F482604

General Info

Members Datasets Scaffolds Average Seq Length
829 404 776 348

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10123440|Ga0157375_101234402
Length 408
Sequence MQKAGGKRLFRDNKTLLSRPGPGAAWRLTGRHVHGGPILRHSSFKTAPDQVSRTFMPSKVRIALDAMGGDVGAAVVIPGAAISLHRHREIEFLLVGDRAKIEPELEKHPALKAASKIIHTDVAVAMHDKPSQALRRGRKTSSMWLAIDAVKKGEADVVISAGNTGALMAMSRFHLRTLPGIDRPAIAGVWPTKRGESVVLDLGAAIGGDAHHLVSLAVMGAAMASVLFDKPRPTVGLLNIGTEEIKGHEEIREAGDRLRAVNLPELDYLGFVEGDGIGKGLADVIVTEGFSGNIALKAAEGTARQMAELLRNEMQRSWLSKLGYLLARSAFKALRDKMDPNKSNGGVFLGLNGIVVKSHGGISSEGFAYAIDVGYEMAHYDLLNKINQMLNREGGALSSVQTAQEAVS

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
3 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
4 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
5 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
6 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
7 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
8 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
9 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
10 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
11 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
12 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
13 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
14 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
15 2922368715
16 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
17 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
18 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
19 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
20 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
21 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
22 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
23 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
24 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
25 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
26 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
27 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
28 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
29 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
30 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
31 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
32 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
33 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
34 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
35 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
36 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
37 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
38 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
39 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
40 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
41 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
42 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
43 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
44 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
45 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
46 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
49 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
50 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
116 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
120 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
121 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
122 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
168 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
242 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
392 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
398 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
399 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
400 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
401 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
402 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
403 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
404 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 0
Isolates 6.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 4.83
Rhizoplane 6.88
Rhizosphere 85.04
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10046626 3300002067 Bacteria 1257
2 JGI24738J21930_10003727 3300002075 Bacteria 3809
3 JGI24751J29686_10006293 3300002459 Bacteria 2419
4 JGI25404J52841_10000633 3300003659 Bacteria 5323
5 Ga0065712_10007290 3300005290 Bacteria 2421
6 Ga0065707_10139160 3300005295 Bacteria 1796
7 Ga0070683_100088887 3300005329 Bacteria 2899
8 Ga0070690_100000265 3300005330 Bacteria 26984
9 Ga0070670_100020525 3300005331 Bacteria 5680
10 Ga0070670_100210252 3300005331 Bacteria 1691
11 Ga0070677_10038139 3300005333 Bacteria 1879
12 Ga0070680_100042355 3300005336 Bacteria 3694
13 Ga0070680_100138733 3300005336 Bacteria 2038
14 Ga0068868_100019196 3300005338 Bacteria 5121
15 Ga0070660_100147351 3300005339 Bacteria 1891
16 Ga0070689_100005036 3300005340 Bacteria 8981
17 Ga0070689_100222194 3300005340 Bacteria 1550
18 Ga0070691_10013507 3300005341 Bacteria 3740
19 Ga0070691_10019890 3300005341 Bacteria 3099
20 Ga0070661_100000197 3300005344 Bacteria 50071
21 Ga0070661_100001914 3300005344 Bacteria 14410
22 Ga0070692_10011366 3300005345 Bacteria 4084
23 Ga0070668_100004142 3300005347 Bacteria 10735
24 Ga0070668_100045066 3300005347 Bacteria 3384
25 Ga0070669_100015913 3300005353 Bacteria 5365
26 Ga0070675_100005536 3300005354 Bacteria 9666
27 Ga0070675_100240228 3300005354 Bacteria 1583
28 Ga0070671_100002517 3300005355 Bacteria 14198
29 Ga0070671_100060270 3300005355 Bacteria 3160
30 Ga0070671_100258462 3300005355 Bacteria 1480
31 Ga0070674_100004678 3300005356 Bacteria 7822
32 Ga0070674_100025242 3300005356 Bacteria 3867
33 Ga0070674_100027684 3300005356 Bacteria 3716
34 Ga0070673_100000516 3300005364 Bacteria 20726
35 Ga0070673_100014278 3300005364 Bacteria 5524
36 Ga0070673_100023414 3300005364 Bacteria 4512
37 Ga0070688_100000119 3300005365 Bacteria 41289
38 Ga0070688_100031342 3300005365 Bacteria 3198
39 Ga0070688_100260651 3300005365 Bacteria 1238
40 Ga0070659_100003462 3300005366 Bacteria 11236
41 Ga0070667_100075587 3300005367 Bacteria 2876
42 Ga0070667_100087149 3300005367 Bacteria 2679
43 Ga0070709_10004735 3300005434 Bacteria 7347
44 Ga0070709_10076401 3300005434 Bacteria 2175
45 Ga0070714_100064971 3300005435 Bacteria 3143
46 Ga0070714_100069443 3300005435 Bacteria 3043
47 Ga0070714_100084045 3300005435 Bacteria 2777
48 Ga0070714_100178911 3300005435 Bacteria 1929
49 Ga0070714_100524211 3300005435 Bacteria 1132
50 Ga0070713_100018520 3300005436 Bacteria 5292
51 Ga0070713_100022107 3300005436 Bacteria 4909
52 Ga0070713_100070374 3300005436 Bacteria 2953
53 Ga0070710_10011895 3300005437 Bacteria 4310
54 Ga0070710_10033533 3300005437 Bacteria 2788
55 Ga0070710_10038184 3300005437 Bacteria 2636
56 Ga0070710_10047850 3300005437 Bacteria 2387
57 Ga0070701_10011185 3300005438 Bacteria 4001
58 Ga0070711_100021551 3300005439 Bacteria 4169
59 Ga0070711_100042811 3300005439 Bacteria 3063
60 Ga0070711_100107306 3300005439 Bacteria 2043
61 Ga0070711_100179612 3300005439 Bacteria 1620
62 Ga0070705_100000641 3300005440 Bacteria 19989
63 Ga0070705_100042894 3300005440 Bacteria 2589
64 Ga0070705_100047910 3300005440 Bacteria 2473
65 Ga0070700_100002572 3300005441 Bacteria 9276
66 Ga0070700_100171944 3300005441 Bacteria 1501
67 Ga0070694_100000838 3300005444 Bacteria 17299
68 Ga0070708_100065932 3300005445 Bacteria 3248
69 Ga0070663_100037125 3300005455 Bacteria 3390
70 Ga0070663_100039942 3300005455 Bacteria 3282
71 Ga0070678_100029338 3300005456 Bacteria 3765
72 Ga0070678_100034953 3300005456 Bacteria 3504
73 Ga0070678_100043104 3300005456 Bacteria 3212
74 Ga0070662_100019961 3300005457 Bacteria 4560
75 Ga0070662_100238040 3300005457 Bacteria 1459
76 Ga0070681_10027480 3300005458 Bacteria 5720
77 Ga0068867_100062386 3300005459 Bacteria 2769
78 Ga0068867_100168124 3300005459 Bacteria 1734
79 Ga0070685_10066453 3300005466 Bacteria 2125
80 Ga0070679_100008876 3300005530 Bacteria 9489
81 Ga0070684_100013362 3300005535 Bacteria 6616
82 Ga0070697_100000748 3300005536 Bacteria 24230
83 Ga0070697_100013035 3300005536 Bacteria 6517
84 Ga0070697_100057019 3300005536 Bacteria 3179
85 Ga0068853_100001657 3300005539 Bacteria 16302
86 Ga0068853_100001680 3300005539 Bacteria 16203
87 Ga0070672_100005169 3300005543 Bacteria 8625
88 Ga0070672_100166489 3300005543 Bacteria 1831
89 Ga0070672_100167997 3300005543 Bacteria 1823
90 Ga0070686_100002196 3300005544 Bacteria 10782
91 Ga0070686_100157552 3300005544 Bacteria 1596
92 Ga0070695_100000560 3300005545 Bacteria 19668
93 Ga0070695_100000696 3300005545 Bacteria 17958
94 Ga0070665_100045229 3300005548 Bacteria 4421
95 Ga0070665_100060372 3300005548 Bacteria 3800
96 Ga0070665_100144581 3300005548 Bacteria 2382
97 Ga0070665_100150045 3300005548 Bacteria 2334
98 Ga0070704_100001082 3300005549 Bacteria 14114
99 Ga0068855_100095631 3300005563 Bacteria 3424
100 Ga0070664_100000182 3300005564 Bacteria 44467
101 Ga0068857_100002534 3300005577 Bacteria 14952
102 Ga0068854_100000423 3300005578 Bacteria 26407
103 Ga0068854_100131751 3300005578 Bacteria 1910
104 Ga0068856_100005230 3300005614 Bacteria 12807
105 Ga0070702_100000037 3300005615 Bacteria 36450
106 Ga0070702_100072164 3300005615 Bacteria 2043
107 Ga0070702_100153004 3300005615 Bacteria 1483
108 Ga0068852_100003616 3300005616 Bacteria 10818
109 Ga0068852_100009229 3300005616 Bacteria 7309
110 Ga0068859_100009627 3300005617 Bacteria 9756
111 Ga0068859_100120910 3300005617 Bacteria 2685
112 Ga0068859_100271064 3300005617 Bacteria 1789
113 Ga0068859_100410189 3300005617 Bacteria 1451
114 Ga0068864_100002959 3300005618 Bacteria 14033
115 Ga0068866_10001701 3300005718 Bacteria 9266
116 Ga0068866_10026304 3300005718 Bacteria 2746
117 Ga0068861_100009658 3300005719 Bacteria 6664
118 Ga0068861_100032234 3300005719 Bacteria 3855
119 Ga0068851_10007794 3300005834 Bacteria 4927
120 Ga0068851_10026127 3300005834 Bacteria 2867
121 Ga0068870_10126204 3300005840 Bacteria 1480
122 Ga0068863_100001181 3300005841 Bacteria 26124
123 Ga0068858_100089368 3300005842 Bacteria 2866
124 Ga0068858_100091252 3300005842 Bacteria 2835
125 Ga0068858_100117126 3300005842 Bacteria 2490
126 Ga0068860_100002535 3300005843 Bacteria 19123
127 Ga0068860_100097405 3300005843 Bacteria 2804
128 Ga0068860_100150002 3300005843 Bacteria 2245
129 Ga0068862_100031093 3300005844 Bacteria 4503
130 Ga0068862_100053488 3300005844 Bacteria 3456
131 Ga0081455_10003665 3300005937 Bacteria 17584
132 Ga0081455_10025826 3300005937 Bacteria 5415
133 Ga0081540_1002699 3300005983 Bacteria 14438
134 Ga0081540_1039161 3300005983 Bacteria 2488
135 Ga0070717_10019351 3300006028 Bacteria 5338
136 Ga0075363_100057433 3300006048 Bacteria 2088
137 Ga0075432_10013785 3300006058 Bacteria 2751
138 Ga0075432_10034867 3300006058 Bacteria 1749
139 Ga0070715_10003008 3300006163 Bacteria 5273
140 Ga0070715_10008256 3300006163 Bacteria 3622
141 Ga0070716_100002195 3300006173 Bacteria 8989
142 Ga0070716_100021364 3300006173 Bacteria 3410
143 Ga0070716_100251186 3300006173 Bacteria 1205
144 Ga0070712_100002422 3300006175 Bacteria 11493
145 Ga0070712_100143431 3300006175 Bacteria 1825
146 Ga0070712_100172654 3300006175 Bacteria 1678
147 Ga0075367_10046668 3300006178 Bacteria 2546
148 Ga0075367_10098687 3300006178 Bacteria 1783
149 Ga0097621_100027332 3300006237 Bacteria 4485
150 Ga0075428_100053187 3300006844 Bacteria 4436
151 Ga0075430_100018717 3300006846 Bacteria 5895
152 Ga0075430_100088198 3300006846 Bacteria 2596
153 Ga0075430_100131722 3300006846 Bacteria 2084
154 Ga0075431_100001010 3300006847 Bacteria 25028
155 Ga0075431_100212876 3300006847 Bacteria 1974
