Bacteria | 2044 |
| 553 | Ga0495584_0016121 | 3300046491 | Bacteria | 3812 |
| 554 | Ga0495585_0008846 | 3300046492 | Bacteria | 6077 |
| 555 | Ga0495594_0047002 | 3300046499 | Bacteria | 2370 |
| 556 | Ga0495594_0060106 | 3300046499 | Bacteria | 2102 |
| 557 | Ga0495606_0006293 | 3300046507 | Bacteria | 11004 |
| 558 | Ga0495606_0022584 | 3300046507 | Bacteria | 4578 |
| 559 | Ga0495606_0074514 | 3300046507 | Bacteria | 2126 |
| 560 | Ga0495608_0034348 | 3300046511 | Bacteria | 3424 |
| 561 | Ga0495608_0040779 | 3300046511 | Bacteria | 3109 |
| 562 | Ga0495608_0047235 | 3300046511 | Bacteria | 2862 |
| 563 | Ga0495620_0025561 | 3300046515 | Bacteria | 2791 |
| 564 | Ga0495630_0000001 | 3300046517 | Bacteria | 1687293 |
| 565 | Ga0495630_0007013 | 3300046517 | Bacteria | 8032 |
| 566 | Ga0495631_0023956 | 3300046518 | Bacteria | 2824 |
| 567 | Ga0495643_0003854 | 3300046522 | Bacteria | 10798 |
| 568 | Ga0495586_0015659 | 3300046535 | Bacteria | 4035 |
| 569 | Ga0495587_0003660 | 3300046536 | Bacteria | 10234 |
| 570 | Ga0495587_0046712 | 3300046536 | Bacteria | 2569 |
| 571 | Ga0495598_0002310 | 3300046537 | Bacteria | 3921 |
| 572 | Ga0495645_0019365 | 3300046543 | Bacteria | 4899 |
| 573 | Ga0495667_0002542 | 3300046559 | Bacteria | 12178 |
| 574 | Ga0495667_0005025 | 3300046559 | Bacteria | 8939 |
| 575 | Ga0495667_0021596 | 3300046559 | Bacteria | 4343 |
| 576 | Ga0495656_0019344 | 3300046615 | Bacteria | 2628 |
| 577 | Ga0495668_0030109 | 3300046616 | Bacteria | 3066 |
| 578 | Ga0495668_0064029 | 3300046616 | Bacteria | 2025 |
| 579 | Ga0495625_0112980 | 3300046660 | Bacteria | 1855 |
| 580 | Ga0495635_0049589 | 3300046663 | Bacteria | 2893 |
| 581 | Ga0495635_0051579 | 3300046663 | Bacteria | 2834 |
| 582 | Ga0495661_0038485 | 3300046665 | Bacteria | 2979 |
| 583 | Ga0495657_0051197 | 3300046675 | Bacteria | 2773 |
| 584 | Ga0495599_0028643 | 3300046678 | Bacteria | 3490 |
| 585 | Ga0495623_0048001 | 3300046679 | Bacteria | 2709 |
| 586 | Ga0495623_0065837 | 3300046679 | Bacteria | 2265 |
| 587 | Ga0495613_0044355 | 3300046689 | Bacteria | 3290 |
| 588 | Ga0495581_0083315 | 3300047315 | Bacteria | 1852 |
| 589 | Ga0495604_0001655 | 3300047317 | Bacteria | 18324 |
| 590 | Ga0495604_0058062 | 3300047317 | Bacteria | 2973 |
| 591 | Ga0495674_0014701 | 3300047319 | Bacteria | 7325 |
| 592 | Ga0495674_0119231 | 3300047319 | Bacteria | 2230 |
| 593 | Ga0495675_0006140 | 3300047444 | Bacteria | 7358 |
| 594 | Ga0495684_0002042 | 3300047471 | Bacteria | 16246 |
| 595 | Ga0495684_0003890 | 3300047471 | Bacteria | 11633 |
| 596 | Ga0495684_0074111 | 3300047471 | Bacteria | 2586 |
| 597 | Ga0495684_0113864 | 3300047471 | Bacteria | 2039 |
| 598 | Ga0495686_0081486 | 3300047472 | Bacteria | 1976 |
| 599 | Ga0495593_0006970 | 3300047673 | Bacteria | 6623 |
| 600 | Ga0495602_0014795 | 3300048088 | Bacteria | 7902 |
| 601 | Ga0496100_0022742 | 3300048903 | Bacteria | 3797 |
| 602 | Ga0496101_0008040 | 3300048904 | Bacteria | 6876 |
| 603 | Ga0496101_0031087 | 3300048904 | Bacteria | 3750 |
| 604 | Ga0496101_0085910 | 3300048904 | Unclassified | 2332 |
| 605 | Ga0496102_0017251 | 3300048905 | Bacteria | 6323 |
| 606 | Ga0496103_0015676 | 3300048906 | Bacteria | 4518 |
| 607 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 608 | Ga0496104_0003162 | 3300048907 | Bacteria | 14174 |
| 609 | Ga0496104_0077923 | 3300048907 | Bacteria | 3158 |
| 610 | Ga0496105_0000014 | 3300048908 | Bacteria | 220911 |
| 611 | Ga0496105_0008988 | 3300048908 | Bacteria | 7794 |
| 612 | Ga0496106_0003590 | 3300048909 | Bacteria | 11563 |
| 613 | Ga0496106_0014750 | 3300048909 | Bacteria | 5777 |
| 614 | Ga0496106_0018996 | 3300048909 | Bacteria | 5094 |
| 615 | Ga0496107_0011333 | 3300048910 | Bacteria | 6205 |
| 616 | Ga0496107_0030480 | 3300048910 | Bacteria | 3845 |
| 617 | Ga0496107_0046080 | 3300048910 | Bacteria | 3138 |
| 618 | Ga0496108_0001362 | 3300048911 | Bacteria | 19210 |
| 619 | Ga0496109_0004451 | 3300048912 | Bacteria | 11701 |
| 620 | Ga0496109_0006154 | 3300048912 | Bacteria | 10087 |
| 621 | Ga0496109_0067323 | 3300048912 | Bacteria | 3280 |
| 622 | Ga0496111_0001111 | 3300048914 | Bacteria | 14909 |
| 623 | Ga0496112_0001433 | 3300048915 | Bacteria | 18299 |
| 624 | Ga0496112_0027792 | 3300048915 | Bacteria | 5457 |
| 625 | Ga0496112_0049418 | 3300048915 | Bacteria | 4123 |
| 626 | Ga0496112_0097163 | 3300048915 | Bacteria | 2916 |
| 627 | Ga0496112_0121431 | 3300048915 | Bacteria | 2583 |
| 628 | Ga0496113_0001251 | 3300048916 | Bacteria | 13990 |
| 629 | Ga0496113_0163284 | 3300048916 | Bacteria | 1762 |
| 630 | Ga0496114_0000605 | 3300048917 | Bacteria | 26516 |
| 631 | Ga0496115_0004711 | 3300048918 | Bacteria | 9892 |
| 632 | Ga0496115_0021418 | 3300048918 | Bacteria | 4994 |
| 633 | Ga0496118_0006767 | 3300048921 | Bacteria | 12467 |
| 634 | Ga0496121_0027871 | 3300048924 | Bacteria | 5275 |
| 635 | Ga0496124_0036705 | 3300048927 | Bacteria | 4271 |
| 636 | Ga0496126_0037232 | 3300048929 | Bacteria | 4542 |
| 637 | Ga0496126_0068448 | 3300048929 | Bacteria | 3170 |
| 638 | Ga0496126_0089746 | 3300048929 | Unclassified | 2705 |
| 639 | Ga0496126_0107717 | 3300048929 | Bacteria | 2430 |
| 640 | Ga0501033_0012779 | 3300049570 | Bacteria | 6402 |
| 641 | Ga0501034_0019802 | 3300049571 | Bacteria | 6876 |
| 642 | Ga0501034_0091799 | 3300049571 | Bacteria | 3034 |
| 643 | Ga0501036_0003473 | 3300049572 | Bacteria | 12596 |
| 644 | Ga0501036_0017501 | 3300049572 | Bacteria | 5993 |
| 645 | Ga0501036_0061746 | 3300049572 | Bacteria | 3174 |
| 646 | Ga0501036_0068608 | 3300049572 | Bacteria | 3000 |
| 647 | Ga0501037_0030911 | 3300049573 | Bacteria | 3955 |
| 648 | Ga0501038_0002013 | 3300049574 | Bacteria | 18771 |
| 649 | Ga0501038_0131447 | 3300049574 | Bacteria | 2055 |
| 650 | Ga0501039_0019011 | 3300049575 | Bacteria | 5273 |
| 651 | Ga0501039_0026867 | 3300049575 | Bacteria | 4424 |
| 652 | Ga0501039_0096725 | 3300049575 | Bacteria | 2302 |
| 653 | Ga0501039_0098805 | 3300049575 | Bacteria | 2277 |
| 654 | Ga0501040_0000723 | 3300049576 | Bacteria | 20393 |
| 655 | Ga0501040_0000999 | 3300049576 | Bacteria | 17899 |
| 656 | Ga0501040_0020551 | 3300049576 | Bacteria | 4401 |
| 657 | Ga0501040_0038713 | 3300049576 | Bacteria | 3241 |
| 658 | Ga0501041_0000056 | 3300049577 | Bacteria | 40879 |
| 659 | Ga0501041_0003865 | 3300049577 | Bacteria | 8618 |
| 660 | Ga0501041_0033269 | 3300049577 | Bacteria | 3118 |
| 661 | Ga0501042_0001793 | 3300049578 | Bacteria | 12844 |
| 662 | Ga0501042_0079205 | 3300049578 | Bacteria | 2353 |
| 663 | Ga0501042_0087351 | 3300049578 | Bacteria | 2237 |
| 664 | Ga0501042_0095105 | 3300049578 | Bacteria | 2140 |
| 665 | Ga0501043_0041938 | 3300049579 | Bacteria | 3595 |
| 666 | Ga0501043_0110221 | 3300049579 | Bacteria | 2161 |
| 667 | Ga0501046_0000308 | 3300049580 | Bacteria | 49533 |
| 668 | Ga0501046_0008050 | 3300049580 | Bacteria | 9214 |
| 669 | Ga0501046_0115879 | 3300049580 | Bacteria | 2043 |
| 670 | Ga0501047_0027549 | 3300049581 | Bacteria | 5475 |
| 671 | Ga0501047_0042761 | 3300049581 | Bacteria | 4377 |
| 672 | Ga0501047_0043135 | 3300049581 | Bacteria | 4357 |
| 673 | Ga0501047_0055629 | 3300049581 | Bacteria | 3826 |
| 674 | Ga0501048_0003052 | 3300049582 | Bacteria | 12759 |
| 675 | Ga0501048_0061790 | 3300049582 | Bacteria | 2652 |
| 676 | Ga0501048_0071828 | 3300049582 | Bacteria | 2443 |
| 677 | Ga0501067_0000047 | 3300049583 | Bacteria | 71799 |
| 678 | Ga0501067_0004765 | 3300049583 | Bacteria | 7514 |
| 679 | Ga0501068_0038906 | 3300049584 | Bacteria | 2850 |
| 680 | Ga0501069_0012595 | 3300049585 | Bacteria | 4498 |
| 681 | Ga0501069_0026725 | 3300049585 | Bacteria | 3161 |
| 682 | Ga0501070_0000004 | 3300049586 | Bacteria | 254956 |
| 683 | Ga0501070_0003413 | 3300049586 | Bacteria | 13775 |
| 684 | Ga0501070_0042848 | 3300049586 | Bacteria | 3769 |
| 685 | Ga0501071_0000181 | 3300049587 | Bacteria | 27971 |
| 686 | Ga0501071_0020444 | 3300049587 | Bacteria | 4601 |
| 687 | Ga0501072_0002081 | 3300049588 | Bacteria | 14893 |
| 688 | Ga0501072_0002955 | 3300049588 | Bacteria | 12802 |
| 689 | Ga0501072_0045364 | 3300049588 | Bacteria | 3456 |
| 690 | Ga0501073_0000116 | 3300049589 | Bacteria | 51190 |
| 691 | Ga0501073_0001796 | 3300049589 | Bacteria | 15963 |
| 692 | Ga0501073_0002310 | 3300049589 | Bacteria | 14268 |
| 693 | Ga0501073_0055121 | 3300049589 | Bacteria | 2782 |
| 694 | Ga0501074_0010501 | 3300049590 | Bacteria | 6721 |
| 695 | Ga0501074_0039374 | 3300049590 | Bacteria | 3424 |
| 696 | Ga0501074_0051281 | 3300049590 | Bacteria | 2978 |
| 697 | Ga0501074_0098150 | 3300049590 | Bacteria | 2097 |
| 698 | Ga0501075_0000781 | 3300049591 | Bacteria | 19885 |
| 699 | Ga0501075_0027282 | 3300049591 | Bacteria | 4208 |
| 700 | Ga0501075_0089627 | 3300049591 | Bacteria | 2332 |
| 701 | Ga0501076_0000164 | 3300049592 | Bacteria | 38475 |
| 702 | Ga0501076_0017555 | 3300049592 | Bacteria | 5440 |
| 703 | Ga0501077_0000214 | 3300049593 | Bacteria | 33816 |
| 704 | Ga0501077_0065327 | 3300049593 | Bacteria | 2307 |
| 705 | Ga0501079_0002624 | 3300049741 | Bacteria | 13071 |
| 706 | Ga0501079_0034966 | 3300049741 | Bacteria | 3866 |
| 707 | Ga0501080_0009120 | 3300049742 | Bacteria | 9031 |
| 708 | Ga0501080_0068992 | 3300049742 | Bacteria | 3288 |
| 709 | Ga0501080_0080503 | 3300049742 | Bacteria | 3027 |
| 710 | Ga0501081_0000077 | 3300049743 | Bacteria | 38611 |
| 711 | Ga0501081_0001401 | 3300049743 | Bacteria | 14718 |
| 712 | Ga0501083_0014521 | 3300049744 | Bacteria | 5507 |
| 713 | Ga0501083_0032970 | 3300049744 | Bacteria | 3548 |
| 714 | Ga0501083_0033459 | 3300049744 | Bacteria | 3520 |
| 715 | Ga0501083_0040862 | 3300049744 | Bacteria | 3147 |
| 716 | Ga0501035_0011181 | 3300049822 | Bacteria | 8312 |
| 717 | Ga0501044_0013237 | 3300049823 | Bacteria | 8931 |
| 718 | Ga0501045_0000175 | 3300049824 | Bacteria | 35180 |
| 719 | Ga0501045_0036296 | 3300049824 | Bacteria | 3579 |
| 720 | Ga0501045_0095911 | 3300049824 | Bacteria | 2194 |
| 721 | nmdc:mga0yw44_25663_c1 | 3300050492 | Bacteria | 3355 |
| 722 | nmdc:mga0yw44_27104_c1 | 3300050492 | Bacteria | 3279 |
| 723 | nmdc:mga06z11_1398_c1 | 3300050494 | Bacteria | 8965 |
| 724 | nmdc:mga04h51_2684_c1 | 3300050495 | Bacteria | 4239 |
| 725 | nmdc:mga07m45_36246_c2 | 3300050496 | Bacteria | 2322 |
| 726 | nmdc:mga05p37_2020_c1 | 3300050507 | Bacteria | 23672 |
| 727 | nmdc:mga05p37_212017_c1 | 3300050507 | Bacteria | 2341 |
| 728 | nmdc:mga05p37_40526_c1 | 3300050507 | Bacteria | 5720 |
| 729 | nmdc:mga05p37_5476_c1 | 3300050507 | Bacteria | 14906 |
| 730 | nmdc:mga09592_5547_c1 | 3300050508 | Bacteria | 10269 |
| 731 | nmdc:mga0qj67_181597_c1 | 3300050509 | Bacteria | 1709 |
| 732 | nmdc:mga06r32_109493_c1 | 3300050510 | Bacteria | 2717 |
| 733 | nmdc:mga06r32_44260_c2 | 3300050510 | Bacteria | 2718 |
| 734 | nmdc:mga06r32_4814_c1 | 3300050510 | Bacteria | 12152 |
| 735 | nmdc:mga08y16_145067_c1 | 3300050511 | Bacteria | 2468 |
| 736 | nmdc:mga08y16_153247_c1 | 3300050511 | Bacteria | 2395 |
| 737 | nmdc:mga08y16_181085_c1 | 3300050511 | Bacteria | 2188 |
| 738 | nmdc:mga08y16_325253_c1 | 3300050511 | Bacteria | 1582 |
| 739 | nmdc:mga08y16_3958_c1 | 3300050511 | Bacteria | 15428 |
| 740 | nmdc:mga08y16_47265_c1 | 3300050511 | Bacteria | 4504 |
| 741 | nmdc:mga0n895_21683_c1 | 3300050512 | Bacteria | 6012 |
| 742 | nmdc:mga0n895_34586_c1 | 3300050512 | Bacteria | 4865 |
| 743 | nmdc:mga0n895_520_c1 | 3300050512 | Bacteria | 26193 |
| 744 | nmdc:mga0rr50_105793_c1 | 3300050513 | Bacteria | 2219 |
| 745 | nmdc:mga0rr50_41745_c1 | 3300050513 | Bacteria | 3345 |
| 746 | nmdc:mga0rr50_65178_c1 | 3300050513 | Bacteria | 2758 |
| 747 | nmdc:mga0a205_344_c1 | 3300050515 | Bacteria | 35080 |
| 748 | nmdc:mga0a205_67881_c1 | 3300050515 | Bacteria | 3444 |
| 749 | nmdc:mga0a205_79984_c1 | 3300050515 | Bacteria | 3158 |
| 750 | nmdc:mga0sz30_39604_c1 | 3300050516 | Bacteria | 1978 |
| 751 | Ga0495601_0017121 | 3300053077 | Bacteria | 4398 |
| 752 | Ga0495601_0055372 | 3300053077 | Bacteria | 2511 |
| 753 | Ga0495595_0006034 | 3300053084 | Bacteria | 4924 |
| 754 | Ga0495595_0012285 | 3300053084 | Bacteria | 3596 |
| 755 | Ga0495619_0009996 | 3300053085 | Bacteria | 5975 |
| 756 | Ga0495619_0035508 | 3300053085 | Bacteria | 3242 |
| 757 | Ga0500651_0020089 | 3300053093 | Bacteria | 4156 |
| 758 | Ga0500641_0010728 | 3300053096 | Bacteria | 3318 |
| 759 | Ga0500562_002576 | 3300053108 | Bacteria | 4518 |
| 760 | Ga0500569_004620 | 3300053109 | Bacteria | 2905 |
| 761 | Ga0500595_016042 | 3300053119 | Bacteria | 2797 |
| 762 | Ga0500622_0004599 | 3300053156 | Bacteria | 8578 |
| 763 | Ga0500599_002793 | 3300053736 | Bacteria | 2110 |
| 764 | Ga0501084_0002013 | 3300054114 | Bacteria | 16235 |
| 765 | Ga0501084_0004719 | 3300054114 | Bacteria | 11134 |
| 766 | Ga0501084_0095650 | 3300054114 | Bacteria | 2495 |
| 767 | Ga0501084_0096375 | 3300054114 | Bacteria | 2485 |
| 768 | Ga0590071_014223 | 3300059421 | Bacteria | 1866 |
| 769 | Ga0587066_000021 | 3300059490 | Bacteria | 7155 |
| 770 | Ga0587070_000288 | 3300059491 | Bacteria | 3763 |
| 771 | Ga0587082_000047 | 3300059504 | Bacteria | 6105 |
| 772 | Ga0587088_000091 | 3300059508 | Bacteria | 4924 |
| 773 | Ga0587092_000171 | 3300059512 | Bacteria | 4226 |
| 774 | Ga0587067_000080 | 3300059640 | Bacteria | 5744 |
| 775 | Ga0587071_000045 | 3300060344 | Bacteria | 7142 |
| 776 | Ga0501082_0001219 | 3300060353 | Bacteria | 22593 |
| 777 | Ga0501082_0002918 | 3300060353 | Bacteria | 14920 |
| 778 | Ga0501082_0009373 | 3300060353 | Bacteria | 8432 |
| 779 | Ga0501082_0012080 | 3300060353 | Bacteria | 7421 |
| 780 | Ga0501082_0028888 | 3300060353 | Bacteria | 4777 |
| 781 | Ga0530510_0000438 | 3300061734 | Bacteria | 26867 |
| 782 | Ga0530510_0023838 | 3300061734 | Bacteria | 4363 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050509 | nmdc:mga0qj67_181597_c1 | nmdc:mga0qj67_181597_c1_309_1688 | 456 |
| 2 | 3300035086 | Ga0373934_0020770 | Ga0373934_0020770_1040_2503 | 458 |
| 3 | 3300048929 | Ga0496126_0068448 | Ga0496126_0068448_17_1432 | 459 |
| 4 | 3300026118 | Ga0207675_100240073 | Ga0207675_1002400732 | 463 |
| 5 | 3300050511 | nmdc:mga08y16_325253_c1 | nmdc:mga08y16_325253_c1_25_1431 | 465 |
| 6 | 3300046462 | Ga0495651_0124773 | Ga0495651_0124773_417_1853 | 468 |
| 7 | 3300048904 | Ga0496101_0085910 | Ga0496101_0085910_55_1503 | 474 |
| 8 | 3300049744 | Ga0501083_0014521 | Ga0501083_0014521_37_1521 | 475 |
| 9 | 3300049579 | Ga0501043_0110221 | Ga0501043_0110221_669_2126 | 477 |
| 10 | 3300009093 | Ga0105240_10111444 | Ga0105240_101114441 | 481 |
| 11 | 3300048929 | Ga0496126_0089746 | Ga0496126_0089746_47_1570 | 498 |
| 12 | 3300009093 | Ga0105240_10071421 | Ga0105240_100714212 | 504 |
| 13 | 3300009551 | Ga0105238_10005614 | Ga0105238_100056148 | 504 |
| 14 | 3300025924 | Ga0207694_10004726 | Ga0207694_100047266 | 504 |
| 15 | 3300005354 | Ga0070675_100102579 | Ga0070675_1001025792 | 505 |
| 16 | 3300025944 | Ga0207661_10126659 | Ga0207661_101266592 | 505 |
| 17 | 3300050511 | nmdc:mga08y16_47265_c1 | nmdc:mga08y16_47265_c1_2090_3772 | 505 |
| 18 | 3300013296 | Ga0157374_10153429 | Ga0157374_101534292 | 506 |
| 19 | 3300049586 | Ga0501070_0042848 | Ga0501070_0042848_236_1864 | 507 |
| 20 | 3300035084 | Ga0373928_0014678 | Ga0373928_0014678_39_1574 | 508 |
| 21 | 3300049570 | Ga0501033_0012779 | Ga0501033_0012779_3203_4885 | 512 |
| 22 | 3300049572 | Ga0501036_0003473 | Ga0501036_0003473_2343_4025 | 512 |
| 23 | 3300049574 | Ga0501038_0002013 | Ga0501038_0002013_3931_5613 | 512 |
| 24 | 3300049575 | Ga0501039_0026867 | Ga0501039_0026867_2217_3899 | 512 |
| 25 | 3300049576 | Ga0501040_0000999 | Ga0501040_0000999_14735_16417 | 512 |
| 26 | 3300049577 | Ga0501041_0000056 | Ga0501041_0000056_30542_32224 | 512 |
| 27 | 3300049578 | Ga0501042_0001793 | Ga0501042_0001793_7016_8698 | 512 |
| 28 | 3300049580 | Ga0501046_0008050 | Ga0501046_0008050_370_2052 | 512 |
| 29 | 3300049582 | Ga0501048_0003052 | Ga0501048_0003052_9658_11340 | 512 |
| 30 | 3300049587 | Ga0501071_0000181 | Ga0501071_0000181_5205_6887 | 512 |
| 31 | 3300049588 | Ga0501072_0002955 | Ga0501072_0002955_1108_2790 | 512 |
| 32 | 3300049590 | Ga0501074_0039374 | Ga0501074_0039374_1415_3097 | 512 |
| 33 | 3300049591 | Ga0501075_0000781 | Ga0501075_0000781_13943_15625 | 512 |
| 34 | 3300049592 | Ga0501076_0000164 | Ga0501076_0000164_6299_7981 | 512 |
| 35 | 3300049593 | Ga0501077_0000214 | Ga0501077_0000214_31452_33134 | 512 |
| 36 | 3300049741 | Ga0501079_0002624 | Ga0501079_0002624_8198_9880 | 512 |
| 37 | 3300049742 | Ga0501080_0009120 | Ga0501080_0009120_7339_9021 | 512 |
| 38 | 3300049743 | Ga0501081_0000077 | Ga0501081_0000077_30036_31718 | 512 |
| 39 | 3300049744 | Ga0501083_0040862 | Ga0501083_0040862_307_1989 | 512 |
| 40 | 3300049822 | Ga0501035_0011181 | Ga0501035_0011181_5377_7059 | 512 |
| 41 | 3300054114 | Ga0501084_0004719 | Ga0501084_0004719_8742_10424 | 512 |
| 42 | 3300060353 | Ga0501082_0001219 | Ga0501082_0001219_14792_16474 | 512 |
| 43 | 3300061734 | Ga0530510_0000438 | Ga0530510_0000438_7911_9593 | 512 |
| 44 | 3300048915 | Ga0496112_0027792 | Ga0496112_0027792_2370_4022 | 516 |
| 45 | 3300005548 | Ga0070665_100022014 | Ga0070665_1000220147 | 522 |
| 46 | 3300014969 | Ga0157376_10019723 | Ga0157376_100197232 | 522 |
| 47 | 3300028379 | Ga0268266_10003458 | Ga0268266_1000345811 | 522 |
| 48 | 3300049574 | Ga0501038_0131447 | Ga0501038_0131447_87_1700 | 523 |
| 49 | 3300049575 | Ga0501039_0019011 | Ga0501039_0019011_2284_3897 | 523 |
| 50 | 3300049578 | Ga0501042_0095105 | Ga0501042_0095105_476_2089 | 523 |
| 51 | 3300049587 | Ga0501071_0020444 | Ga0501071_0020444_607_2220 | 523 |
| 52 | 3300049592 | Ga0501076_0017555 | Ga0501076_0017555_2439_4052 | 523 |
| 53 | 3300049824 | Ga0501045_0036296 | Ga0501045_0036296_235_1848 | 523 |
| 54 | iso_pu_bacteria | 2929921140 | 2929926546 | 523 |
| 55 | 3300005543 | Ga0070672_100039589 | Ga0070672_1000395893 | 524 |
| 56 | 3300013306 | Ga0163162_10154283 | Ga0163162_101542831 | 524 |
| 57 | 3300025923 | Ga0207681_10022455 | Ga0207681_100224552 | 524 |
| 58 | 3300025940 | Ga0207691_10038344 | Ga0207691_100383442 | 524 |
| 59 | 3300026118 | Ga0207675_100020525 | Ga0207675_1000205252 | 524 |
| 60 | 3300039438 | Ga0436360_1016720 | Ga0436360_1016720_724_2346 | 524 |
| 61 | 3300042436 | Ga0439435_0000452 | Ga0439435_0000452_3903_5534 | 524 |
| 62 | 3300049571 | Ga0501034_0019802 | Ga0501034_0019802_4665_6398 | 524 |
| 63 | 3300049573 | Ga0501037_0030911 | Ga0501037_0030911_470_2092 | 524 |
| 64 | 3300049582 | Ga0501048_0071828 | Ga0501048_0071828_696_2429 | 524 |
| 65 | 3300049583 | Ga0501067_0004765 | Ga0501067_0004765_1492_3225 | 524 |
| 66 | 3300049584 | Ga0501068_0038906 | Ga0501068_0038906_134_1867 | 524 |
| 67 | 3300049585 | Ga0501069_0026725 | Ga0501069_0026725_48_1670 | 524 |
| 68 | 3300049589 | Ga0501073_0002310 | Ga0501073_0002310_7333_9066 | 524 |
| 69 | 3300049744 | Ga0501083_0032970 | Ga0501083_0032970_479_2212 | 524 |