156 Ga0075433_10022460 3300006852 Bacteria 5295
157 Ga0075433_10216752 3300006852 Bacteria 1701
158 Ga0075434_100134908 3300006871 Bacteria 2488
159 Ga0075429_100036114 3300006880 Bacteria 4298
160 Ga0075429_100183266 3300006880 Bacteria 1835
161 Ga0068865_100059567 3300006881 Bacteria 2671
162 Ga0068865_100248784 3300006881 Bacteria 1402
163 Ga0075436_100000192 3300006914 Bacteria 37698
164 Ga0075436_100006152 3300006914 Bacteria 8239
165 Ga0075436_100180934 3300006914 Bacteria 1490
166 Ga0097620_100009627 3300006931 Bacteria 9756
167 Ga0097620_100120911 3300006931 Bacteria 2685
168 Ga0097620_100271067 3300006931 Bacteria 1789
169 Ga0097620_100410197 3300006931 Bacteria 1451
170 Ga0075435_100138910 3300007076 Bacteria 2037
171 Ga0075435_100219123 3300007076 Bacteria 1616
172 Ga0099794_10043202 3300007265 Bacteria 2151
173 Ga0099795_10004198 3300007788 Bacteria 3687
174 Ga0105250_10013946 3300009092 Bacteria 3309
175 Ga0105240_10212766 3300009093 Bacteria 2258
176 Ga0105240_10236924 3300009093 Bacteria 2117
177 Ga0111539_10076235 3300009094 Bacteria 3948
178 Ga0111539_10243260 3300009094 Bacteria 2095
179 Ga0105245_10004513 3300009098 Bacteria 12298
180 Ga0105245_10068581 3300009098 Bacteria 3214
181 Ga0105245_10336932 3300009098 Bacteria 1490
182 Ga0105245_10343645 3300009098 Bacteria 1476
183 Ga0105245_10359431 3300009098 Bacteria 1445
184 Ga0105247_10000582 3300009101 Bacteria 29710
185 Ga0105247_10004686 3300009101 Bacteria 8713
186 Ga0114129_10425001 3300009147 Bacteria 1747
187 Ga0105243_10001048 3300009148 Bacteria 25321
188 Ga0105243_10049735 3300009148 Bacteria 3308
189 Ga0105243_10133840 3300009148 Bacteria 2107
190 Ga0105241_10000744 3300009174 Bacteria 24789
191 Ga0105241_10094455 3300009174 Bacteria 2365
192 Ga0105242_10001197 3300009176 Bacteria 20476
193 Ga0105248_10001853 3300009177 Bacteria 23435
194 Ga0105237_10000542 3300009545 Bacteria 53188
195 Ga0105237_10003908 3300009545 Bacteria 17463
196 Ga0105238_10052463 3300009551 Bacteria 4100
197 Ga0105238_10085480 3300009551 Bacteria 3142
198 Ga0105249_10000702 3300009553 Bacteria 30380
199 Ga0105249_10015186 3300009553 Bacteria 6815
200 Ga0099796_10000963 3300010159 Bacteria 5386
201 Ga0105239_10001329 3300010375 Bacteria 33273
202 Ga0105239_10005973 3300010375 Bacteria 14170
203 Ga0105239_10037215 3300010375 Bacteria 5336
204 Ga0105239_10398220 3300010375 Bacteria 1558
205 Ga0105246_10000802 3300011119 Bacteria 17857
206 Ga0157373_10009574 3300013100 Bacteria 7154
207 Ga0157371_10012903 3300013102 Bacteria 6362
208 Ga0157369_10005142 3300013105 Bacteria 15314
209 Ga0157374_10010830 3300013296 Bacteria 7868
210 Ga0157378_10034098 3300013297 Bacteria 4502
211 Ga0163162_10035022 3300013306 Bacteria 4999
212 Ga0157372_10004763 3300013307 Bacteria 14405
213 Ga0157372_10197437 3300013307 Bacteria 2330
214 Ga0157375_10000519 3300013308 Bacteria 34613
215 Ga0157375_10004901 3300013308 Bacteria 11634
216 Ga0157375_10075444 3300013308 Bacteria 3396
217 Ga0157375_10123440 3300013308 Bacteria 2702
218 Ga0163163_10002649 3300014325 Bacteria 15143
219 Ga0163163_10074340 3300014325 Bacteria 3390
220 Ga0157380_10008349 3300014326 Bacteria 7384
221 Ga0157380_10021746 3300014326 Bacteria 4817
222 Ga0157380_10309791 3300014326 Bacteria 1458
223 Ga0157377_10006697 3300014745 Bacteria 5516
224 Ga0157377_10130722 3300014745 Bacteria 1533
225 Ga0157379_10000158 3300014968 Bacteria 50531
226 Ga0157379_10096803 3300014968 Bacteria 2649
227 Ga0157376_10004180 3300014969 Bacteria 10015
228 Ga0157376_10014743 3300014969 Bacteria 5879
229 Ga0157376_10039678 3300014969 Bacteria 3842
230 Ga0163161_10003786 3300017792 Bacteria 10601
231 Ga0163161_10019421 3300017792 Bacteria 4768
232 Ga0213872_10063049 3300021361 Bacteria 1675
233 Ga0213876_10042552 3300021384 Bacteria 2400
234 Ga0209758_1001046 3300025297 Bacteria 36253
235 Ga0207656_10032018 3300025321 Bacteria 2182
236 Ga0207653_10051798 3300025885 Bacteria 1367
237 Ga0207682_10002414 3300025893 Bacteria 8411
238 Ga0207692_10012156 3300025898 Bacteria 3689
239 Ga0207692_10038239 3300025898 Bacteria 2353
240 Ga0207642_10020933 3300025899 Bacteria 2564
241 Ga0207710_10008712 3300025900 Bacteria 4277
242 Ga0207688_10003365 3300025901 Bacteria 8733
243 Ga0207680_10010262 3300025903 Bacteria 4680
244 Ga0207647_10001406 3300025904 Bacteria 18468
245 Ga0207699_10022098 3300025906 Bacteria 3442
246 Ga0207699_10056526 3300025906 Bacteria 2339
247 Ga0207699_10066640 3300025906 Bacteria 2186
248 Ga0207645_10180403 3300025907 Bacteria 1385
249 Ga0207643_10015748 3300025908 Bacteria 4118
250 Ga0207684_10061490 3300025910 Bacteria 3189
251 Ga0207654_10027759 3300025911 Bacteria 3079
252 Ga0207654_10201013 3300025911 Bacteria 1312
253 Ga0207707_10100673 3300025912 Bacteria 2525
254 Ga0207707_10102568 3300025912 Bacteria 2501
255 Ga0207707_10141873 3300025912 Bacteria 2100
256 Ga0207671_10000649 3300025914 Bacteria 45408
257 Ga0207671_10033119 3300025914 Bacteria 3846
258 Ga0207693_10000238 3300025915 Bacteria 50667
259 Ga0207693_10023521 3300025915 Bacteria 4892
260 Ga0207693_10038606 3300025915 Bacteria 3759
261 Ga0207693_10060824 3300025915 Bacteria 2958
262 Ga0207663_10000287 3300025916 Bacteria 22143
263 Ga0207663_10039870 3300025916 Bacteria 2850
264 Ga0207663_10060610 3300025916 Bacteria 2398
265 Ga0207663_10078460 3300025916 Bacteria 2153
266 Ga0207660_10067077 3300025917 Bacteria 2598
267 Ga0207660_10102686 3300025917 Bacteria 2138
268 Ga0207657_10000279 3300025919 Bacteria 54382
269 Ga0207649_10002158 3300025920 Bacteria 11131
270 Ga0207649_10192485 3300025920 Bacteria 1435
271 Ga0207652_10092478 3300025921 Bacteria 2661
272 Ga0207646_10077702 3300025922 Bacteria 2966
273 Ga0207681_10055945 3300025923 Bacteria 2689
274 Ga0207694_10036825 3300025924 Bacteria 3755
275 Ga0207694_10055605 3300025924 Bacteria 3072
276 Ga0207694_10121732 3300025924 Bacteria 2084
277 Ga0207659_10041965 3300025926 Bacteria 3205
278 Ga0207659_10097275 3300025926 Bacteria 2211
279 Ga0207659_10210706 3300025926 Bacteria 1557
280 Ga0207687_10005003 3300025927 Bacteria 8777
281 Ga0207687_10169984 3300025927 Bacteria 1680
282 Ga0207700_10015205 3300025928 Bacteria 5066
283 Ga0207700_10036206 3300025928 Bacteria 3562
284 Ga0207700_10102585 3300025928 Bacteria 2285
285 Ga0207664_10123366 3300025929 Bacteria 2171
286 Ga0207664_10126779 3300025929 Bacteria 2144
287 Ga0207664_10161692 3300025929 Bacteria 1910
288 Ga0207664_10191882 3300025929 Bacteria 1759
289 Ga0207664_10336498 3300025929 Bacteria 1334
290 Ga0207644_10071062 3300025931 Bacteria 2545
291 Ga0207690_10005905 3300025932 Bacteria 7248
292 Ga0207706_10000298 3300025933 Bacteria 53969
293 Ga0207706_10087810 3300025933 Bacteria 2734
294 Ga0207686_10030075 3300025934 Bacteria 3212
295 Ga0207709_10022986 3300025935 Bacteria 3544
296 Ga0207709_10099567 3300025935 Bacteria 1919
297 Ga0207670_10039131 3300025936 Bacteria 3103
298 Ga0207669_10001168 3300025937 Bacteria 11170
299 Ga0207669_10040852 3300025937 Bacteria 2694
300 Ga0207704_10055882 3300025938 Bacteria 2415
301 Ga0207704_10107706 3300025938 Bacteria 1875
302 Ga0207665_10001494 3300025939 Bacteria 15715
303 Ga0207665_10010416 3300025939 Bacteria 6107
304 Ga0207665_10025499 3300025939 Bacteria 3901
305 Ga0207691_10015272 3300025940 Bacteria 7306
306 Ga0207691_10142387 3300025940 Bacteria 2112
307 Ga0207711_10031576 3300025941 Bacteria 4472
308 Ga0207689_10026905 3300025942 Bacteria 4815
309 Ga0207689_10097582 3300025942 Bacteria 2414
310 Ga0207661_10106700 3300025944 Bacteria 2361
311 Ga0207679_10009757 3300025945 Bacteria 6159
312 Ga0207679_10094624 3300025945 Bacteria 2320
313 Ga0207651_10029594 3300025960 Bacteria 3472
314 Ga0207651_10079884 3300025960 Bacteria 2351
315 Ga0207651_10255496 3300025960 Bacteria 1436
316 Ga0207651_10379731 3300025960 Bacteria 1197
317 Ga0207712_10020564 3300025961 Bacteria 4324
318 Ga0207712_10071366 3300025961 Bacteria 2498
319 Ga0207668_10019174 3300025972 Bacteria 4318
320 Ga0207668_10043366 3300025972 Bacteria 3052
321 Ga0207668_10073880 3300025972 Bacteria 2445
322 Ga0207640_10177932 3300025981 Bacteria 1592
323 Ga0207640_10220836 3300025981 Bacteria 1451
324 Ga0207640_10221049 3300025981 Bacteria 1450
325 Ga0207658_10010080 3300025986 Bacteria 6419
326 Ga0207658_10038002 3300025986 Bacteria 3465
327 Ga0207658_10052748 3300025986 Bacteria 3002
328 Ga0207703_10008056 3300026035 Bacteria 8328
329 Ga0207703_10363418 3300026035 Bacteria 1335
330 Ga0207639_10009775 3300026041 Bacteria 6628
331 Ga0207678_10000147 3300026067 Bacteria 57839
332 Ga0207678_10109186 3300026067 Bacteria 2360
333 Ga0207708_10006016 3300026075 Bacteria 8994
334 Ga0207708_10068483 3300026075 Bacteria 2717
335 Ga0207708_10095298 3300026075 Bacteria 2298
336 Ga0207708_10160609 3300026075 Bacteria 1774
337 Ga0207702_10036429 3300026078 Bacteria 4115
338 Ga0207702_10078916 3300026078 Bacteria 2851
339 Ga0207641_10017382 3300026088 Bacteria 5888
340 Ga0207648_10037564 3300026089 Bacteria 4267
341 Ga0207648_10119872 3300026089 Bacteria 2313
342 Ga0207648_10234542 3300026089 Bacteria 1633
343 Ga0207648_10286929 3300026089 Bacteria 1473
344 Ga0207676_10008137 3300026095 Bacteria 7455
345 Ga0207674_10001015 3300026116 Bacteria 36675
346 Ga0207674_10254188 3300026116 Bacteria 1704
347 Ga0207675_100000256 3300026118 Bacteria 50777
348 Ga0207675_100017442 3300026118 Bacteria 6702
349 Ga0207683_10000481 3300026121 Bacteria 36853
350 Ga0207683_10011735 3300026121 Bacteria 7478
351 Ga0207683_10169309 3300026121 Bacteria 1978
352 Ga0207698_10006361 3300026142 Bacteria 7360
353 Ga0207698_10143899 3300026142 Bacteria 2058
354 Ga0207428_10019580 3300027907 Bacteria 5766
355 Ga0268266_10000442 3300028379 Bacteria 61975
356 Ga0268266_10054369 3300028379 Bacteria 3440
357 Ga0268266_10071605 3300028379 Bacteria 3005
358 Ga0268266_10127592 3300028379 Bacteria 2272
359 Ga0268265_10012963 3300028380 Bacteria 5660
360 Ga0268265_10024682 3300028380 Bacteria 4257
361 Ga0268264_10044357 3300028381 Bacteria 3688
362 Ga0268264_10177182 3300028381 Bacteria 1933
363 Ga0265325_10018613 3300031241 Bacteria 3852
364 Ga0265325_10023501 3300031241 Bacteria 3363
365 Ga0265325_10025494 3300031241 Bacteria 3210
366 Ga0265325_10046577 3300031241 Bacteria 2248
367 Ga0265329_10031438 3300031242 Bacteria 1724
368 Ga0265339_10046300 3300031249 Bacteria 2392
369 Ga0265316_10021547 3300031344 Bacteria 5456
370 Ga0265313_10032255 3300031595 Bacteria 2677
371 Ga0265313_10062141 3300031595 Bacteria 1745
372 Ga0265314_10028861 3300031711 Bacteria 4129
373 Ga0307414_10089205 3300032004 Bacteria 2285
374 Ga0316583_10000231 3300032133 Bacteria 15111
375 Ga0316583_10011203 3300032133 Bacteria 3228
376 Ga0373950_0014965 3300034818 Bacteria 1311
377 Ga0373944_0038892 3300035089 Bacteria 1462
378 Ga0373939_0031996 3300035114 Bacteria 1525
379 Ga0373945_0010619 3300035116 Bacteria 3035
380 Ga0373954_0031235 3300035118 Bacteria 2458
381 Ga0373943_0000422 3300035170 Bacteria 17852
382 Ga0373943_0005880 3300035170 Bacteria 5510
383 Ga0373943_0032540 3300035170 Bacteria 2479
384 Ga0373946_0000369 3300035171 Bacteria 14584
385 Ga0373946_0011600 3300035171 Bacteria 3291
386 Ga0373946_0039364 3300035171 Bacteria 1930
387 Ga0373955_0023754 3300035172 Bacteria 3127
388 Ga0373961_0017807 3300035241 Bacteria 1848
389 Ga0373931_0034854 3300035691 Bacteria 2614
390 Ga0373927_0000414 3300035695 Bacteria 32784
391 Ga0373927_0027487 3300035695 Bacteria 3714
392 Ga0373927_0027723 3300035695 Bacteria 3698
393 Ga0373933_0051605 3300035724 Bacteria 2459
394 Ga0373947_0000275 3300035725 Bacteria 29242
395 Ga0373947_0005949 3300035725 Bacteria 7108
396 Ga0373947_0151578 3300035725 Bacteria 1493
397 Ga0373937_0049609 3300036401 Bacteria 3843
398 Ga0316582_0010864 3300036647 Bacteria 5007
399 Ga0316582_0085542 3300036647 Bacteria 2067
400 Ga0373925_0002546 3300037068 Bacteria 14512
401 Ga0373925_0038888 3300037068 Bacteria 3519
402 Ga0373925_0109999 3300037068 Bacteria 2127
403 Ga0395899_0000130 3300037312 Bacteria 117976
404 Ga0395899_0285191 3300037312 Bacteria 1122
405 Ga0395900_0000020 3300037418 Bacteria 353500
406 Ga0395900_0043778 3300037418 Bacteria 4614
407 Ga0395898_0000104 3300037466 Bacteria 223462
408 Ga0395898_0013577 3300037466 Bacteria 8383
409 Ga0395905_0000019 3300037471 Bacteria 353500
410 Ga0395905_0005466 3300037471 Bacteria 12958
411 Ga0395905_0020427 3300037471 Bacteria 6274
412 Ga0316581_0007757 3300037588 Bacteria 2894
413 Ga0395901_0000016 3300038443 Bacteria 354008
414 Ga0395901_0038344 3300038443 Bacteria 4956
415 Ga0436365_0034062 3300039437 Bacteria 1969
416 Ga0436365_0636722 3300039437 Bacteria 3357
417 Ga0436361_0496440 3300039447 Bacteria 3451
418 Ga0436361_0812703 3300039447 Bacteria 4735
419 Ga0436361_1044927 3300039447 Bacteria 6486
420 Ga0436363_0751359 3300039450 Bacteria 2742
421 Ga0439441_001387 3300042001 Bacteria 3144
422 Ga0466972_0039602 3300044658 Bacteria 2299
423 Ga0466964_0026887 3300044706 Bacteria 2255
424 Ga0466960_0024288 3300044901 Bacteria 2733
425 Ga0466967_0127455 3300045976 Bacteria 2359
426 Ga0495592_0004650 3300046454 Bacteria 10057
427 Ga0495603_0001214 3300046455 Bacteria 15042
428 Ga0495603_0051536 3300046455 Bacteria 2445
429 Ga0495629_0002062 3300046459 Bacteria 15586
430 Ga0495629_0015054 3300046459 Bacteria 5559
431 Ga0495641_0022382 3300046461 Bacteria 3163
432 Ga0495641_0023622 3300046461 Bacteria 3049
433 Ga0495651_0033029 3300046462 Bacteria 4037
434 Ga0495653_0016883 3300046463 Bacteria 5940
435 Ga0495580_0000299 3300046472 Bacteria 40203
436 Ga0495580_0008354 3300046472 Bacteria 8234
437 Ga0495580_0090256 3300046472 Bacteria 2133
438 Ga0495582_0011046 3300046473 Bacteria 4971
439 Ga0495582_0025753 3300046473 Bacteria 3222
440 Ga0495639_0005838 3300046475 Bacteria 5293
441 Ga0495639_0077256 3300046475 Bacteria 1545
442 Ga0495662_0000261 3300046476 Bacteria 22323
443 Ga0495664_0000230 3300046477 Bacteria 26824
444 Ga0495664_0003269 3300046477 Bacteria 8808
445 Ga0495584_0008789 3300046491 Bacteria 5223
446 Ga0495584_0035734 3300046491 Bacteria 2511
447 Ga0495585_0004199 3300046492 Bacteria 9408
448 Ga0495594_0000679 3300046499 Bacteria 17523
449 Ga0495607_0008348 3300046501 Bacteria 7084
450 Ga0495618_0006033 3300046514 Bacteria 7360
451 Ga0495618_0014795 3300046514 Bacteria 4759
452 Ga0495628_0164958 3300046516 Bacteria 1682
453 Ga0495630_0038359 3300046517 Bacteria 3583
454 Ga0495630_0302082 3300046517 Bacteria 1223
455 Ga0495644_0001707 3300046523 Bacteria 8891
456 Ga0495644_0043075 3300046523 Bacteria 1699
457 Ga0495666_0005800 3300046526 Bacteria 6224
458 Ga0495665_0027299 3300046531 Bacteria 3064
459 Ga0495665_0073872 3300046531 Bacteria 1795
460 Ga0495640_0009468 3300046533 Bacteria 7588
461 Ga0495640_0154240 3300046533 Bacteria 1474
462 Ga0495586_0092976 3300046535 Bacteria 1667
463 Ga0495587_0036279 3300046536 Bacteria 2966
464 Ga0495621_0009482 3300046539 Bacteria 2956
465 Ga0495645_0014321 3300046543 Bacteria 5624
466 Ga0495622_0000920 3300046557 Bacteria 15926
467 Ga0495633_0003249 3300046558 Bacteria 10952
468 Ga0495667_0004508 3300046559 Bacteria 9402
469 Ga0495656_0000538 3300046615 Bacteria 12366
470 Ga0495656_0013509 3300046615 Bacteria 3041
471 Ga0495634_0006288 3300046642 Bacteria 9046
472 Ga0495634_0124748 3300046642 Bacteria 1646
473 Ga0495661_0039583 3300046665 Bacteria 2929
474 Ga0495588_0001344 3300046674 Bacteria 10506
475 Ga0495588_0002190 3300046674 Bacteria 8363
476 Ga0495599_0095121 3300046678 Bacteria 1858
477 Ga0495646_0043669 3300046680 Bacteria 2743
478 Ga0495647_0002287 3300046681 Bacteria 6009
479 Ga0495647_0009258 3300046681 Bacteria 3331
480 Ga0495658_0015537 3300046683 Bacteria 3906
481 Ga0495658_0085068 3300046683 Bacteria 1863
482 Ga0495613_0000818 3300046689 Bacteria 24094
483 Ga0495613_0033916 3300046689 Bacteria 3791
484 Ga0495624_0008042 3300046690 Bacteria 7386
485 Ga0495624_0013504 3300046690 Bacteria 5568
486 Ga0495670_0002388 3300046691 Bacteria 9251
487 Ga0495649_0074482 3300046694 Bacteria 1819
488 Ga0495589_0143780 3300046794 Bacteria 1141
489 Ga0495600_0028724 3300046809 Bacteria 3599
490 Ga0495581_0002568 3300047315 Bacteria 10314
491 Ga0495604_0012078 3300047317 Bacteria 6867
492 Ga0495636_0024479 3300047318 Bacteria 2449
493 Ga0495674_0000209 3300047319 Bacteria 48240
494 Ga0495674_0209410 3300047319 Bacteria 1615
495 Ga0495676_0020836 3300047321 Bacteria 5743
496 Ga0495676_0195687 3300047321 Bacteria 1408
497 Ga0495673_0043900 3300047469 Bacteria 1997
498 Ga0495684_0002373 3300047471 Bacteria 15050
499 Ga0495684_0003076 3300047471 Bacteria 13112
500 Ga0495684_0009099 3300047471 Bacteria 7672
501 Ga0495593_0003392 3300047673 Bacteria 9541
502 Ga0495593_0024206 3300047673 Bacteria 3367
503 Ga0495614_0015281 3300048089 Bacteria 3347
504 Ga0496100_0027864 3300048903 Bacteria 3477
505 Ga0496100_0115464 3300048903 Bacteria 1872
506 Ga0496101_0003051 3300048904 Bacteria 10335
507 Ga0496101_0029223 3300048904 Bacteria 3855
508 Ga0496101_0084065 3300048904 Bacteria 2357
509 Ga0496102_0026327 3300048905 Bacteria 5186
510 Ga0496102_0039066 3300048905 Bacteria 4286
511 Ga0496102_0149761 3300048905 Bacteria 2192
512 Ga0496102_0472128 3300048905 Bacteria 1175
513 Ga0496103_0016875 3300048906 Bacteria 4360
514 Ga0496103_0077622 3300048906 Bacteria 2085
515 Ga0496103_0169762 3300048906 Bacteria 1401
516 Ga0496104_0005722 3300048907 Bacteria 10879
517 Ga0496104_0030057 3300048907 Bacteria 5045
518 Ga0496104_0050836 3300048907 Bacteria 3911
519 Ga0496104_0118063 3300048907 Bacteria 2546
520 Ga0496104_0221501 3300048907 Bacteria 1804
521 Ga0496105_0012770 3300048908 Bacteria 6653
522 Ga0496105_0014052 3300048908 Bacteria 6370
523 Ga0496105_0148154 3300048908 Bacteria 1930
524 Ga0496106_0023465 3300048909 Bacteria 4583
525 Ga0496106_0033436 3300048909 Bacteria 3836
526 Ga0496106_0054544 3300048909 Bacteria 3020
527 Ga0496107_0014875 3300048910 Bacteria 5449
528 Ga0496107_0018774 3300048910 Bacteria 4872
529 Ga0496107_0036689 3300048910 Bacteria 3516
530 Ga0496107_0048501 3300048910 Bacteria 3059
531 Ga0496107_0090042 3300048910 Bacteria 2241
532 Ga0496107_0196165 3300048910 Bacteria 1500
533 Ga0496108_0021693 3300048911 Bacteria 5279
534 Ga0496108_0202542 3300048911 Bacteria 1722
535 Ga0496108_0215572 3300048911 Bacteria 1667
536 Ga0496108_0430428 3300048911 Bacteria 1152
537 Ga0496108_0439344 3300048911 Bacteria 1140
538 Ga0496109_0035964 3300048912 Bacteria 4470
539 Ga0496109_0041180 3300048912 Bacteria 4185
540 Ga0496109_0049798 3300048912 Bacteria 3815
541 Ga0496109_0133005 3300048912 Bacteria 2323
542 Ga0496109_0238586 3300048912 Bacteria 1711
543 Ga0496110_0017894 3300048913 Bacteria 5933
544 Ga0496110_0047849 3300048913 Bacteria 3746
545 Ga0496110_0233701 3300048913 Bacteria 1672
546 Ga0496111_0014031 3300048914 Bacteria 5465
547 Ga0496111_0128705 3300048914 Bacteria 1872
548 Ga0496112_0003536 3300048915 Bacteria 12967
549 Ga0496112_0013959 3300048915 Bacteria 7433
550 Ga0496112_0085671 3300048915 Bacteria 3117
551 Ga0496113_0015547 3300048916 Bacteria 5235
552 Ga0496113_0063345 3300048916 Bacteria 2794
553 Ga0496113_0132943 3300048916 Bacteria 1953
554 Ga0496114_0011742 3300048917 Bacteria 7006
555 Ga0496114_0014599 3300048917 Bacteria 6310
556 Ga0496114_0018780 3300048917 Bacteria 5595
557 Ga0496114_0025447 3300048917 Bacteria 4838
558 Ga0496114_0063446 3300048917 Bacteria 3093
559 Ga0496115_0004532 3300048918 Bacteria 10050
560 Ga0496115_0007837 3300048918 Bacteria 7874
561 Ga0496117_0001320 3300048920 Bacteria 36466
562 Ga0496118_0167398 3300048921 Bacteria 1348
563 Ga0501031_0030985 3300049568 Bacteria 3489
564 Ga0501031_0032572 3300049568 Bacteria 3398
565 Ga0501031_0037770 3300049568 Bacteria 3152
566 Ga0501031_0066112 3300049568 Bacteria 2356
567 Ga0501031_0267329 3300049568 Bacteria 1111
568 Ga0501032_0037553 3300049569 Bacteria 3302
569 Ga0501032_0050135 3300049569 Bacteria 2815
570 Ga0501032_0060859 3300049569 Bacteria 2532
571 Ga0501032_0134508 3300049569 Bacteria 1630
572 Ga0501032_0154909 3300049569 Bacteria 1506
573 Ga0501033_0001956 3300049570 Bacteria 17932
574 Ga0501033_0041454 3300049570 Bacteria 3435
575 Ga0501033_0103729 3300049570 Bacteria 2073
576 Ga0501033_0119762 3300049570 Bacteria 1911
577 Ga0501033_0218645 3300049570 Bacteria 1356
578 Ga0501034_0012317 3300049571 Bacteria 8835
579 Ga0501034_0060416 3300049571 Bacteria 3806
580 Ga0501034_0102117 3300049571 Bacteria 2861
581 Ga0501034_0264000 3300049571 Bacteria 1664
582 Ga0501034_0434288 3300049571 Bacteria 1232
583 Ga0501036_0023367 3300049572 Bacteria 5207
584 Ga0501036_0033890 3300049572 Bacteria 4319
585 Ga0501036_0041532 3300049572 Bacteria 3890
586 Ga0501036_0238203 3300049572 Bacteria 1526
587 Ga0501036_0433179 3300049572 Bacteria 1096
588 Ga0501037_0000505 3300049573 Bacteria 31438
589 Ga0501037_0071665 3300049573 Bacteria 2520
590 Ga0501037_0100717 3300049573 Bacteria 2086
591 Ga0501038_0006501 3300049574 Bacteria 10816
592 Ga0501038_0042838 3300049574 Bacteria 3941
593 Ga0501038_0166790 3300049574 Bacteria 1786
594 Ga0501038_0278022 3300049574 Bacteria 1319
595 Ga0501039_0018886 3300049575 Bacteria 5293
596 Ga0501039_0035125 3300049575 Bacteria 3868
597 Ga0501039_0050030 3300049575 Bacteria 3232
598 Ga0501039_0050488 3300049575 Bacteria 3218
599 Ga0501039_0055204 3300049575 Bacteria 3075
600 Ga0501039_0246646 3300049575 Bacteria 1404
601 Ga0501040_0019021 3300049576 Bacteria 4564
602 Ga0501040_0054327 3300049576 Bacteria 2746
603 Ga0501040_0069979 3300049576 Bacteria 2421
604 Ga0501040_0365530 3300049576 Bacteria 1034
605 Ga0501041_0011323 3300049577 Bacteria 5271
606 Ga0501041_0022453 3300049577 Bacteria 3778
607 Ga0501041_0053028 3300049577 Bacteria 2473
608 Ga0501041_0083261 3300049577 Bacteria 1972
609 Ga0501041_0087204 3300049577 Bacteria 1926
610 Ga0501042_0017882 3300049578 Bacteria 4898
611 Ga0501042_0039929 3300049578 Bacteria 3336
612 Ga0501042_0056561 3300049578 Bacteria 2799
613 Ga0501042_0087879 3300049578 Bacteria 2230
614 Ga0501042_0107026 3300049578 Bacteria 2013
615 Ga0501042_0175799 3300049578 Bacteria 1544
616 Ga0501042_0241409 3300049578 Bacteria 1304
617 Ga0501043_0029259 3300049579 Bacteria 4326
618 Ga0501043_0053301 3300049579 Bacteria 3176
619 Ga0501043_0061995 3300049579 Bacteria 2936
620 Ga0501043_0173619 3300049579 Bacteria 1681
621 Ga0501046_0030619 3300049580 Bacteria 4366
622 Ga0501046_0051777 3300049580 Bacteria 3239
623 Ga0501046_0064791 3300049580 Bacteria 2852
624 Ga0501046_0094208 3300049580 Bacteria 2301
625 Ga0501046_0176533 3300049580 Bacteria 1600
626 Ga0501047_0029059 3300049581 Bacteria 5332
627 Ga0501047_0076477 3300049581 Bacteria 3221
628 Ga0501047_0126178 3300049581 Bacteria 2439
629 Ga0501048_0026181 3300049582 Bacteria 4246
630 Ga0501048_0034825 3300049582 Bacteria 3629
631 Ga0501048_0064062 3300049582 Bacteria 2600
632 Ga0501048_0136010 3300049582 Bacteria 1737
633 Ga0501048_0148190 3300049582 Bacteria 1659
634 Ga0501048_0238124 3300049582 Bacteria 1291
635 Ga0501067_0085477 3300049583 Bacteria 1750
636 Ga0501068_0013109 3300049584 Bacteria 4712
637 Ga0501068_0034779 3300049584 Bacteria 3006
638 Ga0501068_0044180 3300049584 Bacteria 2682
639 Ga0501068_0054184 3300049584 Bacteria 2429
640 Ga0501068_0227180 3300049584 Bacteria 1187
641 Ga0501069_0063574 3300049585 Bacteria 2061
642 Ga0501069_0070010 3300049585 Bacteria 1965
643 Ga0501070_0007975 3300049586 Bacteria 8970
644 Ga0501070_0032521 3300049586 Bacteria 4366
645 Ga0501070_0054634 3300049586 Bacteria 3311