| 70 | 3300060353 | Ga0501082_0028888 | Ga0501082_0028888_715_2448 | 524 |
| 71 | 3300046517 | Ga0495630_0007013 | Ga0495630_0007013_5525_7165 | 525 |
| 72 | 3300046535 | Ga0495586_0015659 | Ga0495586_0015659_444_2084 | 525 |
| 73 | 3300046663 | Ga0495635_0051579 | Ga0495635_0051579_126_1775 | 525 |
| 74 | 3300047319 | Ga0495674_0014701 | Ga0495674_0014701_5501_7141 | 525 |
| 75 | 3300049575 | Ga0501039_0098805 | Ga0501039_0098805_329_2047 | 525 |
| 76 | 3300049576 | Ga0501040_0038713 | Ga0501040_0038713_321_2039 | 525 |
| 77 | 3300049590 | Ga0501074_0098150 | Ga0501074_0098150_146_1864 | 525 |
| 78 | 3300053077 | Ga0495601_0055372 | Ga0495601_0055372_809_2449 | 525 |
| 79 | 3300061734 | Ga0530510_0023838 | Ga0530510_0023838_2248_3966 | 525 |
| 80 | 3300046522 | Ga0495643_0003854 | Ga0495643_0003854_5594_7222 | 526 |
| 81 | 3300048915 | Ga0496112_0097163 | Ga0496112_0097163_482_2095 | 526 |
| 82 | 3300049585 | Ga0501069_0012595 | Ga0501069_0012595_31_1659 | 526 |
| 83 | 3300053096 | Ga0500641_0010728 | Ga0500641_0010728_13_1701 | 526 |
| 84 | 3300034818 | Ga0373950_0000004 | Ga0373950_0000004_372205_373914 | 527 |
| 85 | 3300035086 | Ga0373934_0001038 | Ga0373934_0001038_80_1723 | 527 |
| 86 | 3300036401 | Ga0373937_0009564 | Ga0373937_0009564_4822_6465 | 527 |
| 87 | 3300046462 | Ga0495651_0004773 | Ga0495651_0004773_460_2103 | 527 |
| 88 | 3300049572 | Ga0501036_0017501 | Ga0501036_0017501_4017_5669 | 527 |
| 89 | 3300049583 | Ga0501067_0000047 | Ga0501067_0000047_65039_66736 | 527 |
| 90 | 3300049589 | Ga0501073_0000116 | Ga0501073_0000116_42025_43722 | 527 |
| 91 | 3300049590 | Ga0501074_0010501 | Ga0501074_0010501_4174_5799 | 527 |
| 92 | iso_pu_bacteria | 2929177148 | 2929179244 | 527 |
| 93 | iso_pu_bacteria | 2945977869 | 2945981649 | 527 |
| 94 | iso_pu_bacteria | 2946013367 | 2946018948 | 527 |
| 95 | 3300003320 | rootH2_10007600 | rootH2_100076009 | 528 |
| 96 | 3300005339 | Ga0070660_100033219 | Ga0070660_1000332192 | 528 |
| 97 | 3300005344 | Ga0070661_100033996 | Ga0070661_1000339962 | 528 |
| 98 | 3300005355 | Ga0070671_100026958 | Ga0070671_1000269582 | 528 |
| 99 | 3300005367 | Ga0070667_100050429 | Ga0070667_1000504292 | 528 |
| 100 | 3300005458 | Ga0070681_10076439 | Ga0070681_100764392 | 528 |
| 101 | 3300005539 | Ga0068853_100123661 | Ga0068853_1001236611 | 528 |
| 102 | 3300006844 | Ga0075428_100044000 | Ga0075428_1000440002 | 528 |
| 103 | 3300006847 | Ga0075431_100006638 | Ga0075431_1000066383 | 528 |
| 104 | 3300006852 | Ga0075433_10012921 | Ga0075433_100129212 | 528 |
| 105 | 3300006871 | Ga0075434_100149194 | Ga0075434_1001491942 | 528 |
| 106 | 3300006880 | Ga0075429_100009232 | Ga0075429_1000092322 | 528 |
| 107 | 3300007076 | Ga0075435_100071219 | Ga0075435_1000712192 | 528 |
| 108 | 3300009093 | Ga0105240_10071166 | Ga0105240_100711663 | 528 |
| 109 | 3300009094 | Ga0111539_10010470 | Ga0111539_100104707 | 528 |
| 110 | 3300009147 | Ga0114129_10005646 | Ga0114129_100056468 | 528 |
| 111 | 3300009174 | Ga0105241_10032532 | Ga0105241_100325322 | 528 |
| 112 | 3300009177 | Ga0105248_10053684 | Ga0105248_100536842 | 528 |
| 113 | 3300009545 | Ga0105237_10015439 | Ga0105237_100154393 | 528 |
| 114 | 3300010375 | Ga0105239_10009835 | Ga0105239_100098352 | 528 |
| 115 | 3300013100 | Ga0157373_10024396 | Ga0157373_100243962 | 528 |
| 116 | 3300013296 | Ga0157374_10030972 | Ga0157374_100309722 | 528 |
| 117 | 3300013297 | Ga0157378_10032559 | Ga0157378_100325592 | 528 |
| 118 | 3300014497 | Ga0182008_10001734 | Ga0182008_100017342 | 528 |
| 119 | 3300014969 | Ga0157376_10008786 | Ga0157376_100087865 | 528 |
| 120 | 3300015262 | Ga0182007_10003243 | Ga0182007_100032432 | 528 |
| 121 | 3300015265 | Ga0182005_1003229 | Ga0182005_10032293 | 528 |
| 122 | 3300020070 | Ga0206356_11293394 | Ga0206356_112933942 | 528 |
| 123 | 3300020078 | Ga0206352_10204954 | Ga0206352_102049542 | 528 |
| 124 | 3300020080 | Ga0206350_10435960 | Ga0206350_104359602 | 528 |
| 125 | 3300025919 | Ga0207657_10000821 | Ga0207657_1000082126 | 528 |
| 126 | 3300025920 | Ga0207649_10009926 | Ga0207649_100099262 | 528 |
| 127 | 3300025932 | Ga0207690_10008982 | Ga0207690_100089823 | 528 |
| 128 | 3300025941 | Ga0207711_10049236 | Ga0207711_100492362 | 528 |
| 129 | 3300025949 | Ga0207667_10119852 | Ga0207667_101198522 | 528 |
| 130 | 3300026088 | Ga0207641_10126097 | Ga0207641_101260972 | 528 |
| 131 | 3300027907 | Ga0207428_10019525 | Ga0207428_100195254 | 528 |
| 132 | 3300035086 | Ga0373934_0002734 | Ga0373934_0002734_2697_4346 | 528 |
| 133 | 3300035724 | Ga0373933_0002421 | Ga0373933_0002421_7043_8692 | 528 |
| 134 | 3300036401 | Ga0373937_0022329 | Ga0373937_0022329_2208_3857 | 528 |
| 135 | 3300046462 | Ga0495651_0010804 | Ga0495651_0010804_5024_6673 | 528 |
| 136 | 3300046463 | Ga0495653_0095444 | Ga0495653_0095444_365_2014 | 528 |
| 137 | 3300046499 | Ga0495594_0047002 | Ga0495594_0047002_490_2139 | 528 |
| 138 | 3300046536 | Ga0495587_0046712 | Ga0495587_0046712_780_2429 | 528 |
| 139 | 3300046679 | Ga0495623_0048001 | Ga0495623_0048001_16_1665 | 528 |
| 140 | 3300047317 | Ga0495604_0001655 | Ga0495604_0001655_1035_2684 | 528 |
| 141 | 3300047471 | Ga0495684_0074111 | Ga0495684_0074111_16_1665 | 528 |
| 142 | 3300047471 | Ga0495684_0113864 | Ga0495684_0113864_307_1950 | 528 |
| 143 | 3300048088 | Ga0495602_0014795 | Ga0495602_0014795_2068_3717 | 528 |
| 144 | 3300048909 | Ga0496106_0018996 | Ga0496106_0018996_2452_4101 | 528 |
| 145 | 3300048912 | Ga0496109_0067323 | Ga0496109_0067323_843_2492 | 528 |
| 146 | 3300049586 | Ga0501070_0000004 | Ga0501070_0000004_186774_188408 | 528 |
| 147 | 3300049742 | Ga0501080_0068992 | Ga0501080_0068992_473_2107 | 528 |
| 148 | 3300050507 | nmdc:mga05p37_2020_c1 | nmdc:mga05p37_2020_c1_2778_4403 | 528 |
| 149 | 3300050508 | nmdc:mga09592_5547_c1 | nmdc:mga09592_5547_c1_2154_3779 | 528 |
| 150 | 3300050510 | nmdc:mga06r32_4814_c1 | nmdc:mga06r32_4814_c1_5266_6891 | 528 |
| 151 | 3300050511 | nmdc:mga08y16_3958_c1 | nmdc:mga08y16_3958_c1_11374_13002 | 528 |
| 152 | 3300050512 | nmdc:mga0n895_21683_c1 | nmdc:mga0n895_21683_c1_516_2165 | 528 |
| 153 | 3300050513 | nmdc:mga0rr50_65178_c1 | nmdc:mga0rr50_65178_c1_612_2261 | 528 |
| 154 | 3300050515 | nmdc:mga0a205_67881_c1 | nmdc:mga0a205_67881_c1_299_1948 | 528 |
| 155 | 3300053085 | Ga0495619_0035508 | Ga0495619_0035508_1466_3109 | 528 |
| 156 | 3300059490 | Ga0587066_000021 | Ga0587066_000021_3377_5026 | 528 |
| 157 | 3300059491 | Ga0587070_000288 | Ga0587070_000288_717_2366 | 528 |
| 158 | 3300059504 | Ga0587082_000047 | Ga0587082_000047_2125_3774 | 528 |
| 159 | 3300059508 | Ga0587088_000091 | Ga0587088_000091_1390_3039 | 528 |
| 160 | 3300059512 | Ga0587092_000171 | Ga0587092_000171_1861_3510 | 528 |
| 161 | 3300059640 | Ga0587067_000080 | Ga0587067_000080_717_2366 | 528 |
| 162 | 3300060344 | Ga0587071_000045 | Ga0587071_000045_3345_4994 | 528 |
| 163 | 3300060353 | Ga0501082_0002918 | Ga0501082_0002918_1586_3220 | 528 |
| 164 | iso_pu_bacteria | 2643221618 | 2644105858 | 528 |
| 165 | iso_pu_bacteria | 2643221626 | 2644147176 | 528 |
| 166 | iso_pu_bacteria | 2643221643 | 2644238259 | 528 |
| 167 | iso_pu_bacteria | 2643221655 | 2644310470 | 528 |
| 168 | iso_pu_bacteria | 2643221659 | 2644334745 | 528 |
| 169 | iso_pu_bacteria | 2643221698 | 2644545061 | 528 |
| 170 | iso_pu_bacteria | 2643221712 | 2644612572 | 528 |
| 171 | iso_pu_bacteria | 2844163670 | 2844165554 | 528 |
| 172 | iso_pu_bacteria | 2884791551 | 2884794051 | 528 |
| 173 | iso_pu_bacteria | 2939669807 | 2939672450 | 528 |
| 174 | 3300005331 | Ga0070670_100046479 | Ga0070670_1000464792 | 529 |
| 175 | 3300005354 | Ga0070675_100014324 | Ga0070675_1000143242 | 529 |
| 176 | 3300025926 | Ga0207659_10002574 | Ga0207659_100025749 | 529 |
| 177 | iso_pu_bacteria | 2513237104 | 2513718892 | 529 |
| 178 | iso_pu_bacteria | 2513237141 | 2513894834 | 529 |
| 179 | iso_pu_bacteria | 2582581283 | 2585169276 | 529 |
| 180 | iso_pu_bacteria | 2643221636 | 2644203035 | 529 |
| 181 | iso_pu_bacteria | 2767802442 | 2770197260 | 529 |
| 182 | iso_pu_bacteria | 2885409591 | 2885410029 | 529 |
| 183 | iso_pu_bacteria | 2894652903 | 2894657144 | 529 |
| 184 | 3300037068 | Ga0373925_0108187 | Ga0373925_0108187_489_2126 | 530 |
| 185 | 3300048915 | Ga0496112_0121431 | Ga0496112_0121431_371_2074 | 530 |
| 186 | 3300048927 | Ga0496124_0036705 | Ga0496124_0036705_1047_2648 | 530 |
| 187 | iso_pu_bacteria | 2528768022 | 2528851707 | 530 |
| 188 | iso_pu_bacteria | 2738543024 | 2739308502 | 530 |
| 189 | iso_pu_bacteria | 2816332527 | 2818236018 | 530 |
| 190 | iso_pu_bacteria | 2840764183 | 2840764809 | 530 |
| 191 | iso_pu_bacteria | 2841911363 | 2841913048 | 530 |
| 192 | iso_pu_bacteria | 2841917233 | 2841918795 | 530 |
| 193 | iso_pu_bacteria | 2917699015 | 2917701680 | 530 |
| 194 | iso_pu_bacteria | 2941531003 | 2941537654 | 530 |
| 195 | iso_pu_bacteria | 2996336353 | 2996339273 | 530 |
| 196 | iso_pu_bacteria | 3005710791 | 3005712874 | 530 |
| 197 | 3300003320 | rootH2_10055935 | rootH2_100559353 | 531 |
| 198 | 3300003323 | rootH1_10010931 | rootH1_100109313 | 531 |
| 199 | 3300005577 | Ga0068857_100012233 | Ga0068857_1000122332 | 531 |
| 200 | 3300026116 | Ga0207674_10074818 | Ga0207674_100748182 | 531 |
| 201 | 3300031249 | Ga0265339_10010845 | Ga0265339_100108454 | 531 |
| 202 | 3300046492 | Ga0495585_0008846 | Ga0495585_0008846_1712_3316 | 531 |
| 203 | 3300046507 | Ga0495606_0074514 | Ga0495606_0074514_236_1840 | 531 |
| 204 | 3300046515 | Ga0495620_0025561 | Ga0495620_0025561_1149_2753 | 531 |