646 Ga0501071_0011812 3300049587 Bacteria 5893
647 Ga0501071_0125279 3300049587 Bacteria 1906
648 Ga0501071_0158670 3300049587 Bacteria 1690
649 Ga0501071_0202563 3300049587 Bacteria 1491
650 Ga0501071_0370505 3300049587 Bacteria 1091
651 Ga0501072_0018777 3300049588 Bacteria 5332
652 Ga0501072_0031428 3300049588 Bacteria 4157
653 Ga0501072_0033228 3300049588 Bacteria 4042
654 Ga0501072_0058644 3300049588 Bacteria 3034
655 Ga0501072_0074870 3300049588 Bacteria 2677
656 Ga0501072_0092065 3300049588 Bacteria 2407
657 Ga0501072_0164154 3300049588 Bacteria 1772
658 Ga0501073_0034730 3300049589 Bacteria 3587
659 Ga0501073_0047412 3300049589 Bacteria 3020
660 Ga0501073_0173702 3300049589 Bacteria 1492
661 Ga0501074_0005361 3300049590 Bacteria 9222
662 Ga0501074_0006129 3300049590 Bacteria 8684
663 Ga0501074_0014482 3300049590 Bacteria 5738
664 Ga0501074_0027814 3300049590 Bacteria 4100
665 Ga0501074_0036341 3300049590 Bacteria 3568
666 Ga0501074_0212053 3300049590 Bacteria 1380
667 Ga0501075_0014112 3300049591 Bacteria 5722
668 Ga0501075_0021030 3300049591 Bacteria 4754
669 Ga0501075_0081325 3300049591 Bacteria 2452
670 Ga0501075_0099884 3300049591 Bacteria 2204
671 Ga0501075_0141760 3300049591 Bacteria 1832
672 Ga0501075_0179888 3300049591 Bacteria 1613
673 Ga0501076_0005491 3300049592 Bacteria 9131
674 Ga0501076_0036967 3300049592 Bacteria 3827
675 Ga0501076_0037909 3300049592 Bacteria 3782
676 Ga0501076_0086664 3300049592 Bacteria 2517
677 Ga0501076_0128327 3300049592 Bacteria 2056
678 Ga0501076_0172551 3300049592 Bacteria 1763
679 Ga0501077_0007434 3300049593 Bacteria 6758
680 Ga0501077_0035201 3300049593 Bacteria 3187
681 Ga0501077_0049569 3300049593 Bacteria 2668
682 Ga0501079_0015639 3300049741 Bacteria 5795
683 Ga0501079_0029595 3300049741 Bacteria 4205
684 Ga0501079_0066283 3300049741 Bacteria 2786
685 Ga0501079_0096015 3300049741 Bacteria 2298
686 Ga0501079_0331755 3300049741 Bacteria 1191
687 Ga0501080_0038730 3300049742 Bacteria 4450
688 Ga0501080_0040549 3300049742 Bacteria 4342
689 Ga0501080_0068732 3300049742 Bacteria 3295
690 Ga0501080_0078421 3300049742 Bacteria 3072
691 Ga0501080_0111323 3300049742 Bacteria 2538
692 Ga0501080_0162575 3300049742 Bacteria 2061
693 Ga0501080_0171255 3300049742 Bacteria 2002
694 Ga0501080_0250735 3300049742 Bacteria 1614
695 Ga0501080_0443156 3300049742 Bacteria 1165
696 Ga0501081_0013258 3300049743 Bacteria 5421
697 Ga0501081_0034250 3300049743 Bacteria 3455
698 Ga0501081_0039930 3300049743 Bacteria 3213
699 Ga0501081_0051414 3300049743 Bacteria 2842
700 Ga0501081_0074663 3300049743 Bacteria 2366
701 Ga0501081_0154902 3300049743 Bacteria 1648
702 Ga0501081_0169781 3300049743 Bacteria 1574
703 Ga0501083_0019073 3300049744 Bacteria 4776
704 Ga0501083_0053537 3300049744 Bacteria 2709
705 Ga0501083_0123486 3300049744 Bacteria 1698
706 Ga0501083_0125939 3300049744 Bacteria 1679
707 Ga0501083_0143303 3300049744 Bacteria 1564
708 Ga0501083_0161522 3300049744 Bacteria 1466
709 Ga0501035_0005152 3300049822 Bacteria 12360
710 Ga0501035_0059715 3300049822 Bacteria 3396
711 Ga0501035_0081968 3300049822 Bacteria 2847
712 Ga0501035_0091071 3300049822 Bacteria 2684
713 Ga0501035_0099632 3300049822 Bacteria 2551
714 Ga0501035_0104063 3300049822 Bacteria 2489
715 Ga0501035_0114014 3300049822 Bacteria 2368
716 Ga0501035_0152089 3300049822 Bacteria 2008
717 Ga0501044_0093651 3300049823 Bacteria 3029
718 Ga0501044_0147725 3300049823 Bacteria 2334
719 Ga0501044_0155713 3300049823 Bacteria 2264
720 Ga0501044_0203679 3300049823 Bacteria 1936
721 Ga0501044_0247095 3300049823 Bacteria 1727
722 Ga0501045_0005186 3300049824 Bacteria 9007
723 Ga0501045_0018625 3300049824 Bacteria 4941
724 Ga0501045_0030041 3300049824 Bacteria 3931
725 Ga0501045_0106955 3300049824 Bacteria 2073
726 Ga0501045_0180192 3300049824 Bacteria 1574
727 nmdc:mga03n38_80889_c1 3300050490 Bacteria 1526
728 nmdc:mga00v17_147061_c1 3300050491 Bacteria 1513
729 nmdc:mga06z11_99650_c1 3300050494 Bacteria 1592
730 nmdc:mga05p37_420053_c1 3300050507 Bacteria 1556
731 nmdc:mga05p37_65041_c1 3300050507 Bacteria 4488
732 nmdc:mga0qj67_132584_c1 3300050509 Bacteria 2018
733 nmdc:mga0qj67_157229_c1 3300050509 Bacteria 1845
734 nmdc:mga0qj67_2103_c1 3300050509 Bacteria 14183
735 nmdc:mga0qj67_99301_c1 3300050509 Bacteria 2345
736 nmdc:mga06r32_74289_c1 3300050510 Bacteria 3296
737 nmdc:mga08y16_278027_c1 3300050511 Bacteria 1727
738 nmdc:mga08y16_384401_c1 3300050511 Bacteria 1438
739 nmdc:mga08y16_529365_c1 3300050511 Bacteria 1195
740 nmdc:mga0n895_149393_c1 3300050512 Bacteria 2366
741 nmdc:mga0n895_226025_c1 3300050512 Bacteria 1900
742 nmdc:mga0n895_295773_c1 3300050512 Bacteria 1641
743 nmdc:mga0rr50_17468_c1 3300050513 Bacteria 4792
744 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
745 nmdc:mga0a205_72477_c1 3300050515 Bacteria 3328
746 Ga0495601_0087873 3300053077 Bacteria 1998
747 Ga0495612_0000174 3300053078 Bacteria 27107
748 Ga0495612_0014780 3300053078 Bacteria 3132
749 Ga0495655_0013726 3300053083 Bacteria 1682
750 Ga0495595_0006151 3300053084 Bacteria 4880
751 Ga0495595_0040868 3300053084 Bacteria 2120
752 Ga0495619_0001077 3300053085 Bacteria 17905
753 Ga0495619_0013003 3300053085 Bacteria 5243
754 Ga0495619_0025301 3300053085 Bacteria 3811
755 Ga0495619_0033668 3300053085 Bacteria 3328
756 Ga0500597_080414 3300053120 Bacteria 1414
757 Ga0500559_0011662 3300053136 Bacteria 3750
758 Ga0500616_0000139 3300053153 Bacteria 123841
759 Ga0500639_065658 3300053163 Bacteria 1861
760 Ga0501084_0035441 3300054114 Bacteria 4171
761 Ga0501084_0040029 3300054114 Bacteria 3920
762 Ga0501084_0048951 3300054114 Bacteria 3538
763 Ga0501084_0112004 3300054114 Bacteria 2293
764 Ga0501082_0004740 3300060353 Bacteria 11863
765 Ga0501082_0007926 3300060353 Bacteria 9175
766 Ga0501082_0008215 3300060353 Bacteria 9004
767 Ga0501082_0031797 3300060353 Bacteria 4551
768 Ga0501082_0058326 3300060353 Bacteria 3326
769 Ga0530510_0001990 3300061734 Bacteria 14008
770 Ga0530510_0006461 3300061734 Bacteria 8163
771 Ga0530510_0013414 3300061734 Bacteria 5762
772 Ga0530510_0022809 3300061734 Bacteria 4460
773 Ga0530510_0027933 3300061734 Bacteria 4044
774 Ga0530510_0055856 3300061734 Bacteria 2852
775 Ga0530510_0069943 3300061734 Bacteria 2547
776 Ga0530510_0164619 3300061734 Bacteria 1641

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0041454 Ga0501033_0041454_29_925 278
2 3300005466 Ga0070685_10066453 Ga0070685_100664533 286
3 3300049578 Ga0501042_0175799 Ga0501042_0175799_599_1528 309
4 3300005355 Ga0070671_100258462 Ga0070671_1002584622 310
5 3300005718 Ga0068866_10026304 Ga0068866_100263043 311
6 3300005578 Ga0068854_100131751 Ga0068854_1001317512 313
7 3300049587 Ga0501071_0370505 Ga0501071_0370505_134_1075 313
8 3300025981 Ga0207640_10220836 Ga0207640_102208362 314
9 3300048911 Ga0496108_0430428 Ga0496108_0430428_25_1035 314
10 3300049824 Ga0501045_0106955 Ga0501045_0106955_310_1371 317
11 3300006880 Ga0075429_100183266 Ga0075429_1001832661 320
12 3300049570 Ga0501033_0218645 Ga0501033_0218645_340_1344 320
13 3300050509 nmdc:mga0qj67_99301_c1 nmdc:mga0qj67_99301_c1_318_1379 320
14 3300025929 Ga0207664_10161692 Ga0207664_101616922 322
15 3300049571 Ga0501034_0264000 Ga0501034_0264000_31_1059 322
16 3300048911 Ga0496108_0439344 Ga0496108_0439344_23_1015 323
17 3300048915 Ga0496112_0085671 Ga0496112_0085671_185_1228 325
18 3300048916 Ga0496113_0132943 Ga0496113_0132943_216_1259 325
19 3300049589 Ga0501073_0173702 Ga0501073_0173702_176_1246 325
20 3300050494 nmdc:mga06z11_99650_c1 nmdc:mga06z11_99650_c1_17_1021 325
21 3300025916 Ga0207663_10060610 Ga0207663_100606102 326
22 3300049576 Ga0501040_0365530 Ga0501040_0365530_13_1020 326
23 3300049742 Ga0501080_0171255 Ga0501080_0171255_19_1041 326
24 3300005295 Ga0065707_10139160 Ga0065707_101391603 327
25 3300046794 Ga0495589_0143780 Ga0495589_0143780_78_1112 327
26 3300049568 Ga0501031_0030985 Ga0501031_0030985_1008_2069 327
27 3300049570 Ga0501033_0001956 Ga0501033_0001956_503_1564 327
28 3300049572 Ga0501036_0238203 Ga0501036_0238203_176_1237 327
29 3300049573 Ga0501037_0000505 Ga0501037_0000505_21535_22596 327
30 3300049575 Ga0501039_0018886 Ga0501039_0018886_3074_4135 327
31 3300049575 Ga0501039_0035125 Ga0501039_0035125_1976_3037 327
32 3300049578 Ga0501042_0056561 Ga0501042_0056561_612_1673 327
33 3300049580 Ga0501046_0030619 Ga0501046_0030619_3236_4297 327
34 3300049584 Ga0501068_0227180 Ga0501068_0227180_44_1105 327
35 3300006048 Ga0075363_100057433 Ga0075363_1000574332 328
36 3300006178 Ga0075367_10098687 Ga0075367_100986872 328
37 3300025912 Ga0207707_10141873 Ga0207707_101418732 328
38 3300025917 Ga0207660_10102686 Ga0207660_101026862 328
39 3300049575 Ga0501039_0246646 Ga0501039_0246646_13_999 328
40 3300050490 nmdc:mga03n38_80889_c1 nmdc:mga03n38_80889_c1_11_1021 328
41 3300050507 nmdc:mga05p37_420053_c1 nmdc:mga05p37_420053_c1_10_996 328
42 3300050511 nmdc:mga08y16_384401_c1 nmdc:mga08y16_384401_c1_347_1408 329
43 3300039447 Ga0436361_0812703 Ga0436361_0812703_2345_3406 331
44 3300034818 Ga0373950_0014965 Ga0373950_0014965_98_1156 332
45 3300049578 Ga0501042_0241409 Ga0501042_0241409_14_1039 332
46 3300005331 Ga0070670_100210252 Ga0070670_1002102521 333
47 3300005435 Ga0070714_100178911 Ga0070714_1001789112 333
48 3300009148 Ga0105243_10049735 Ga0105243_100497352 333
49 3300046531 Ga0495665_0027299 Ga0495665_0027299_2022_3050 333
50 3300047673 Ga0495593_0024206 Ga0495593_0024206_2325_3353 333
51 3300049568 Ga0501031_0066112 Ga0501031_0066112_359_1420 333
52 3300049571 Ga0501034_0102117 Ga0501034_0102117_987_2048 333
53 3300049581 Ga0501047_0029059 Ga0501047_0029059_1798_2859 333
54 3300049822 Ga0501035_0059715 Ga0501035_0059715_325_1386 333
55 3300049823 Ga0501044_0093651 Ga0501044_0093651_1089_2150 333
56 3300053078 Ga0495612_0014780 Ga0495612_0014780_2075_3103 333
57 3300053153 Ga0500616_0000139 Ga0500616_0000139_15773_16834 333
58 3300021361 Ga0213872_10063049 Ga0213872_100630492 334
59 3300049569 Ga0501032_0060859 Ga0501032_0060859_946_1992 334
60 3300049571 Ga0501034_0060416 Ga0501034_0060416_879_1925 334
61 3300049572 Ga0501036_0033890 Ga0501036_0033890_1135_2181 334
62 3300049575 Ga0501039_0055204 Ga0501039_0055204_541_1587 334
63 3300049578 Ga0501042_0017882 Ga0501042_0017882_1557_2603 334
64 3300049581 Ga0501047_0076477 Ga0501047_0076477_1635_2681 334
65 3300049581 Ga0501047_0126178 Ga0501047_0126178_538_1584 334
66 3300049582 Ga0501048_0026181 Ga0501048_0026181_2294_3340 334
67 3300049584 Ga0501068_0054184 Ga0501068_0054184_116_1162 334
68 3300049823 Ga0501044_0147725 Ga0501044_0147725_413_1459 334
69 iso_pu_bacteria 2917554339 2917557128 334
70 3300005344 Ga0070661_100001914 Ga0070661_10000191410 335
71 3300005367 Ga0070667_100075587 Ga0070667_1000755874 335
72 3300025986 Ga0207658_10038002 Ga0207658_100380024 335
73 3300032004 Ga0307414_10089205 Ga0307414_100892052 335
74 3300048920 Ga0496117_0001320 Ga0496117_0001320_9821_10849 335
75 3300049744 Ga0501083_0125939 Ga0501083_0125939_242_1288 335
76 3300005455 Ga0070663_100037125 Ga0070663_1000371252 336
77 3300005456 Ga0070678_100043104 Ga0070678_1000431043 336
78 3300005548 Ga0070665_100150045 Ga0070665_1001500452 336
79 3300005617 Ga0068859_100410189 Ga0068859_1004101892 336
80 3300005842 Ga0068858_100091252 Ga0068858_1000912522 336
81 3300005843 Ga0068860_100150002 Ga0068860_1001500022 336
82 3300005937 Ga0081455_10003665 Ga0081455_1000366512 336
83 3300006852 Ga0075433_10216752 Ga0075433_102167522 336
84 3300006881 Ga0068865_100248784 Ga0068865_1002487842 336
85 3300006931 Ga0097620_100410197 Ga0097620_1004101972 336
86 3300025899 Ga0207642_10020933 Ga0207642_100209332 336
87 3300025911 Ga0207654_10201013 Ga0207654_102010131 336
88 3300025926 Ga0207659_10097275 Ga0207659_100972752 336