| 205 | 3300046518 | Ga0495631_0023956 | Ga0495631_0023956_646_2250 | 531 |
| 206 | 3300046616 | Ga0495668_0030109 | Ga0495668_0030109_205_1809 | 531 |
| 207 | 3300046660 | Ga0495625_0112980 | Ga0495625_0112980_151_1755 | 531 |
| 208 | 3300046665 | Ga0495661_0038485 | Ga0495661_0038485_1033_2637 | 531 |
| 209 | 3300047472 | Ga0495686_0081486 | Ga0495686_0081486_208_1812 | 531 |
| 210 | 3300048929 | Ga0496126_0107717 | Ga0496126_0107717_616_2232 | 531 |
| 211 | iso_pu_bacteria | 2643221736 | 2644744949 | 531 |
| 212 | 3300004625 | Ga0055543_1010238 | Ga0055543_10102382 | 532 |
| 213 | 3300005262 | Ga0065165_1000162 | Ga0065165_10001622 | 532 |
| 214 | 3300005262 | Ga0065165_1000972 | Ga0065165_100097235 | 532 |
| 215 | 3300005329 | Ga0070683_100035061 | Ga0070683_1000350612 | 532 |
| 216 | 3300005347 | Ga0070668_100074847 | Ga0070668_1000748472 | 532 |
| 217 | 3300005441 | Ga0070700_100069947 | Ga0070700_1000699472 | 532 |
| 218 | 3300005456 | Ga0070678_100058855 | Ga0070678_1000588552 | 532 |
| 219 | 3300005543 | Ga0070672_100013051 | Ga0070672_1000130512 | 532 |
| 220 | 3300005544 | Ga0070686_100035732 | Ga0070686_1000357322 | 532 |
| 221 | 3300005616 | Ga0068852_100000929 | Ga0068852_1000009298 | 532 |
| 222 | 3300009174 | Ga0105241_10012748 | Ga0105241_100127482 | 532 |
| 223 | 3300009545 | Ga0105237_10008152 | Ga0105237_100081523 | 532 |
| 224 | 3300025254 | Ga0209148_1000274 | Ga0209148_100027456 | 532 |
| 225 | 3300025272 | Ga0209455_1002264 | Ga0209455_10022641 | 532 |
| 226 | 3300025302 | Ga0207426_1000598 | Ga0207426_100059845 | 532 |
| 227 | 3300025911 | Ga0207654_10011484 | Ga0207654_100114842 | 532 |
| 228 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015555 | 532 |
| 229 | 3300025914 | Ga0207671_10019093 | Ga0207671_100190933 | 532 |
| 230 | 3300025923 | Ga0207681_10015819 | Ga0207681_100158194 | 532 |
| 231 | 3300025937 | Ga0207669_10008584 | Ga0207669_100085844 | 532 |
| 232 | 3300025938 | Ga0207704_10054131 | Ga0207704_100541312 | 532 |
| 233 | 3300025940 | Ga0207691_10003838 | Ga0207691_1000383811 | 532 |
| 234 | 3300025944 | Ga0207661_10011440 | Ga0207661_100114403 | 532 |
| 235 | 3300026075 | Ga0207708_10000806 | Ga0207708_1000080621 | 532 |
| 236 | 3300026121 | Ga0207683_10090489 | Ga0207683_100904892 | 532 |
| 237 | 3300026142 | Ga0207698_10022413 | Ga0207698_100224131 | 532 |
| 238 | 3300033180 | Ga0307510_10002057 | Ga0307510_100020573 | 532 |
| 239 | 3300046460 | Ga0495638_0005958 | Ga0495638_0005958_3372_5198 | 532 |
| 240 | 3300046507 | Ga0495606_0022584 | Ga0495606_0022584_1645_3471 | 532 |
| 241 | 3300046615 | Ga0495656_0019344 | Ga0495656_0019344_544_2151 | 532 |
| 242 | 3300046616 | Ga0495668_0064029 | Ga0495668_0064029_77_1696 | 532 |
| 243 | 3300047317 | Ga0495604_0058062 | Ga0495604_0058062_1275_2894 | 532 |
| 244 | 3300048904 | Ga0496101_0008040 | Ga0496101_0008040_2192_3850 | 532 |
| 245 | 3300048910 | Ga0496107_0046080 | Ga0496107_0046080_1387_3045 | 532 |
| 246 | 3300048917 | Ga0496114_0000605 | Ga0496114_0000605_12512_14170 | 532 |
| 247 | 3300050492 | nmdc:mga0yw44_27104_c1 | nmdc:mga0yw44_27104_c1_788_2407 | 532 |
| 248 | 3300053108 | Ga0500562_002576 | Ga0500562_002576_1614_3440 | 532 |
| 249 | 3300053156 | Ga0500622_0004599 | Ga0500622_0004599_368_2194 | 532 |
| 250 | 3300053736 | Ga0500599_002793 | Ga0500599_002793_274_1893 | 532 |
| 251 | iso_pu_bacteria | 2513237096 | 2513656914 | 532 |
| 252 | iso_pu_bacteria | 2513237137 | 2513855992 | 532 |
| 253 | iso_pu_bacteria | 2513237145 | 2513918654 | 532 |
| 254 | iso_pu_bacteria | 2517572143 | 2517891900 | 532 |
| 255 | iso_pu_bacteria | 2885374607 | 2885382589 | 532 |
| 256 | iso_pu_bacteria | 2903748898 | 2903749486 | 532 |
| 257 | iso_pu_bacteria | 2906635258 | 2906643510 | 532 |
| 258 | iso_pu_bacteria | 2906660503 | 2906662268 | 532 |
| 259 | iso_pu_bacteria | 2935959822 | 2935963265 | 532 |
| 260 | iso_pu_bacteria | 3005474847 | 3005476695 | 532 |
| 261 | 3300003771 | Ga0055526_1000276 | Ga0055526_100027620 | 533 |
| 262 | 3300005328 | Ga0070676_10011011 | Ga0070676_100110113 | 533 |
| 263 | 3300005328 | Ga0070676_10034638 | Ga0070676_100346382 | 533 |
| 264 | 3300005330 | Ga0070690_100027442 | Ga0070690_1000274422 | 533 |
| 265 | 3300005333 | Ga0070677_10002249 | Ga0070677_100022492 | 533 |
| 266 | 3300005339 | Ga0070660_100027495 | Ga0070660_1000274952 | 533 |
| 267 | 3300005340 | Ga0070689_100025513 | Ga0070689_1000255132 | 533 |
| 268 | 3300005344 | Ga0070661_100024325 | Ga0070661_1000243252 | 533 |
| 269 | 3300005356 | Ga0070674_100001037 | Ga0070674_10000103711 | 533 |
| 270 | 3300005364 | Ga0070673_100016251 | Ga0070673_1000162514 | 533 |
| 271 | 3300005435 | Ga0070714_100062618 | Ga0070714_1000626181 | 533 |
| 272 | 3300005435 | Ga0070714_100091087 | Ga0070714_1000910871 | 533 |
| 273 | 3300005436 | Ga0070713_100018183 | Ga0070713_1000181831 | 533 |
| 274 | 3300005456 | Ga0070678_100002007 | Ga0070678_1000020077 | 533 |
| 275 | 3300005457 | Ga0070662_100001647 | Ga0070662_1000016475 | 533 |
| 276 | 3300005458 | Ga0070681_10004445 | Ga0070681_1000444511 | 533 |
| 277 | 3300005466 | Ga0070685_10083734 | Ga0070685_100837341 | 533 |
| 278 | 3300005530 | Ga0070679_100010067 | Ga0070679_1000100673 | 533 |
| 279 | 3300005539 | Ga0068853_100000967 | Ga0068853_1000009673 | 533 |
| 280 | 3300005539 | Ga0068853_100002561 | Ga0068853_1000025616 | 533 |
| 281 | 3300005543 | Ga0070672_100015376 | Ga0070672_1000153762 | 533 |
| 282 | 3300005563 | Ga0068855_100005891 | Ga0068855_1000058916 | 533 |
| 283 | 3300005563 | Ga0068855_100008354 | Ga0068855_1000083542 | 533 |
| 284 | 3300005564 | Ga0070664_100010431 | Ga0070664_1000104313 | 533 |
| 285 | 3300005578 | Ga0068854_100070598 | Ga0068854_1000705982 | 533 |
| 286 | 3300005614 | Ga0068856_100000181 | Ga0068856_10000018144 | 533 |
| 287 | 3300005616 | Ga0068852_100003731 | Ga0068852_1000037312 | 533 |
| 288 | 3300005719 | Ga0068861_100042311 | Ga0068861_1000423111 | 533 |
| 289 | 3300005719 | Ga0068861_100089355 | Ga0068861_1000893552 | 533 |
| 290 | 3300005937 | Ga0081455_10003206 | Ga0081455_100032065 | 533 |
| 291 | 3300005981 | Ga0081538_10007650 | Ga0081538_100076504 | 533 |
| 292 | 3300005985 | Ga0081539_10003759 | Ga0081539_1000375912 | 533 |
| 293 | 3300006042 | Ga0075368_10000428 | Ga0075368_100004283 | 533 |
| 294 | 3300006048 | Ga0075363_100002557 | Ga0075363_1000025575 | 533 |
| 295 | 3300006051 | Ga0075364_10006874 | Ga0075364_100068745 | 533 |
| 296 | 3300006178 | Ga0075367_10000343 | Ga0075367_1000034312 | 533 |
| 297 | 3300006844 | Ga0075428_100114611 | Ga0075428_1001146112 | 533 |
| 298 | 3300009093 | Ga0105240_10002009 | Ga0105240_1000200928 | 533 |
| 299 | 3300009094 | Ga0111539_10115319 | Ga0111539_101153191 | 533 |
| 300 | 3300009147 | Ga0114129_10065995 | Ga0114129_100659952 | 533 |
| 301 | 3300009545 | Ga0105237_10033182 | Ga0105237_100331822 | 533 |
| 302 | 3300010159 | Ga0099796_10002246 | Ga0099796_100022462 | 533 |
| 303 | 3300013100 | Ga0157373_10000932 | Ga0157373_1000093215 | 533 |
| 304 | 3300013100 | Ga0157373_10022198 | Ga0157373_100221982 | 533 |
| 305 | 3300013102 | Ga0157371_10000221 | Ga0157371_1000022137 | 533 |
| 306 | 3300013105 | Ga0157369_10003494 | Ga0157369_1000349414 | 533 |
| 307 | 3300013250 | Ga0171462_1034 | Ga0171462_103460 | 533 |
| 308 | 3300013296 | Ga0157374_10111446 | Ga0157374_101114462 | 533 |
| 309 | 3300013297 | Ga0157378_10018200 | Ga0157378_100182005 | 533 |
| 310 | 3300013306 | Ga0163162_10168610 | Ga0163162_101686102 | 533 |
| 311 | 3300013307 | Ga0157372_10116949 | Ga0157372_101169492 | 533 |
| 312 | 3300013308 | Ga0157375_10037256 | Ga0157375_100372562 | 533 |
| 313 | 3300014326 | Ga0157380_10109202 | Ga0157380_101092022 | 533 |
| 314 | 3300014969 | Ga0157376_10068798 | Ga0157376_100687982 | 533 |
| 315 | 3300025295 | Ga0209564_1000023 | Ga0209564_1000023427 | 533 |
| 316 | 3300025901 | Ga0207688_10010093 | Ga0207688_100100933 | 533 |
| 317 | 3300025907 | Ga0207645_10011990 | Ga0207645_100119902 | 533 |
| 318 | 3300025907 | Ga0207645_10052568 | Ga0207645_100525682 | 533 |
| 319 | 3300025912 | Ga0207707_10002151 | Ga0207707_100021515 | 533 |
| 320 | 3300025913 | Ga0207695_10021629 | Ga0207695_100216294 | 533 |
| 321 | 3300025914 | Ga0207671_10112472 | Ga0207671_101124721 | 533 |
| 322 | 3300025919 | Ga0207657_10000596 | Ga0207657_100005962 | 533 |
| 323 | 3300025919 | Ga0207657_10014459 | Ga0207657_100144591 | 533 |
| 324 | 3300025920 | Ga0207649_10006405 | Ga0207649_100064054 | 533 |
| 325 | 3300025921 | Ga0207652_10007822 | Ga0207652_100078221 | 533 |
| 326 | 3300025921 | Ga0207652_10118624 | Ga0207652_101186242 | 533 |
| 327 | 3300025923 | Ga0207681_10032737 | Ga0207681_100327372 | 533 |
| 328 | 3300025924 | Ga0207694_10002220 | Ga0207694_100022202 | 533 |
| 329 | 3300025925 | Ga0207650_10047792 | Ga0207650_100477922 | 533 |
| 330 | 3300025926 | Ga0207659_10014368 | Ga0207659_100143683 | 533 |
| 331 | 3300025929 | Ga0207664_10018344 | Ga0207664_100183442 | 533 |
| 332 | 3300025931 | Ga0207644_10017480 | Ga0207644_100174804 | 533 |
| 333 | 3300025931 | Ga0207644_10043689 | Ga0207644_100436892 | 533 |
| 334 | 3300025932 | Ga0207690_10001205 | Ga0207690_100012055 | 533 |
| 335 | 3300025933 | Ga0207706_10000074 | Ga0207706_1000007445 | 533 |
| 336 | 3300025936 | Ga0207670_10077777 | Ga0207670_100777772 | 533 |
| 337 | 3300025939 | Ga0207665_10029745 | Ga0207665_100297454 | 533 |
| 338 | 3300025940 | Ga0207691_10006478 | Ga0207691_100064783 | 533 |
| 339 | 3300025945 | Ga0207679_10003974 | Ga0207679_100039743 | 533 |