89 3300025938 Ga0207704_10107706 Ga0207704_101077062 336
90 3300025942 Ga0207689_10097582 Ga0207689_100975821 336
91 3300025960 Ga0207651_10255496 Ga0207651_102554962 336
92 3300025972 Ga0207668_10073880 Ga0207668_100738802 336
93 3300025981 Ga0207640_10221049 Ga0207640_102210492 336
94 3300026067 Ga0207678_10109186 Ga0207678_101091863 336
95 3300026075 Ga0207708_10068483 Ga0207708_100684832 336
96 3300026078 Ga0207702_10078916 Ga0207702_100789162 336
97 3300026089 Ga0207648_10286929 Ga0207648_102869291 336
98 3300026121 Ga0207683_10169309 Ga0207683_101693092 336
99 3300028379 Ga0268266_10127592 Ga0268266_101275922 336
100 3300028381 Ga0268264_10177182 Ga0268264_101771822 336
101 3300048905 Ga0496102_0472128 Ga0496102_0472128_19_1029 336
102 3300049592 Ga0501076_0172551 Ga0501076_0172551_27_1037 336
103 3300049823 Ga0501044_0247095 Ga0501044_0247095_698_1708 336
104 3300053085 Ga0495619_0033668 Ga0495619_0033668_2120_3130 336
105 3300061734 Ga0530510_0164619 Ga0530510_0164619_20_1030 336
106 3300005341 Ga0070691_10019890 Ga0070691_100198902 338
107 3300005347 Ga0070668_100045066 Ga0070668_1000450664 338
108 3300005356 Ga0070674_100004678 Ga0070674_1000046787 338
109 3300005459 Ga0068867_100062386 Ga0068867_1000623862 338
110 3300005617 Ga0068859_100120910 Ga0068859_1001209103 338
111 3300005719 Ga0068861_100009658 Ga0068861_1000096584 338
112 3300005840 Ga0068870_10126204 Ga0068870_101262042 338
113 3300005843 Ga0068860_100097405 Ga0068860_1000974052 338
114 3300005844 Ga0068862_100031093 Ga0068862_1000310932 338
115 3300006881 Ga0068865_100059567 Ga0068865_1000595672 338
116 3300006931 Ga0097620_100120911 Ga0097620_1001209113 338
117 3300009148 Ga0105243_10133840 Ga0105243_101338402 338
118 3300009553 Ga0105249_10015186 Ga0105249_100151864 338
119 3300013308 Ga0157375_10075444 Ga0157375_100754444 338
120 3300014969 Ga0157376_10039678 Ga0157376_100396785 338
121 3300017792 Ga0163161_10019421 Ga0163161_100194214 338
122 3300025935 Ga0207709_10099567 Ga0207709_100995672 338
123 3300025937 Ga0207669_10040852 Ga0207669_100408522 338
124 3300025938 Ga0207704_10055882 Ga0207704_100558822 338
125 3300025961 Ga0207712_10020564 Ga0207712_100205643 338
126 3300025972 Ga0207668_10043366 Ga0207668_100433662 338
127 3300026089 Ga0207648_10234542 Ga0207648_102345422 338
128 3300026118 Ga0207675_100017442 Ga0207675_1000174424 338
129 3300028380 Ga0268265_10012963 Ga0268265_100129634 338
130 3300048903 Ga0496100_0115464 Ga0496100_0115464_194_1261 338
131 3300048904 Ga0496101_0029223 Ga0496101_0029223_846_1913 338
132 3300048906 Ga0496103_0169762 Ga0496103_0169762_291_1358 338
133 3300048907 Ga0496104_0050836 Ga0496104_0050836_1824_2891 338
134 3300048910 Ga0496107_0014875 Ga0496107_0014875_2413_3480 338
135 3300048917 Ga0496114_0025447 Ga0496114_0025447_2300_3367 338
136 iso_pu_bacteria 2837651117 2837652705 338
137 3300005336 Ga0070680_100138733 Ga0070680_1001387332 339
138 3300049744 Ga0501083_0161522 Ga0501083_0161522_221_1282 339
139 3300009093 Ga0105240_10212766 Ga0105240_102127661 340
140 3300039437 Ga0436365_0636722 Ga0436365_0636722_410_1468 340
141 3300039450 Ga0436363_0751359 Ga0436363_0751359_462_1517 340
142 iso_pu_bacteria 2523231067 2523470249 340
143 iso_pu_bacteria 2528768022 2528855784 340
144 iso_pu_bacteria 2738543031 2739350217 340
145 iso_pu_bacteria 2791355196 2793064814 340
146 iso_pu_bacteria 2824661429 2824666226 340
147 iso_pu_bacteria 2824679649 2824686421 340
148 iso_pu_bacteria 2874620515 2874627073 340
149 iso_pu_bacteria 2879099564 2879102182 340
150 iso_pu_bacteria 2879142872 2879149884 340
151 iso_pu_bacteria 2904666416 2904669774 340
152 iso_pu_bacteria 2906643746 2906645838 340
153 iso_pu_bacteria 2919450847 2919454674 340
154 iso_pu_bacteria 2922368715 2922373362 340
155 iso_pu_bacteria 2922393267 2922395545 340
156 iso_pu_bacteria 2932784394 2932791946 340
157 iso_pu_bacteria 2932809354 2932815686 340
158 iso_pu_bacteria 2932818245 2932819234 340
159 iso_pu_bacteria 2932828146 2932835931 340
160 iso_pu_bacteria 2935616580 2935624348 340
161 iso_pu_bacteria 2935638405 2935647247 340
162 iso_pu_bacteria 2935665750 2935674447 340
163 iso_pu_bacteria 2935675223 2935678268 340
164 iso_pu_bacteria 2935684952 2935688310 340
165 iso_pu_bacteria 2935694250 2935698973 340
166 iso_pu_bacteria 2935703347 2935708590 340
167 iso_pu_bacteria 2935713505 2935715329 340
168 iso_pu_bacteria 2935722832 2935726107 340
169 iso_pu_bacteria 2935732158 2935734148 340
170 iso_pu_bacteria 2935741537 2935743527 340
171 iso_pu_bacteria 2935750917 2935754436 340
172 iso_pu_bacteria 2935760218 2935768207 340
173 iso_pu_bacteria 2935801545 2935809425 340
174 iso_pu_bacteria 2935810662 2935818904 340
175 iso_pu_bacteria 2935827899 2935836722 340
176 iso_pu_bacteria 2935837841 2935846554 340
177 iso_pu_bacteria 2935855204 2935862618 340
178 iso_pu_bacteria 2935864058 2935871783 340
179 iso_pu_bacteria 2935873716 2935881850 340
180 iso_pu_bacteria 2935992306 2935998881 340
181 iso_pu_bacteria 2936002035 2936007435 340
182 iso_pu_bacteria 2936037263 2936045618 340
183 iso_pu_bacteria 2940556831 2940560188 340
184 iso_pu_bacteria 2941538514 2941546662 340
185 iso_pu_bacteria 8001845381 8001849631 340
186 iso_pu_bacteria 8017057580 8017062047 340
187 iso_pu_bacteria 8019576017 8019581587 340
188 iso_pu_bacteria 8019586578 8019589221 340
189 iso_pu_bacteria 8019597564 8019602012 340
190 iso_pu_bacteria 8019608314 8019616540 340
191 iso_pu_bacteria 8056967851 8056972652 340
192 iso_pu_bacteria 2939669807 2939670719 341
193 3300006173 Ga0070716_100021364 Ga0070716_1000213642 342
194 3300007788 Ga0099795_10004198 Ga0099795_100041982 342
195 3300010159 Ga0099796_10000963 Ga0099796_100009633 342
196 3300021384 Ga0213876_10042552 Ga0213876_100425523 342
197 3300025929 Ga0207664_10336498 Ga0207664_103364981 342
198 3300025939 Ga0207665_10025499 Ga0207665_100254992 342
199 3300036647 Ga0316582_0085542 Ga0316582_0085542_799_1842 342
200 3300037312 Ga0395899_0000130 Ga0395899_0000130_76066_77136 342
201 3300037418 Ga0395900_0000020 Ga0395900_0000020_276365_277435 342
202 3300037466 Ga0395898_0000104 Ga0395898_0000104_76066_77136 342
203 3300037471 Ga0395905_0000019 Ga0395905_0000019_76066_77136 342
204 3300038443 Ga0395901_0000016 Ga0395901_0000016_276873_277943 342
205 3300049585 Ga0501069_0070010 Ga0501069_0070010_313_1383 342
206 3300049589 Ga0501073_0034730 Ga0501073_0034730_1837_2907 342
207 3300053136 Ga0500559_0011662 Ga0500559_0011662_2220_3281 342
208 3300053163 Ga0500639_065658 Ga0500639_065658_359_1411 342
209 3300005290 Ga0065712_10007290 Ga0065712_100072901 343
210 3300005364 Ga0070673_100023414 Ga0070673_1000234145 343
211 3300005441 Ga0070700_100171944 Ga0070700_1001719442 343
212 3300005543 Ga0070672_100166489 Ga0070672_1001664892 343
213 3300009098 Ga0105245_10336932 Ga0105245_103369322 343
214 3300009101 Ga0105247_10004686 Ga0105247_100046862 343
215 3300014326 Ga0157380_10309791 Ga0157380_103097912 343
216 3300025893 Ga0207682_10002414 Ga0207682_100024144 343
217 3300025908 Ga0207643_10015748 Ga0207643_100157482 343
218 3300025986 Ga0207658_10052748 Ga0207658_100527482 343
219 3300031241 Ga0265325_10023501 Ga0265325_100235012 343
220 3300031595 Ga0265313_10032255 Ga0265313_100322552 343
221 3300046539 Ga0495621_0009482 Ga0495621_0009482_1600_2652 343
222 3300049569 Ga0501032_0037553 Ga0501032_0037553_494_1552 343
223 3300049571 Ga0501034_0012317 Ga0501034_0012317_5543_6601 343
224 3300049571 Ga0501034_0434288 Ga0501034_0434288_79_1137 343
225 3300049572 Ga0501036_0041532 Ga0501036_0041532_2220_3278 343
226 3300049579 Ga0501043_0053301 Ga0501043_0053301_570_1628 343
227 3300049584 Ga0501068_0034779 Ga0501068_0034779_863_1921 343
228 3300049586 Ga0501070_0007975 Ga0501070_0007975_6874_7932 343
229 3300049586 Ga0501070_0032521 Ga0501070_0032521_909_1967 343
230 3300049586 Ga0501070_0054634 Ga0501070_0054634_385_1443 343
231 3300049589 Ga0501073_0047412 Ga0501073_0047412_1226_2272 343
232 3300049590 Ga0501074_0014482 Ga0501074_0014482_3338_4396 343
233 3300049590 Ga0501074_0027814 Ga0501074_0027814_2545_3591 343
234 3300049741 Ga0501079_0029595 Ga0501079_0029595_1428_2486 343
235 3300049742 Ga0501080_0038730 Ga0501080_0038730_2029_3075 343
236 3300049742 Ga0501080_0040549 Ga0501080_0040549_1752_2810 343
237 3300049742 Ga0501080_0111323 Ga0501080_0111323_567_1613 343
238 3300049744 Ga0501083_0019073 Ga0501083_0019073_2205_3263 343
239 3300049744 Ga0501083_0053537 Ga0501083_0053537_363_1421 343
240 3300049822 Ga0501035_0081968 Ga0501035_0081968_96_1154 343
241 3300049822 Ga0501035_0104063 Ga0501035_0104063_282_1340 343
242 3300049823 Ga0501044_0203679 Ga0501044_0203679_121_1179 343
243 3300003659 JGI25404J52841_10000633 JGI25404J52841_100006335 344
244 3300005340 Ga0070689_100222194 Ga0070689_1002221942 344
245 3300005354 Ga0070675_100240228 Ga0070675_1002402282 344
246 3300005355 Ga0070671_100060270 Ga0070671_1000602703 344
247 3300005356 Ga0070674_100027684 Ga0070674_1000276842 344
248 3300005364 Ga0070673_100014278 Ga0070673_1000142786 344
249 3300005365 Ga0070688_100031342 Ga0070688_1000313423 344
250 3300005434 Ga0070709_10076401 Ga0070709_100764011 344
251 3300005435 Ga0070714_100064971 Ga0070714_1000649712 344
252 3300005435 Ga0070714_100069443 Ga0070714_1000694432 344
253 3300005436 Ga0070713_100022107 Ga0070713_1000221076 344
254 3300005436 Ga0070713_100070374 Ga0070713_1000703744 344
255 3300005437 Ga0070710_10033533 Ga0070710_100335332 344
256 3300005437 Ga0070710_10038184 Ga0070710_100381842 344
257 3300005439 Ga0070711_100042811 Ga0070711_1000428112 344
258 3300005439 Ga0070711_100107306 Ga0070711_1001073062 344
259 3300005439 Ga0070711_100179612 Ga0070711_1001796122 344
260 3300005445 Ga0070708_100065932 Ga0070708_1000659323 344
261 3300005455 Ga0070663_100039942 Ga0070663_1000399422 344
262 3300005456 Ga0070678_100029338 Ga0070678_1000293385 344
263 3300005459 Ga0068867_100168124 Ga0068867_1001681241 344
264 3300005543 Ga0070672_100167997 Ga0070672_1001679972 344
265 3300005548 Ga0070665_100060372 Ga0070665_1000603723 344
266 3300005615 Ga0070702_100153004 Ga0070702_1001530042 344
267 3300005617 Ga0068859_100271064 Ga0068859_1002710642 344
268 3300005842 Ga0068858_100089368 Ga0068858_1000893683 344
269 3300005842 Ga0068858_100117126 Ga0068858_1001171261 344
270 3300005983 Ga0081540_1002699 Ga0081540_10026995 344
271 3300005983 Ga0081540_1039161 Ga0081540_10391613 344
272 3300006028 Ga0070717_10019351 Ga0070717_100193517 344
273 3300006058 Ga0075432_10013785 Ga0075432_100137853 344
274 3300006163 Ga0070715_10008256 Ga0070715_100082564 344
275 3300006175 Ga0070712_100143431 Ga0070712_1001434312 344
276 3300006175 Ga0070712_100172654 Ga0070712_1001726541 344
277 3300006178 Ga0075367_10046668 Ga0075367_100466683 344
278 3300006846 Ga0075430_100131722 Ga0075430_1001317222 344
279 3300006847 Ga0075431_100212876 Ga0075431_1002128762 344
280 3300006871 Ga0075434_100134908 Ga0075434_1001349082 344
281 3300006914 Ga0075436_100180934 Ga0075436_1001809342 344
282 3300006931 Ga0097620_100271067 Ga0097620_1002710672 344
283 3300007076 Ga0075435_100138910 Ga0075435_1001389102 344
284 3300007076 Ga0075435_100219123 Ga0075435_1002191232 344
285 3300007265 Ga0099794_10043202 Ga0099794_100432022 344
286 3300009094 Ga0111539_10076235 Ga0111539_100762352 344
287 3300009098 Ga0105245_10343645 Ga0105245_103436452 344
288 3300009098 Ga0105245_10359431 Ga0105245_103594312 344
289 3300009147 Ga0114129_10425001 Ga0114129_104250012 344
290 3300013308 Ga0157375_10123440 Ga0157375_101234402 344
291 3300014325 Ga0163163_10074340 Ga0163163_100743402 344
292 3300025297 Ga0209758_1001046 Ga0209758_100104620 344
293 3300025885 Ga0207653_10051798 Ga0207653_100517981 344