| 340 | 3300025949 | Ga0207667_10002291 | Ga0207667_100022914 | 533 |
| 341 | 3300025949 | Ga0207667_10075529 | Ga0207667_100755292 | 533 |
| 342 | 3300025960 | Ga0207651_10011198 | Ga0207651_100111981 | 533 |
| 343 | 3300026041 | Ga0207639_10013813 | Ga0207639_100138135 | 533 |
| 344 | 3300026078 | Ga0207702_10002345 | Ga0207702_1000234516 | 533 |
| 345 | 3300026078 | Ga0207702_10033819 | Ga0207702_100338192 | 533 |
| 346 | 3300026116 | Ga0207674_10000084 | Ga0207674_1000008439 | 533 |
| 347 | 3300026118 | Ga0207675_100124027 | Ga0207675_1001240272 | 533 |
| 348 | 3300026121 | Ga0207683_10000492 | Ga0207683_1000049223 | 533 |
| 349 | 3300027671 | Ga0209588_1012263 | Ga0209588_10122631 | 533 |
| 350 | 3300027866 | Ga0209813_10002462 | Ga0209813_100024622 | 533 |
| 351 | 3300035691 | Ga0373931_0003093 | Ga0373931_0003093_3575_5191 | 533 |
| 352 | 3300039438 | Ga0436360_1099428 | Ga0436360_1099428_522_2144 | 533 |
| 353 | 3300046491 | Ga0495584_0016121 | Ga0495584_0016121_247_1863 | 533 |
| 354 | 3300046507 | Ga0495606_0006293 | Ga0495606_0006293_6199_7815 | 533 |
| 355 | 3300046537 | Ga0495598_0002310 | Ga0495598_0002310_1724_3340 | 533 |
| 356 | 3300047315 | Ga0495581_0083315 | Ga0495581_0083315_224_1840 | 533 |
| 357 | 3300048905 | Ga0496102_0017251 | Ga0496102_0017251_3886_5625 | 533 |
| 358 | 3300048906 | Ga0496103_0015676 | Ga0496103_0015676_19_1758 | 533 |
| 359 | 3300048907 | Ga0496104_0003162 | Ga0496104_0003162_11852_13468 | 533 |
| 360 | 3300048908 | Ga0496105_0008988 | Ga0496105_0008988_2695_4311 | 533 |
| 361 | 3300048909 | Ga0496106_0003590 | Ga0496106_0003590_2906_4645 | 533 |
| 362 | 3300048910 | Ga0496107_0011333 | Ga0496107_0011333_990_2729 | 533 |
| 363 | 3300048911 | Ga0496108_0001362 | Ga0496108_0001362_6429_8045 | 533 |
| 364 | 3300048912 | Ga0496109_0004451 | Ga0496109_0004451_9547_11163 | 533 |
| 365 | 3300048914 | Ga0496111_0001111 | Ga0496111_0001111_2618_4234 | 533 |
| 366 | 3300048916 | Ga0496113_0001251 | Ga0496113_0001251_1992_3608 | 533 |
| 367 | 3300048916 | Ga0496113_0163284 | Ga0496113_0163284_103_1713 | 533 |
| 368 | 3300048929 | Ga0496126_0037232 | Ga0496126_0037232_1709_3328 | 533 |
| 369 | 3300049581 | Ga0501047_0043135 | Ga0501047_0043135_138_1841 | 533 |
| 370 | 3300049586 | Ga0501070_0003413 | Ga0501070_0003413_374_2077 | 533 |
| 371 | 3300049588 | Ga0501072_0002081 | Ga0501072_0002081_4531_6234 | 533 |
| 372 | 3300049589 | Ga0501073_0001796 | Ga0501073_0001796_983_2686 | 533 |
| 373 | 3300049744 | Ga0501083_0033459 | Ga0501083_0033459_26_1729 | 533 |
| 374 | 3300050492 | nmdc:mga0yw44_25663_c1 | nmdc:mga0yw44_25663_c1_1070_2686 | 533 |
| 375 | 3300050494 | nmdc:mga06z11_1398_c1 | nmdc:mga06z11_1398_c1_6555_8171 | 533 |
| 376 | 3300050495 | nmdc:mga04h51_2684_c1 | nmdc:mga04h51_2684_c1_2081_3697 | 533 |
| 377 | 3300050511 | nmdc:mga08y16_153247_c1 | nmdc:mga08y16_153247_c1_428_2044 | 533 |
| 378 | 3300053119 | Ga0500595_016042 | Ga0500595_016042_668_2326 | 533 |
| 379 | iso_pu_bacteria | 2524023228 | 2524535359 | 533 |
| 380 | iso_pu_bacteria | 2667528175 | 2671117463 | 533 |
| 381 | iso_pu_bacteria | 2904690495 | 2904698596 | 533 |
| 382 | iso_pu_bacteria | 2904699407 | 2904707302 | 533 |
| 383 | iso_pu_bacteria | 2908756301 | 2908762394 | 533 |
| 384 | iso_pu_bacteria | 8006933436 | 8006935070 | 533 |
| 385 | iso_pu_bacteria | 8006973647 | 8006975039 | 533 |
| 386 | 3300003371 | JGI26145J50221_1000801 | JGI26145J50221_10008012 | 534 |
| 387 | 3300003775 | Ga0055524_1003976 | Ga0055524_10039763 | 534 |
| 388 | 3300005340 | Ga0070689_100001133 | Ga0070689_1000011332 | 534 |
| 389 | 3300005353 | Ga0070669_100138926 | Ga0070669_1001389261 | 534 |
| 390 | 3300007788 | Ga0099795_10009302 | Ga0099795_100093022 | 534 |
| 391 | 3300009147 | Ga0114129_10008086 | Ga0114129_1000808611 | 534 |
| 392 | 3300013308 | Ga0157375_10006693 | Ga0157375_100066937 | 534 |
| 393 | 3300025299 | Ga0209256_1000128 | Ga0209256_100012846 | 534 |
| 394 | 3300025931 | Ga0207644_10007121 | Ga0207644_100071212 | 534 |
| 395 | 3300025936 | Ga0207670_10015063 | Ga0207670_100150632 | 534 |
| 396 | 3300025941 | Ga0207711_10009043 | Ga0207711_100090437 | 534 |
| 397 | 3300026088 | Ga0207641_10048705 | Ga0207641_100487052 | 534 |
| 398 | 3300031995 | Ga0307409_100174111 | Ga0307409_1001741111 | 534 |
| 399 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002676 | 534 |
| 400 | 3300035118 | Ga0373954_0000128 | Ga0373954_0000128_15320_16939 | 534 |
| 401 | 3300035119 | Ga0373956_0015558 | Ga0373956_0015558_803_2422 | 534 |
| 402 | 3300035724 | Ga0373933_0001000 | Ga0373933_0001000_5453_7189 | 534 |
| 403 | 3300036401 | Ga0373937_0020254 | Ga0373937_0020254_2107_3843 | 534 |
| 404 | 3300042876 | Ga0451577_0012128 | Ga0451577_0012128_6406_8091 | 534 |
| 405 | 3300046457 | Ga0495590_0036535 | Ga0495590_0036535_18_1646 | 534 |
| 406 | 3300046459 | Ga0495629_0055551 | Ga0495629_0055551_828_2447 | 534 |
| 407 | 3300046462 | Ga0495651_0050496 | Ga0495651_0050496_1312_2931 | 534 |
| 408 | 3300046476 | Ga0495662_0048790 | Ga0495662_0048790_139_1758 | 534 |
| 409 | 3300046511 | Ga0495608_0047235 | Ga0495608_0047235_1228_2847 | 534 |
| 410 | 3300046559 | Ga0495667_0002542 | Ga0495667_0002542_4759_6378 | 534 |
| 411 | 3300046689 | Ga0495613_0044355 | Ga0495613_0044355_1631_3250 | 534 |
| 412 | 3300047471 | Ga0495684_0003890 | Ga0495684_0003890_1447_3066 | 534 |
| 413 | 3300047673 | Ga0495593_0006970 | Ga0495593_0006970_3347_4966 | 534 |
| 414 | 3300049581 | Ga0501047_0055629 | Ga0501047_0055629_1862_3487 | 534 |
| 415 | 3300049742 | Ga0501080_0080503 | Ga0501080_0080503_1180_2805 | 534 |
| 416 | 3300049823 | Ga0501044_0013237 | Ga0501044_0013237_1779_3404 | 534 |
| 417 | 3300053084 | Ga0495595_0012285 | Ga0495595_0012285_1088_2707 | 534 |
| 418 | iso_pu_bacteria | 2643221733 | 2644729537 | 534 |
| 419 | iso_pu_bacteria | 2738543013 | 2739248990 | 534 |
| 420 | 3300004800 | Ga0058861_12067306 | Ga0058861_120673062 | 535 |
| 421 | 3300004800 | Ga0058861_12074013 | Ga0058861_120740133 | 535 |
| 422 | 3300004803 | Ga0058862_10036173 | Ga0058862_100361731 | 535 |
| 423 | 3300004803 | Ga0058862_10052075 | Ga0058862_100520751 | 535 |
| 424 | 3300005327 | Ga0070658_10058520 | Ga0070658_100585202 | 535 |
| 425 | 3300005329 | Ga0070683_100013742 | Ga0070683_1000137422 | 535 |
| 426 | 3300005336 | Ga0070680_100000715 | Ga0070680_10000071513 | 535 |
| 427 | 3300005336 | Ga0070680_100010034 | Ga0070680_1000100346 | 535 |
| 428 | 3300005339 | Ga0070660_100001964 | Ga0070660_1000019642 | 535 |
| 429 | 3300005354 | Ga0070675_100032787 | Ga0070675_1000327872 | 535 |
| 430 | 3300005434 | Ga0070709_10004238 | Ga0070709_100042384 | 535 |
| 431 | 3300005436 | Ga0070713_100022397 | Ga0070713_1000223972 | 535 |
| 432 | 3300005458 | Ga0070681_10012807 | Ga0070681_100128076 | 535 |
| 433 | 3300005458 | Ga0070681_10017468 | Ga0070681_100174684 | 535 |
| 434 | 3300005518 | Ga0070699_100115352 | Ga0070699_1001153523 | 535 |
| 435 | 3300005530 | Ga0070679_100027279 | Ga0070679_1000272792 | 535 |
| 436 | 3300005535 | Ga0070684_100001210 | Ga0070684_1000012104 | 535 |
| 437 | 3300005539 | Ga0068853_100003101 | Ga0068853_1000031014 | 535 |
| 438 | 3300005563 | Ga0068855_100008023 | Ga0068855_10000802316 | 535 |
| 439 | 3300005563 | Ga0068855_100062241 | Ga0068855_1000622415 | 535 |
| 440 | 3300005577 | Ga0068857_100006177 | Ga0068857_1000061776 | 535 |
| 441 | 3300005616 | Ga0068852_100014481 | Ga0068852_1000144815 | 535 |
| 442 | 3300005834 | Ga0068851_10005754 | Ga0068851_100057543 | 535 |
| 443 | 3300005983 | Ga0081540_1003514 | Ga0081540_10035144 | 535 |
| 444 | 3300006028 | Ga0070717_10120328 | Ga0070717_101203282 | 535 |
| 445 | 3300006844 | Ga0075428_100013889 | Ga0075428_1000138893 | 535 |
| 446 | 3300006871 | Ga0075434_100035715 | Ga0075434_1000357152 | 535 |
| 447 | 3300009093 | Ga0105240_10003096 | Ga0105240_1000309623 | 535 |
| 448 | 3300009093 | Ga0105240_10082635 | Ga0105240_100826352 | 535 |
| 449 | 3300009093 | Ga0105240_10149486 | Ga0105240_101494862 | 535 |
| 450 | 3300009094 | Ga0111539_10006379 | Ga0111539_100063794 | 535 |
| 451 | 3300009545 | Ga0105237_10002350 | Ga0105237_1000235013 | 535 |
| 452 | 3300009545 | Ga0105237_10103535 | Ga0105237_101035352 | 535 |
| 453 | 3300009551 | Ga0105238_10000408 | Ga0105238_1000040833 | 535 |
| 454 | 3300013105 | Ga0157369_10000685 | Ga0157369_1000068532 | 535 |
| 455 | 3300013105 | Ga0157369_10004094 | Ga0157369_1000409426 | 535 |
| 456 | 3300013105 | Ga0157369_10021093 | Ga0157369_100210932 | 535 |
| 457 | 3300013105 | Ga0157369_10050094 | Ga0157369_100500942 | 535 |
| 458 | 3300013105 | Ga0157369_10159845 | Ga0157369_101598452 | 535 |
| 459 | 3300013307 | Ga0157372_10060940 | Ga0157372_100609403 | 535 |
| 460 | 3300013307 | Ga0157372_10173751 | Ga0157372_101737512 | 535 |
| 461 | 3300020069 | Ga0197907_10380380 | Ga0197907_103803801 | 535 |
| 462 | 3300020070 | Ga0206356_10784946 | Ga0206356_107849461 | 535 |
| 463 | 3300020076 | Ga0206355_1226068 | Ga0206355_12260682 | 535 |
| 464 | 3300020080 | Ga0206350_11179710 | Ga0206350_111797102 | 535 |
| 465 | 3300020081 | Ga0206354_10968831 | Ga0206354_109688312 | 535 |
| 466 | 3300022467 | Ga0224712_10022092 | Ga0224712_100220921 | 535 |
| 467 | 3300025294 | Ga0209025_1002328 | Ga0209025_10023288 | 535 |
| 468 | 3300025321 | Ga0207656_10006700 | Ga0207656_100067003 | 535 |
| 469 | 3300025909 | Ga0207705_10096207 | Ga0207705_100962071 | 535 |
| 470 | 3300025912 | Ga0207707_10000126 | Ga0207707_1000012627 | 535 |
| 471 | 3300025912 | Ga0207707_10003896 | Ga0207707_100038966 | 535 |