294 3300025898 Ga0207692_10038239 Ga0207692_100382392 344
295 3300025906 Ga0207699_10022098 Ga0207699_100220983 344
296 3300025906 Ga0207699_10056526 Ga0207699_100565261 344
297 3300025907 Ga0207645_10180403 Ga0207645_101804032 344
298 3300025910 Ga0207684_10061490 Ga0207684_100614904 344
299 3300025912 Ga0207707_10102568 Ga0207707_101025682 344
300 3300025915 Ga0207693_10023521 Ga0207693_100235213 344
301 3300025915 Ga0207693_10038606 Ga0207693_100386064 344
302 3300025915 Ga0207693_10060824 Ga0207693_100608244 344
303 3300025916 Ga0207663_10039870 Ga0207663_100398704 344
304 3300025916 Ga0207663_10078460 Ga0207663_100784602 344
305 3300025920 Ga0207649_10192485 Ga0207649_101924852 344
306 3300025922 Ga0207646_10077702 Ga0207646_100777022 344
307 3300025924 Ga0207694_10121732 Ga0207694_101217321 344
308 3300025926 Ga0207659_10210706 Ga0207659_102107061 344
309 3300025927 Ga0207687_10169984 Ga0207687_101699842 344
310 3300025928 Ga0207700_10036206 Ga0207700_100362062 344
311 3300025928 Ga0207700_10102585 Ga0207700_101025851 344
312 3300025929 Ga0207664_10123366 Ga0207664_101233662 344
313 3300025929 Ga0207664_10191882 Ga0207664_101918822 344
314 3300025933 Ga0207706_10087810 Ga0207706_100878102 344
315 3300025939 Ga0207665_10010416 Ga0207665_100104164 344
316 3300025940 Ga0207691_10142387 Ga0207691_101423872 344
317 3300025945 Ga0207679_10094624 Ga0207679_100946242 344
318 3300025960 Ga0207651_10029594 Ga0207651_100295943 344
319 3300025960 Ga0207651_10379731 Ga0207651_103797312 344
320 3300026035 Ga0207703_10363418 Ga0207703_103634181 344
321 3300026075 Ga0207708_10095298 Ga0207708_100952983 344
322 3300026075 Ga0207708_10160609 Ga0207708_101606092 344
323 3300026089 Ga0207648_10119872 Ga0207648_101198722 344
324 3300026121 Ga0207683_10011735 Ga0207683_100117354 344
325 3300026142 Ga0207698_10143899 Ga0207698_101438991 344
326 3300027907 Ga0207428_10019580 Ga0207428_100195804 344
327 3300028379 Ga0268266_10071605 Ga0268266_100716053 344
328 3300031241 Ga0265325_10046577 Ga0265325_100465772 344
329 3300031242 Ga0265329_10031438 Ga0265329_100314382 344
330 3300032133 Ga0316583_10000231 Ga0316583_100002312 344
331 3300035116 Ga0373945_0010619 Ga0373945_0010619_1111_2172 344
332 3300035118 Ga0373954_0031235 Ga0373954_0031235_778_1839 344
333 3300035170 Ga0373943_0000422 Ga0373943_0000422_9134_10195 344
334 3300035170 Ga0373943_0032540 Ga0373943_0032540_569_1630 344
335 3300035171 Ga0373946_0000369 Ga0373946_0000369_6554_7615 344
336 3300035171 Ga0373946_0011600 Ga0373946_0011600_1204_2265 344
337 3300035171 Ga0373946_0039364 Ga0373946_0039364_825_1886 344
338 3300035172 Ga0373955_0023754 Ga0373955_0023754_1203_2264 344
339 3300035241 Ga0373961_0017807 Ga0373961_0017807_298_1353 344
340 3300035695 Ga0373927_0000414 Ga0373927_0000414_8088_9149 344
341 3300035695 Ga0373927_0027487 Ga0373927_0027487_1734_2795 344
342 3300035724 Ga0373933_0051605 Ga0373933_0051605_700_1761 344
343 3300035725 Ga0373947_0000275 Ga0373947_0000275_5614_6675 344
344 3300035725 Ga0373947_0151578 Ga0373947_0151578_309_1370 344
345 3300036401 Ga0373937_0049609 Ga0373937_0049609_2771_3832 344
346 3300037068 Ga0373925_0002546 Ga0373925_0002546_154_1215 344
347 3300037068 Ga0373925_0109999 Ga0373925_0109999_847_1908 344
348 3300037471 Ga0395905_0020427 Ga0395905_0020427_3000_4061 344
349 3300039437 Ga0436365_0034062 Ga0436365_0034062_445_1506 344
350 3300044658 Ga0466972_0039602 Ga0466972_0039602_1017_2078 344
351 3300044706 Ga0466964_0026887 Ga0466964_0026887_477_1538 344
352 3300044901 Ga0466960_0024288 Ga0466960_0024288_1150_2211 344
353 3300045976 Ga0466967_0127455 Ga0466967_0127455_132_1193 344
354 3300046454 Ga0495592_0004650 Ga0495592_0004650_7649_8710 344
355 3300046455 Ga0495603_0051536 Ga0495603_0051536_1204_2265 344
356 3300046459 Ga0495629_0015054 Ga0495629_0015054_4061_5122 344
357 3300046461 Ga0495641_0023622 Ga0495641_0023622_1802_2863 344
358 3300046462 Ga0495651_0033029 Ga0495651_0033029_2279_3340 344
359 3300046463 Ga0495653_0016883 Ga0495653_0016883_232_1293 344
360 3300046472 Ga0495580_0008354 Ga0495580_0008354_1131_2192 344
361 3300046472 Ga0495580_0090256 Ga0495580_0090256_245_1306 344
362 3300046473 Ga0495582_0025753 Ga0495582_0025753_1146_2207 344
363 3300046475 Ga0495639_0077256 Ga0495639_0077256_142_1203 344
364 3300046476 Ga0495662_0000261 Ga0495662_0000261_20519_21580 344
365 3300046477 Ga0495664_0000230 Ga0495664_0000230_2456_3517 344
366 3300046477 Ga0495664_0003269 Ga0495664_0003269_7051_8112 344
367 3300046491 Ga0495584_0035734 Ga0495584_0035734_489_1550 344
368 3300046492 Ga0495585_0004199 Ga0495585_0004199_5221_6282 344
369 3300046501 Ga0495607_0008348 Ga0495607_0008348_3026_4087 344
370 3300046514 Ga0495618_0006033 Ga0495618_0006033_5064_6125 344
371 3300046514 Ga0495618_0014795 Ga0495618_0014795_776_1837 344
372 3300046516 Ga0495628_0164958 Ga0495628_0164958_89_1150 344
373 3300046517 Ga0495630_0038359 Ga0495630_0038359_1686_2747 344
374 3300046523 Ga0495644_0001707 Ga0495644_0001707_2317_3378 344
375 3300046526 Ga0495666_0005800 Ga0495666_0005800_1840_2901 344
376 3300046533 Ga0495640_0009468 Ga0495640_0009468_4771_5832 344
377 3300046533 Ga0495640_0154240 Ga0495640_0154240_105_1166 344
378 3300046535 Ga0495586_0092976 Ga0495586_0092976_232_1293 344
379 3300046536 Ga0495587_0036279 Ga0495587_0036279_1348_2409 344
380 3300046543 Ga0495645_0014321 Ga0495645_0014321_1513_2574 344
381 3300046558 Ga0495633_0003249 Ga0495633_0003249_5857_6918 344
382 3300046559 Ga0495667_0004508 Ga0495667_0004508_5017_6078 344
383 3300046615 Ga0495656_0000538 Ga0495656_0000538_4826_5887 344
384 3300046642 Ga0495634_0124748 Ga0495634_0124748_405_1466 344
385 3300046665 Ga0495661_0039583 Ga0495661_0039583_1472_2533 344
386 3300046674 Ga0495588_0002190 Ga0495588_0002190_1707_2768 344
387 3300046678 Ga0495599_0095121 Ga0495599_0095121_123_1184 344
388 3300046680 Ga0495646_0043669 Ga0495646_0043669_226_1287 344
389 3300046681 Ga0495647_0002287 Ga0495647_0002287_2887_3948 344
390 3300046683 Ga0495658_0085068 Ga0495658_0085068_18_1079 344
391 3300046689 Ga0495613_0033916 Ga0495613_0033916_458_1519 344
392 3300046690 Ga0495624_0008042 Ga0495624_0008042_4387_5448 344
393 3300046690 Ga0495624_0013504 Ga0495624_0013504_89_1150 344
394 3300046691 Ga0495670_0002388 Ga0495670_0002388_1919_2980 344
395 3300046694 Ga0495649_0074482 Ga0495649_0074482_296_1357 344
396 3300046809 Ga0495600_0028724 Ga0495600_0028724_702_1763 344
397 3300047317 Ga0495604_0012078 Ga0495604_0012078_5553_6614 344
398 3300047318 Ga0495636_0024479 Ga0495636_0024479_1055_2116 344
399 3300047319 Ga0495674_0000209 Ga0495674_0000209_20109_21170 344
400 3300047319 Ga0495674_0209410 Ga0495674_0209410_374_1435 344
401 3300047469 Ga0495673_0043900 Ga0495673_0043900_258_1319 344
402 3300047471 Ga0495684_0002373 Ga0495684_0002373_8102_9163 344
403 3300047471 Ga0495684_0003076 Ga0495684_0003076_8507_9568 344
404 3300047471 Ga0495684_0009099 Ga0495684_0009099_1203_2264 344
405 3300048904 Ga0496101_0084065 Ga0496101_0084065_49_1101 344
406 3300048909 Ga0496106_0054544 Ga0496106_0054544_66_1118 344
407 3300048910 Ga0496107_0196165 Ga0496107_0196165_295_1356 344
408 3300048911 Ga0496108_0215572 Ga0496108_0215572_585_1646 344
409 3300048912 Ga0496109_0133005 Ga0496109_0133005_667_1728 344
410 3300048913 Ga0496110_0017894 Ga0496110_0017894_3976_5037 344
411 3300048913 Ga0496110_0233701 Ga0496110_0233701_573_1625 344
412 3300048917 Ga0496114_0014599 Ga0496114_0014599_3026_4087 344
413 3300048917 Ga0496114_0018780 Ga0496114_0018780_4158_5219 344
414 3300048921 Ga0496118_0167398 Ga0496118_0167398_45_1106 344
415 3300049568 Ga0501031_0037770 Ga0501031_0037770_1230_2291 344
416 3300049569 Ga0501032_0050135 Ga0501032_0050135_867_1928 344
417 3300049570 Ga0501033_0103729 Ga0501033_0103729_810_1871 344
418 3300049572 Ga0501036_0023367 Ga0501036_0023367_1242_2303 344
419 3300049573 Ga0501037_0071665 Ga0501037_0071665_1082_2143 344
420 3300049574 Ga0501038_0006501 Ga0501038_0006501_6446_7507 344
421 3300049575 Ga0501039_0050488 Ga0501039_0050488_1354_2415 344
422 3300049579 Ga0501043_0029259 Ga0501043_0029259_711_1772 344
423 3300049580 Ga0501046_0094208 Ga0501046_0094208_378_1439 344
424 3300049583 Ga0501067_0085477 Ga0501067_0085477_279_1340 344
425 3300049584 Ga0501068_0044180 Ga0501068_0044180_815_1876 344
426 3300049585 Ga0501069_0063574 Ga0501069_0063574_159_1220 344
427 3300049587 Ga0501071_0125279 Ga0501071_0125279_18_1079 344
428 3300049590 Ga0501074_0005361 Ga0501074_0005361_780_1841 344
429 3300049592 Ga0501076_0128327 Ga0501076_0128327_819_1880 344
430 3300049741 Ga0501079_0066283 Ga0501079_0066283_483_1544 344
431 3300049742 Ga0501080_0162575 Ga0501080_0162575_798_1859 344
432 3300049822 Ga0501035_0005152 Ga0501035_0005152_10390_11451 344
433 3300049823 Ga0501044_0155713 Ga0501044_0155713_1001_2062 344
434 3300050491 nmdc:mga00v17_147061_c1 nmdc:mga00v17_147061_c1_427_1500 344
435 3300050509 nmdc:mga0qj67_132584_c1 nmdc:mga0qj67_132584_c1_756_1817 344
436 3300050512 nmdc:mga0n895_149393_c1 nmdc:mga0n895_149393_c1_1175_2236 344
437 3300050512 nmdc:mga0n895_226025_c1 nmdc:mga0n895_226025_c1_595_1656 344
438 3300053077 Ga0495601_0087873 Ga0495601_0087873_405_1466 344
439 3300053078 Ga0495612_0000174 Ga0495612_0000174_24162_25223 344
440 3300053084 Ga0495595_0006151 Ga0495595_0006151_2850_3911 344
441 3300053085 Ga0495619_0001077 Ga0495619_0001077_9311_10372 344
442 3300053085 Ga0495619_0013003 Ga0495619_0013003_2979_4040 344
443 3300053085 Ga0495619_0025301 Ga0495619_0025301_2601_3662 344
444 3300053120 Ga0500597_080414 Ga0500597_080414_22_1083 344
445 3300054114 Ga0501084_0040029 Ga0501084_0040029_2114_3175 344
446 3300060353 Ga0501082_0008215 Ga0501082_0008215_7277_8338 344
447 3300005440 Ga0070705_100042894 Ga0070705_1000428943 345
448 3300005536 Ga0070697_100000748 Ga0070697_1000007488 345
449 3300005545 Ga0070695_100000696 Ga0070695_1000006967 345
450 3300006846 Ga0075430_100018717 Ga0075430_1000187176 345
451 3300006847 Ga0075431_100001010 Ga0075431_10000101022 345
452 3300006914 Ga0075436_100000192 Ga0075436_10000019222 345
453 3300031241 Ga0265325_10025494 Ga0265325_100254943 345
454 3300031249 Ga0265339_10046300 Ga0265339_100463002 345
455 3300031344 Ga0265316_10021547 Ga0265316_100215476 345
456 3300031595 Ga0265313_10062141 Ga0265313_100621412 345
457 3300031711 Ga0265314_10028861 Ga0265314_100288613 345
458 3300039447 Ga0436361_0496440 Ga0436361_0496440_1086_2132 345
459 3300039447 Ga0436361_1044927 Ga0436361_1044927_2433_3479 345
460 3300049576 Ga0501040_0054327 Ga0501040_0054327_1525_2586 345
461 3300049743 Ga0501081_0039930 Ga0501081_0039930_187_1248 345
462 3300050509 nmdc:mga0qj67_2103_c1 nmdc:mga0qj67_2103_c1_6373_7428 345
463 3300050512 nmdc:mga0n895_295773_c1 nmdc:mga0n895_295773_c1_438_1496 345
464 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_99745_100800 345
465 3300061734 Ga0530510_0069943 Ga0530510_0069943_172_1233 345
466 3300005539 Ga0068853_100001680 Ga0068853_1000016809 346
467 3300005548 Ga0070665_100045229 Ga0070665_1000452294 346
468 3300005563 Ga0068855_100095631 Ga0068855_1000956314 346
469 3300005616 Ga0068852_100003616 Ga0068852_10000361613 346
470 3300005834 Ga0068851_10026127 Ga0068851_100261274 346
471 3300009093 Ga0105240_10236924 Ga0105240_102369242 346
472 3300009174 Ga0105241_10094455 Ga0105241_100944553 346
473 3300009545 Ga0105237_10000542 Ga0105237_1000054230 346
474 3300009551 Ga0105238_10085480 Ga0105238_100854802 346
475 3300010375 Ga0105239_10001329 Ga0105239_1000132920 346
476 3300010375 Ga0105239_10037215 Ga0105239_100372154 346
477 3300025321 Ga0207656_10032018 Ga0207656_100320182 346
478 3300025911 Ga0207654_10027759 Ga0207654_100277592 346
479 3300025914 Ga0207671_10000649 Ga0207671_1000064923 346