| 472 | 3300025912 | Ga0207707_10010718 | Ga0207707_100107183 | 535 |
| 473 | 3300025913 | Ga0207695_10025608 | Ga0207695_1002560811 | 535 |
| 474 | 3300025914 | Ga0207671_10007097 | Ga0207671_1000709710 | 535 |
| 475 | 3300025917 | Ga0207660_10002234 | Ga0207660_100022341 | 535 |
| 476 | 3300025917 | Ga0207660_10008952 | Ga0207660_100089525 | 535 |
| 477 | 3300025919 | Ga0207657_10000261 | Ga0207657_1000026138 | 535 |
| 478 | 3300025921 | Ga0207652_10012243 | Ga0207652_100122432 | 535 |
| 479 | 3300025949 | Ga0207667_10005359 | Ga0207667_100053597 | 535 |
| 480 | 3300025949 | Ga0207667_10244383 | Ga0207667_102443831 | 535 |
| 481 | 3300026041 | Ga0207639_10027184 | Ga0207639_100271841 | 535 |
| 482 | 3300026142 | Ga0207698_10010802 | Ga0207698_100108022 | 535 |
| 483 | 3300036401 | Ga0373937_0006557 | Ga0373937_0006557_363_1991 | 535 |
| 484 | 3300037312 | Ga0395899_0016911 | Ga0395899_0016911_409_2031 | 535 |
| 485 | 3300037312 | Ga0395899_0058489 | Ga0395899_0058489_744_2366 | 535 |
| 486 | 3300037418 | Ga0395900_0036729 | Ga0395900_0036729_2237_3859 | 535 |
| 487 | 3300037418 | Ga0395900_0039923 | Ga0395900_0039923_1383_3005 | 535 |
| 488 | 3300037418 | Ga0395900_0085466 | Ga0395900_0085466_1436_3058 | 535 |
| 489 | 3300037418 | Ga0395900_0127850 | Ga0395900_0127850_498_2120 | 535 |
| 490 | 3300037466 | Ga0395898_0128242 | Ga0395898_0128242_472_2094 | 535 |
| 491 | 3300038443 | Ga0395901_0029678 | Ga0395901_0029678_2082_3704 | 535 |
| 492 | 3300050512 | nmdc:mga0n895_34586_c1 | nmdc:mga0n895_34586_c1_1646_3283 | 535 |
| 493 | 3300050516 | nmdc:mga0sz30_39604_c1 | nmdc:mga0sz30_39604_c1_80_1726 | 535 |
| 494 | 3300053084 | Ga0495595_0006034 | Ga0495595_0006034_865_2493 | 535 |
| 495 | 3300053085 | Ga0495619_0009996 | Ga0495619_0009996_179_1807 | 535 |
| 496 | 3300053109 | Ga0500569_004620 | Ga0500569_004620_308_1942 | 535 |
| 497 | 3300005336 | Ga0070680_100123770 | Ga0070680_1001237702 | 536 |
| 498 | 3300006844 | Ga0075428_100141868 | Ga0075428_1001418682 | 536 |
| 499 | 3300006847 | Ga0075431_100183915 | Ga0075431_1001839152 | 536 |
| 500 | 3300025253 | Ga0209677_100369 | Ga0209677_10036924 | 536 |
| 501 | 3300031852 | Ga0307410_10001696 | Ga0307410_100016966 | 536 |
| 502 | 3300032002 | Ga0307416_100080094 | Ga0307416_1000800942 | 536 |
| 503 | 3300044673 | Ga0453683_0016414 | Ga0453683_0016414_2708_4390 | 536 |
| 504 | 3300046463 | Ga0495653_0084118 | Ga0495653_0084118_682_2325 | 536 |
| 505 | 3300046511 | Ga0495608_0034348 | Ga0495608_0034348_773_2416 | 536 |
| 506 | 3300046536 | Ga0495587_0003660 | Ga0495587_0003660_965_2608 | 536 |
| 507 | 3300046559 | Ga0495667_0005025 | Ga0495667_0005025_6874_8517 | 536 |
| 508 | 3300046675 | Ga0495657_0051197 | Ga0495657_0051197_111_1754 | 536 |
| 509 | 3300046678 | Ga0495599_0028643 | Ga0495599_0028643_186_1829 | 536 |
| 510 | 3300046679 | Ga0495623_0065837 | Ga0495623_0065837_401_2044 | 536 |
| 511 | 3300047444 | Ga0495675_0006140 | Ga0495675_0006140_2763_4457 | 536 |
| 512 | 3300048921 | Ga0496118_0006767 | Ga0496118_0006767_1836_3470 | 536 |
| 513 | 3300048924 | Ga0496121_0027871 | Ga0496121_0027871_3623_5257 | 536 |
| 514 | 3300049588 | Ga0501072_0045364 | Ga0501072_0045364_163_1788 | 536 |
| 515 | 3300050507 | nmdc:mga05p37_5476_c1 | nmdc:mga05p37_5476_c1_845_2467 | 536 |
| 516 | 3300050510 | nmdc:mga06r32_44260_c2 | nmdc:mga06r32_44260_c2_714_2447 | 536 |
| 517 | 3300050513 | nmdc:mga0rr50_105793_c1 | nmdc:mga0rr50_105793_c1_334_1950 | 536 |
| 518 | 3300053077 | Ga0495601_0017121 | Ga0495601_0017121_2331_3974 | 536 |
| 519 | 3300025933 | Ga0207706_10146150 | Ga0207706_101461502 | 537 |
| 520 | 3300025940 | Ga0207691_10014367 | Ga0207691_100143674 | 537 |
| 521 | 3300031901 | Ga0307406_10016372 | Ga0307406_100163722 | 537 |
| 522 | 3300036401 | Ga0373937_0009073 | Ga0373937_0009073_1988_3619 | 537 |
| 523 | 3300039450 | Ga0436363_1339296 | Ga0436363_1339296_10259_11917 | 537 |
| 524 | 3300046499 | Ga0495594_0060106 | Ga0495594_0060106_357_1982 | 537 |
| 525 | 3300049571 | Ga0501034_0091799 | Ga0501034_0091799_260_1918 | 537 |
| 526 | 3300050515 | nmdc:mga0a205_79984_c1 | nmdc:mga0a205_79984_c1_41_1675 | 537 |
| 527 | 3300059421 | Ga0590071_014223 | Ga0590071_014223_58_1695 | 537 |
| 528 | 3300017792 | Ga0163161_10067888 | Ga0163161_100678882 | 538 |
| 529 | 3300025927 | Ga0207687_10057206 | Ga0207687_100572061 | 538 |
| 530 | 3300031731 | Ga0307405_10050494 | Ga0307405_100504942 | 538 |
| 531 | 3300049572 | Ga0501036_0061746 | Ga0501036_0061746_277_1917 | 538 |
| 532 | 3300049575 | Ga0501039_0096725 | Ga0501039_0096725_463_2103 | 538 |
| 533 | 3300049824 | Ga0501045_0095911 | Ga0501045_0095911_246_1886 | 538 |
| 534 | 3300005336 | Ga0070680_100002629 | Ga0070680_1000026298 | 539 |
| 535 | 3300005458 | Ga0070681_10005791 | Ga0070681_1000579111 | 539 |
| 536 | 3300005543 | Ga0070672_100001618 | Ga0070672_1000016189 | 539 |
| 537 | 3300005548 | Ga0070665_100006978 | Ga0070665_1000069783 | 539 |
| 538 | 3300006844 | Ga0075428_100015388 | Ga0075428_1000153882 | 539 |
| 539 | 3300006880 | Ga0075429_100029737 | Ga0075429_1000297375 | 539 |
| 540 | 3300009147 | Ga0114129_10257263 | Ga0114129_102572631 | 539 |
| 541 | 3300009174 | Ga0105241_10063574 | Ga0105241_100635743 | 539 |
| 542 | 3300013307 | Ga0157372_10036013 | Ga0157372_100360133 | 539 |
| 543 | 3300025315 | Ga0207697_10021428 | Ga0207697_100214282 | 539 |
| 544 | 3300025903 | Ga0207680_10074032 | Ga0207680_100740322 | 539 |
| 545 | 3300025912 | Ga0207707_10003761 | Ga0207707_1000376112 | 539 |
| 546 | 3300025917 | Ga0207660_10056828 | Ga0207660_100568282 | 539 |
| 547 | 3300025919 | Ga0207657_10137726 | Ga0207657_101377261 | 539 |
| 548 | 3300025934 | Ga0207686_10011466 | Ga0207686_100114662 | 539 |
| 549 | 3300025940 | Ga0207691_10012608 | Ga0207691_100126083 | 539 |
| 550 | 3300025945 | Ga0207679_10032346 | Ga0207679_100323463 | 539 |
| 551 | 3300025949 | Ga0207667_10092225 | Ga0207667_100922252 | 539 |
| 552 | 3300025960 | Ga0207651_10028518 | Ga0207651_100285182 | 539 |
| 553 | 3300026078 | Ga0207702_10045703 | Ga0207702_100457035 | 539 |
| 554 | 3300026118 | Ga0207675_100018551 | Ga0207675_1000185513 | 539 |
| 555 | 3300026142 | Ga0207698_10066523 | Ga0207698_100665232 | 539 |
| 556 | 3300028379 | Ga0268266_10005821 | Ga0268266_100058213 | 539 |
| 557 | 3300031731 | Ga0307405_10004741 | Ga0307405_100047413 | 539 |
| 558 | 3300031903 | Ga0307407_10003024 | Ga0307407_100030243 | 539 |
| 559 | 3300031995 | Ga0307409_100002813 | Ga0307409_1000028133 | 539 |
| 560 | 3300042005 | Ga0439448_0017551 | Ga0439448_0017551_14_1717 | 539 |
| 561 | 3300042439 | Ga0439464_0000278 | Ga0439464_0000278_757_2460 | 539 |
| 562 | 3300050507 | nmdc:mga05p37_212017_c1 | nmdc:mga05p37_212017_c1_175_1809 | 539 |
| 563 | 3300050511 | nmdc:mga08y16_181085_c1 | nmdc:mga08y16_181085_c1_147_1781 | 539 |
| 564 | 3300005356 | Ga0070674_100084412 | Ga0070674_1000844122 | 540 |
| 565 | 3300005436 | Ga0070713_100065627 | Ga0070713_1000656272 | 540 |
| 566 | 3300005459 | Ga0068867_100077400 | Ga0068867_1000774002 | 540 |
| 567 | 3300005614 | Ga0068856_100057362 | Ga0068856_1000573622 | 540 |
| 568 | 3300005719 | Ga0068861_100043433 | Ga0068861_1000434332 | 540 |
| 569 | 3300005983 | Ga0081540_1003133 | Ga0081540_10031333 | 540 |
| 570 | 3300006178 | Ga0075367_10056492 | Ga0075367_100564922 | 540 |
| 571 | 3300009148 | Ga0105243_10029177 | Ga0105243_100291773 | 540 |
| 572 | 3300025928 | Ga0207700_10043983 | Ga0207700_100439832 | 540 |
| 573 | 3300025933 | Ga0207706_10004802 | Ga0207706_100048021 | 540 |
| 574 | 3300025938 | Ga0207704_10010238 | Ga0207704_100102382 | 540 |
| 575 | 3300025939 | Ga0207665_10024852 | Ga0207665_100248522 | 540 |
| 576 | 3300026075 | Ga0207708_10053405 | Ga0207708_100534052 | 540 |
| 577 | 3300027552 | Ga0209982_1002111 | Ga0209982_10021112 | 540 |
| 578 | 3300027617 | Ga0210002_1000255 | Ga0210002_10002555 | 540 |
| 579 | 3300027876 | Ga0209974_10001404 | Ga0209974_100014047 | 540 |
| 580 | 3300031548 | Ga0307408_100033723 | Ga0307408_1000337232 | 540 |
| 581 | 3300031824 | Ga0307413_10028407 | Ga0307413_100284071 | 540 |
| 582 | 3300031911 | Ga0307412_10061541 | Ga0307412_100615412 | 540 |
| 583 | 3300032002 | Ga0307416_100003810 | Ga0307416_1000038108 | 540 |
| 584 | 3300032005 | Ga0307411_10000915 | Ga0307411_100009156 | 540 |
| 585 | 3300035170 | Ga0373943_0030289 | Ga0373943_0030289_292_1986 | 540 |
| 586 | 3300046543 | Ga0495645_0019365 | Ga0495645_0019365_464_2170 | 540 |
| 587 | 3300047319 | Ga0495674_0119231 | Ga0495674_0119231_267_1973 | 540 |
| 588 | 3300048907 | Ga0496104_0077923 | Ga0496104_0077923_1381_3087 | 540 |
| 589 | 3300048918 | Ga0496115_0004711 | Ga0496115_0004711_3475_5181 | 540 |
| 590 | 3300049590 | Ga0501074_0051281 | Ga0501074_0051281_374_2065 | 540 |
| 591 | 3300005330 | Ga0070690_100009374 | Ga0070690_1000093743 | 541 |
| 592 | 3300005334 | Ga0068869_100006008 | Ga0068869_1000060086 | 541 |
| 593 | 3300005340 | Ga0070689_100037406 | Ga0070689_1000374062 | 541 |
| 594 | 3300005438 | Ga0070701_10013249 | Ga0070701_100132492 | 541 |
| 595 | 3300005440 | Ga0070705_100025693 | Ga0070705_1000256932 | 541 |
| 596 | 3300005441 | Ga0070700_100003815 | Ga0070700_1000038153 | 541 |
| 597 | 3300005459 | Ga0068867_100007147 | Ga0068867_1000071475 | 541 |
| 598 | 3300005544 | Ga0070686_100005382 | Ga0070686_1000053822 | 541 |
| 599 | 3300005546 | Ga0070696_100049752 | Ga0070696_1000497522 | 541 |
| 600 | 3300005615 | Ga0070702_100008363 | Ga0070702_1000083633 | 541 |