480 3300025920 Ga0207649_10002158 Ga0207649_100021584 346
481 3300025924 Ga0207694_10055605 Ga0207694_100556054 346
482 3300026116 Ga0207674_10254188 Ga0207674_102541882 346
483 3300028379 Ga0268266_10000442 Ga0268266_1000044225 346
484 3300031241 Ga0265325_10018613 Ga0265325_100186135 346
485 3300035089 Ga0373944_0038892 Ga0373944_0038892_306_1346 346
486 3300035170 Ga0373943_0005880 Ga0373943_0005880_3809_4849 346
487 3300035695 Ga0373927_0027723 Ga0373927_0027723_2011_3051 346
488 3300035725 Ga0373947_0005949 Ga0373947_0005949_3816_4856 346
489 3300037068 Ga0373925_0038888 Ga0373925_0038888_663_1703 346
490 3300042001 Ga0439441_001387 Ga0439441_001387_390_1463 346
491 3300046455 Ga0495603_0001214 Ga0495603_0001214_11745_12785 346
492 3300046459 Ga0495629_0002062 Ga0495629_0002062_3675_4715 346
493 3300046461 Ga0495641_0022382 Ga0495641_0022382_214_1254 346
494 3300046472 Ga0495580_0000299 Ga0495580_0000299_3626_4666 346
495 3300046473 Ga0495582_0011046 Ga0495582_0011046_1996_3036 346
496 3300046475 Ga0495639_0005838 Ga0495639_0005838_2390_3430 346
497 3300046499 Ga0495594_0000679 Ga0495594_0000679_12767_13807 346
498 3300046517 Ga0495630_0302082 Ga0495630_0302082_103_1143 346
499 3300046531 Ga0495665_0073872 Ga0495665_0073872_159_1199 346
500 3300046557 Ga0495622_0000920 Ga0495622_0000920_2143_3183 346
501 3300046642 Ga0495634_0006288 Ga0495634_0006288_5379_6419 346
502 3300046674 Ga0495588_0001344 Ga0495588_0001344_1874_2914 346
503 3300046681 Ga0495647_0009258 Ga0495647_0009258_943_1983 346
504 3300046683 Ga0495658_0015537 Ga0495658_0015537_666_1706 346
505 3300046689 Ga0495613_0000818 Ga0495613_0000818_4650_5690 346
506 3300047315 Ga0495581_0002568 Ga0495581_0002568_7784_8824 346
507 3300047321 Ga0495676_0020836 Ga0495676_0020836_2420_3460 346
508 3300047673 Ga0495593_0003392 Ga0495593_0003392_3354_4394 346
509 3300048089 Ga0495614_0015281 Ga0495614_0015281_114_1154 346
510 3300049570 Ga0501033_0119762 Ga0501033_0119762_70_1128 346
511 3300049582 Ga0501048_0064062 Ga0501048_0064062_1122_2198 346
512 3300049588 Ga0501072_0031428 Ga0501072_0031428_1653_2729 346
513 3300049591 Ga0501075_0021030 Ga0501075_0021030_1316_2392 346
514 3300049592 Ga0501076_0086664 Ga0501076_0086664_643_1719 346
515 3300049741 Ga0501079_0096015 Ga0501079_0096015_432_1490 346
516 3300049741 Ga0501079_0331755 Ga0501079_0331755_39_1115 346
517 3300049743 Ga0501081_0051414 Ga0501081_0051414_12_1070 346
518 3300049743 Ga0501081_0074663 Ga0501081_0074663_474_1550 346
519 3300049824 Ga0501045_0030041 Ga0501045_0030041_1298_2356 346
520 3300053084 Ga0495595_0040868 Ga0495595_0040868_390_1430 346
521 3300060353 Ga0501082_0007926 Ga0501082_0007926_1823_2881 346
522 3300061734 Ga0530510_0006461 Ga0530510_0006461_1517_2575 346
523 3300061734 Ga0530510_0013414 Ga0530510_0013414_1246_2322 346
524 3300002067 JGI24735J21928_10046626 JGI24735J21928_100466261 347
525 3300002075 JGI24738J21930_10003727 JGI24738J21930_100037275 347
526 3300002459 JGI24751J29686_10006293 JGI24751J29686_100062932 347
527 3300005329 Ga0070683_100088887 Ga0070683_1000888872 347
528 3300005330 Ga0070690_100000265 Ga0070690_10000026523 347
529 3300005331 Ga0070670_100020525 Ga0070670_1000205253 347
530 3300005333 Ga0070677_10038139 Ga0070677_100381392 347
531 3300005336 Ga0070680_100042355 Ga0070680_1000423552 347
532 3300005338 Ga0068868_100019196 Ga0068868_1000191965 347
533 3300005339 Ga0070660_100147351 Ga0070660_1001473512 347
534 3300005340 Ga0070689_100005036 Ga0070689_1000050367 347
535 3300005341 Ga0070691_10013507 Ga0070691_100135072 347
536 3300005344 Ga0070661_100000197 Ga0070661_10000019750 347
537 3300005345 Ga0070692_10011366 Ga0070692_100113665 347
538 3300005347 Ga0070668_100004142 Ga0070668_1000041427 347
539 3300005353 Ga0070669_100015913 Ga0070669_1000159134 347
540 3300005354 Ga0070675_100005536 Ga0070675_1000055365 347
541 3300005355 Ga0070671_100002517 Ga0070671_1000025174 347
542 3300005356 Ga0070674_100025242 Ga0070674_1000252422 347
543 3300005364 Ga0070673_100000516 Ga0070673_10000051620 347
544 3300005365 Ga0070688_100000119 Ga0070688_1000001195 347
545 3300005365 Ga0070688_100260651 Ga0070688_1002606511 347
546 3300005366 Ga0070659_100003462 Ga0070659_1000034623 347
547 3300005367 Ga0070667_100087149 Ga0070667_1000871492 347
548 3300005434 Ga0070709_10004735 Ga0070709_100047357 347
549 3300005435 Ga0070714_100084045 Ga0070714_1000840453 347
550 3300005435 Ga0070714_100524211 Ga0070714_1005242111 347
551 3300005436 Ga0070713_100018520 Ga0070713_1000185205 347
552 3300005437 Ga0070710_10011895 Ga0070710_100118953 347
553 3300005437 Ga0070710_10047850 Ga0070710_100478503 347
554 3300005438 Ga0070701_10011185 Ga0070701_100111852 347
555 3300005439 Ga0070711_100021551 Ga0070711_1000215514 347
556 3300005440 Ga0070705_100000641 Ga0070705_1000006418 347
557 3300005440 Ga0070705_100047910 Ga0070705_1000479102 347
558 3300005441 Ga0070700_100002572 Ga0070700_1000025726 347
559 3300005444 Ga0070694_100000838 Ga0070694_10000083816 347
560 3300005456 Ga0070678_100034953 Ga0070678_1000349532 347
561 3300005457 Ga0070662_100019961 Ga0070662_1000199612 347
562 3300005457 Ga0070662_100238040 Ga0070662_1002380402 347
563 3300005458 Ga0070681_10027480 Ga0070681_100274805 347
564 3300005530 Ga0070679_100008876 Ga0070679_10000887610 347
565 3300005535 Ga0070684_100013362 Ga0070684_1000133625 347
566 3300005536 Ga0070697_100013035 Ga0070697_1000130353 347
567 3300005536 Ga0070697_100057019 Ga0070697_1000570193 347
568 3300005539 Ga0068853_100001657 Ga0068853_1000016575 347
569 3300005543 Ga0070672_100005169 Ga0070672_1000051696 347
570 3300005544 Ga0070686_100002196 Ga0070686_1000021962 347
571 3300005544 Ga0070686_100157552 Ga0070686_1001575521 347
572 3300005545 Ga0070695_100000560 Ga0070695_1000005605 347
573 3300005548 Ga0070665_100144581 Ga0070665_1001445812 347
574 3300005549 Ga0070704_100001082 Ga0070704_10000108214 347
575 3300005564 Ga0070664_100000182 Ga0070664_1000001824 347
576 3300005577 Ga0068857_100002534 Ga0068857_10000253413 347
577 3300005578 Ga0068854_100000423 Ga0068854_10000042326 347
578 3300005614 Ga0068856_100005230 Ga0068856_10000523013 347
579 3300005615 Ga0070702_100000037 Ga0070702_1000000374 347
580 3300005615 Ga0070702_100072164 Ga0070702_1000721642 347
581 3300005616 Ga0068852_100009229 Ga0068852_1000092295 347
582 3300005617 Ga0068859_100009627 Ga0068859_1000096279 347
583 3300005618 Ga0068864_100002959 Ga0068864_1000029595 347
584 3300005718 Ga0068866_10001701 Ga0068866_100017015 347
585 3300005719 Ga0068861_100032234 Ga0068861_1000322343 347
586 3300005834 Ga0068851_10007794 Ga0068851_100077945 347
587 3300005841 Ga0068863_100001181 Ga0068863_1000011813 347
588 3300005843 Ga0068860_100002535 Ga0068860_10000253518 347
589 3300005844 Ga0068862_100053488 Ga0068862_1000534884 347
590 3300005937 Ga0081455_10025826 Ga0081455_100258265 347
591 3300006058 Ga0075432_10034867 Ga0075432_100348672 347
592 3300006163 Ga0070715_10003008 Ga0070715_100030084 347
593 3300006173 Ga0070716_100002195 Ga0070716_1000021957 347
594 3300006173 Ga0070716_100251186 Ga0070716_1002511861 347
595 3300006175 Ga0070712_100002422 Ga0070712_10000242210 347
596 3300006237 Ga0097621_100027332 Ga0097621_1000273325 347
597 3300006844 Ga0075428_100053187 Ga0075428_1000531875 347
598 3300006846 Ga0075430_100088198 Ga0075430_1000881983 347
599 3300006852 Ga0075433_10022460 Ga0075433_100224602 347
600 3300006880 Ga0075429_100036114 Ga0075429_1000361142 347
601 3300006914 Ga0075436_100006152 Ga0075436_1000061526 347
602 3300006931 Ga0097620_100009627 Ga0097620_1000096279 347
603 3300009092 Ga0105250_10013946 Ga0105250_100139463 347
604 3300009094 Ga0111539_10243260 Ga0111539_102432602 347
605 3300009098 Ga0105245_10004513 Ga0105245_1000451312 347
606 3300009098 Ga0105245_10068581 Ga0105245_100685812 347
607 3300009101 Ga0105247_10000582 Ga0105247_1000058230 347
608 3300009148 Ga0105243_10001048 Ga0105243_1000104823 347
609 3300009174 Ga0105241_10000744 Ga0105241_100007445 347
610 3300009176 Ga0105242_10001197 Ga0105242_1000119718 347
611 3300009177 Ga0105248_10001853 Ga0105248_1000185322 347
612 3300009545 Ga0105237_10003908 Ga0105237_1000390816 347
613 3300009551 Ga0105238_10052463 Ga0105238_100524633 347
614 3300009553 Ga0105249_10000702 Ga0105249_1000070225 347
615 3300010375 Ga0105239_10005973 Ga0105239_100059732 347
616 3300010375 Ga0105239_10398220 Ga0105239_103982202 347
617 3300011119 Ga0105246_10000802 Ga0105246_1000080216 347
618 3300013100 Ga0157373_10009574 Ga0157373_100095745 347
619 3300013102 Ga0157371_10012903 Ga0157371_100129034 347
620 3300013105 Ga0157369_10005142 Ga0157369_100051424 347
621 3300013296 Ga0157374_10010830 Ga0157374_100108302 347
622 3300013297 Ga0157378_10034098 Ga0157378_100340982 347
623 3300013306 Ga0163162_10035022 Ga0163162_100350227 347
624 3300013307 Ga0157372_10004763 Ga0157372_1000476314 347
625 3300013307 Ga0157372_10197437 Ga0157372_101974371 347
626 3300013308 Ga0157375_10000519 Ga0157375_1000051930 347
627 3300013308 Ga0157375_10004901 Ga0157375_1000490110 347
628 3300014325 Ga0163163_10002649 Ga0163163_100026492 347
629 3300014326 Ga0157380_10008349 Ga0157380_100083495 347
630 3300014326 Ga0157380_10021746 Ga0157380_100217464 347
631 3300014745 Ga0157377_10006697 Ga0157377_100066974 347
632 3300014745 Ga0157377_10130722 Ga0157377_101307222 347
633 3300014968 Ga0157379_10000158 Ga0157379_1000015849 347
634 3300014968 Ga0157379_10096803 Ga0157379_100968033 347
635 3300014969 Ga0157376_10004180 Ga0157376_100041805 347
636 3300014969 Ga0157376_10014743 Ga0157376_100147435 347
637 3300017792 Ga0163161_10003786 Ga0163161_100037869 347
638 3300025898 Ga0207692_10012156 Ga0207692_100121564 347
639 3300025900 Ga0207710_10008712 Ga0207710_100087124 347
640 3300025901 Ga0207688_10003365 Ga0207688_100033657 347
641 3300025903 Ga0207680_10010262 Ga0207680_100102625 347
642 3300025904 Ga0207647_10001406 Ga0207647_1000140617 347
643 3300025906 Ga0207699_10066640 Ga0207699_100666402 347
644 3300025912 Ga0207707_10100673 Ga0207707_101006732 347
645 3300025914 Ga0207671_10033119 Ga0207671_100331195 347
646 3300025915 Ga0207693_10000238 Ga0207693_1000023850 347
647 3300025916 Ga0207663_10000287 Ga0207663_100002877 347
648 3300025917 Ga0207660_10067077 Ga0207660_100670773 347
649 3300025919 Ga0207657_10000279 Ga0207657_1000027956 347
650 3300025921 Ga0207652_10092478 Ga0207652_100924783 347
651 3300025923 Ga0207681_10055945 Ga0207681_100559452 347
652 3300025924 Ga0207694_10036825 Ga0207694_100368253 347
653 3300025926 Ga0207659_10041965 Ga0207659_100419654 347
654 3300025927 Ga0207687_10005003 Ga0207687_100050034 347
655 3300025928 Ga0207700_10015205 Ga0207700_100152054 347
656 3300025929 Ga0207664_10126779 Ga0207664_101267792 347
657 3300025931 Ga0207644_10071062 Ga0207644_100710622 347
658 3300025932 Ga0207690_10005905 Ga0207690_100059055 347
659 3300025933 Ga0207706_10000298 Ga0207706_1000029855 347
660 3300025934 Ga0207686_10030075 Ga0207686_100300754 347
661 3300025935 Ga0207709_10022986 Ga0207709_100229862 347
662 3300025936 Ga0207670_10039131 Ga0207670_100391312 347
663 3300025937 Ga0207669_10001168 Ga0207669_1000116812 347
664 3300025939 Ga0207665_10001494 Ga0207665_1000149414 347
665 3300025940 Ga0207691_10015272 Ga0207691_100152725 347
666 3300025941 Ga0207711_10031576 Ga0207711_100315763 347
667 3300025942 Ga0207689_10026905 Ga0207689_100269055 347
668 3300025944 Ga0207661_10106700 Ga0207661_101067002 347
669 3300025945 Ga0207679_10009757 Ga0207679_100097573 347
670 3300025960 Ga0207651_10079884 Ga0207651_100798842 347
671 3300025961 Ga0207712_10071366 Ga0207712_100713662 347
672 3300025972 Ga0207668_10019174 Ga0207668_100191745 347
673 3300025981 Ga0207640_10177932 Ga0207640_101779321 347
674 3300025986 Ga0207658_10010080 Ga0207658_100100803 347
675 3300026035 Ga0207703_10008056 Ga0207703_100080563 347
676 3300026041 Ga0207639_10009775 Ga0207639_100097755 347
677 3300026067 Ga0207678_10000147 Ga0207678_1000014755 347
678 3300026075 Ga0207708_10006016 Ga0207708_100060167 347
679 3300026078 Ga0207702_10036429 Ga0207702_100364293 347
680 3300026088 Ga0207641_10017382 Ga0207641_100173822 347
681 3300026089 Ga0207648_10037564 Ga0207648_100375642 347
682 3300026095 Ga0207676_10008137 Ga0207676_100081376 347
683 3300026116 Ga0207674_10001015 Ga0207674_100010156 347
684 3300026118 Ga0207675_100000256 Ga0207675_10000025652 347
685 3300026121 Ga0207683_10000481 Ga0207683_1000048135 347
686 3300026142 Ga0207698_10006361 Ga0207698_100063615 347
687 3300028379 Ga0268266_10054369 Ga0268266_100543692 347
688 3300028380 Ga0268265_10024682 Ga0268265_100246823 347
689 3300028381 Ga0268264_10044357 Ga0268264_100443574 347
690 3300032133 Ga0316583_10011203 Ga0316583_100112032 347
691 3300035114 Ga0373939_0031996 Ga0373939_0031996_27_1070 347
692 3300035691 Ga0373931_0034854 Ga0373931_0034854_1449_2492 347
693 3300036647 Ga0316582_0010864 Ga0316582_0010864_3000_4043 347
694 3300037312 Ga0395899_0285191 Ga0395899_0285191_47_1090 347
695 3300037418 Ga0395900_0043778 Ga0395900_0043778_226_1269 347
696 3300037466 Ga0395898_0013577 Ga0395898_0013577_2265_3308 347
697 3300037471 Ga0395905_0005466 Ga0395905_0005466_7917_8960 347
698 3300037588 Ga0316581_0007757 Ga0316581_0007757_640_1683 347
699 3300038443 Ga0395901_0038344 Ga0395901_0038344_3042_4085 347
700 3300046491 Ga0495584_0008789 Ga0495584_0008789_2980_4023 347
701 3300046523 Ga0495644_0043075 Ga0495644_0043075_59_1102 347
702 3300046615 Ga0495656_0013509 Ga0495656_0013509_1844_2887 347
703 3300047321 Ga0495676_0195687 Ga0495676_0195687_323_1366 347
704 3300048903 Ga0496100_0027864 Ga0496100_0027864_521_1564 347
705 3300048904 Ga0496101_0003051 Ga0496101_0003051_8518_9561 347
706 3300048905 Ga0496102_0026327 Ga0496102_0026327_1517_2560 347
707 3300048905 Ga0496102_0039066 Ga0496102_0039066_2368_3411 347
708 3300048905 Ga0496102_0149761 Ga0496102_0149761_300_1343 347
709 3300048906 Ga0496103_0016875 Ga0496103_0016875_2100_3143 347
710 3300048906 Ga0496103_0077622 Ga0496103_0077622_178_1221 347
711 3300048907 Ga0496104_0005722 Ga0496104_0005722_6771_7814 347
712 3300048907 Ga0496104_0030057 Ga0496104_0030057_2368_3411 347
713 3300048907 Ga0496104_0118063 Ga0496104_0118063_855_1898 347
714 3300048907 Ga0496104_0221501 Ga0496104_0221501_112_1155 347
715 3300048908 Ga0496105_0012770 Ga0496105_0012770_2579_3622 347
716 3300048908 Ga0496105_0014052 Ga0496105_0014052_3436_4479 347
717 3300048908 Ga0496105_0148154 Ga0496105_0148154_157_1200 347
718 3300048909 Ga0496106_0023465 Ga0496106_0023465_1016_2059 347
719 3300048909 Ga0496106_0033436 Ga0496106_0033436_426_1469 347
720 3300048910 Ga0496107_0018774 Ga0496107_0018774_3040_4083 347
721 3300048910 Ga0496107_0036689 Ga0496107_0036689_219_1262 347
722 3300048910 Ga0496107_0048501 Ga0496107_0048501_569_1612 347
723 3300048910 Ga0496107_0090042 Ga0496107_0090042_449_1492 347
724 3300048911 Ga0496108_0021693 Ga0496108_0021693_775_1818 347
725 3300048911 Ga0496108_0202542 Ga0496108_0202542_273_1316 347
726 3300048912 Ga0496109_0035964 Ga0496109_0035964_1319_2362 347
727 3300048912 Ga0496109_0041180 Ga0496109_0041180_775_1818 347
728 3300048912 Ga0496109_0049798 Ga0496109_0049798_2206_3249 347
729 3300048912 Ga0496109_0238586 Ga0496109_0238586_169_1212 347
730 3300048913 Ga0496110_0047849 Ga0496110_0047849_2166_3209 347
731 3300048914 Ga0496111_0014031 Ga0496111_0014031_2972_4015 347
732 3300048914 Ga0496111_0128705 Ga0496111_0128705_420_1463 347
733 3300048915 Ga0496112_0003536 Ga0496112_0003536_2356_3399 347
734 3300048915 Ga0496112_0013959 Ga0496112_0013959_5981_7024 347
735 3300048916 Ga0496113_0015547 Ga0496113_0015547_2975_4018 347
736 3300048916 Ga0496113_0063345 Ga0496113_0063345_1477_2520 347
737 3300048917 Ga0496114_0011742 Ga0496114_0011742_1218_2261 347
738 3300048917 Ga0496114_0063446 Ga0496114_0063446_1195_2238 347
739 3300048918 Ga0496115_0004532 Ga0496115_0004532_3305_4348 347
740 3300048918 Ga0496115_0007837 Ga0496115_0007837_473_1516 347
741 3300049568 Ga0501031_0032572 Ga0501031_0032572_2038_3081 347
742 3300049568 Ga0501031_0267329 Ga0501031_0267329_37_1080 347
743 3300049569 Ga0501032_0134508 Ga0501032_0134508_402_1445 347
744 3300049569 Ga0501032_0154909 Ga0501032_0154909_351_1394 347
745 3300049572 Ga0501036_0433179 Ga0501036_0433179_22_1065 347
746 3300049573 Ga0501037_0100717 Ga0501037_0100717_404_1447 347
747 3300049574 Ga0501038_0042838 Ga0501038_0042838_2137_3180 347
748 3300049574 Ga0501038_0166790 Ga0501038_0166790_353_1396 347
749 3300049574 Ga0501038_0278022 Ga0501038_0278022_74_1150 347
750 3300049575 Ga0501039_0050030 Ga0501039_0050030_2126_3169 347
751 3300049576 Ga0501040_0019021 Ga0501040_0019021_3429_4472 347
752 3300049576 Ga0501040_0069979 Ga0501040_0069979_502_1545 347
753 3300049577 Ga0501041_0011323 Ga0501041_0011323_1997_3040 347
754 3300049577 Ga0501041_0022453 Ga0501041_0022453_448_1491 347
755 3300049577 Ga0501041_0053028 Ga0501041_0053028_981_2024 347
756 3300049577 Ga0501041_0083261 Ga0501041_0083261_712_1755 347
757 3300049577 Ga0501041_0087204 Ga0501041_0087204_556_1599 347
758 3300049578 Ga0501042_0039929 Ga0501042_0039929_1189_2232 347
759 3300049578 Ga0501042_0087879 Ga0501042_0087879_1058_2101 347
760 3300049578 Ga0501042_0107026 Ga0501042_0107026_511_1554 347
761 3300049579 Ga0501043_0061995 Ga0501043_0061995_605_1648 347
762 3300049579 Ga0501043_0173619 Ga0501043_0173619_544_1587 347
763 3300049580 Ga0501046_0051777 Ga0501046_0051777_1724_2767 347
764 3300049580 Ga0501046_0064791 Ga0501046_0064791_647_1690 347
765 3300049580 Ga0501046_0176533 Ga0501046_0176533_430_1473 347
766 3300049582 Ga0501048_0034825 Ga0501048_0034825_1122_2165 347
767 3300049582 Ga0501048_0136010 Ga0501048_0136010_370_1413 347
768 3300049582 Ga0501048_0148190 Ga0501048_0148190_329_1372 347
769 3300049582 Ga0501048_0238124 Ga0501048_0238124_91_1134 347
770 3300049584 Ga0501068_0013109 Ga0501068_0013109_2399_3442 347
771 3300049587 Ga0501071_0011812 Ga0501071_0011812_2733_3776 347
772 3300049587 Ga0501071_0158670 Ga0501071_0158670_423_1466 347
773 3300049587 Ga0501071_0202563 Ga0501071_0202563_85_1128 347
774 3300049588 Ga0501072_0018777 Ga0501072_0018777_795_1838 347
775 3300049588 Ga0501072_0033228 Ga0501072_0033228_2522_3565 347
776 3300049588 Ga0501072_0058644 Ga0501072_0058644_1929_2972 347
777 3300049588 Ga0501072_0074870 Ga0501072_0074870_847_1890 347
778 3300049588 Ga0501072_0092065 Ga0501072_0092065_310_1353 347
779 3300049588 Ga0501072_0164154 Ga0501072_0164154_53_1096 347
780 3300049590 Ga0501074_0006129 Ga0501074_0006129_5414_6457 347
781 3300049590 Ga0501074_0036341 Ga0501074_0036341_1005_2048 347
782 3300049590 Ga0501074_0212053 Ga0501074_0212053_74_1117 347
783 3300049591 Ga0501075_0014112 Ga0501075_0014112_2185_3228 347
784 3300049591 Ga0501075_0081325 Ga0501075_0081325_851_1894 347
785 3300049591 Ga0501075_0099884 Ga0501075_0099884_829_1872 347
786 3300049591 Ga0501075_0141760 Ga0501075_0141760_595_1638 347
787 3300049591 Ga0501075_0179888 Ga0501075_0179888_75_1118 347
788 3300049592 Ga0501076_0005491 Ga0501076_0005491_3303_4346 347
789 3300049592 Ga0501076_0036967 Ga0501076_0036967_787_1830 347
790 3300049592 Ga0501076_0037909 Ga0501076_0037909_620_1663 347
791 3300049593 Ga0501077_0007434 Ga0501077_0007434_3186_4229 347
792 3300049593 Ga0501077_0035201 Ga0501077_0035201_974_2017 347
793 3300049593 Ga0501077_0049569 Ga0501077_0049569_614_1657 347
794 3300049741 Ga0501079_0015639 Ga0501079_0015639_4457_5500 347
795 3300049742 Ga0501080_0068732 Ga0501080_0068732_516_1559 347
796 3300049742 Ga0501080_0078421 Ga0501080_0078421_1339_2382 347
797 3300049742 Ga0501080_0250735 Ga0501080_0250735_290_1333 347
798 3300049742 Ga0501080_0443156 Ga0501080_0443156_73_1116 347
799 3300049743 Ga0501081_0013258 Ga0501081_0013258_2480_3523 347
800 3300049743 Ga0501081_0034250 Ga0501081_0034250_1557_2600 347
801 3300049743 Ga0501081_0154902 Ga0501081_0154902_185_1228 347
802 3300049743 Ga0501081_0169781 Ga0501081_0169781_274_1317 347
803 3300049744 Ga0501083_0123486 Ga0501083_0123486_180_1223 347
804 3300049744 Ga0501083_0143303 Ga0501083_0143303_504_1547 347
805 3300049822 Ga0501035_0091071 Ga0501035_0091071_296_1339 347
806 3300049822 Ga0501035_0099632 Ga0501035_0099632_905_1948 347
807 3300049822 Ga0501035_0114014 Ga0501035_0114014_252_1295 347
808 3300049822 Ga0501035_0152089 Ga0501035_0152089_266_1309 347
809 3300049824 Ga0501045_0005186 Ga0501045_0005186_3619_4662 347
810 3300049824 Ga0501045_0018625 Ga0501045_0018625_2867_3910 347
811 3300049824 Ga0501045_0180192 Ga0501045_0180192_378_1421 347
812 3300050507 nmdc:mga05p37_65041_c1 nmdc:mga05p37_65041_c1_1838_2881 347
813 3300050509 nmdc:mga0qj67_157229_c1 nmdc:mga0qj67_157229_c1_570_1613 347
814 3300050510 nmdc:mga06r32_74289_c1 nmdc:mga06r32_74289_c1_807_1850 347
815 3300050511 nmdc:mga08y16_278027_c1 nmdc:mga08y16_278027_c1_426_1469 347
816 3300050511 nmdc:mga08y16_529365_c1 nmdc:mga08y16_529365_c1_53_1096 347
817 3300050513 nmdc:mga0rr50_17468_c1 nmdc:mga0rr50_17468_c1_1650_2693 347
818 3300050515 nmdc:mga0a205_72477_c1 nmdc:mga0a205_72477_c1_596_1639 347
819 3300053083 Ga0495655_0013726 Ga0495655_0013726_581_1624 347
820 3300054114 Ga0501084_0035441 Ga0501084_0035441_2899_3942 347
821 3300054114 Ga0501084_0048951 Ga0501084_0048951_695_1738 347
822 3300054114 Ga0501084_0112004 Ga0501084_0112004_1201_2244 347
823 3300060353 Ga0501082_0004740 Ga0501082_0004740_209_1252 347
824 3300060353 Ga0501082_0031797 Ga0501082_0031797_1579_2622 347
825 3300060353 Ga0501082_0058326 Ga0501082_0058326_1107_2150 347
826 3300061734 Ga0530510_0001990 Ga0530510_0001990_12240_13283 347
827 3300061734 Ga0530510_0022809 Ga0530510_0022809_1951_2994 347
828 3300061734 Ga0530510_0027933 Ga0530510_0027933_2151_3194 347
829 3300061734 Ga0530510_0055856 Ga0530510_0055856_971_2014 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

60

385

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.8962 5 332
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.891 5 332
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.8838 5 334
1u7n-assembly1.cif.gz_A crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.8795 5 332
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.8725 5 335
ID Description Score Start End Superfamily
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9378 5 339 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9192 5 339 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8612 7 332 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8509 7 332 3.40.718.10
1vmiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isocitrate/Isopropylmalate dehydrogenase-like 0.7621 125 244 3.40.50.10750
ID Description Score Start End GO Terms
AF-A0A436RKA8-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9752 5 100 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A2A4LCX3-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9743 1 339 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A3C1B4Q7-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9724 1 119 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A7C1SU67-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9723 5 165 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A0A8K3G6-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9672 22 347 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Feature Viewer

pLDDT pTM Quality
86.79 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map