| 601 | 3300005718 | Ga0068866_10000727 | Ga0068866_100007278 | 541 |
| 602 | 3300005719 | Ga0068861_100009840 | Ga0068861_1000098405 | 541 |
| 603 | 3300006237 | Ga0097621_100009194 | Ga0097621_1000091942 | 541 |
| 604 | 3300006237 | Ga0097621_100084007 | Ga0097621_1000840072 | 541 |
| 605 | 3300006358 | Ga0068871_100067460 | Ga0068871_1000674602 | 541 |
| 606 | 3300006358 | Ga0068871_100117763 | Ga0068871_1001177632 | 541 |
| 607 | 3300009098 | Ga0105245_10002145 | Ga0105245_100021456 | 541 |
| 608 | 3300009148 | Ga0105243_10019893 | Ga0105243_100198932 | 541 |
| 609 | 3300009177 | Ga0105248_10047454 | Ga0105248_100474542 | 541 |
| 610 | 3300013105 | Ga0157369_10095468 | Ga0157369_100954682 | 541 |
| 611 | 3300013297 | Ga0157378_10002321 | Ga0157378_100023213 | 541 |
| 612 | 3300014326 | Ga0157380_10051083 | Ga0157380_100510832 | 541 |
| 613 | 3300025899 | Ga0207642_10001979 | Ga0207642_100019795 | 541 |
| 614 | 3300025906 | Ga0207699_10020361 | Ga0207699_100203612 | 541 |
| 615 | 3300025920 | Ga0207649_10062187 | Ga0207649_100621872 | 541 |
| 616 | 3300025927 | Ga0207687_10007925 | Ga0207687_100079254 | 541 |
| 617 | 3300025934 | Ga0207686_10000342 | Ga0207686_100003426 | 541 |
| 618 | 3300025935 | Ga0207709_10010227 | Ga0207709_100102272 | 541 |
| 619 | 3300025938 | Ga0207704_10015550 | Ga0207704_100155502 | 541 |
| 620 | 3300025940 | Ga0207691_10094608 | Ga0207691_100946081 | 541 |
| 621 | 3300025942 | Ga0207689_10001067 | Ga0207689_1000106715 | 541 |
| 622 | 3300025945 | Ga0207679_10023460 | Ga0207679_100234601 | 541 |
| 623 | 3300025949 | Ga0207667_10092814 | Ga0207667_100928142 | 541 |
| 624 | 3300026075 | Ga0207708_10000850 | Ga0207708_100008507 | 541 |
| 625 | 3300026089 | Ga0207648_10002986 | Ga0207648_100029868 | 541 |
| 626 | 3300026118 | Ga0207675_100000430 | Ga0207675_10000043013 | 541 |
| 627 | 3300028380 | Ga0268265_10026927 | Ga0268265_100269272 | 541 |
| 628 | 3300049578 | Ga0501042_0087351 | Ga0501042_0087351_37_1698 | 541 |
| 629 | 3300049582 | Ga0501048_0061790 | Ga0501048_0061790_859_2520 | 541 |
| 630 | 3300049591 | Ga0501075_0089627 | Ga0501075_0089627_510_2171 | 541 |
| 631 | 3300054114 | Ga0501084_0096375 | Ga0501084_0096375_729_2390 | 541 |
| 632 | 3300005459 | Ga0068867_100068370 | Ga0068867_1000683701 | 542 |
| 633 | 3300005530 | Ga0070679_100008257 | Ga0070679_1000082573 | 542 |
| 634 | 3300005563 | Ga0068855_100091501 | Ga0068855_1000915012 | 542 |
| 635 | 3300005615 | Ga0070702_100002103 | Ga0070702_1000021034 | 542 |
| 636 | 3300006852 | Ga0075433_10000045 | Ga0075433_100000455 | 542 |
| 637 | 3300006871 | Ga0075434_100000014 | Ga0075434_10000001445 | 542 |
| 638 | 3300007076 | Ga0075435_100004145 | Ga0075435_1000041457 | 542 |
| 639 | 3300013306 | Ga0163162_10000003 | Ga0163162_1000000325 | 542 |
| 640 | 3300013306 | Ga0163162_10139152 | Ga0163162_101391523 | 542 |
| 641 | 3300025910 | Ga0207684_10022621 | Ga0207684_100226212 | 542 |
| 642 | 3300025917 | Ga0207660_10025203 | Ga0207660_100252033 | 542 |
| 643 | 3300025926 | Ga0207659_10043717 | Ga0207659_100437172 | 542 |
| 644 | 3300026118 | Ga0207675_100067703 | Ga0207675_1000677032 | 542 |
| 645 | 3300036401 | Ga0373937_0003233 | Ga0373937_0003233_9865_11502 | 542 |
| 646 | 3300046476 | Ga0495662_0002087 | Ga0495662_0002087_6086_7729 | 542 |
| 647 | 3300046517 | Ga0495630_0000001 | Ga0495630_0000001_722474_724117 | 542 |
| 648 | 3300050511 | nmdc:mga08y16_145067_c1 | nmdc:mga08y16_145067_c1_682_2346 | 542 |
| 649 | 3300050512 | nmdc:mga0n895_520_c1 | nmdc:mga0n895_520_c1_21662_23308 | 542 |
| 650 | 3300050513 | nmdc:mga0rr50_41745_c1 | nmdc:mga0rr50_41745_c1_1055_2701 | 542 |
| 651 | 3300050515 | nmdc:mga0a205_344_c1 | nmdc:mga0a205_344_c1_15097_16743 | 542 |
| 652 | 3300005290 | Ga0065712_10077866 | Ga0065712_100778662 | 543 |
| 653 | 3300005295 | Ga0065707_10001246 | Ga0065707_100012463 | 543 |
| 654 | 3300005331 | Ga0070670_100004697 | Ga0070670_1000046977 | 543 |
| 655 | 3300005335 | Ga0070666_10005944 | Ga0070666_100059442 | 543 |
| 656 | 3300005354 | Ga0070675_100001879 | Ga0070675_10000187911 | 543 |
| 657 | 3300005354 | Ga0070675_100183794 | Ga0070675_1001837941 | 543 |
| 658 | 3300005355 | Ga0070671_100000304 | Ga0070671_10000030424 | 543 |
| 659 | 3300005844 | Ga0068862_100126870 | Ga0068862_1001268701 | 543 |
| 660 | 3300006358 | Ga0068871_100055951 | Ga0068871_1000559512 | 543 |
| 661 | 3300006844 | Ga0075428_100081280 | Ga0075428_1000812802 | 543 |
| 662 | 3300013296 | Ga0157374_10002246 | Ga0157374_100022463 | 543 |
| 663 | 3300013306 | Ga0163162_10002786 | Ga0163162_1000278611 | 543 |
| 664 | 3300013308 | Ga0157375_10000187 | Ga0157375_1000018737 | 543 |
| 665 | 3300025925 | Ga0207650_10003657 | Ga0207650_100036573 | 543 |
| 666 | 3300025931 | Ga0207644_10003083 | Ga0207644_100030839 | 543 |
| 667 | 3300025940 | Ga0207691_10050422 | Ga0207691_100504223 | 543 |
| 668 | 3300025960 | Ga0207651_10042466 | Ga0207651_100424662 | 543 |
| 669 | 3300035692 | Ga0373935_0035720 | Ga0373935_0035720_928_2667 | 543 |
| 670 | 3300045051 | Ga0451576_0021579 | Ga0451576_0021579_2082_3725 | 543 |
| 671 | 3300048903 | Ga0496100_0022742 | Ga0496100_0022742_713_2452 | 543 |
| 672 | 3300048904 | Ga0496101_0031087 | Ga0496101_0031087_187_1926 | 543 |
| 673 | 3300048909 | Ga0496106_0014750 | Ga0496106_0014750_1194_2933 | 543 |
| 674 | 3300048915 | Ga0496112_0001433 | Ga0496112_0001433_4941_6581 | 543 |
| 675 | 3300048915 | Ga0496112_0049418 | Ga0496112_0049418_1196_2935 | 543 |
| 676 | 3300048918 | Ga0496115_0021418 | Ga0496115_0021418_2926_4665 | 543 |
| 677 | 3300050507 | nmdc:mga05p37_40526_c1 | nmdc:mga05p37_40526_c1_1236_2885 | 543 |
| 678 | 3300050510 | nmdc:mga06r32_109493_c1 | nmdc:mga06r32_109493_c1_279_1928 | 543 |
| 679 | 3300005293 | Ga0065715_10094129 | Ga0065715_100941294 | 544 |
| 680 | 3300005331 | Ga0070670_100002242 | Ga0070670_10000224210 | 544 |
| 681 | 3300005543 | Ga0070672_100080762 | Ga0070672_1000807622 | 544 |
| 682 | 3300005616 | Ga0068852_100024417 | Ga0068852_1000244173 | 544 |
| 683 | 3300006931 | Ga0097620_100084703 | Ga0097620_1000847032 | 544 |
| 684 | 3300009094 | Ga0111539_10233718 | Ga0111539_102337182 | 544 |
| 685 | 3300013307 | Ga0157372_10119531 | Ga0157372_101195312 | 544 |
| 686 | 3300014325 | Ga0163163_10022104 | Ga0163163_100221045 | 544 |
| 687 | 3300025907 | Ga0207645_10025507 | Ga0207645_100255072 | 544 |
| 688 | 3300025940 | Ga0207691_10002268 | Ga0207691_100022683 | 544 |
| 689 | 3300025940 | Ga0207691_10026399 | Ga0207691_100263994 | 544 |
| 690 | 3300026089 | Ga0207648_10013379 | Ga0207648_100133796 | 544 |
| 691 | 3300027665 | Ga0209983_1002433 | Ga0209983_10024332 | 544 |
| 692 | 3300035117 | Ga0373953_0036209 | Ga0373953_0036209_195_1862 | 544 |
| 693 | 3300046473 | Ga0495582_0000764 | Ga0495582_0000764_13849_15495 | 544 |
| 694 | 3300046511 | Ga0495608_0040779 | Ga0495608_0040779_1431_3086 | 544 |
| 695 | 3300046559 | Ga0495667_0021596 | Ga0495667_0021596_1976_3631 | 544 |
| 696 | 3300047471 | Ga0495684_0002042 | Ga0495684_0002042_5973_7619 | 544 |
| 697 | 3300049572 | Ga0501036_0068608 | Ga0501036_0068608_171_1817 | 544 |
| 698 | 3300049576 | Ga0501040_0020551 | Ga0501040_0020551_2545_4191 | 544 |
| 699 | 3300049577 | Ga0501041_0033269 | Ga0501041_0033269_747_2393 | 544 |
| 700 | 3300049578 | Ga0501042_0079205 | Ga0501042_0079205_508_2154 | 544 |
| 701 | 3300049579 | Ga0501043_0041938 | Ga0501043_0041938_1172_2818 | 544 |
| 702 | 3300049580 | Ga0501046_0115879 | Ga0501046_0115879_45_1691 | 544 |
| 703 | 3300049581 | Ga0501047_0042761 | Ga0501047_0042761_1513_3159 | 544 |
| 704 | 3300049589 | Ga0501073_0055121 | Ga0501073_0055121_52_1698 | 544 |
| 705 | 3300053093 | Ga0500651_0020089 | Ga0500651_0020089_386_2032 | 544 |
| 706 | 3300054114 | Ga0501084_0095650 | Ga0501084_0095650_401_2047 | 544 |
| 707 | 3300060353 | Ga0501082_0012080 | Ga0501082_0012080_4213_5859 | 544 |
| 708 | 3300003347 | JGI26128J50194_1000456 | JGI26128J50194_10004561 | 545 |
| 709 | 3300005328 | Ga0070676_10004147 | Ga0070676_100041472 | 545 |
| 710 | 3300005331 | Ga0070670_100060623 | Ga0070670_1000606232 | 545 |
| 711 | 3300005334 | Ga0068869_100000833 | Ga0068869_10000083312 | 545 |
| 712 | 3300005334 | Ga0068869_100050537 | Ga0068869_1000505372 | 545 |
| 713 | 3300005354 | Ga0070675_100025831 | Ga0070675_1000258313 | 545 |
| 714 | 3300005364 | Ga0070673_100000114 | Ga0070673_10000011431 | 545 |
| 715 | 3300005364 | Ga0070673_100008549 | Ga0070673_1000085495 | 545 |
| 716 | 3300005436 | Ga0070713_100002486 | Ga0070713_1000024867 | 545 |
| 717 | 3300005439 | Ga0070711_100001996 | Ga0070711_1000019964 | 545 |
| 718 | 3300005441 | Ga0070700_100012604 | Ga0070700_1000126043 | 545 |
| 719 | 3300005444 | Ga0070694_100004983 | Ga0070694_1000049835 | 545 |
| 720 | 3300005466 | Ga0070685_10001172 | Ga0070685_1000117212 | 545 |
| 721 | 3300005544 | Ga0070686_100031109 | Ga0070686_1000311092 | 545 |
| 722 | 3300005545 | Ga0070695_100000676 | Ga0070695_10000067614 | 545 |
| 723 | 3300005547 | Ga0070693_100063562 | Ga0070693_1000635621 | 545 |
| 724 | 3300005548 | Ga0070665_100017868 | Ga0070665_1000178684 | 545 |
| 725 | 3300005614 | Ga0068856_100009519 | Ga0068856_1000095194 | 545 |
| 726 | 3300005617 | Ga0068859_100005614 | Ga0068859_1000056147 | 545 |
| 727 | 3300005841 | Ga0068863_100003910 | Ga0068863_1000039107 | 545 |
| 728 | 3300005841 | Ga0068863_100058217 | Ga0068863_1000582172 | 545 |
| 729 | 3300005843 | Ga0068860_100055521 | Ga0068860_1000555213 | 545 |
| 730 | 3300006175 | Ga0070712_100004514 | Ga0070712_1000045143 | 545 |
| 731 | 3300006237 | Ga0097621_100029715 | Ga0097621_1000297153 | 545 |
| 732 | 3300006881 | Ga0068865_100008745 | Ga0068865_1000087453 | 545 |
| 733 | 3300006931 | Ga0097620_100005614 | Ga0097620_1000056147 | 545 |
| 734 | 3300009098 | Ga0105245_10009740 | Ga0105245_100097403 | 545 |
| 735 | 3300009148 | Ga0105243_10032071 | Ga0105243_100320713 | 545 |
| 736 | 3300009176 | Ga0105242_10016585 | Ga0105242_100165853 | 545 |
| 737 | 3300013296 | Ga0157374_10001774 | Ga0157374_100017744 | 545 |
| 738 | 3300013306 | Ga0163162_10014356 | Ga0163162_100143563 | 545 |
| 739 | 3300013307 | Ga0157372_10089521 | Ga0157372_100895212 | 545 |
| 740 | 3300013308 | Ga0157375_10002337 | Ga0157375_1000233713 | 545 |
| 741 | 3300014968 | Ga0157379_10002071 | Ga0157379_100020714 | 545 |
| 742 | 3300014969 | Ga0157376_10002637 | Ga0157376_100026374 | 545 |
| 743 | 3300025907 | Ga0207645_10007037 | Ga0207645_100070373 | 545 |
| 744 | 3300025915 | Ga0207693_10000589 | Ga0207693_1000058914 | 545 |
| 745 | 3300025916 | Ga0207663_10001397 | Ga0207663_100013974 | 545 |
| 746 | 3300025924 | Ga0207694_10045696 | Ga0207694_100456962 | 545 |
| 747 | 3300025926 | Ga0207659_10076642 | Ga0207659_100766422 | 545 |
| 748 | 3300025927 | Ga0207687_10001005 | Ga0207687_1000100513 | 545 |
| 749 | 3300025928 | Ga0207700_10003680 | Ga0207700_100036803 | 545 |
| 750 | 3300025934 | Ga0207686_10008067 | Ga0207686_100080671 | 545 |
| 751 | 3300025938 | Ga0207704_10005242 | Ga0207704_100052423 | 545 |
| 752 | 3300025938 | Ga0207704_10006848 | Ga0207704_100068483 | 545 |
| 753 | 3300025939 | Ga0207665_10054887 | Ga0207665_100548872 | 545 |
| 754 | 3300025941 | Ga0207711_10000157 | Ga0207711_1000015719 | 545 |
| 755 | 3300025960 | Ga0207651_10000499 | Ga0207651_100004997 | 545 |
| 756 | 3300025986 | Ga0207658_10005604 | Ga0207658_100056043 | 545 |
| 757 | 3300026023 | Ga0207677_10001200 | Ga0207677_100012008 | 545 |
| 758 | 3300026075 | Ga0207708_10010197 | Ga0207708_100101976 | 545 |
| 759 | 3300026078 | Ga0207702_10012439 | Ga0207702_100124393 | 545 |
| 760 | 3300026088 | Ga0207641_10005017 | Ga0207641_100050173 | 545 |
| 761 | 3300026088 | Ga0207641_10012757 | Ga0207641_100127574 | 545 |
| 762 | 3300026089 | Ga0207648_10002900 | Ga0207648_100029002 | 545 |
| 763 | 3300026095 | Ga0207676_10000054 | Ga0207676_10000054113 | 545 |
| 764 | 3300028381 | Ga0268264_10001476 | Ga0268264_100014764 | 545 |
| 765 | 3300028381 | Ga0268264_10112325 | Ga0268264_101123252 | 545 |
| 766 | 3300031548 | Ga0307408_100034480 | Ga0307408_1000344802 | 545 |
| 767 | 3300031995 | Ga0307409_100096994 | Ga0307409_1000969942 | 545 |
| 768 | 3300035086 | Ga0373934_0010611 | Ga0373934_0010611_1047_2696 | 545 |
| 769 | 3300035118 | Ga0373954_0000493 | Ga0373954_0000493_12547_14196 | 545 |
| 770 | 3300035172 | Ga0373955_0002077 | Ga0373955_0002077_4654_6303 | 545 |
| 771 | 3300035724 | Ga0373933_0001768 | Ga0373933_0001768_7565_9214 | 545 |
| 772 | 3300036401 | Ga0373937_0012074 | Ga0373937_0012074_2317_3966 | 545 |
| 773 | 3300036401 | Ga0373937_0043322 | Ga0373937_0043322_37_1686 | 545 |
| 774 | 3300042876 | Ga0451577_0069457 | Ga0451577_0069457_1047_2738 | 545 |
| 775 | 3300046663 | Ga0495635_0049589 | Ga0495635_0049589_617_2266 | 545 |
| 776 | 3300048907 | Ga0496104_0000011 | Ga0496104_0000011_6748_8397 | 545 |
| 777 | 3300048908 | Ga0496105_0000014 | Ga0496105_0000014_6775_8424 | 545 |
| 778 | 3300048910 | Ga0496107_0030480 | Ga0496107_0030480_1859_3508 | 545 |
| 779 | 3300048912 | Ga0496109_0006154 | Ga0496109_0006154_220_1869 | 545 |
| 780 | 3300005329 | Ga0070683_100070044 | Ga0070683_1000700443 | 546 |
| 781 | 3300005355 | Ga0070671_100009413 | Ga0070671_1000094134 | 546 |
| 782 | 3300005546 | Ga0070696_100015471 | Ga0070696_1000154714 | 546 |
| 783 | 3300005547 | Ga0070693_100003292 | Ga0070693_1000032923 | 546 |
| 784 | 3300005564 | Ga0070664_100007952 | Ga0070664_1000079529 | 546 |
| 785 | 3300006237 | Ga0097621_100019032 | Ga0097621_1000190322 | 546 |
| 786 | 3300006353 | Ga0075370_10023289 | Ga0075370_100232892 | 546 |
| 787 | 3300009174 | Ga0105241_10005162 | Ga0105241_100051624 | 546 |
| 788 | 3300013297 | Ga0157378_10005007 | Ga0157378_100050076 | 546 |
| 789 | 3300013306 | Ga0163162_10006774 | Ga0163162_100067745 | 546 |
| 790 | 3300013307 | Ga0157372_10014377 | Ga0157372_100143773 | 546 |
| 791 | 3300014325 | Ga0163163_10016100 | Ga0163163_100161003 | 546 |
| 792 | 3300014969 | Ga0157376_10013053 | Ga0157376_100130532 | 546 |
| 793 | 3300025927 | Ga0207687_10002597 | Ga0207687_100025977 | 546 |
| 794 | 3300025933 | Ga0207706_10016672 | Ga0207706_100166725 | 546 |
| 795 | 3300025934 | Ga0207686_10001013 | Ga0207686_100010134 | 546 |
| 796 | 3300025944 | Ga0207661_10016684 | Ga0207661_100166842 | 546 |
| 797 | 3300025945 | Ga0207679_10010306 | Ga0207679_100103063 | 546 |
| 798 | 3300025945 | Ga0207679_10021331 | Ga0207679_100213312 | 546 |
| 799 | 3300026089 | Ga0207648_10029560 | Ga0207648_100295604 | 546 |
| 800 | 3300026121 | Ga0207683_10013950 | Ga0207683_100139502 | 546 |
| 801 | 3300026142 | Ga0207698_10029927 | Ga0207698_100299272 | 546 |
| 802 | 3300027360 | Ga0209969_1002196 | Ga0209969_10021962 | 546 |
| 803 | 3300027395 | Ga0209996_1002284 | Ga0209996_10022842 | 546 |
| 804 | 3300027526 | Ga0209968_1001505 | Ga0209968_10015052 | 546 |
| 805 | 3300027614 | Ga0209970_1004448 | Ga0209970_10044482 | 546 |
| 806 | 3300027665 | Ga0209983_1001474 | Ga0209983_10014743 | 546 |
| 807 | 3300027682 | Ga0209971_1000009 | Ga0209971_100000946 | 546 |
| 808 | 3300027695 | Ga0209966_1000125 | Ga0209966_10001258 | 546 |
| 809 | 3300027717 | Ga0209998_10000047 | Ga0209998_1000004717 | 546 |
| 810 | 3300027876 | Ga0209974_10002285 | Ga0209974_100022853 | 546 |
| 811 | 3300028800 | Ga0265338_10017055 | Ga0265338_100170553 | 546 |
| 812 | 3300031995 | Ga0307409_100146331 | Ga0307409_1001463311 | 546 |
| 813 | 3300035725 | Ga0373947_0040953 | Ga0373947_0040953_980_2623 | 546 |
| 814 | 3300049576 | Ga0501040_0000723 | Ga0501040_0000723_14504_16195 | 546 |
| 815 | 3300049577 | Ga0501041_0003865 | Ga0501041_0003865_4782_6473 | 546 |
| 816 | 3300049580 | Ga0501046_0000308 | Ga0501046_0000308_39191_40882 | 546 |
| 817 | 3300049581 | Ga0501047_0027549 | Ga0501047_0027549_2568_4259 | 546 |
| 818 | 3300049591 | Ga0501075_0027282 | Ga0501075_0027282_2027_3718 | 546 |
| 819 | 3300049593 | Ga0501077_0065327 | Ga0501077_0065327_166_1857 | 546 |
| 820 | 3300049741 | Ga0501079_0034966 | Ga0501079_0034966_1104_2795 | 546 |
| 821 | 3300049743 | Ga0501081_0001401 | Ga0501081_0001401_2985_4676 | 546 |
| 822 | 3300049824 | Ga0501045_0000175 | Ga0501045_0000175_30856_32547 | 546 |
| 823 | 3300050496 | nmdc:mga07m45_36246_c2 | nmdc:mga07m45_36246_c2_515_2170 | 546 |
| 824 | 3300054114 | Ga0501084_0002013 | Ga0501084_0002013_13328_15019 | 546 |
| 825 | 3300060353 | Ga0501082_0009373 | Ga0501082_0009373_1326_3017 | 546 |
| 826 | 3300000545 | CNXas_1000057 | CNXas_100005719 | 547 |
| 827 | 3300005458 | Ga0070681_10012013 | Ga0070681_100120134 | 547 |
| 828 | 3300005530 | Ga0070679_100017173 | Ga0070679_1000171733 | 547 |
| 829 | 3300013100 | Ga0157373_10006363 | Ga0157373_100063633 | 547 |
| 830 | 3300013104 | Ga0157370_10006437 | Ga0157370_100064372 | 547 |
| 831 | 3300013307 | Ga0157372_10043861 | Ga0157372_100438612 | 547 |
| 832 | 3300025912 | Ga0207707_10041173 | Ga0207707_100411731 | 547 |
| 833 | 3300025940 | Ga0207691_10069760 | Ga0207691_100697602 | 547 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fdd-assembly1.cif.gz_A | the crystal structure of the pseudomonas dacunhae aspartate-beta-decarboxylase reveals a novel oligomeric assembly for a pyridoxal-5-phosphate dependent enzyme | 0.9455 | 38 | 526 |
| 3fdd-assembly1.cif.gz_A | the crystal structure of the pseudomonas dacunhae aspartate-beta-decarboxylase reveals a novel oligomeric assembly for a pyridoxal-5-phosphate dependent enzyme | 0.92 | 38 | 526 |
| 2zy2-assembly1.cif.gz_A | dodecameric l-aspartate beta-decarboxylase | 0.9165 | 13 | 532 |
| 2zy2-assembly1.cif.gz_A | dodecameric l-aspartate beta-decarboxylase | 0.9114 | 13 | 532 |
| 2zy5-assembly1.cif.gz_F | r487a mutant of l-aspartate beta-decarboxylase | 0.909 | 13 | 531 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zy3A02 | Mainly Alpha;Orthogonal Bundle;Histone, subunit A; | 0.9532 | 40 | 153 | 1.10.20.110 |
| 3f6tB02 | Mainly Alpha;Orthogonal Bundle;Histone, subunit A; | 0.9106 | 40 | 154 | 1.10.20.110 |
| 3f6tA03 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8986 | 167 | 382 | 3.40.640.10 |
| 3f6tA03 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8791 | 167 | 382 | 3.40.640.10 |
| 3f6tA01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.8702 | 408 | 526 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q89PK3-F1-model_v4 | Aspartate 4-decarboxylase (EC 4.1.1.12) | 0.979 | 3 | 533 |
GO:0006520
GO:0006531 GO:0008483 GO:0009058 GO:0030170 GO:0047688 |
| AF-A0A3N5FU08-F1-model_v4 | Bifunctional aspartate transaminase/aspartate 4-decarboxylase (EC 2.6.1.1, EC 4.1.1.12) | 0.9733 | 207 | 531 |
GO:0004069
GO:0006520 GO:0009058 GO:0030170 GO:0047688 |
| AF-A0A7J4YN08-F1-model_v4 | Aspartate 4-decarboxylase (EC 4.1.1.12) | 0.9704 | 6 | 527 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 GO:0047688 |
| AF-A0A2P7BNC4-F1-model_v4 | Aspartate 4-decarboxylase (EC 4.1.1.12) | 0.9699 | 3 | 531 |
GO:0006531
GO:0008483 GO:0009058 GO:0030170 GO:0047688 |
| AF-A0A3N2N423-F1-model_v4 | deleted | 0.9696 | 6 | 531 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar