F482604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 829 | 404 | 776 | 348 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10123440|Ga0157375_101234402 |
| Length | 408 |
| Sequence | MQKAGGKRLFRDNKTLLSRPGPGAAWRLTGRHVHGGPILRHSSFKTAPDQVSRTFMPSKVRIALDAMGGDVGAAVVIPGAAISLHRHREIEFLLVGDRAKIEPELEKHPALKAASKIIHTDVAVAMHDKPSQALRRGRKTSSMWLAIDAVKKGEADVVISAGNTGALMAMSRFHLRTLPGIDRPAIAGVWPTKRGESVVLDLGAAIGGDAHHLVSLAVMGAAMASVLFDKPRPTVGLLNIGTEEIKGHEEIREAGDRLRAVNLPELDYLGFVEGDGIGKGLADVIVTEGFSGNIALKAAEGTARQMAELLRNEMQRSWLSKLGYLLARSAFKALRDKMDPNKSNGGVFLGLNGIVVKSHGGISSEGFAYAIDVGYEMAHYDLLNKINQMLNREGGALSSVQTAQEAVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 2 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 3 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 4 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 5 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 6 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 7 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 8 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 9 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 10 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 11 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 12 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 13 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 14 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 15 | 2922368715 | |||
| 16 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 17 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 18 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 19 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 20 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 21 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 22 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 23 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 24 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 25 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 26 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 27 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 28 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 29 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 30 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 31 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 32 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 33 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 34 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 35 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 36 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 37 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 38 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 39 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 40 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 41 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 42 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 43 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 44 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 45 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 46 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 47 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 48 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 49 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 50 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 107 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 115 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 116 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 120 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 127 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 128 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 129 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 135 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 136 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 168 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 242 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 262 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 267 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 268 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 329 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 341 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 393 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 398 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 399 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 400 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 401 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 402 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 403 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 404 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.72 |
| Metatranscriptomes | 0 |
| Isolates | 6.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 4.83 |
| Rhizoplane | 6.88 |
| Rhizosphere | 85.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10046626 | 3300002067 | Bacteria | 1257 |
| 2 | JGI24738J21930_10003727 | 3300002075 | Bacteria | 3809 |
| 3 | JGI24751J29686_10006293 | 3300002459 | Bacteria | 2419 |
| 4 | JGI25404J52841_10000633 | 3300003659 | Bacteria | 5323 |
| 5 | Ga0065712_10007290 | 3300005290 | Bacteria | 2421 |
| 6 | Ga0065707_10139160 | 3300005295 | Bacteria | 1796 |
| 7 | Ga0070683_100088887 | 3300005329 | Bacteria | 2899 |
| 8 | Ga0070690_100000265 | 3300005330 | Bacteria | 26984 |
| 9 | Ga0070670_100020525 | 3300005331 | Bacteria | 5680 |
| 10 | Ga0070670_100210252 | 3300005331 | Bacteria | 1691 |
| 11 | Ga0070677_10038139 | 3300005333 | Bacteria | 1879 |
| 12 | Ga0070680_100042355 | 3300005336 | Bacteria | 3694 |
| 13 | Ga0070680_100138733 | 3300005336 | Bacteria | 2038 |
| 14 | Ga0068868_100019196 | 3300005338 | Bacteria | 5121 |
| 15 | Ga0070660_100147351 | 3300005339 | Bacteria | 1891 |
| 16 | Ga0070689_100005036 | 3300005340 | Bacteria | 8981 |
| 17 | Ga0070689_100222194 | 3300005340 | Bacteria | 1550 |
| 18 | Ga0070691_10013507 | 3300005341 | Bacteria | 3740 |
| 19 | Ga0070691_10019890 | 3300005341 | Bacteria | 3099 |
| 20 | Ga0070661_100000197 | 3300005344 | Bacteria | 50071 |
| 21 | Ga0070661_100001914 | 3300005344 | Bacteria | 14410 |
| 22 | Ga0070692_10011366 | 3300005345 | Bacteria | 4084 |
| 23 | Ga0070668_100004142 | 3300005347 | Bacteria | 10735 |
| 24 | Ga0070668_100045066 | 3300005347 | Bacteria | 3384 |
| 25 | Ga0070669_100015913 | 3300005353 | Bacteria | 5365 |
| 26 | Ga0070675_100005536 | 3300005354 | Bacteria | 9666 |
| 27 | Ga0070675_100240228 | 3300005354 | Bacteria | 1583 |
| 28 | Ga0070671_100002517 | 3300005355 | Bacteria | 14198 |
| 29 | Ga0070671_100060270 | 3300005355 | Bacteria | 3160 |
| 30 | Ga0070671_100258462 | 3300005355 | Bacteria | 1480 |
| 31 | Ga0070674_100004678 | 3300005356 | Bacteria | 7822 |
| 32 | Ga0070674_100025242 | 3300005356 | Bacteria | 3867 |
| 33 | Ga0070674_100027684 | 3300005356 | Bacteria | 3716 |
| 34 | Ga0070673_100000516 | 3300005364 | Bacteria | 20726 |
| 35 | Ga0070673_100014278 | 3300005364 | Bacteria | 5524 |
| 36 | Ga0070673_100023414 | 3300005364 | Bacteria | 4512 |
| 37 | Ga0070688_100000119 | 3300005365 | Bacteria | 41289 |
| 38 | Ga0070688_100031342 | 3300005365 | Bacteria | 3198 |
| 39 | Ga0070688_100260651 | 3300005365 | Bacteria | 1238 |
| 40 | Ga0070659_100003462 | 3300005366 | Bacteria | 11236 |
| 41 | Ga0070667_100075587 | 3300005367 | Bacteria | 2876 |
| 42 | Ga0070667_100087149 | 3300005367 | Bacteria | 2679 |
| 43 | Ga0070709_10004735 | 3300005434 | Bacteria | 7347 |
| 44 | Ga0070709_10076401 | 3300005434 | Bacteria | 2175 |
| 45 | Ga0070714_100064971 | 3300005435 | Bacteria | 3143 |
| 46 | Ga0070714_100069443 | 3300005435 | Bacteria | 3043 |
| 47 | Ga0070714_100084045 | 3300005435 | Bacteria | 2777 |
| 48 | Ga0070714_100178911 | 3300005435 | Bacteria | 1929 |
| 49 | Ga0070714_100524211 | 3300005435 | Bacteria | 1132 |
| 50 | Ga0070713_100018520 | 3300005436 | Bacteria | 5292 |
| 51 | Ga0070713_100022107 | 3300005436 | Bacteria | 4909 |
| 52 | Ga0070713_100070374 | 3300005436 | Bacteria | 2953 |
| 53 | Ga0070710_10011895 | 3300005437 | Bacteria | 4310 |
| 54 | Ga0070710_10033533 | 3300005437 | Bacteria | 2788 |
| 55 | Ga0070710_10038184 | 3300005437 | Bacteria | 2636 |
| 56 | Ga0070710_10047850 | 3300005437 | Bacteria | 2387 |
| 57 | Ga0070701_10011185 | 3300005438 | Bacteria | 4001 |
| 58 | Ga0070711_100021551 | 3300005439 | Bacteria | 4169 |
| 59 | Ga0070711_100042811 | 3300005439 | Bacteria | 3063 |
| 60 | Ga0070711_100107306 | 3300005439 | Bacteria | 2043 |
| 61 | Ga0070711_100179612 | 3300005439 | Bacteria | 1620 |
| 62 | Ga0070705_100000641 | 3300005440 | Bacteria | 19989 |
| 63 | Ga0070705_100042894 | 3300005440 | Bacteria | 2589 |
| 64 | Ga0070705_100047910 | 3300005440 | Bacteria | 2473 |
| 65 | Ga0070700_100002572 | 3300005441 | Bacteria | 9276 |
| 66 | Ga0070700_100171944 | 3300005441 | Bacteria | 1501 |
| 67 | Ga0070694_100000838 | 3300005444 | Bacteria | 17299 |
| 68 | Ga0070708_100065932 | 3300005445 | Bacteria | 3248 |
| 69 | Ga0070663_100037125 | 3300005455 | Bacteria | 3390 |
| 70 | Ga0070663_100039942 | 3300005455 | Bacteria | 3282 |
| 71 | Ga0070678_100029338 | 3300005456 | Bacteria | 3765 |
| 72 | Ga0070678_100034953 | 3300005456 | Bacteria | 3504 |
| 73 | Ga0070678_100043104 | 3300005456 | Bacteria | 3212 |
| 74 | Ga0070662_100019961 | 3300005457 | Bacteria | 4560 |
| 75 | Ga0070662_100238040 | 3300005457 | Bacteria | 1459 |
| 76 | Ga0070681_10027480 | 3300005458 | Bacteria | 5720 |
| 77 | Ga0068867_100062386 | 3300005459 | Bacteria | 2769 |
| 78 | Ga0068867_100168124 | 3300005459 | Bacteria | 1734 |
| 79 | Ga0070685_10066453 | 3300005466 | Bacteria | 2125 |
| 80 | Ga0070679_100008876 | 3300005530 | Bacteria | 9489 |
| 81 | Ga0070684_100013362 | 3300005535 | Bacteria | 6616 |
| 82 | Ga0070697_100000748 | 3300005536 | Bacteria | 24230 |
| 83 | Ga0070697_100013035 | 3300005536 | Bacteria | 6517 |
| 84 | Ga0070697_100057019 | 3300005536 | Bacteria | 3179 |
| 85 | Ga0068853_100001657 | 3300005539 | Bacteria | 16302 |
| 86 | Ga0068853_100001680 | 3300005539 | Bacteria | 16203 |
| 87 | Ga0070672_100005169 | 3300005543 | Bacteria | 8625 |
| 88 | Ga0070672_100166489 | 3300005543 | Bacteria | 1831 |
| 89 | Ga0070672_100167997 | 3300005543 | Bacteria | 1823 |
| 90 | Ga0070686_100002196 | 3300005544 | Bacteria | 10782 |
| 91 | Ga0070686_100157552 | 3300005544 | Bacteria | 1596 |
| 92 | Ga0070695_100000560 | 3300005545 | Bacteria | 19668 |
| 93 | Ga0070695_100000696 | 3300005545 | Bacteria | 17958 |
| 94 | Ga0070665_100045229 | 3300005548 | Bacteria | 4421 |
| 95 | Ga0070665_100060372 | 3300005548 | Bacteria | 3800 |
| 96 | Ga0070665_100144581 | 3300005548 | Bacteria | 2382 |
| 97 | Ga0070665_100150045 | 3300005548 | Bacteria | 2334 |
| 98 | Ga0070704_100001082 | 3300005549 | Bacteria | 14114 |
| 99 | Ga0068855_100095631 | 3300005563 | Bacteria | 3424 |
| 100 | Ga0070664_100000182 | 3300005564 | Bacteria | 44467 |
| 101 | Ga0068857_100002534 | 3300005577 | Bacteria | 14952 |
| 102 | Ga0068854_100000423 | 3300005578 | Bacteria | 26407 |
| 103 | Ga0068854_100131751 | 3300005578 | Bacteria | 1910 |
| 104 | Ga0068856_100005230 | 3300005614 | Bacteria | 12807 |
| 105 | Ga0070702_100000037 | 3300005615 | Bacteria | 36450 |
| 106 | Ga0070702_100072164 | 3300005615 | Bacteria | 2043 |
| 107 | Ga0070702_100153004 | 3300005615 | Bacteria | 1483 |
| 108 | Ga0068852_100003616 | 3300005616 | Bacteria | 10818 |
| 109 | Ga0068852_100009229 | 3300005616 | Bacteria | 7309 |
| 110 | Ga0068859_100009627 | 3300005617 | Bacteria | 9756 |
| 111 | Ga0068859_100120910 | 3300005617 | Bacteria | 2685 |
| 112 | Ga0068859_100271064 | 3300005617 | Bacteria | 1789 |
| 113 | Ga0068859_100410189 | 3300005617 | Bacteria | 1451 |
| 114 | Ga0068864_100002959 | 3300005618 | Bacteria | 14033 |
| 115 | Ga0068866_10001701 | 3300005718 | Bacteria | 9266 |
| 116 | Ga0068866_10026304 | 3300005718 | Bacteria | 2746 |
| 117 | Ga0068861_100009658 | 3300005719 | Bacteria | 6664 |
| 118 | Ga0068861_100032234 | 3300005719 | Bacteria | 3855 |
| 119 | Ga0068851_10007794 | 3300005834 | Bacteria | 4927 |
| 120 | Ga0068851_10026127 | 3300005834 | Bacteria | 2867 |
| 121 | Ga0068870_10126204 | 3300005840 | Bacteria | 1480 |
| 122 | Ga0068863_100001181 | 3300005841 | Bacteria | 26124 |
| 123 | Ga0068858_100089368 | 3300005842 | Bacteria | 2866 |
| 124 | Ga0068858_100091252 | 3300005842 | Bacteria | 2835 |
| 125 | Ga0068858_100117126 | 3300005842 | Bacteria | 2490 |
| 126 | Ga0068860_100002535 | 3300005843 | Bacteria | 19123 |
| 127 | Ga0068860_100097405 | 3300005843 | Bacteria | 2804 |
| 128 | Ga0068860_100150002 | 3300005843 | Bacteria | 2245 |
| 129 | Ga0068862_100031093 | 3300005844 | Bacteria | 4503 |
| 130 | Ga0068862_100053488 | 3300005844 | Bacteria | 3456 |
| 131 | Ga0081455_10003665 | 3300005937 | Bacteria | 17584 |
| 132 | Ga0081455_10025826 | 3300005937 | Bacteria | 5415 |
| 133 | Ga0081540_1002699 | 3300005983 | Bacteria | 14438 |
| 134 | Ga0081540_1039161 | 3300005983 | Bacteria | 2488 |
| 135 | Ga0070717_10019351 | 3300006028 | Bacteria | 5338 |
| 136 | Ga0075363_100057433 | 3300006048 | Bacteria | 2088 |
| 137 | Ga0075432_10013785 | 3300006058 | Bacteria | 2751 |
| 138 | Ga0075432_10034867 | 3300006058 | Bacteria | 1749 |
| 139 | Ga0070715_10003008 | 3300006163 | Bacteria | 5273 |
| 140 | Ga0070715_10008256 | 3300006163 | Bacteria | 3622 |
| 141 | Ga0070716_100002195 | 3300006173 | Bacteria | 8989 |
| 142 | Ga0070716_100021364 | 3300006173 | Bacteria | 3410 |
| 143 | Ga0070716_100251186 | 3300006173 | Bacteria | 1205 |
| 144 | Ga0070712_100002422 | 3300006175 | Bacteria | 11493 |
| 145 | Ga0070712_100143431 | 3300006175 | Bacteria | 1825 |
| 146 | Ga0070712_100172654 | 3300006175 | Bacteria | 1678 |
| 147 | Ga0075367_10046668 | 3300006178 | Bacteria | 2546 |
| 148 | Ga0075367_10098687 | 3300006178 | Bacteria | 1783 |
| 149 | Ga0097621_100027332 | 3300006237 | Bacteria | 4485 |
| 150 | Ga0075428_100053187 | 3300006844 | Bacteria | 4436 |
| 151 | Ga0075430_100018717 | 3300006846 | Bacteria | 5895 |
| 152 | Ga0075430_100088198 | 3300006846 | Bacteria | 2596 |
| 153 | Ga0075430_100131722 | 3300006846 | Bacteria | 2084 |
| 154 | Ga0075431_100001010 | 3300006847 | Bacteria | 25028 |
| 155 | Ga0075431_100212876 | 3300006847 | Bacteria | 1974 |
| 156 | Ga0075433_10022460 | 3300006852 | Bacteria | 5295 |
| 157 | Ga0075433_10216752 | 3300006852 | Bacteria | 1701 |
| 158 | Ga0075434_100134908 | 3300006871 | Bacteria | 2488 |
| 159 | Ga0075429_100036114 | 3300006880 | Bacteria | 4298 |
| 160 | Ga0075429_100183266 | 3300006880 | Bacteria | 1835 |
| 161 | Ga0068865_100059567 | 3300006881 | Bacteria | 2671 |
| 162 | Ga0068865_100248784 | 3300006881 | Bacteria | 1402 |
| 163 | Ga0075436_100000192 | 3300006914 | Bacteria | 37698 |
| 164 | Ga0075436_100006152 | 3300006914 | Bacteria | 8239 |
| 165 | Ga0075436_100180934 | 3300006914 | Bacteria | 1490 |
| 166 | Ga0097620_100009627 | 3300006931 | Bacteria | 9756 |
| 167 | Ga0097620_100120911 | 3300006931 | Bacteria | 2685 |
| 168 | Ga0097620_100271067 | 3300006931 | Bacteria | 1789 |
| 169 | Ga0097620_100410197 | 3300006931 | Bacteria | 1451 |
| 170 | Ga0075435_100138910 | 3300007076 | Bacteria | 2037 |
| 171 | Ga0075435_100219123 | 3300007076 | Bacteria | 1616 |
| 172 | Ga0099794_10043202 | 3300007265 | Bacteria | 2151 |
| 173 | Ga0099795_10004198 | 3300007788 | Bacteria | 3687 |
| 174 | Ga0105250_10013946 | 3300009092 | Bacteria | 3309 |
| 175 | Ga0105240_10212766 | 3300009093 | Bacteria | 2258 |
| 176 | Ga0105240_10236924 | 3300009093 | Bacteria | 2117 |
| 177 | Ga0111539_10076235 | 3300009094 | Bacteria | 3948 |
| 178 | Ga0111539_10243260 | 3300009094 | Bacteria | 2095 |
| 179 | Ga0105245_10004513 | 3300009098 | Bacteria | 12298 |
| 180 | Ga0105245_10068581 | 3300009098 | Bacteria | 3214 |
| 181 | Ga0105245_10336932 | 3300009098 | Bacteria | 1490 |
| 182 | Ga0105245_10343645 | 3300009098 | Bacteria | 1476 |
| 183 | Ga0105245_10359431 | 3300009098 | Bacteria | 1445 |
| 184 | Ga0105247_10000582 | 3300009101 | Bacteria | 29710 |
| 185 | Ga0105247_10004686 | 3300009101 | Bacteria | 8713 |
| 186 | Ga0114129_10425001 | 3300009147 | Bacteria | 1747 |
| 187 | Ga0105243_10001048 | 3300009148 | Bacteria | 25321 |
| 188 | Ga0105243_10049735 | 3300009148 | Bacteria | 3308 |
| 189 | Ga0105243_10133840 | 3300009148 | Bacteria | 2107 |
| 190 | Ga0105241_10000744 | 3300009174 | Bacteria | 24789 |
| 191 | Ga0105241_10094455 | 3300009174 | Bacteria | 2365 |
| 192 | Ga0105242_10001197 | 3300009176 | Bacteria | 20476 |
| 193 | Ga0105248_10001853 | 3300009177 | Bacteria | 23435 |
| 194 | Ga0105237_10000542 | 3300009545 | Bacteria | 53188 |
| 195 | Ga0105237_10003908 | 3300009545 | Bacteria | 17463 |
| 196 | Ga0105238_10052463 | 3300009551 | Bacteria | 4100 |
| 197 | Ga0105238_10085480 | 3300009551 | Bacteria | 3142 |
| 198 | Ga0105249_10000702 | 3300009553 | Bacteria | 30380 |
| 199 | Ga0105249_10015186 | 3300009553 | Bacteria | 6815 |
| 200 | Ga0099796_10000963 | 3300010159 | Bacteria | 5386 |
| 201 | Ga0105239_10001329 | 3300010375 | Bacteria | 33273 |
| 202 | Ga0105239_10005973 | 3300010375 | Bacteria | 14170 |
| 203 | Ga0105239_10037215 | 3300010375 | Bacteria | 5336 |
| 204 | Ga0105239_10398220 | 3300010375 | Bacteria | 1558 |
| 205 | Ga0105246_10000802 | 3300011119 | Bacteria | 17857 |
| 206 | Ga0157373_10009574 | 3300013100 | Bacteria | 7154 |
| 207 | Ga0157371_10012903 | 3300013102 | Bacteria | 6362 |
| 208 | Ga0157369_10005142 | 3300013105 | Bacteria | 15314 |
| 209 | Ga0157374_10010830 | 3300013296 | Bacteria | 7868 |
| 210 | Ga0157378_10034098 | 3300013297 | Bacteria | 4502 |
| 211 | Ga0163162_10035022 | 3300013306 | Bacteria | 4999 |
| 212 | Ga0157372_10004763 | 3300013307 | Bacteria | 14405 |
| 213 | Ga0157372_10197437 | 3300013307 | Bacteria | 2330 |
| 214 | Ga0157375_10000519 | 3300013308 | Bacteria | 34613 |
| 215 | Ga0157375_10004901 | 3300013308 | Bacteria | 11634 |
| 216 | Ga0157375_10075444 | 3300013308 | Bacteria | 3396 |
| 217 | Ga0157375_10123440 | 3300013308 | Bacteria | 2702 |
| 218 | Ga0163163_10002649 | 3300014325 | Bacteria | 15143 |
| 219 | Ga0163163_10074340 | 3300014325 | Bacteria | 3390 |
| 220 | Ga0157380_10008349 | 3300014326 | Bacteria | 7384 |
| 221 | Ga0157380_10021746 | 3300014326 | Bacteria | 4817 |
| 222 | Ga0157380_10309791 | 3300014326 | Bacteria | 1458 |
| 223 | Ga0157377_10006697 | 3300014745 | Bacteria | 5516 |
| 224 | Ga0157377_10130722 | 3300014745 | Bacteria | 1533 |
| 225 | Ga0157379_10000158 | 3300014968 | Bacteria | 50531 |
| 226 | Ga0157379_10096803 | 3300014968 | Bacteria | 2649 |
| 227 | Ga0157376_10004180 | 3300014969 | Bacteria | 10015 |
| 228 | Ga0157376_10014743 | 3300014969 | Bacteria | 5879 |
| 229 | Ga0157376_10039678 | 3300014969 | Bacteria | 3842 |
| 230 | Ga0163161_10003786 | 3300017792 | Bacteria | 10601 |
| 231 | Ga0163161_10019421 | 3300017792 | Bacteria | 4768 |
| 232 | Ga0213872_10063049 | 3300021361 | Bacteria | 1675 |
| 233 | Ga0213876_10042552 | 3300021384 | Bacteria | 2400 |
| 234 | Ga0209758_1001046 | 3300025297 | Bacteria | 36253 |
| 235 | Ga0207656_10032018 | 3300025321 | Bacteria | 2182 |
| 236 | Ga0207653_10051798 | 3300025885 | Bacteria | 1367 |
| 237 | Ga0207682_10002414 | 3300025893 | Bacteria | 8411 |
| 238 | Ga0207692_10012156 | 3300025898 | Bacteria | 3689 |
| 239 | Ga0207692_10038239 | 3300025898 | Bacteria | 2353 |
| 240 | Ga0207642_10020933 | 3300025899 | Bacteria | 2564 |
| 241 | Ga0207710_10008712 | 3300025900 | Bacteria | 4277 |
| 242 | Ga0207688_10003365 | 3300025901 | Bacteria | 8733 |
| 243 | Ga0207680_10010262 | 3300025903 | Bacteria | 4680 |
| 244 | Ga0207647_10001406 | 3300025904 | Bacteria | 18468 |
| 245 | Ga0207699_10022098 | 3300025906 | Bacteria | 3442 |
| 246 | Ga0207699_10056526 | 3300025906 | Bacteria | 2339 |
| 247 | Ga0207699_10066640 | 3300025906 | Bacteria | 2186 |
| 248 | Ga0207645_10180403 | 3300025907 | Bacteria | 1385 |
| 249 | Ga0207643_10015748 | 3300025908 | Bacteria | 4118 |
| 250 | Ga0207684_10061490 | 3300025910 | Bacteria | 3189 |
| 251 | Ga0207654_10027759 | 3300025911 | Bacteria | 3079 |
| 252 | Ga0207654_10201013 | 3300025911 | Bacteria | 1312 |
| 253 | Ga0207707_10100673 | 3300025912 | Bacteria | 2525 |
| 254 | Ga0207707_10102568 | 3300025912 | Bacteria | 2501 |
| 255 | Ga0207707_10141873 | 3300025912 | Bacteria | 2100 |
| 256 | Ga0207671_10000649 | 3300025914 | Bacteria | 45408 |
| 257 | Ga0207671_10033119 | 3300025914 | Bacteria | 3846 |
| 258 | Ga0207693_10000238 | 3300025915 | Bacteria | 50667 |
| 259 | Ga0207693_10023521 | 3300025915 | Bacteria | 4892 |
| 260 | Ga0207693_10038606 | 3300025915 | Bacteria | 3759 |
| 261 | Ga0207693_10060824 | 3300025915 | Bacteria | 2958 |
| 262 | Ga0207663_10000287 | 3300025916 | Bacteria | 22143 |
| 263 | Ga0207663_10039870 | 3300025916 | Bacteria | 2850 |
| 264 | Ga0207663_10060610 | 3300025916 | Bacteria | 2398 |
| 265 | Ga0207663_10078460 | 3300025916 | Bacteria | 2153 |
| 266 | Ga0207660_10067077 | 3300025917 | Bacteria | 2598 |
| 267 | Ga0207660_10102686 | 3300025917 | Bacteria | 2138 |
| 268 | Ga0207657_10000279 | 3300025919 | Bacteria | 54382 |
| 269 | Ga0207649_10002158 | 3300025920 | Bacteria | 11131 |
| 270 | Ga0207649_10192485 | 3300025920 | Bacteria | 1435 |
| 271 | Ga0207652_10092478 | 3300025921 | Bacteria | 2661 |
| 272 | Ga0207646_10077702 | 3300025922 | Bacteria | 2966 |
| 273 | Ga0207681_10055945 | 3300025923 | Bacteria | 2689 |
| 274 | Ga0207694_10036825 | 3300025924 | Bacteria | 3755 |
| 275 | Ga0207694_10055605 | 3300025924 | Bacteria | 3072 |
| 276 | Ga0207694_10121732 | 3300025924 | Bacteria | 2084 |
| 277 | Ga0207659_10041965 | 3300025926 | Bacteria | 3205 |
| 278 | Ga0207659_10097275 | 3300025926 | Bacteria | 2211 |
| 279 | Ga0207659_10210706 | 3300025926 | Bacteria | 1557 |
| 280 | Ga0207687_10005003 | 3300025927 | Bacteria | 8777 |
| 281 | Ga0207687_10169984 | 3300025927 | Bacteria | 1680 |
| 282 | Ga0207700_10015205 | 3300025928 | Bacteria | 5066 |
| 283 | Ga0207700_10036206 | 3300025928 | Bacteria | 3562 |
| 284 | Ga0207700_10102585 | 3300025928 | Bacteria | 2285 |
| 285 | Ga0207664_10123366 | 3300025929 | Bacteria | 2171 |
| 286 | Ga0207664_10126779 | 3300025929 | Bacteria | 2144 |
| 287 | Ga0207664_10161692 | 3300025929 | Bacteria | 1910 |
| 288 | Ga0207664_10191882 | 3300025929 | Bacteria | 1759 |
| 289 | Ga0207664_10336498 | 3300025929 | Bacteria | 1334 |
| 290 | Ga0207644_10071062 | 3300025931 | Bacteria | 2545 |
| 291 | Ga0207690_10005905 | 3300025932 | Bacteria | 7248 |
| 292 | Ga0207706_10000298 | 3300025933 | Bacteria | 53969 |
| 293 | Ga0207706_10087810 | 3300025933 | Bacteria | 2734 |
| 294 | Ga0207686_10030075 | 3300025934 | Bacteria | 3212 |
| 295 | Ga0207709_10022986 | 3300025935 | Bacteria | 3544 |
| 296 | Ga0207709_10099567 | 3300025935 | Bacteria | 1919 |
| 297 | Ga0207670_10039131 | 3300025936 | Bacteria | 3103 |
| 298 | Ga0207669_10001168 | 3300025937 | Bacteria | 11170 |
| 299 | Ga0207669_10040852 | 3300025937 | Bacteria | 2694 |
| 300 | Ga0207704_10055882 | 3300025938 | Bacteria | 2415 |
| 301 | Ga0207704_10107706 | 3300025938 | Bacteria | 1875 |
| 302 | Ga0207665_10001494 | 3300025939 | Bacteria | 15715 |
| 303 | Ga0207665_10010416 | 3300025939 | Bacteria | 6107 |
| 304 | Ga0207665_10025499 | 3300025939 | Bacteria | 3901 |
| 305 | Ga0207691_10015272 | 3300025940 | Bacteria | 7306 |
| 306 | Ga0207691_10142387 | 3300025940 | Bacteria | 2112 |
| 307 | Ga0207711_10031576 | 3300025941 | Bacteria | 4472 |
| 308 | Ga0207689_10026905 | 3300025942 | Bacteria | 4815 |
| 309 | Ga0207689_10097582 | 3300025942 | Bacteria | 2414 |
| 310 | Ga0207661_10106700 | 3300025944 | Bacteria | 2361 |
| 311 | Ga0207679_10009757 | 3300025945 | Bacteria | 6159 |
| 312 | Ga0207679_10094624 | 3300025945 | Bacteria | 2320 |
| 313 | Ga0207651_10029594 | 3300025960 | Bacteria | 3472 |
| 314 | Ga0207651_10079884 | 3300025960 | Bacteria | 2351 |
| 315 | Ga0207651_10255496 | 3300025960 | Bacteria | 1436 |
| 316 | Ga0207651_10379731 | 3300025960 | Bacteria | 1197 |
| 317 | Ga0207712_10020564 | 3300025961 | Bacteria | 4324 |
| 318 | Ga0207712_10071366 | 3300025961 | Bacteria | 2498 |
| 319 | Ga0207668_10019174 | 3300025972 | Bacteria | 4318 |
| 320 | Ga0207668_10043366 | 3300025972 | Bacteria | 3052 |
| 321 | Ga0207668_10073880 | 3300025972 | Bacteria | 2445 |
| 322 | Ga0207640_10177932 | 3300025981 | Bacteria | 1592 |
| 323 | Ga0207640_10220836 | 3300025981 | Bacteria | 1451 |
| 324 | Ga0207640_10221049 | 3300025981 | Bacteria | 1450 |
| 325 | Ga0207658_10010080 | 3300025986 | Bacteria | 6419 |
| 326 | Ga0207658_10038002 | 3300025986 | Bacteria | 3465 |
| 327 | Ga0207658_10052748 | 3300025986 | Bacteria | 3002 |
| 328 | Ga0207703_10008056 | 3300026035 | Bacteria | 8328 |
| 329 | Ga0207703_10363418 | 3300026035 | Bacteria | 1335 |
| 330 | Ga0207639_10009775 | 3300026041 | Bacteria | 6628 |
| 331 | Ga0207678_10000147 | 3300026067 | Bacteria | 57839 |
| 332 | Ga0207678_10109186 | 3300026067 | Bacteria | 2360 |
| 333 | Ga0207708_10006016 | 3300026075 | Bacteria | 8994 |
| 334 | Ga0207708_10068483 | 3300026075 | Bacteria | 2717 |
| 335 | Ga0207708_10095298 | 3300026075 | Bacteria | 2298 |
| 336 | Ga0207708_10160609 | 3300026075 | Bacteria | 1774 |
| 337 | Ga0207702_10036429 | 3300026078 | Bacteria | 4115 |
| 338 | Ga0207702_10078916 | 3300026078 | Bacteria | 2851 |
| 339 | Ga0207641_10017382 | 3300026088 | Bacteria | 5888 |
| 340 | Ga0207648_10037564 | 3300026089 | Bacteria | 4267 |
| 341 | Ga0207648_10119872 | 3300026089 | Bacteria | 2313 |
| 342 | Ga0207648_10234542 | 3300026089 | Bacteria | 1633 |
| 343 | Ga0207648_10286929 | 3300026089 | Bacteria | 1473 |
| 344 | Ga0207676_10008137 | 3300026095 | Bacteria | 7455 |
| 345 | Ga0207674_10001015 | 3300026116 | Bacteria | 36675 |
| 346 | Ga0207674_10254188 | 3300026116 | Bacteria | 1704 |
| 347 | Ga0207675_100000256 | 3300026118 | Bacteria | 50777 |
| 348 | Ga0207675_100017442 | 3300026118 | Bacteria | 6702 |
| 349 | Ga0207683_10000481 | 3300026121 | Bacteria | 36853 |
| 350 | Ga0207683_10011735 | 3300026121 | Bacteria | 7478 |
| 351 | Ga0207683_10169309 | 3300026121 | Bacteria | 1978 |
| 352 | Ga0207698_10006361 | 3300026142 | Bacteria | 7360 |
| 353 | Ga0207698_10143899 | 3300026142 | Bacteria | 2058 |
| 354 | Ga0207428_10019580 | 3300027907 | Bacteria | 5766 |
| 355 | Ga0268266_10000442 | 3300028379 | Bacteria | 61975 |
| 356 | Ga0268266_10054369 | 3300028379 | Bacteria | 3440 |
| 357 | Ga0268266_10071605 | 3300028379 | Bacteria | 3005 |
| 358 | Ga0268266_10127592 | 3300028379 | Bacteria | 2272 |
| 359 | Ga0268265_10012963 | 3300028380 | Bacteria | 5660 |
| 360 | Ga0268265_10024682 | 3300028380 | Bacteria | 4257 |
| 361 | Ga0268264_10044357 | 3300028381 | Bacteria | 3688 |
| 362 | Ga0268264_10177182 | 3300028381 | Bacteria | 1933 |
| 363 | Ga0265325_10018613 | 3300031241 | Bacteria | 3852 |
| 364 | Ga0265325_10023501 | 3300031241 | Bacteria | 3363 |
| 365 | Ga0265325_10025494 | 3300031241 | Bacteria | 3210 |
| 366 | Ga0265325_10046577 | 3300031241 | Bacteria | 2248 |
| 367 | Ga0265329_10031438 | 3300031242 | Bacteria | 1724 |
| 368 | Ga0265339_10046300 | 3300031249 | Bacteria | 2392 |
| 369 | Ga0265316_10021547 | 3300031344 | Bacteria | 5456 |
| 370 | Ga0265313_10032255 | 3300031595 | Bacteria | 2677 |
| 371 | Ga0265313_10062141 | 3300031595 | Bacteria | 1745 |
| 372 | Ga0265314_10028861 | 3300031711 | Bacteria | 4129 |
| 373 | Ga0307414_10089205 | 3300032004 | Bacteria | 2285 |
| 374 | Ga0316583_10000231 | 3300032133 | Bacteria | 15111 |
| 375 | Ga0316583_10011203 | 3300032133 | Bacteria | 3228 |
| 376 | Ga0373950_0014965 | 3300034818 | Bacteria | 1311 |
| 377 | Ga0373944_0038892 | 3300035089 | Bacteria | 1462 |
| 378 | Ga0373939_0031996 | 3300035114 | Bacteria | 1525 |
| 379 | Ga0373945_0010619 | 3300035116 | Bacteria | 3035 |
| 380 | Ga0373954_0031235 | 3300035118 | Bacteria | 2458 |
| 381 | Ga0373943_0000422 | 3300035170 | Bacteria | 17852 |
| 382 | Ga0373943_0005880 | 3300035170 | Bacteria | 5510 |
| 383 | Ga0373943_0032540 | 3300035170 | Bacteria | 2479 |
| 384 | Ga0373946_0000369 | 3300035171 | Bacteria | 14584 |
| 385 | Ga0373946_0011600 | 3300035171 | Bacteria | 3291 |
| 386 | Ga0373946_0039364 | 3300035171 | Bacteria | 1930 |
| 387 | Ga0373955_0023754 | 3300035172 | Bacteria | 3127 |
| 388 | Ga0373961_0017807 | 3300035241 | Bacteria | 1848 |
| 389 | Ga0373931_0034854 | 3300035691 | Bacteria | 2614 |
| 390 | Ga0373927_0000414 | 3300035695 | Bacteria | 32784 |
| 391 | Ga0373927_0027487 | 3300035695 | Bacteria | 3714 |
| 392 | Ga0373927_0027723 | 3300035695 | Bacteria | 3698 |
| 393 | Ga0373933_0051605 | 3300035724 | Bacteria | 2459 |
| 394 | Ga0373947_0000275 | 3300035725 | Bacteria | 29242 |
| 395 | Ga0373947_0005949 | 3300035725 | Bacteria | 7108 |
| 396 | Ga0373947_0151578 | 3300035725 | Bacteria | 1493 |
| 397 | Ga0373937_0049609 | 3300036401 | Bacteria | 3843 |
| 398 | Ga0316582_0010864 | 3300036647 | Bacteria | 5007 |
| 399 | Ga0316582_0085542 | 3300036647 | Bacteria | 2067 |
| 400 | Ga0373925_0002546 | 3300037068 | Bacteria | 14512 |
| 401 | Ga0373925_0038888 | 3300037068 | Bacteria | 3519 |
| 402 | Ga0373925_0109999 | 3300037068 | Bacteria | 2127 |
| 403 | Ga0395899_0000130 | 3300037312 | Bacteria | 117976 |
| 404 | Ga0395899_0285191 | 3300037312 | Bacteria | 1122 |
| 405 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 406 | Ga0395900_0043778 | 3300037418 | Bacteria | 4614 |
| 407 | Ga0395898_0000104 | 3300037466 | Bacteria | 223462 |
| 408 | Ga0395898_0013577 | 3300037466 | Bacteria | 8383 |
| 409 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 410 | Ga0395905_0005466 | 3300037471 | Bacteria | 12958 |
| 411 | Ga0395905_0020427 | 3300037471 | Bacteria | 6274 |
| 412 | Ga0316581_0007757 | 3300037588 | Bacteria | 2894 |
| 413 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 414 | Ga0395901_0038344 | 3300038443 | Bacteria | 4956 |
| 415 | Ga0436365_0034062 | 3300039437 | Bacteria | 1969 |
| 416 | Ga0436365_0636722 | 3300039437 | Bacteria | 3357 |
| 417 | Ga0436361_0496440 | 3300039447 | Bacteria | 3451 |
| 418 | Ga0436361_0812703 | 3300039447 | Bacteria | 4735 |
| 419 | Ga0436361_1044927 | 3300039447 | Bacteria | 6486 |
| 420 | Ga0436363_0751359 | 3300039450 | Bacteria | 2742 |
| 421 | Ga0439441_001387 | 3300042001 | Bacteria | 3144 |
| 422 | Ga0466972_0039602 | 3300044658 | Bacteria | 2299 |
| 423 | Ga0466964_0026887 | 3300044706 | Bacteria | 2255 |
| 424 | Ga0466960_0024288 | 3300044901 | Bacteria | 2733 |
| 425 | Ga0466967_0127455 | 3300045976 | Bacteria | 2359 |
| 426 | Ga0495592_0004650 | 3300046454 | Bacteria | 10057 |
| 427 | Ga0495603_0001214 | 3300046455 | Bacteria | 15042 |
| 428 | Ga0495603_0051536 | 3300046455 | Bacteria | 2445 |
| 429 | Ga0495629_0002062 | 3300046459 | Bacteria | 15586 |
| 430 | Ga0495629_0015054 | 3300046459 | Bacteria | 5559 |
| 431 | Ga0495641_0022382 | 3300046461 | Bacteria | 3163 |
| 432 | Ga0495641_0023622 | 3300046461 | Bacteria | 3049 |
| 433 | Ga0495651_0033029 | 3300046462 | Bacteria | 4037 |
| 434 | Ga0495653_0016883 | 3300046463 | Bacteria | 5940 |
| 435 | Ga0495580_0000299 | 3300046472 | Bacteria | 40203 |
| 436 | Ga0495580_0008354 | 3300046472 | Bacteria | 8234 |
| 437 | Ga0495580_0090256 | 3300046472 | Bacteria | 2133 |
| 438 | Ga0495582_0011046 | 3300046473 | Bacteria | 4971 |
| 439 | Ga0495582_0025753 | 3300046473 | Bacteria | 3222 |
| 440 | Ga0495639_0005838 | 3300046475 | Bacteria | 5293 |
| 441 | Ga0495639_0077256 | 3300046475 | Bacteria | 1545 |
| 442 | Ga0495662_0000261 | 3300046476 | Bacteria | 22323 |
| 443 | Ga0495664_0000230 | 3300046477 | Bacteria | 26824 |
| 444 | Ga0495664_0003269 | 3300046477 | Bacteria | 8808 |
| 445 | Ga0495584_0008789 | 3300046491 | Bacteria | 5223 |
| 446 | Ga0495584_0035734 | 3300046491 | Bacteria | 2511 |
| 447 | Ga0495585_0004199 | 3300046492 | Bacteria | 9408 |
| 448 | Ga0495594_0000679 | 3300046499 | Bacteria | 17523 |
| 449 | Ga0495607_0008348 | 3300046501 | Bacteria | 7084 |
| 450 | Ga0495618_0006033 | 3300046514 | Bacteria | 7360 |
| 451 | Ga0495618_0014795 | 3300046514 | Bacteria | 4759 |
| 452 | Ga0495628_0164958 | 3300046516 | Bacteria | 1682 |
| 453 | Ga0495630_0038359 | 3300046517 | Bacteria | 3583 |
| 454 | Ga0495630_0302082 | 3300046517 | Bacteria | 1223 |
| 455 | Ga0495644_0001707 | 3300046523 | Bacteria | 8891 |
| 456 | Ga0495644_0043075 | 3300046523 | Bacteria | 1699 |
| 457 | Ga0495666_0005800 | 3300046526 | Bacteria | 6224 |
| 458 | Ga0495665_0027299 | 3300046531 | Bacteria | 3064 |
| 459 | Ga0495665_0073872 | 3300046531 | Bacteria | 1795 |
| 460 | Ga0495640_0009468 | 3300046533 | Bacteria | 7588 |
| 461 | Ga0495640_0154240 | 3300046533 | Bacteria | 1474 |
| 462 | Ga0495586_0092976 | 3300046535 | Bacteria | 1667 |
| 463 | Ga0495587_0036279 | 3300046536 | Bacteria | 2966 |
| 464 | Ga0495621_0009482 | 3300046539 | Bacteria | 2956 |
| 465 | Ga0495645_0014321 | 3300046543 | Bacteria | 5624 |
| 466 | Ga0495622_0000920 | 3300046557 | Bacteria | 15926 |
| 467 | Ga0495633_0003249 | 3300046558 | Bacteria | 10952 |
| 468 | Ga0495667_0004508 | 3300046559 | Bacteria | 9402 |
| 469 | Ga0495656_0000538 | 3300046615 | Bacteria | 12366 |
| 470 | Ga0495656_0013509 | 3300046615 | Bacteria | 3041 |
| 471 | Ga0495634_0006288 | 3300046642 | Bacteria | 9046 |
| 472 | Ga0495634_0124748 | 3300046642 | Bacteria | 1646 |
| 473 | Ga0495661_0039583 | 3300046665 | Bacteria | 2929 |
| 474 | Ga0495588_0001344 | 3300046674 | Bacteria | 10506 |
| 475 | Ga0495588_0002190 | 3300046674 | Bacteria | 8363 |
| 476 | Ga0495599_0095121 | 3300046678 | Bacteria | 1858 |
| 477 | Ga0495646_0043669 | 3300046680 | Bacteria | 2743 |
| 478 | Ga0495647_0002287 | 3300046681 | Bacteria | 6009 |
| 479 | Ga0495647_0009258 | 3300046681 | Bacteria | 3331 |
| 480 | Ga0495658_0015537 | 3300046683 | Bacteria | 3906 |
| 481 | Ga0495658_0085068 | 3300046683 | Bacteria | 1863 |
| 482 | Ga0495613_0000818 | 3300046689 | Bacteria | 24094 |
| 483 | Ga0495613_0033916 | 3300046689 | Bacteria | 3791 |
| 484 | Ga0495624_0008042 | 3300046690 | Bacteria | 7386 |
| 485 | Ga0495624_0013504 | 3300046690 | Bacteria | 5568 |
| 486 | Ga0495670_0002388 | 3300046691 | Bacteria | 9251 |
| 487 | Ga0495649_0074482 | 3300046694 | Bacteria | 1819 |
| 488 | Ga0495589_0143780 | 3300046794 | Bacteria | 1141 |
| 489 | Ga0495600_0028724 | 3300046809 | Bacteria | 3599 |
| 490 | Ga0495581_0002568 | 3300047315 | Bacteria | 10314 |
| 491 | Ga0495604_0012078 | 3300047317 | Bacteria | 6867 |
| 492 | Ga0495636_0024479 | 3300047318 | Bacteria | 2449 |
| 493 | Ga0495674_0000209 | 3300047319 | Bacteria | 48240 |
| 494 | Ga0495674_0209410 | 3300047319 | Bacteria | 1615 |
| 495 | Ga0495676_0020836 | 3300047321 | Bacteria | 5743 |
| 496 | Ga0495676_0195687 | 3300047321 | Bacteria | 1408 |
| 497 | Ga0495673_0043900 | 3300047469 | Bacteria | 1997 |
| 498 | Ga0495684_0002373 | 3300047471 | Bacteria | 15050 |
| 499 | Ga0495684_0003076 | 3300047471 | Bacteria | 13112 |
| 500 | Ga0495684_0009099 | 3300047471 | Bacteria | 7672 |
| 501 | Ga0495593_0003392 | 3300047673 | Bacteria | 9541 |
| 502 | Ga0495593_0024206 | 3300047673 | Bacteria | 3367 |
| 503 | Ga0495614_0015281 | 3300048089 | Bacteria | 3347 |
| 504 | Ga0496100_0027864 | 3300048903 | Bacteria | 3477 |
| 505 | Ga0496100_0115464 | 3300048903 | Bacteria | 1872 |
| 506 | Ga0496101_0003051 | 3300048904 | Bacteria | 10335 |
| 507 | Ga0496101_0029223 | 3300048904 | Bacteria | 3855 |
| 508 | Ga0496101_0084065 | 3300048904 | Bacteria | 2357 |
| 509 | Ga0496102_0026327 | 3300048905 | Bacteria | 5186 |
| 510 | Ga0496102_0039066 | 3300048905 | Bacteria | 4286 |
| 511 | Ga0496102_0149761 | 3300048905 | Bacteria | 2192 |
| 512 | Ga0496102_0472128 | 3300048905 | Bacteria | 1175 |
| 513 | Ga0496103_0016875 | 3300048906 | Bacteria | 4360 |
| 514 | Ga0496103_0077622 | 3300048906 | Bacteria | 2085 |
| 515 | Ga0496103_0169762 | 3300048906 | Bacteria | 1401 |
| 516 | Ga0496104_0005722 | 3300048907 | Bacteria | 10879 |
| 517 | Ga0496104_0030057 | 3300048907 | Bacteria | 5045 |
| 518 | Ga0496104_0050836 | 3300048907 | Bacteria | 3911 |
| 519 | Ga0496104_0118063 | 3300048907 | Bacteria | 2546 |
| 520 | Ga0496104_0221501 | 3300048907 | Bacteria | 1804 |
| 521 | Ga0496105_0012770 | 3300048908 | Bacteria | 6653 |
| 522 | Ga0496105_0014052 | 3300048908 | Bacteria | 6370 |
| 523 | Ga0496105_0148154 | 3300048908 | Bacteria | 1930 |
| 524 | Ga0496106_0023465 | 3300048909 | Bacteria | 4583 |
| 525 | Ga0496106_0033436 | 3300048909 | Bacteria | 3836 |
| 526 | Ga0496106_0054544 | 3300048909 | Bacteria | 3020 |
| 527 | Ga0496107_0014875 | 3300048910 | Bacteria | 5449 |
| 528 | Ga0496107_0018774 | 3300048910 | Bacteria | 4872 |
| 529 | Ga0496107_0036689 | 3300048910 | Bacteria | 3516 |
| 530 | Ga0496107_0048501 | 3300048910 | Bacteria | 3059 |
| 531 | Ga0496107_0090042 | 3300048910 | Bacteria | 2241 |
| 532 | Ga0496107_0196165 | 3300048910 | Bacteria | 1500 |
| 533 | Ga0496108_0021693 | 3300048911 | Bacteria | 5279 |
| 534 | Ga0496108_0202542 | 3300048911 | Bacteria | 1722 |
| 535 | Ga0496108_0215572 | 3300048911 | Bacteria | 1667 |
| 536 | Ga0496108_0430428 | 3300048911 | Bacteria | 1152 |
| 537 | Ga0496108_0439344 | 3300048911 | Bacteria | 1140 |
| 538 | Ga0496109_0035964 | 3300048912 | Bacteria | 4470 |
| 539 | Ga0496109_0041180 | 3300048912 | Bacteria | 4185 |
| 540 | Ga0496109_0049798 | 3300048912 | Bacteria | 3815 |
| 541 | Ga0496109_0133005 | 3300048912 | Bacteria | 2323 |
| 542 | Ga0496109_0238586 | 3300048912 | Bacteria | 1711 |
| 543 | Ga0496110_0017894 | 3300048913 | Bacteria | 5933 |
| 544 | Ga0496110_0047849 | 3300048913 | Bacteria | 3746 |
| 545 | Ga0496110_0233701 | 3300048913 | Bacteria | 1672 |
| 546 | Ga0496111_0014031 | 3300048914 | Bacteria | 5465 |
| 547 | Ga0496111_0128705 | 3300048914 | Bacteria | 1872 |
| 548 | Ga0496112_0003536 | 3300048915 | Bacteria | 12967 |
| 549 | Ga0496112_0013959 | 3300048915 | Bacteria | 7433 |
| 550 | Ga0496112_0085671 | 3300048915 | Bacteria | 3117 |
| 551 | Ga0496113_0015547 | 3300048916 | Bacteria | 5235 |
| 552 | Ga0496113_0063345 | 3300048916 | Bacteria | 2794 |
| 553 | Ga0496113_0132943 | 3300048916 | Bacteria | 1953 |
| 554 | Ga0496114_0011742 | 3300048917 | Bacteria | 7006 |
| 555 | Ga0496114_0014599 | 3300048917 | Bacteria | 6310 |
| 556 | Ga0496114_0018780 | 3300048917 | Bacteria | 5595 |
| 557 | Ga0496114_0025447 | 3300048917 | Bacteria | 4838 |
| 558 | Ga0496114_0063446 | 3300048917 | Bacteria | 3093 |
| 559 | Ga0496115_0004532 | 3300048918 | Bacteria | 10050 |
| 560 | Ga0496115_0007837 | 3300048918 | Bacteria | 7874 |
| 561 | Ga0496117_0001320 | 3300048920 | Bacteria | 36466 |
| 562 | Ga0496118_0167398 | 3300048921 | Bacteria | 1348 |
| 563 | Ga0501031_0030985 | 3300049568 | Bacteria | 3489 |
| 564 | Ga0501031_0032572 | 3300049568 | Bacteria | 3398 |
| 565 | Ga0501031_0037770 | 3300049568 | Bacteria | 3152 |
| 566 | Ga0501031_0066112 | 3300049568 | Bacteria | 2356 |
| 567 | Ga0501031_0267329 | 3300049568 | Bacteria | 1111 |
| 568 | Ga0501032_0037553 | 3300049569 | Bacteria | 3302 |
| 569 | Ga0501032_0050135 | 3300049569 | Bacteria | 2815 |
| 570 | Ga0501032_0060859 | 3300049569 | Bacteria | 2532 |
| 571 | Ga0501032_0134508 | 3300049569 | Bacteria | 1630 |
| 572 | Ga0501032_0154909 | 3300049569 | Bacteria | 1506 |
| 573 | Ga0501033_0001956 | 3300049570 | Bacteria | 17932 |
| 574 | Ga0501033_0041454 | 3300049570 | Bacteria | 3435 |
| 575 | Ga0501033_0103729 | 3300049570 | Bacteria | 2073 |
| 576 | Ga0501033_0119762 | 3300049570 | Bacteria | 1911 |
| 577 | Ga0501033_0218645 | 3300049570 | Bacteria | 1356 |
| 578 | Ga0501034_0012317 | 3300049571 | Bacteria | 8835 |
| 579 | Ga0501034_0060416 | 3300049571 | Bacteria | 3806 |
| 580 | Ga0501034_0102117 | 3300049571 | Bacteria | 2861 |
| 581 | Ga0501034_0264000 | 3300049571 | Bacteria | 1664 |
| 582 | Ga0501034_0434288 | 3300049571 | Bacteria | 1232 |
| 583 | Ga0501036_0023367 | 3300049572 | Bacteria | 5207 |
| 584 | Ga0501036_0033890 | 3300049572 | Bacteria | 4319 |
| 585 | Ga0501036_0041532 | 3300049572 | Bacteria | 3890 |
| 586 | Ga0501036_0238203 | 3300049572 | Bacteria | 1526 |
| 587 | Ga0501036_0433179 | 3300049572 | Bacteria | 1096 |
| 588 | Ga0501037_0000505 | 3300049573 | Bacteria | 31438 |
| 589 | Ga0501037_0071665 | 3300049573 | Bacteria | 2520 |
| 590 | Ga0501037_0100717 | 3300049573 | Bacteria | 2086 |
| 591 | Ga0501038_0006501 | 3300049574 | Bacteria | 10816 |
| 592 | Ga0501038_0042838 | 3300049574 | Bacteria | 3941 |
| 593 | Ga0501038_0166790 | 3300049574 | Bacteria | 1786 |
| 594 | Ga0501038_0278022 | 3300049574 | Bacteria | 1319 |
| 595 | Ga0501039_0018886 | 3300049575 | Bacteria | 5293 |
| 596 | Ga0501039_0035125 | 3300049575 | Bacteria | 3868 |
| 597 | Ga0501039_0050030 | 3300049575 | Bacteria | 3232 |
| 598 | Ga0501039_0050488 | 3300049575 | Bacteria | 3218 |
| 599 | Ga0501039_0055204 | 3300049575 | Bacteria | 3075 |
| 600 | Ga0501039_0246646 | 3300049575 | Bacteria | 1404 |
| 601 | Ga0501040_0019021 | 3300049576 | Bacteria | 4564 |
| 602 | Ga0501040_0054327 | 3300049576 | Bacteria | 2746 |
| 603 | Ga0501040_0069979 | 3300049576 | Bacteria | 2421 |
| 604 | Ga0501040_0365530 | 3300049576 | Bacteria | 1034 |
| 605 | Ga0501041_0011323 | 3300049577 | Bacteria | 5271 |
| 606 | Ga0501041_0022453 | 3300049577 | Bacteria | 3778 |
| 607 | Ga0501041_0053028 | 3300049577 | Bacteria | 2473 |
| 608 | Ga0501041_0083261 | 3300049577 | Bacteria | 1972 |
| 609 | Ga0501041_0087204 | 3300049577 | Bacteria | 1926 |
| 610 | Ga0501042_0017882 | 3300049578 | Bacteria | 4898 |
| 611 | Ga0501042_0039929 | 3300049578 | Bacteria | 3336 |
| 612 | Ga0501042_0056561 | 3300049578 | Bacteria | 2799 |
| 613 | Ga0501042_0087879 | 3300049578 | Bacteria | 2230 |
| 614 | Ga0501042_0107026 | 3300049578 | Bacteria | 2013 |
| 615 | Ga0501042_0175799 | 3300049578 | Bacteria | 1544 |
| 616 | Ga0501042_0241409 | 3300049578 | Bacteria | 1304 |
| 617 | Ga0501043_0029259 | 3300049579 | Bacteria | 4326 |
| 618 | Ga0501043_0053301 | 3300049579 | Bacteria | 3176 |
| 619 | Ga0501043_0061995 | 3300049579 | Bacteria | 2936 |
| 620 | Ga0501043_0173619 | 3300049579 | Bacteria | 1681 |
| 621 | Ga0501046_0030619 | 3300049580 | Bacteria | 4366 |
| 622 | Ga0501046_0051777 | 3300049580 | Bacteria | 3239 |
| 623 | Ga0501046_0064791 | 3300049580 | Bacteria | 2852 |
| 624 | Ga0501046_0094208 | 3300049580 | Bacteria | 2301 |
| 625 | Ga0501046_0176533 | 3300049580 | Bacteria | 1600 |
| 626 | Ga0501047_0029059 | 3300049581 | Bacteria | 5332 |
| 627 | Ga0501047_0076477 | 3300049581 | Bacteria | 3221 |
| 628 | Ga0501047_0126178 | 3300049581 | Bacteria | 2439 |
| 629 | Ga0501048_0026181 | 3300049582 | Bacteria | 4246 |
| 630 | Ga0501048_0034825 | 3300049582 | Bacteria | 3629 |
| 631 | Ga0501048_0064062 | 3300049582 | Bacteria | 2600 |
| 632 | Ga0501048_0136010 | 3300049582 | Bacteria | 1737 |
| 633 | Ga0501048_0148190 | 3300049582 | Bacteria | 1659 |
| 634 | Ga0501048_0238124 | 3300049582 | Bacteria | 1291 |
| 635 | Ga0501067_0085477 | 3300049583 | Bacteria | 1750 |
| 636 | Ga0501068_0013109 | 3300049584 | Bacteria | 4712 |
| 637 | Ga0501068_0034779 | 3300049584 | Bacteria | 3006 |
| 638 | Ga0501068_0044180 | 3300049584 | Bacteria | 2682 |
| 639 | Ga0501068_0054184 | 3300049584 | Bacteria | 2429 |
| 640 | Ga0501068_0227180 | 3300049584 | Bacteria | 1187 |
| 641 | Ga0501069_0063574 | 3300049585 | Bacteria | 2061 |
| 642 | Ga0501069_0070010 | 3300049585 | Bacteria | 1965 |
| 643 | Ga0501070_0007975 | 3300049586 | Bacteria | 8970 |
| 644 | Ga0501070_0032521 | 3300049586 | Bacteria | 4366 |
| 645 | Ga0501070_0054634 | 3300049586 | Bacteria | 3311 |
| 646 | Ga0501071_0011812 | 3300049587 | Bacteria | 5893 |
| 647 | Ga0501071_0125279 | 3300049587 | Bacteria | 1906 |
| 648 | Ga0501071_0158670 | 3300049587 | Bacteria | 1690 |
| 649 | Ga0501071_0202563 | 3300049587 | Bacteria | 1491 |
| 650 | Ga0501071_0370505 | 3300049587 | Bacteria | 1091 |
| 651 | Ga0501072_0018777 | 3300049588 | Bacteria | 5332 |
| 652 | Ga0501072_0031428 | 3300049588 | Bacteria | 4157 |
| 653 | Ga0501072_0033228 | 3300049588 | Bacteria | 4042 |
| 654 | Ga0501072_0058644 | 3300049588 | Bacteria | 3034 |
| 655 | Ga0501072_0074870 | 3300049588 | Bacteria | 2677 |
| 656 | Ga0501072_0092065 | 3300049588 | Bacteria | 2407 |
| 657 | Ga0501072_0164154 | 3300049588 | Bacteria | 1772 |
| 658 | Ga0501073_0034730 | 3300049589 | Bacteria | 3587 |
| 659 | Ga0501073_0047412 | 3300049589 | Bacteria | 3020 |
| 660 | Ga0501073_0173702 | 3300049589 | Bacteria | 1492 |
| 661 | Ga0501074_0005361 | 3300049590 | Bacteria | 9222 |
| 662 | Ga0501074_0006129 | 3300049590 | Bacteria | 8684 |
| 663 | Ga0501074_0014482 | 3300049590 | Bacteria | 5738 |
| 664 | Ga0501074_0027814 | 3300049590 | Bacteria | 4100 |
| 665 | Ga0501074_0036341 | 3300049590 | Bacteria | 3568 |
| 666 | Ga0501074_0212053 | 3300049590 | Bacteria | 1380 |
| 667 | Ga0501075_0014112 | 3300049591 | Bacteria | 5722 |
| 668 | Ga0501075_0021030 | 3300049591 | Bacteria | 4754 |
| 669 | Ga0501075_0081325 | 3300049591 | Bacteria | 2452 |
| 670 | Ga0501075_0099884 | 3300049591 | Bacteria | 2204 |
| 671 | Ga0501075_0141760 | 3300049591 | Bacteria | 1832 |
| 672 | Ga0501075_0179888 | 3300049591 | Bacteria | 1613 |
| 673 | Ga0501076_0005491 | 3300049592 | Bacteria | 9131 |
| 674 | Ga0501076_0036967 | 3300049592 | Bacteria | 3827 |
| 675 | Ga0501076_0037909 | 3300049592 | Bacteria | 3782 |
| 676 | Ga0501076_0086664 | 3300049592 | Bacteria | 2517 |
| 677 | Ga0501076_0128327 | 3300049592 | Bacteria | 2056 |
| 678 | Ga0501076_0172551 | 3300049592 | Bacteria | 1763 |
| 679 | Ga0501077_0007434 | 3300049593 | Bacteria | 6758 |
| 680 | Ga0501077_0035201 | 3300049593 | Bacteria | 3187 |
| 681 | Ga0501077_0049569 | 3300049593 | Bacteria | 2668 |
| 682 | Ga0501079_0015639 | 3300049741 | Bacteria | 5795 |
| 683 | Ga0501079_0029595 | 3300049741 | Bacteria | 4205 |
| 684 | Ga0501079_0066283 | 3300049741 | Bacteria | 2786 |
| 685 | Ga0501079_0096015 | 3300049741 | Bacteria | 2298 |
| 686 | Ga0501079_0331755 | 3300049741 | Bacteria | 1191 |
| 687 | Ga0501080_0038730 | 3300049742 | Bacteria | 4450 |
| 688 | Ga0501080_0040549 | 3300049742 | Bacteria | 4342 |
| 689 | Ga0501080_0068732 | 3300049742 | Bacteria | 3295 |
| 690 | Ga0501080_0078421 | 3300049742 | Bacteria | 3072 |
| 691 | Ga0501080_0111323 | 3300049742 | Bacteria | 2538 |
| 692 | Ga0501080_0162575 | 3300049742 | Bacteria | 2061 |
| 693 | Ga0501080_0171255 | 3300049742 | Bacteria | 2002 |
| 694 | Ga0501080_0250735 | 3300049742 | Bacteria | 1614 |
| 695 | Ga0501080_0443156 | 3300049742 | Bacteria | 1165 |
| 696 | Ga0501081_0013258 | 3300049743 | Bacteria | 5421 |
| 697 | Ga0501081_0034250 | 3300049743 | Bacteria | 3455 |
| 698 | Ga0501081_0039930 | 3300049743 | Bacteria | 3213 |
| 699 | Ga0501081_0051414 | 3300049743 | Bacteria | 2842 |
| 700 | Ga0501081_0074663 | 3300049743 | Bacteria | 2366 |
| 701 | Ga0501081_0154902 | 3300049743 | Bacteria | 1648 |
| 702 | Ga0501081_0169781 | 3300049743 | Bacteria | 1574 |
| 703 | Ga0501083_0019073 | 3300049744 | Bacteria | 4776 |
| 704 | Ga0501083_0053537 | 3300049744 | Bacteria | 2709 |
| 705 | Ga0501083_0123486 | 3300049744 | Bacteria | 1698 |
| 706 | Ga0501083_0125939 | 3300049744 | Bacteria | 1679 |
| 707 | Ga0501083_0143303 | 3300049744 | Bacteria | 1564 |
| 708 | Ga0501083_0161522 | 3300049744 | Bacteria | 1466 |
| 709 | Ga0501035_0005152 | 3300049822 | Bacteria | 12360 |
| 710 | Ga0501035_0059715 | 3300049822 | Bacteria | 3396 |
| 711 | Ga0501035_0081968 | 3300049822 | Bacteria | 2847 |
| 712 | Ga0501035_0091071 | 3300049822 | Bacteria | 2684 |
| 713 | Ga0501035_0099632 | 3300049822 | Bacteria | 2551 |
| 714 | Ga0501035_0104063 | 3300049822 | Bacteria | 2489 |
| 715 | Ga0501035_0114014 | 3300049822 | Bacteria | 2368 |
| 716 | Ga0501035_0152089 | 3300049822 | Bacteria | 2008 |
| 717 | Ga0501044_0093651 | 3300049823 | Bacteria | 3029 |
| 718 | Ga0501044_0147725 | 3300049823 | Bacteria | 2334 |
| 719 | Ga0501044_0155713 | 3300049823 | Bacteria | 2264 |
| 720 | Ga0501044_0203679 | 3300049823 | Bacteria | 1936 |
| 721 | Ga0501044_0247095 | 3300049823 | Bacteria | 1727 |
| 722 | Ga0501045_0005186 | 3300049824 | Bacteria | 9007 |
| 723 | Ga0501045_0018625 | 3300049824 | Bacteria | 4941 |
| 724 | Ga0501045_0030041 | 3300049824 | Bacteria | 3931 |
| 725 | Ga0501045_0106955 | 3300049824 | Bacteria | 2073 |
| 726 | Ga0501045_0180192 | 3300049824 | Bacteria | 1574 |
| 727 | nmdc:mga03n38_80889_c1 | 3300050490 | Bacteria | 1526 |
| 728 | nmdc:mga00v17_147061_c1 | 3300050491 | Bacteria | 1513 |
| 729 | nmdc:mga06z11_99650_c1 | 3300050494 | Bacteria | 1592 |
| 730 | nmdc:mga05p37_420053_c1 | 3300050507 | Bacteria | 1556 |
| 731 | nmdc:mga05p37_65041_c1 | 3300050507 | Bacteria | 4488 |
| 732 | nmdc:mga0qj67_132584_c1 | 3300050509 | Bacteria | 2018 |
| 733 | nmdc:mga0qj67_157229_c1 | 3300050509 | Bacteria | 1845 |
| 734 | nmdc:mga0qj67_2103_c1 | 3300050509 | Bacteria | 14183 |
| 735 | nmdc:mga0qj67_99301_c1 | 3300050509 | Bacteria | 2345 |
| 736 | nmdc:mga06r32_74289_c1 | 3300050510 | Bacteria | 3296 |
| 737 | nmdc:mga08y16_278027_c1 | 3300050511 | Bacteria | 1727 |
| 738 | nmdc:mga08y16_384401_c1 | 3300050511 | Bacteria | 1438 |
| 739 | nmdc:mga08y16_529365_c1 | 3300050511 | Bacteria | 1195 |
| 740 | nmdc:mga0n895_149393_c1 | 3300050512 | Bacteria | 2366 |
| 741 | nmdc:mga0n895_226025_c1 | 3300050512 | Bacteria | 1900 |
| 742 | nmdc:mga0n895_295773_c1 | 3300050512 | Bacteria | 1641 |
| 743 | nmdc:mga0rr50_17468_c1 | 3300050513 | Bacteria | 4792 |
| 744 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 745 | nmdc:mga0a205_72477_c1 | 3300050515 | Bacteria | 3328 |
| 746 | Ga0495601_0087873 | 3300053077 | Bacteria | 1998 |
| 747 | Ga0495612_0000174 | 3300053078 | Bacteria | 27107 |
| 748 | Ga0495612_0014780 | 3300053078 | Bacteria | 3132 |
| 749 | Ga0495655_0013726 | 3300053083 | Bacteria | 1682 |
| 750 | Ga0495595_0006151 | 3300053084 | Bacteria | 4880 |
| 751 | Ga0495595_0040868 | 3300053084 | Bacteria | 2120 |
| 752 | Ga0495619_0001077 | 3300053085 | Bacteria | 17905 |
| 753 | Ga0495619_0013003 | 3300053085 | Bacteria | 5243 |
| 754 | Ga0495619_0025301 | 3300053085 | Bacteria | 3811 |
| 755 | Ga0495619_0033668 | 3300053085 | Bacteria | 3328 |
| 756 | Ga0500597_080414 | 3300053120 | Bacteria | 1414 |
| 757 | Ga0500559_0011662 | 3300053136 | Bacteria | 3750 |
| 758 | Ga0500616_0000139 | 3300053153 | Bacteria | 123841 |
| 759 | Ga0500639_065658 | 3300053163 | Bacteria | 1861 |
| 760 | Ga0501084_0035441 | 3300054114 | Bacteria | 4171 |
| 761 | Ga0501084_0040029 | 3300054114 | Bacteria | 3920 |
| 762 | Ga0501084_0048951 | 3300054114 | Bacteria | 3538 |
| 763 | Ga0501084_0112004 | 3300054114 | Bacteria | 2293 |
| 764 | Ga0501082_0004740 | 3300060353 | Bacteria | 11863 |
| 765 | Ga0501082_0007926 | 3300060353 | Bacteria | 9175 |
| 766 | Ga0501082_0008215 | 3300060353 | Bacteria | 9004 |
| 767 | Ga0501082_0031797 | 3300060353 | Bacteria | 4551 |
| 768 | Ga0501082_0058326 | 3300060353 | Bacteria | 3326 |
| 769 | Ga0530510_0001990 | 3300061734 | Bacteria | 14008 |
| 770 | Ga0530510_0006461 | 3300061734 | Bacteria | 8163 |
| 771 | Ga0530510_0013414 | 3300061734 | Bacteria | 5762 |
| 772 | Ga0530510_0022809 | 3300061734 | Bacteria | 4460 |
| 773 | Ga0530510_0027933 | 3300061734 | Bacteria | 4044 |
| 774 | Ga0530510_0055856 | 3300061734 | Bacteria | 2852 |
| 775 | Ga0530510_0069943 | 3300061734 | Bacteria | 2547 |
| 776 | Ga0530510_0164619 | 3300061734 | Bacteria | 1641 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0041454 | Ga0501033_0041454_29_925 | 278 |
| 2 | 3300005466 | Ga0070685_10066453 | Ga0070685_100664533 | 286 |
| 3 | 3300049578 | Ga0501042_0175799 | Ga0501042_0175799_599_1528 | 309 |
| 4 | 3300005355 | Ga0070671_100258462 | Ga0070671_1002584622 | 310 |
| 5 | 3300005718 | Ga0068866_10026304 | Ga0068866_100263043 | 311 |
| 6 | 3300005578 | Ga0068854_100131751 | Ga0068854_1001317512 | 313 |
| 7 | 3300049587 | Ga0501071_0370505 | Ga0501071_0370505_134_1075 | 313 |
| 8 | 3300025981 | Ga0207640_10220836 | Ga0207640_102208362 | 314 |
| 9 | 3300048911 | Ga0496108_0430428 | Ga0496108_0430428_25_1035 | 314 |
| 10 | 3300049824 | Ga0501045_0106955 | Ga0501045_0106955_310_1371 | 317 |
| 11 | 3300006880 | Ga0075429_100183266 | Ga0075429_1001832661 | 320 |
| 12 | 3300049570 | Ga0501033_0218645 | Ga0501033_0218645_340_1344 | 320 |
| 13 | 3300050509 | nmdc:mga0qj67_99301_c1 | nmdc:mga0qj67_99301_c1_318_1379 | 320 |
| 14 | 3300025929 | Ga0207664_10161692 | Ga0207664_101616922 | 322 |
| 15 | 3300049571 | Ga0501034_0264000 | Ga0501034_0264000_31_1059 | 322 |
| 16 | 3300048911 | Ga0496108_0439344 | Ga0496108_0439344_23_1015 | 323 |
| 17 | 3300048915 | Ga0496112_0085671 | Ga0496112_0085671_185_1228 | 325 |
| 18 | 3300048916 | Ga0496113_0132943 | Ga0496113_0132943_216_1259 | 325 |
| 19 | 3300049589 | Ga0501073_0173702 | Ga0501073_0173702_176_1246 | 325 |
| 20 | 3300050494 | nmdc:mga06z11_99650_c1 | nmdc:mga06z11_99650_c1_17_1021 | 325 |
| 21 | 3300025916 | Ga0207663_10060610 | Ga0207663_100606102 | 326 |
| 22 | 3300049576 | Ga0501040_0365530 | Ga0501040_0365530_13_1020 | 326 |
| 23 | 3300049742 | Ga0501080_0171255 | Ga0501080_0171255_19_1041 | 326 |
| 24 | 3300005295 | Ga0065707_10139160 | Ga0065707_101391603 | 327 |
| 25 | 3300046794 | Ga0495589_0143780 | Ga0495589_0143780_78_1112 | 327 |
| 26 | 3300049568 | Ga0501031_0030985 | Ga0501031_0030985_1008_2069 | 327 |
| 27 | 3300049570 | Ga0501033_0001956 | Ga0501033_0001956_503_1564 | 327 |
| 28 | 3300049572 | Ga0501036_0238203 | Ga0501036_0238203_176_1237 | 327 |
| 29 | 3300049573 | Ga0501037_0000505 | Ga0501037_0000505_21535_22596 | 327 |
| 30 | 3300049575 | Ga0501039_0018886 | Ga0501039_0018886_3074_4135 | 327 |
| 31 | 3300049575 | Ga0501039_0035125 | Ga0501039_0035125_1976_3037 | 327 |
| 32 | 3300049578 | Ga0501042_0056561 | Ga0501042_0056561_612_1673 | 327 |
| 33 | 3300049580 | Ga0501046_0030619 | Ga0501046_0030619_3236_4297 | 327 |
| 34 | 3300049584 | Ga0501068_0227180 | Ga0501068_0227180_44_1105 | 327 |
| 35 | 3300006048 | Ga0075363_100057433 | Ga0075363_1000574332 | 328 |
| 36 | 3300006178 | Ga0075367_10098687 | Ga0075367_100986872 | 328 |
| 37 | 3300025912 | Ga0207707_10141873 | Ga0207707_101418732 | 328 |
| 38 | 3300025917 | Ga0207660_10102686 | Ga0207660_101026862 | 328 |
| 39 | 3300049575 | Ga0501039_0246646 | Ga0501039_0246646_13_999 | 328 |
| 40 | 3300050490 | nmdc:mga03n38_80889_c1 | nmdc:mga03n38_80889_c1_11_1021 | 328 |
| 41 | 3300050507 | nmdc:mga05p37_420053_c1 | nmdc:mga05p37_420053_c1_10_996 | 328 |
| 42 | 3300050511 | nmdc:mga08y16_384401_c1 | nmdc:mga08y16_384401_c1_347_1408 | 329 |
| 43 | 3300039447 | Ga0436361_0812703 | Ga0436361_0812703_2345_3406 | 331 |
| 44 | 3300034818 | Ga0373950_0014965 | Ga0373950_0014965_98_1156 | 332 |
| 45 | 3300049578 | Ga0501042_0241409 | Ga0501042_0241409_14_1039 | 332 |
| 46 | 3300005331 | Ga0070670_100210252 | Ga0070670_1002102521 | 333 |
| 47 | 3300005435 | Ga0070714_100178911 | Ga0070714_1001789112 | 333 |
| 48 | 3300009148 | Ga0105243_10049735 | Ga0105243_100497352 | 333 |
| 49 | 3300046531 | Ga0495665_0027299 | Ga0495665_0027299_2022_3050 | 333 |
| 50 | 3300047673 | Ga0495593_0024206 | Ga0495593_0024206_2325_3353 | 333 |
| 51 | 3300049568 | Ga0501031_0066112 | Ga0501031_0066112_359_1420 | 333 |
| 52 | 3300049571 | Ga0501034_0102117 | Ga0501034_0102117_987_2048 | 333 |
| 53 | 3300049581 | Ga0501047_0029059 | Ga0501047_0029059_1798_2859 | 333 |
| 54 | 3300049822 | Ga0501035_0059715 | Ga0501035_0059715_325_1386 | 333 |
| 55 | 3300049823 | Ga0501044_0093651 | Ga0501044_0093651_1089_2150 | 333 |
| 56 | 3300053078 | Ga0495612_0014780 | Ga0495612_0014780_2075_3103 | 333 |
| 57 | 3300053153 | Ga0500616_0000139 | Ga0500616_0000139_15773_16834 | 333 |
| 58 | 3300021361 | Ga0213872_10063049 | Ga0213872_100630492 | 334 |
| 59 | 3300049569 | Ga0501032_0060859 | Ga0501032_0060859_946_1992 | 334 |
| 60 | 3300049571 | Ga0501034_0060416 | Ga0501034_0060416_879_1925 | 334 |
| 61 | 3300049572 | Ga0501036_0033890 | Ga0501036_0033890_1135_2181 | 334 |
| 62 | 3300049575 | Ga0501039_0055204 | Ga0501039_0055204_541_1587 | 334 |
| 63 | 3300049578 | Ga0501042_0017882 | Ga0501042_0017882_1557_2603 | 334 |
| 64 | 3300049581 | Ga0501047_0076477 | Ga0501047_0076477_1635_2681 | 334 |
| 65 | 3300049581 | Ga0501047_0126178 | Ga0501047_0126178_538_1584 | 334 |
| 66 | 3300049582 | Ga0501048_0026181 | Ga0501048_0026181_2294_3340 | 334 |
| 67 | 3300049584 | Ga0501068_0054184 | Ga0501068_0054184_116_1162 | 334 |
| 68 | 3300049823 | Ga0501044_0147725 | Ga0501044_0147725_413_1459 | 334 |
| 69 | iso_pu_bacteria | 2917554339 | 2917557128 | 334 |
| 70 | 3300005344 | Ga0070661_100001914 | Ga0070661_10000191410 | 335 |
| 71 | 3300005367 | Ga0070667_100075587 | Ga0070667_1000755874 | 335 |
| 72 | 3300025986 | Ga0207658_10038002 | Ga0207658_100380024 | 335 |
| 73 | 3300032004 | Ga0307414_10089205 | Ga0307414_100892052 | 335 |
| 74 | 3300048920 | Ga0496117_0001320 | Ga0496117_0001320_9821_10849 | 335 |
| 75 | 3300049744 | Ga0501083_0125939 | Ga0501083_0125939_242_1288 | 335 |
| 76 | 3300005455 | Ga0070663_100037125 | Ga0070663_1000371252 | 336 |
| 77 | 3300005456 | Ga0070678_100043104 | Ga0070678_1000431043 | 336 |
| 78 | 3300005548 | Ga0070665_100150045 | Ga0070665_1001500452 | 336 |
| 79 | 3300005617 | Ga0068859_100410189 | Ga0068859_1004101892 | 336 |
| 80 | 3300005842 | Ga0068858_100091252 | Ga0068858_1000912522 | 336 |
| 81 | 3300005843 | Ga0068860_100150002 | Ga0068860_1001500022 | 336 |
| 82 | 3300005937 | Ga0081455_10003665 | Ga0081455_1000366512 | 336 |
| 83 | 3300006852 | Ga0075433_10216752 | Ga0075433_102167522 | 336 |
| 84 | 3300006881 | Ga0068865_100248784 | Ga0068865_1002487842 | 336 |
| 85 | 3300006931 | Ga0097620_100410197 | Ga0097620_1004101972 | 336 |
| 86 | 3300025899 | Ga0207642_10020933 | Ga0207642_100209332 | 336 |
| 87 | 3300025911 | Ga0207654_10201013 | Ga0207654_102010131 | 336 |
| 88 | 3300025926 | Ga0207659_10097275 | Ga0207659_100972752 | 336 |
| 89 | 3300025938 | Ga0207704_10107706 | Ga0207704_101077062 | 336 |
| 90 | 3300025942 | Ga0207689_10097582 | Ga0207689_100975821 | 336 |
| 91 | 3300025960 | Ga0207651_10255496 | Ga0207651_102554962 | 336 |
| 92 | 3300025972 | Ga0207668_10073880 | Ga0207668_100738802 | 336 |
| 93 | 3300025981 | Ga0207640_10221049 | Ga0207640_102210492 | 336 |
| 94 | 3300026067 | Ga0207678_10109186 | Ga0207678_101091863 | 336 |
| 95 | 3300026075 | Ga0207708_10068483 | Ga0207708_100684832 | 336 |
| 96 | 3300026078 | Ga0207702_10078916 | Ga0207702_100789162 | 336 |
| 97 | 3300026089 | Ga0207648_10286929 | Ga0207648_102869291 | 336 |
| 98 | 3300026121 | Ga0207683_10169309 | Ga0207683_101693092 | 336 |
| 99 | 3300028379 | Ga0268266_10127592 | Ga0268266_101275922 | 336 |
| 100 | 3300028381 | Ga0268264_10177182 | Ga0268264_101771822 | 336 |
| 101 | 3300048905 | Ga0496102_0472128 | Ga0496102_0472128_19_1029 | 336 |
| 102 | 3300049592 | Ga0501076_0172551 | Ga0501076_0172551_27_1037 | 336 |
| 103 | 3300049823 | Ga0501044_0247095 | Ga0501044_0247095_698_1708 | 336 |
| 104 | 3300053085 | Ga0495619_0033668 | Ga0495619_0033668_2120_3130 | 336 |
| 105 | 3300061734 | Ga0530510_0164619 | Ga0530510_0164619_20_1030 | 336 |
| 106 | 3300005341 | Ga0070691_10019890 | Ga0070691_100198902 | 338 |
| 107 | 3300005347 | Ga0070668_100045066 | Ga0070668_1000450664 | 338 |
| 108 | 3300005356 | Ga0070674_100004678 | Ga0070674_1000046787 | 338 |
| 109 | 3300005459 | Ga0068867_100062386 | Ga0068867_1000623862 | 338 |
| 110 | 3300005617 | Ga0068859_100120910 | Ga0068859_1001209103 | 338 |
| 111 | 3300005719 | Ga0068861_100009658 | Ga0068861_1000096584 | 338 |
| 112 | 3300005840 | Ga0068870_10126204 | Ga0068870_101262042 | 338 |
| 113 | 3300005843 | Ga0068860_100097405 | Ga0068860_1000974052 | 338 |
| 114 | 3300005844 | Ga0068862_100031093 | Ga0068862_1000310932 | 338 |
| 115 | 3300006881 | Ga0068865_100059567 | Ga0068865_1000595672 | 338 |
| 116 | 3300006931 | Ga0097620_100120911 | Ga0097620_1001209113 | 338 |
| 117 | 3300009148 | Ga0105243_10133840 | Ga0105243_101338402 | 338 |
| 118 | 3300009553 | Ga0105249_10015186 | Ga0105249_100151864 | 338 |
| 119 | 3300013308 | Ga0157375_10075444 | Ga0157375_100754444 | 338 |
| 120 | 3300014969 | Ga0157376_10039678 | Ga0157376_100396785 | 338 |
| 121 | 3300017792 | Ga0163161_10019421 | Ga0163161_100194214 | 338 |
| 122 | 3300025935 | Ga0207709_10099567 | Ga0207709_100995672 | 338 |
| 123 | 3300025937 | Ga0207669_10040852 | Ga0207669_100408522 | 338 |
| 124 | 3300025938 | Ga0207704_10055882 | Ga0207704_100558822 | 338 |
| 125 | 3300025961 | Ga0207712_10020564 | Ga0207712_100205643 | 338 |
| 126 | 3300025972 | Ga0207668_10043366 | Ga0207668_100433662 | 338 |
| 127 | 3300026089 | Ga0207648_10234542 | Ga0207648_102345422 | 338 |
| 128 | 3300026118 | Ga0207675_100017442 | Ga0207675_1000174424 | 338 |
| 129 | 3300028380 | Ga0268265_10012963 | Ga0268265_100129634 | 338 |
| 130 | 3300048903 | Ga0496100_0115464 | Ga0496100_0115464_194_1261 | 338 |
| 131 | 3300048904 | Ga0496101_0029223 | Ga0496101_0029223_846_1913 | 338 |
| 132 | 3300048906 | Ga0496103_0169762 | Ga0496103_0169762_291_1358 | 338 |
| 133 | 3300048907 | Ga0496104_0050836 | Ga0496104_0050836_1824_2891 | 338 |
| 134 | 3300048910 | Ga0496107_0014875 | Ga0496107_0014875_2413_3480 | 338 |
| 135 | 3300048917 | Ga0496114_0025447 | Ga0496114_0025447_2300_3367 | 338 |
| 136 | iso_pu_bacteria | 2837651117 | 2837652705 | 338 |
| 137 | 3300005336 | Ga0070680_100138733 | Ga0070680_1001387332 | 339 |
| 138 | 3300049744 | Ga0501083_0161522 | Ga0501083_0161522_221_1282 | 339 |
| 139 | 3300009093 | Ga0105240_10212766 | Ga0105240_102127661 | 340 |
| 140 | 3300039437 | Ga0436365_0636722 | Ga0436365_0636722_410_1468 | 340 |
| 141 | 3300039450 | Ga0436363_0751359 | Ga0436363_0751359_462_1517 | 340 |
| 142 | iso_pu_bacteria | 2523231067 | 2523470249 | 340 |
| 143 | iso_pu_bacteria | 2528768022 | 2528855784 | 340 |
| 144 | iso_pu_bacteria | 2738543031 | 2739350217 | 340 |
| 145 | iso_pu_bacteria | 2791355196 | 2793064814 | 340 |
| 146 | iso_pu_bacteria | 2824661429 | 2824666226 | 340 |
| 147 | iso_pu_bacteria | 2824679649 | 2824686421 | 340 |
| 148 | iso_pu_bacteria | 2874620515 | 2874627073 | 340 |
| 149 | iso_pu_bacteria | 2879099564 | 2879102182 | 340 |
| 150 | iso_pu_bacteria | 2879142872 | 2879149884 | 340 |
| 151 | iso_pu_bacteria | 2904666416 | 2904669774 | 340 |
| 152 | iso_pu_bacteria | 2906643746 | 2906645838 | 340 |
| 153 | iso_pu_bacteria | 2919450847 | 2919454674 | 340 |
| 154 | iso_pu_bacteria | 2922368715 | 2922373362 | 340 |
| 155 | iso_pu_bacteria | 2922393267 | 2922395545 | 340 |
| 156 | iso_pu_bacteria | 2932784394 | 2932791946 | 340 |
| 157 | iso_pu_bacteria | 2932809354 | 2932815686 | 340 |
| 158 | iso_pu_bacteria | 2932818245 | 2932819234 | 340 |
| 159 | iso_pu_bacteria | 2932828146 | 2932835931 | 340 |
| 160 | iso_pu_bacteria | 2935616580 | 2935624348 | 340 |
| 161 | iso_pu_bacteria | 2935638405 | 2935647247 | 340 |
| 162 | iso_pu_bacteria | 2935665750 | 2935674447 | 340 |
| 163 | iso_pu_bacteria | 2935675223 | 2935678268 | 340 |
| 164 | iso_pu_bacteria | 2935684952 | 2935688310 | 340 |
| 165 | iso_pu_bacteria | 2935694250 | 2935698973 | 340 |
| 166 | iso_pu_bacteria | 2935703347 | 2935708590 | 340 |
| 167 | iso_pu_bacteria | 2935713505 | 2935715329 | 340 |
| 168 | iso_pu_bacteria | 2935722832 | 2935726107 | 340 |
| 169 | iso_pu_bacteria | 2935732158 | 2935734148 | 340 |
| 170 | iso_pu_bacteria | 2935741537 | 2935743527 | 340 |
| 171 | iso_pu_bacteria | 2935750917 | 2935754436 | 340 |
| 172 | iso_pu_bacteria | 2935760218 | 2935768207 | 340 |
| 173 | iso_pu_bacteria | 2935801545 | 2935809425 | 340 |
| 174 | iso_pu_bacteria | 2935810662 | 2935818904 | 340 |
| 175 | iso_pu_bacteria | 2935827899 | 2935836722 | 340 |
| 176 | iso_pu_bacteria | 2935837841 | 2935846554 | 340 |
| 177 | iso_pu_bacteria | 2935855204 | 2935862618 | 340 |
| 178 | iso_pu_bacteria | 2935864058 | 2935871783 | 340 |
| 179 | iso_pu_bacteria | 2935873716 | 2935881850 | 340 |
| 180 | iso_pu_bacteria | 2935992306 | 2935998881 | 340 |
| 181 | iso_pu_bacteria | 2936002035 | 2936007435 | 340 |
| 182 | iso_pu_bacteria | 2936037263 | 2936045618 | 340 |
| 183 | iso_pu_bacteria | 2940556831 | 2940560188 | 340 |
| 184 | iso_pu_bacteria | 2941538514 | 2941546662 | 340 |
| 185 | iso_pu_bacteria | 8001845381 | 8001849631 | 340 |
| 186 | iso_pu_bacteria | 8017057580 | 8017062047 | 340 |
| 187 | iso_pu_bacteria | 8019576017 | 8019581587 | 340 |
| 188 | iso_pu_bacteria | 8019586578 | 8019589221 | 340 |
| 189 | iso_pu_bacteria | 8019597564 | 8019602012 | 340 |
| 190 | iso_pu_bacteria | 8019608314 | 8019616540 | 340 |
| 191 | iso_pu_bacteria | 8056967851 | 8056972652 | 340 |
| 192 | iso_pu_bacteria | 2939669807 | 2939670719 | 341 |
| 193 | 3300006173 | Ga0070716_100021364 | Ga0070716_1000213642 | 342 |
| 194 | 3300007788 | Ga0099795_10004198 | Ga0099795_100041982 | 342 |
| 195 | 3300010159 | Ga0099796_10000963 | Ga0099796_100009633 | 342 |
| 196 | 3300021384 | Ga0213876_10042552 | Ga0213876_100425523 | 342 |
| 197 | 3300025929 | Ga0207664_10336498 | Ga0207664_103364981 | 342 |
| 198 | 3300025939 | Ga0207665_10025499 | Ga0207665_100254992 | 342 |
| 199 | 3300036647 | Ga0316582_0085542 | Ga0316582_0085542_799_1842 | 342 |
| 200 | 3300037312 | Ga0395899_0000130 | Ga0395899_0000130_76066_77136 | 342 |
| 201 | 3300037418 | Ga0395900_0000020 | Ga0395900_0000020_276365_277435 | 342 |
| 202 | 3300037466 | Ga0395898_0000104 | Ga0395898_0000104_76066_77136 | 342 |
| 203 | 3300037471 | Ga0395905_0000019 | Ga0395905_0000019_76066_77136 | 342 |
| 204 | 3300038443 | Ga0395901_0000016 | Ga0395901_0000016_276873_277943 | 342 |
| 205 | 3300049585 | Ga0501069_0070010 | Ga0501069_0070010_313_1383 | 342 |
| 206 | 3300049589 | Ga0501073_0034730 | Ga0501073_0034730_1837_2907 | 342 |
| 207 | 3300053136 | Ga0500559_0011662 | Ga0500559_0011662_2220_3281 | 342 |
| 208 | 3300053163 | Ga0500639_065658 | Ga0500639_065658_359_1411 | 342 |
| 209 | 3300005290 | Ga0065712_10007290 | Ga0065712_100072901 | 343 |
| 210 | 3300005364 | Ga0070673_100023414 | Ga0070673_1000234145 | 343 |
| 211 | 3300005441 | Ga0070700_100171944 | Ga0070700_1001719442 | 343 |
| 212 | 3300005543 | Ga0070672_100166489 | Ga0070672_1001664892 | 343 |
| 213 | 3300009098 | Ga0105245_10336932 | Ga0105245_103369322 | 343 |
| 214 | 3300009101 | Ga0105247_10004686 | Ga0105247_100046862 | 343 |
| 215 | 3300014326 | Ga0157380_10309791 | Ga0157380_103097912 | 343 |
| 216 | 3300025893 | Ga0207682_10002414 | Ga0207682_100024144 | 343 |
| 217 | 3300025908 | Ga0207643_10015748 | Ga0207643_100157482 | 343 |
| 218 | 3300025986 | Ga0207658_10052748 | Ga0207658_100527482 | 343 |
| 219 | 3300031241 | Ga0265325_10023501 | Ga0265325_100235012 | 343 |
| 220 | 3300031595 | Ga0265313_10032255 | Ga0265313_100322552 | 343 |
| 221 | 3300046539 | Ga0495621_0009482 | Ga0495621_0009482_1600_2652 | 343 |
| 222 | 3300049569 | Ga0501032_0037553 | Ga0501032_0037553_494_1552 | 343 |
| 223 | 3300049571 | Ga0501034_0012317 | Ga0501034_0012317_5543_6601 | 343 |
| 224 | 3300049571 | Ga0501034_0434288 | Ga0501034_0434288_79_1137 | 343 |
| 225 | 3300049572 | Ga0501036_0041532 | Ga0501036_0041532_2220_3278 | 343 |
| 226 | 3300049579 | Ga0501043_0053301 | Ga0501043_0053301_570_1628 | 343 |
| 227 | 3300049584 | Ga0501068_0034779 | Ga0501068_0034779_863_1921 | 343 |
| 228 | 3300049586 | Ga0501070_0007975 | Ga0501070_0007975_6874_7932 | 343 |
| 229 | 3300049586 | Ga0501070_0032521 | Ga0501070_0032521_909_1967 | 343 |
| 230 | 3300049586 | Ga0501070_0054634 | Ga0501070_0054634_385_1443 | 343 |
| 231 | 3300049589 | Ga0501073_0047412 | Ga0501073_0047412_1226_2272 | 343 |
| 232 | 3300049590 | Ga0501074_0014482 | Ga0501074_0014482_3338_4396 | 343 |
| 233 | 3300049590 | Ga0501074_0027814 | Ga0501074_0027814_2545_3591 | 343 |
| 234 | 3300049741 | Ga0501079_0029595 | Ga0501079_0029595_1428_2486 | 343 |
| 235 | 3300049742 | Ga0501080_0038730 | Ga0501080_0038730_2029_3075 | 343 |
| 236 | 3300049742 | Ga0501080_0040549 | Ga0501080_0040549_1752_2810 | 343 |
| 237 | 3300049742 | Ga0501080_0111323 | Ga0501080_0111323_567_1613 | 343 |
| 238 | 3300049744 | Ga0501083_0019073 | Ga0501083_0019073_2205_3263 | 343 |
| 239 | 3300049744 | Ga0501083_0053537 | Ga0501083_0053537_363_1421 | 343 |
| 240 | 3300049822 | Ga0501035_0081968 | Ga0501035_0081968_96_1154 | 343 |
| 241 | 3300049822 | Ga0501035_0104063 | Ga0501035_0104063_282_1340 | 343 |
| 242 | 3300049823 | Ga0501044_0203679 | Ga0501044_0203679_121_1179 | 343 |
| 243 | 3300003659 | JGI25404J52841_10000633 | JGI25404J52841_100006335 | 344 |
| 244 | 3300005340 | Ga0070689_100222194 | Ga0070689_1002221942 | 344 |
| 245 | 3300005354 | Ga0070675_100240228 | Ga0070675_1002402282 | 344 |
| 246 | 3300005355 | Ga0070671_100060270 | Ga0070671_1000602703 | 344 |
| 247 | 3300005356 | Ga0070674_100027684 | Ga0070674_1000276842 | 344 |
| 248 | 3300005364 | Ga0070673_100014278 | Ga0070673_1000142786 | 344 |
| 249 | 3300005365 | Ga0070688_100031342 | Ga0070688_1000313423 | 344 |
| 250 | 3300005434 | Ga0070709_10076401 | Ga0070709_100764011 | 344 |
| 251 | 3300005435 | Ga0070714_100064971 | Ga0070714_1000649712 | 344 |
| 252 | 3300005435 | Ga0070714_100069443 | Ga0070714_1000694432 | 344 |
| 253 | 3300005436 | Ga0070713_100022107 | Ga0070713_1000221076 | 344 |
| 254 | 3300005436 | Ga0070713_100070374 | Ga0070713_1000703744 | 344 |
| 255 | 3300005437 | Ga0070710_10033533 | Ga0070710_100335332 | 344 |
| 256 | 3300005437 | Ga0070710_10038184 | Ga0070710_100381842 | 344 |
| 257 | 3300005439 | Ga0070711_100042811 | Ga0070711_1000428112 | 344 |
| 258 | 3300005439 | Ga0070711_100107306 | Ga0070711_1001073062 | 344 |
| 259 | 3300005439 | Ga0070711_100179612 | Ga0070711_1001796122 | 344 |
| 260 | 3300005445 | Ga0070708_100065932 | Ga0070708_1000659323 | 344 |
| 261 | 3300005455 | Ga0070663_100039942 | Ga0070663_1000399422 | 344 |
| 262 | 3300005456 | Ga0070678_100029338 | Ga0070678_1000293385 | 344 |
| 263 | 3300005459 | Ga0068867_100168124 | Ga0068867_1001681241 | 344 |
| 264 | 3300005543 | Ga0070672_100167997 | Ga0070672_1001679972 | 344 |
| 265 | 3300005548 | Ga0070665_100060372 | Ga0070665_1000603723 | 344 |
| 266 | 3300005615 | Ga0070702_100153004 | Ga0070702_1001530042 | 344 |
| 267 | 3300005617 | Ga0068859_100271064 | Ga0068859_1002710642 | 344 |
| 268 | 3300005842 | Ga0068858_100089368 | Ga0068858_1000893683 | 344 |
| 269 | 3300005842 | Ga0068858_100117126 | Ga0068858_1001171261 | 344 |
| 270 | 3300005983 | Ga0081540_1002699 | Ga0081540_10026995 | 344 |
| 271 | 3300005983 | Ga0081540_1039161 | Ga0081540_10391613 | 344 |
| 272 | 3300006028 | Ga0070717_10019351 | Ga0070717_100193517 | 344 |
| 273 | 3300006058 | Ga0075432_10013785 | Ga0075432_100137853 | 344 |
| 274 | 3300006163 | Ga0070715_10008256 | Ga0070715_100082564 | 344 |
| 275 | 3300006175 | Ga0070712_100143431 | Ga0070712_1001434312 | 344 |
| 276 | 3300006175 | Ga0070712_100172654 | Ga0070712_1001726541 | 344 |
| 277 | 3300006178 | Ga0075367_10046668 | Ga0075367_100466683 | 344 |
| 278 | 3300006846 | Ga0075430_100131722 | Ga0075430_1001317222 | 344 |
| 279 | 3300006847 | Ga0075431_100212876 | Ga0075431_1002128762 | 344 |
| 280 | 3300006871 | Ga0075434_100134908 | Ga0075434_1001349082 | 344 |
| 281 | 3300006914 | Ga0075436_100180934 | Ga0075436_1001809342 | 344 |
| 282 | 3300006931 | Ga0097620_100271067 | Ga0097620_1002710672 | 344 |
| 283 | 3300007076 | Ga0075435_100138910 | Ga0075435_1001389102 | 344 |
| 284 | 3300007076 | Ga0075435_100219123 | Ga0075435_1002191232 | 344 |
| 285 | 3300007265 | Ga0099794_10043202 | Ga0099794_100432022 | 344 |
| 286 | 3300009094 | Ga0111539_10076235 | Ga0111539_100762352 | 344 |
| 287 | 3300009098 | Ga0105245_10343645 | Ga0105245_103436452 | 344 |
| 288 | 3300009098 | Ga0105245_10359431 | Ga0105245_103594312 | 344 |
| 289 | 3300009147 | Ga0114129_10425001 | Ga0114129_104250012 | 344 |
| 290 | 3300013308 | Ga0157375_10123440 | Ga0157375_101234402 | 344 |
| 291 | 3300014325 | Ga0163163_10074340 | Ga0163163_100743402 | 344 |
| 292 | 3300025297 | Ga0209758_1001046 | Ga0209758_100104620 | 344 |
| 293 | 3300025885 | Ga0207653_10051798 | Ga0207653_100517981 | 344 |
| 294 | 3300025898 | Ga0207692_10038239 | Ga0207692_100382392 | 344 |
| 295 | 3300025906 | Ga0207699_10022098 | Ga0207699_100220983 | 344 |
| 296 | 3300025906 | Ga0207699_10056526 | Ga0207699_100565261 | 344 |
| 297 | 3300025907 | Ga0207645_10180403 | Ga0207645_101804032 | 344 |
| 298 | 3300025910 | Ga0207684_10061490 | Ga0207684_100614904 | 344 |
| 299 | 3300025912 | Ga0207707_10102568 | Ga0207707_101025682 | 344 |
| 300 | 3300025915 | Ga0207693_10023521 | Ga0207693_100235213 | 344 |
| 301 | 3300025915 | Ga0207693_10038606 | Ga0207693_100386064 | 344 |
| 302 | 3300025915 | Ga0207693_10060824 | Ga0207693_100608244 | 344 |
| 303 | 3300025916 | Ga0207663_10039870 | Ga0207663_100398704 | 344 |
| 304 | 3300025916 | Ga0207663_10078460 | Ga0207663_100784602 | 344 |
| 305 | 3300025920 | Ga0207649_10192485 | Ga0207649_101924852 | 344 |
| 306 | 3300025922 | Ga0207646_10077702 | Ga0207646_100777022 | 344 |
| 307 | 3300025924 | Ga0207694_10121732 | Ga0207694_101217321 | 344 |
| 308 | 3300025926 | Ga0207659_10210706 | Ga0207659_102107061 | 344 |
| 309 | 3300025927 | Ga0207687_10169984 | Ga0207687_101699842 | 344 |
| 310 | 3300025928 | Ga0207700_10036206 | Ga0207700_100362062 | 344 |
| 311 | 3300025928 | Ga0207700_10102585 | Ga0207700_101025851 | 344 |
| 312 | 3300025929 | Ga0207664_10123366 | Ga0207664_101233662 | 344 |
| 313 | 3300025929 | Ga0207664_10191882 | Ga0207664_101918822 | 344 |
| 314 | 3300025933 | Ga0207706_10087810 | Ga0207706_100878102 | 344 |
| 315 | 3300025939 | Ga0207665_10010416 | Ga0207665_100104164 | 344 |
| 316 | 3300025940 | Ga0207691_10142387 | Ga0207691_101423872 | 344 |
| 317 | 3300025945 | Ga0207679_10094624 | Ga0207679_100946242 | 344 |
| 318 | 3300025960 | Ga0207651_10029594 | Ga0207651_100295943 | 344 |
| 319 | 3300025960 | Ga0207651_10379731 | Ga0207651_103797312 | 344 |
| 320 | 3300026035 | Ga0207703_10363418 | Ga0207703_103634181 | 344 |
| 321 | 3300026075 | Ga0207708_10095298 | Ga0207708_100952983 | 344 |
| 322 | 3300026075 | Ga0207708_10160609 | Ga0207708_101606092 | 344 |
| 323 | 3300026089 | Ga0207648_10119872 | Ga0207648_101198722 | 344 |
| 324 | 3300026121 | Ga0207683_10011735 | Ga0207683_100117354 | 344 |
| 325 | 3300026142 | Ga0207698_10143899 | Ga0207698_101438991 | 344 |
| 326 | 3300027907 | Ga0207428_10019580 | Ga0207428_100195804 | 344 |
| 327 | 3300028379 | Ga0268266_10071605 | Ga0268266_100716053 | 344 |
| 328 | 3300031241 | Ga0265325_10046577 | Ga0265325_100465772 | 344 |
| 329 | 3300031242 | Ga0265329_10031438 | Ga0265329_100314382 | 344 |
| 330 | 3300032133 | Ga0316583_10000231 | Ga0316583_100002312 | 344 |
| 331 | 3300035116 | Ga0373945_0010619 | Ga0373945_0010619_1111_2172 | 344 |
| 332 | 3300035118 | Ga0373954_0031235 | Ga0373954_0031235_778_1839 | 344 |
| 333 | 3300035170 | Ga0373943_0000422 | Ga0373943_0000422_9134_10195 | 344 |
| 334 | 3300035170 | Ga0373943_0032540 | Ga0373943_0032540_569_1630 | 344 |
| 335 | 3300035171 | Ga0373946_0000369 | Ga0373946_0000369_6554_7615 | 344 |
| 336 | 3300035171 | Ga0373946_0011600 | Ga0373946_0011600_1204_2265 | 344 |
| 337 | 3300035171 | Ga0373946_0039364 | Ga0373946_0039364_825_1886 | 344 |
| 338 | 3300035172 | Ga0373955_0023754 | Ga0373955_0023754_1203_2264 | 344 |
| 339 | 3300035241 | Ga0373961_0017807 | Ga0373961_0017807_298_1353 | 344 |
| 340 | 3300035695 | Ga0373927_0000414 | Ga0373927_0000414_8088_9149 | 344 |
| 341 | 3300035695 | Ga0373927_0027487 | Ga0373927_0027487_1734_2795 | 344 |
| 342 | 3300035724 | Ga0373933_0051605 | Ga0373933_0051605_700_1761 | 344 |
| 343 | 3300035725 | Ga0373947_0000275 | Ga0373947_0000275_5614_6675 | 344 |
| 344 | 3300035725 | Ga0373947_0151578 | Ga0373947_0151578_309_1370 | 344 |
| 345 | 3300036401 | Ga0373937_0049609 | Ga0373937_0049609_2771_3832 | 344 |
| 346 | 3300037068 | Ga0373925_0002546 | Ga0373925_0002546_154_1215 | 344 |
| 347 | 3300037068 | Ga0373925_0109999 | Ga0373925_0109999_847_1908 | 344 |
| 348 | 3300037471 | Ga0395905_0020427 | Ga0395905_0020427_3000_4061 | 344 |
| 349 | 3300039437 | Ga0436365_0034062 | Ga0436365_0034062_445_1506 | 344 |
| 350 | 3300044658 | Ga0466972_0039602 | Ga0466972_0039602_1017_2078 | 344 |
| 351 | 3300044706 | Ga0466964_0026887 | Ga0466964_0026887_477_1538 | 344 |
| 352 | 3300044901 | Ga0466960_0024288 | Ga0466960_0024288_1150_2211 | 344 |
| 353 | 3300045976 | Ga0466967_0127455 | Ga0466967_0127455_132_1193 | 344 |
| 354 | 3300046454 | Ga0495592_0004650 | Ga0495592_0004650_7649_8710 | 344 |
| 355 | 3300046455 | Ga0495603_0051536 | Ga0495603_0051536_1204_2265 | 344 |
| 356 | 3300046459 | Ga0495629_0015054 | Ga0495629_0015054_4061_5122 | 344 |
| 357 | 3300046461 | Ga0495641_0023622 | Ga0495641_0023622_1802_2863 | 344 |
| 358 | 3300046462 | Ga0495651_0033029 | Ga0495651_0033029_2279_3340 | 344 |
| 359 | 3300046463 | Ga0495653_0016883 | Ga0495653_0016883_232_1293 | 344 |
| 360 | 3300046472 | Ga0495580_0008354 | Ga0495580_0008354_1131_2192 | 344 |
| 361 | 3300046472 | Ga0495580_0090256 | Ga0495580_0090256_245_1306 | 344 |
| 362 | 3300046473 | Ga0495582_0025753 | Ga0495582_0025753_1146_2207 | 344 |
| 363 | 3300046475 | Ga0495639_0077256 | Ga0495639_0077256_142_1203 | 344 |
| 364 | 3300046476 | Ga0495662_0000261 | Ga0495662_0000261_20519_21580 | 344 |
| 365 | 3300046477 | Ga0495664_0000230 | Ga0495664_0000230_2456_3517 | 344 |
| 366 | 3300046477 | Ga0495664_0003269 | Ga0495664_0003269_7051_8112 | 344 |
| 367 | 3300046491 | Ga0495584_0035734 | Ga0495584_0035734_489_1550 | 344 |
| 368 | 3300046492 | Ga0495585_0004199 | Ga0495585_0004199_5221_6282 | 344 |
| 369 | 3300046501 | Ga0495607_0008348 | Ga0495607_0008348_3026_4087 | 344 |
| 370 | 3300046514 | Ga0495618_0006033 | Ga0495618_0006033_5064_6125 | 344 |
| 371 | 3300046514 | Ga0495618_0014795 | Ga0495618_0014795_776_1837 | 344 |
| 372 | 3300046516 | Ga0495628_0164958 | Ga0495628_0164958_89_1150 | 344 |
| 373 | 3300046517 | Ga0495630_0038359 | Ga0495630_0038359_1686_2747 | 344 |
| 374 | 3300046523 | Ga0495644_0001707 | Ga0495644_0001707_2317_3378 | 344 |
| 375 | 3300046526 | Ga0495666_0005800 | Ga0495666_0005800_1840_2901 | 344 |
| 376 | 3300046533 | Ga0495640_0009468 | Ga0495640_0009468_4771_5832 | 344 |
| 377 | 3300046533 | Ga0495640_0154240 | Ga0495640_0154240_105_1166 | 344 |
| 378 | 3300046535 | Ga0495586_0092976 | Ga0495586_0092976_232_1293 | 344 |
| 379 | 3300046536 | Ga0495587_0036279 | Ga0495587_0036279_1348_2409 | 344 |
| 380 | 3300046543 | Ga0495645_0014321 | Ga0495645_0014321_1513_2574 | 344 |
| 381 | 3300046558 | Ga0495633_0003249 | Ga0495633_0003249_5857_6918 | 344 |
| 382 | 3300046559 | Ga0495667_0004508 | Ga0495667_0004508_5017_6078 | 344 |
| 383 | 3300046615 | Ga0495656_0000538 | Ga0495656_0000538_4826_5887 | 344 |
| 384 | 3300046642 | Ga0495634_0124748 | Ga0495634_0124748_405_1466 | 344 |
| 385 | 3300046665 | Ga0495661_0039583 | Ga0495661_0039583_1472_2533 | 344 |
| 386 | 3300046674 | Ga0495588_0002190 | Ga0495588_0002190_1707_2768 | 344 |
| 387 | 3300046678 | Ga0495599_0095121 | Ga0495599_0095121_123_1184 | 344 |
| 388 | 3300046680 | Ga0495646_0043669 | Ga0495646_0043669_226_1287 | 344 |
| 389 | 3300046681 | Ga0495647_0002287 | Ga0495647_0002287_2887_3948 | 344 |
| 390 | 3300046683 | Ga0495658_0085068 | Ga0495658_0085068_18_1079 | 344 |
| 391 | 3300046689 | Ga0495613_0033916 | Ga0495613_0033916_458_1519 | 344 |
| 392 | 3300046690 | Ga0495624_0008042 | Ga0495624_0008042_4387_5448 | 344 |
| 393 | 3300046690 | Ga0495624_0013504 | Ga0495624_0013504_89_1150 | 344 |
| 394 | 3300046691 | Ga0495670_0002388 | Ga0495670_0002388_1919_2980 | 344 |
| 395 | 3300046694 | Ga0495649_0074482 | Ga0495649_0074482_296_1357 | 344 |
| 396 | 3300046809 | Ga0495600_0028724 | Ga0495600_0028724_702_1763 | 344 |
| 397 | 3300047317 | Ga0495604_0012078 | Ga0495604_0012078_5553_6614 | 344 |
| 398 | 3300047318 | Ga0495636_0024479 | Ga0495636_0024479_1055_2116 | 344 |
| 399 | 3300047319 | Ga0495674_0000209 | Ga0495674_0000209_20109_21170 | 344 |
| 400 | 3300047319 | Ga0495674_0209410 | Ga0495674_0209410_374_1435 | 344 |
| 401 | 3300047469 | Ga0495673_0043900 | Ga0495673_0043900_258_1319 | 344 |
| 402 | 3300047471 | Ga0495684_0002373 | Ga0495684_0002373_8102_9163 | 344 |
| 403 | 3300047471 | Ga0495684_0003076 | Ga0495684_0003076_8507_9568 | 344 |
| 404 | 3300047471 | Ga0495684_0009099 | Ga0495684_0009099_1203_2264 | 344 |
| 405 | 3300048904 | Ga0496101_0084065 | Ga0496101_0084065_49_1101 | 344 |
| 406 | 3300048909 | Ga0496106_0054544 | Ga0496106_0054544_66_1118 | 344 |
| 407 | 3300048910 | Ga0496107_0196165 | Ga0496107_0196165_295_1356 | 344 |
| 408 | 3300048911 | Ga0496108_0215572 | Ga0496108_0215572_585_1646 | 344 |
| 409 | 3300048912 | Ga0496109_0133005 | Ga0496109_0133005_667_1728 | 344 |
| 410 | 3300048913 | Ga0496110_0017894 | Ga0496110_0017894_3976_5037 | 344 |
| 411 | 3300048913 | Ga0496110_0233701 | Ga0496110_0233701_573_1625 | 344 |
| 412 | 3300048917 | Ga0496114_0014599 | Ga0496114_0014599_3026_4087 | 344 |
| 413 | 3300048917 | Ga0496114_0018780 | Ga0496114_0018780_4158_5219 | 344 |
| 414 | 3300048921 | Ga0496118_0167398 | Ga0496118_0167398_45_1106 | 344 |
| 415 | 3300049568 | Ga0501031_0037770 | Ga0501031_0037770_1230_2291 | 344 |
| 416 | 3300049569 | Ga0501032_0050135 | Ga0501032_0050135_867_1928 | 344 |
| 417 | 3300049570 | Ga0501033_0103729 | Ga0501033_0103729_810_1871 | 344 |
| 418 | 3300049572 | Ga0501036_0023367 | Ga0501036_0023367_1242_2303 | 344 |
| 419 | 3300049573 | Ga0501037_0071665 | Ga0501037_0071665_1082_2143 | 344 |
| 420 | 3300049574 | Ga0501038_0006501 | Ga0501038_0006501_6446_7507 | 344 |
| 421 | 3300049575 | Ga0501039_0050488 | Ga0501039_0050488_1354_2415 | 344 |
| 422 | 3300049579 | Ga0501043_0029259 | Ga0501043_0029259_711_1772 | 344 |
| 423 | 3300049580 | Ga0501046_0094208 | Ga0501046_0094208_378_1439 | 344 |
| 424 | 3300049583 | Ga0501067_0085477 | Ga0501067_0085477_279_1340 | 344 |
| 425 | 3300049584 | Ga0501068_0044180 | Ga0501068_0044180_815_1876 | 344 |
| 426 | 3300049585 | Ga0501069_0063574 | Ga0501069_0063574_159_1220 | 344 |
| 427 | 3300049587 | Ga0501071_0125279 | Ga0501071_0125279_18_1079 | 344 |
| 428 | 3300049590 | Ga0501074_0005361 | Ga0501074_0005361_780_1841 | 344 |
| 429 | 3300049592 | Ga0501076_0128327 | Ga0501076_0128327_819_1880 | 344 |
| 430 | 3300049741 | Ga0501079_0066283 | Ga0501079_0066283_483_1544 | 344 |
| 431 | 3300049742 | Ga0501080_0162575 | Ga0501080_0162575_798_1859 | 344 |
| 432 | 3300049822 | Ga0501035_0005152 | Ga0501035_0005152_10390_11451 | 344 |
| 433 | 3300049823 | Ga0501044_0155713 | Ga0501044_0155713_1001_2062 | 344 |
| 434 | 3300050491 | nmdc:mga00v17_147061_c1 | nmdc:mga00v17_147061_c1_427_1500 | 344 |
| 435 | 3300050509 | nmdc:mga0qj67_132584_c1 | nmdc:mga0qj67_132584_c1_756_1817 | 344 |
| 436 | 3300050512 | nmdc:mga0n895_149393_c1 | nmdc:mga0n895_149393_c1_1175_2236 | 344 |
| 437 | 3300050512 | nmdc:mga0n895_226025_c1 | nmdc:mga0n895_226025_c1_595_1656 | 344 |
| 438 | 3300053077 | Ga0495601_0087873 | Ga0495601_0087873_405_1466 | 344 |
| 439 | 3300053078 | Ga0495612_0000174 | Ga0495612_0000174_24162_25223 | 344 |
| 440 | 3300053084 | Ga0495595_0006151 | Ga0495595_0006151_2850_3911 | 344 |
| 441 | 3300053085 | Ga0495619_0001077 | Ga0495619_0001077_9311_10372 | 344 |
| 442 | 3300053085 | Ga0495619_0013003 | Ga0495619_0013003_2979_4040 | 344 |
| 443 | 3300053085 | Ga0495619_0025301 | Ga0495619_0025301_2601_3662 | 344 |
| 444 | 3300053120 | Ga0500597_080414 | Ga0500597_080414_22_1083 | 344 |
| 445 | 3300054114 | Ga0501084_0040029 | Ga0501084_0040029_2114_3175 | 344 |
| 446 | 3300060353 | Ga0501082_0008215 | Ga0501082_0008215_7277_8338 | 344 |
| 447 | 3300005440 | Ga0070705_100042894 | Ga0070705_1000428943 | 345 |
| 448 | 3300005536 | Ga0070697_100000748 | Ga0070697_1000007488 | 345 |
| 449 | 3300005545 | Ga0070695_100000696 | Ga0070695_1000006967 | 345 |
| 450 | 3300006846 | Ga0075430_100018717 | Ga0075430_1000187176 | 345 |
| 451 | 3300006847 | Ga0075431_100001010 | Ga0075431_10000101022 | 345 |
| 452 | 3300006914 | Ga0075436_100000192 | Ga0075436_10000019222 | 345 |
| 453 | 3300031241 | Ga0265325_10025494 | Ga0265325_100254943 | 345 |
| 454 | 3300031249 | Ga0265339_10046300 | Ga0265339_100463002 | 345 |
| 455 | 3300031344 | Ga0265316_10021547 | Ga0265316_100215476 | 345 |
| 456 | 3300031595 | Ga0265313_10062141 | Ga0265313_100621412 | 345 |
| 457 | 3300031711 | Ga0265314_10028861 | Ga0265314_100288613 | 345 |
| 458 | 3300039447 | Ga0436361_0496440 | Ga0436361_0496440_1086_2132 | 345 |
| 459 | 3300039447 | Ga0436361_1044927 | Ga0436361_1044927_2433_3479 | 345 |
| 460 | 3300049576 | Ga0501040_0054327 | Ga0501040_0054327_1525_2586 | 345 |
| 461 | 3300049743 | Ga0501081_0039930 | Ga0501081_0039930_187_1248 | 345 |
| 462 | 3300050509 | nmdc:mga0qj67_2103_c1 | nmdc:mga0qj67_2103_c1_6373_7428 | 345 |
| 463 | 3300050512 | nmdc:mga0n895_295773_c1 | nmdc:mga0n895_295773_c1_438_1496 | 345 |
| 464 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_99745_100800 | 345 |
| 465 | 3300061734 | Ga0530510_0069943 | Ga0530510_0069943_172_1233 | 345 |
| 466 | 3300005539 | Ga0068853_100001680 | Ga0068853_1000016809 | 346 |
| 467 | 3300005548 | Ga0070665_100045229 | Ga0070665_1000452294 | 346 |
| 468 | 3300005563 | Ga0068855_100095631 | Ga0068855_1000956314 | 346 |
| 469 | 3300005616 | Ga0068852_100003616 | Ga0068852_10000361613 | 346 |
| 470 | 3300005834 | Ga0068851_10026127 | Ga0068851_100261274 | 346 |
| 471 | 3300009093 | Ga0105240_10236924 | Ga0105240_102369242 | 346 |
| 472 | 3300009174 | Ga0105241_10094455 | Ga0105241_100944553 | 346 |
| 473 | 3300009545 | Ga0105237_10000542 | Ga0105237_1000054230 | 346 |
| 474 | 3300009551 | Ga0105238_10085480 | Ga0105238_100854802 | 346 |
| 475 | 3300010375 | Ga0105239_10001329 | Ga0105239_1000132920 | 346 |
| 476 | 3300010375 | Ga0105239_10037215 | Ga0105239_100372154 | 346 |
| 477 | 3300025321 | Ga0207656_10032018 | Ga0207656_100320182 | 346 |
| 478 | 3300025911 | Ga0207654_10027759 | Ga0207654_100277592 | 346 |
| 479 | 3300025914 | Ga0207671_10000649 | Ga0207671_1000064923 | 346 |
| 480 | 3300025920 | Ga0207649_10002158 | Ga0207649_100021584 | 346 |
| 481 | 3300025924 | Ga0207694_10055605 | Ga0207694_100556054 | 346 |
| 482 | 3300026116 | Ga0207674_10254188 | Ga0207674_102541882 | 346 |
| 483 | 3300028379 | Ga0268266_10000442 | Ga0268266_1000044225 | 346 |
| 484 | 3300031241 | Ga0265325_10018613 | Ga0265325_100186135 | 346 |
| 485 | 3300035089 | Ga0373944_0038892 | Ga0373944_0038892_306_1346 | 346 |
| 486 | 3300035170 | Ga0373943_0005880 | Ga0373943_0005880_3809_4849 | 346 |
| 487 | 3300035695 | Ga0373927_0027723 | Ga0373927_0027723_2011_3051 | 346 |
| 488 | 3300035725 | Ga0373947_0005949 | Ga0373947_0005949_3816_4856 | 346 |
| 489 | 3300037068 | Ga0373925_0038888 | Ga0373925_0038888_663_1703 | 346 |
| 490 | 3300042001 | Ga0439441_001387 | Ga0439441_001387_390_1463 | 346 |
| 491 | 3300046455 | Ga0495603_0001214 | Ga0495603_0001214_11745_12785 | 346 |
| 492 | 3300046459 | Ga0495629_0002062 | Ga0495629_0002062_3675_4715 | 346 |
| 493 | 3300046461 | Ga0495641_0022382 | Ga0495641_0022382_214_1254 | 346 |
| 494 | 3300046472 | Ga0495580_0000299 | Ga0495580_0000299_3626_4666 | 346 |
| 495 | 3300046473 | Ga0495582_0011046 | Ga0495582_0011046_1996_3036 | 346 |
| 496 | 3300046475 | Ga0495639_0005838 | Ga0495639_0005838_2390_3430 | 346 |
| 497 | 3300046499 | Ga0495594_0000679 | Ga0495594_0000679_12767_13807 | 346 |
| 498 | 3300046517 | Ga0495630_0302082 | Ga0495630_0302082_103_1143 | 346 |
| 499 | 3300046531 | Ga0495665_0073872 | Ga0495665_0073872_159_1199 | 346 |
| 500 | 3300046557 | Ga0495622_0000920 | Ga0495622_0000920_2143_3183 | 346 |
| 501 | 3300046642 | Ga0495634_0006288 | Ga0495634_0006288_5379_6419 | 346 |
| 502 | 3300046674 | Ga0495588_0001344 | Ga0495588_0001344_1874_2914 | 346 |
| 503 | 3300046681 | Ga0495647_0009258 | Ga0495647_0009258_943_1983 | 346 |
| 504 | 3300046683 | Ga0495658_0015537 | Ga0495658_0015537_666_1706 | 346 |
| 505 | 3300046689 | Ga0495613_0000818 | Ga0495613_0000818_4650_5690 | 346 |
| 506 | 3300047315 | Ga0495581_0002568 | Ga0495581_0002568_7784_8824 | 346 |
| 507 | 3300047321 | Ga0495676_0020836 | Ga0495676_0020836_2420_3460 | 346 |
| 508 | 3300047673 | Ga0495593_0003392 | Ga0495593_0003392_3354_4394 | 346 |
| 509 | 3300048089 | Ga0495614_0015281 | Ga0495614_0015281_114_1154 | 346 |
| 510 | 3300049570 | Ga0501033_0119762 | Ga0501033_0119762_70_1128 | 346 |
| 511 | 3300049582 | Ga0501048_0064062 | Ga0501048_0064062_1122_2198 | 346 |
| 512 | 3300049588 | Ga0501072_0031428 | Ga0501072_0031428_1653_2729 | 346 |
| 513 | 3300049591 | Ga0501075_0021030 | Ga0501075_0021030_1316_2392 | 346 |
| 514 | 3300049592 | Ga0501076_0086664 | Ga0501076_0086664_643_1719 | 346 |
| 515 | 3300049741 | Ga0501079_0096015 | Ga0501079_0096015_432_1490 | 346 |
| 516 | 3300049741 | Ga0501079_0331755 | Ga0501079_0331755_39_1115 | 346 |
| 517 | 3300049743 | Ga0501081_0051414 | Ga0501081_0051414_12_1070 | 346 |
| 518 | 3300049743 | Ga0501081_0074663 | Ga0501081_0074663_474_1550 | 346 |
| 519 | 3300049824 | Ga0501045_0030041 | Ga0501045_0030041_1298_2356 | 346 |
| 520 | 3300053084 | Ga0495595_0040868 | Ga0495595_0040868_390_1430 | 346 |
| 521 | 3300060353 | Ga0501082_0007926 | Ga0501082_0007926_1823_2881 | 346 |
| 522 | 3300061734 | Ga0530510_0006461 | Ga0530510_0006461_1517_2575 | 346 |
| 523 | 3300061734 | Ga0530510_0013414 | Ga0530510_0013414_1246_2322 | 346 |
| 524 | 3300002067 | JGI24735J21928_10046626 | JGI24735J21928_100466261 | 347 |
| 525 | 3300002075 | JGI24738J21930_10003727 | JGI24738J21930_100037275 | 347 |
| 526 | 3300002459 | JGI24751J29686_10006293 | JGI24751J29686_100062932 | 347 |
| 527 | 3300005329 | Ga0070683_100088887 | Ga0070683_1000888872 | 347 |
| 528 | 3300005330 | Ga0070690_100000265 | Ga0070690_10000026523 | 347 |
| 529 | 3300005331 | Ga0070670_100020525 | Ga0070670_1000205253 | 347 |
| 530 | 3300005333 | Ga0070677_10038139 | Ga0070677_100381392 | 347 |
| 531 | 3300005336 | Ga0070680_100042355 | Ga0070680_1000423552 | 347 |
| 532 | 3300005338 | Ga0068868_100019196 | Ga0068868_1000191965 | 347 |
| 533 | 3300005339 | Ga0070660_100147351 | Ga0070660_1001473512 | 347 |
| 534 | 3300005340 | Ga0070689_100005036 | Ga0070689_1000050367 | 347 |
| 535 | 3300005341 | Ga0070691_10013507 | Ga0070691_100135072 | 347 |
| 536 | 3300005344 | Ga0070661_100000197 | Ga0070661_10000019750 | 347 |
| 537 | 3300005345 | Ga0070692_10011366 | Ga0070692_100113665 | 347 |
| 538 | 3300005347 | Ga0070668_100004142 | Ga0070668_1000041427 | 347 |
| 539 | 3300005353 | Ga0070669_100015913 | Ga0070669_1000159134 | 347 |
| 540 | 3300005354 | Ga0070675_100005536 | Ga0070675_1000055365 | 347 |
| 541 | 3300005355 | Ga0070671_100002517 | Ga0070671_1000025174 | 347 |
| 542 | 3300005356 | Ga0070674_100025242 | Ga0070674_1000252422 | 347 |
| 543 | 3300005364 | Ga0070673_100000516 | Ga0070673_10000051620 | 347 |
| 544 | 3300005365 | Ga0070688_100000119 | Ga0070688_1000001195 | 347 |
| 545 | 3300005365 | Ga0070688_100260651 | Ga0070688_1002606511 | 347 |
| 546 | 3300005366 | Ga0070659_100003462 | Ga0070659_1000034623 | 347 |
| 547 | 3300005367 | Ga0070667_100087149 | Ga0070667_1000871492 | 347 |
| 548 | 3300005434 | Ga0070709_10004735 | Ga0070709_100047357 | 347 |
| 549 | 3300005435 | Ga0070714_100084045 | Ga0070714_1000840453 | 347 |
| 550 | 3300005435 | Ga0070714_100524211 | Ga0070714_1005242111 | 347 |
| 551 | 3300005436 | Ga0070713_100018520 | Ga0070713_1000185205 | 347 |
| 552 | 3300005437 | Ga0070710_10011895 | Ga0070710_100118953 | 347 |
| 553 | 3300005437 | Ga0070710_10047850 | Ga0070710_100478503 | 347 |
| 554 | 3300005438 | Ga0070701_10011185 | Ga0070701_100111852 | 347 |
| 555 | 3300005439 | Ga0070711_100021551 | Ga0070711_1000215514 | 347 |
| 556 | 3300005440 | Ga0070705_100000641 | Ga0070705_1000006418 | 347 |
| 557 | 3300005440 | Ga0070705_100047910 | Ga0070705_1000479102 | 347 |
| 558 | 3300005441 | Ga0070700_100002572 | Ga0070700_1000025726 | 347 |
| 559 | 3300005444 | Ga0070694_100000838 | Ga0070694_10000083816 | 347 |
| 560 | 3300005456 | Ga0070678_100034953 | Ga0070678_1000349532 | 347 |
| 561 | 3300005457 | Ga0070662_100019961 | Ga0070662_1000199612 | 347 |
| 562 | 3300005457 | Ga0070662_100238040 | Ga0070662_1002380402 | 347 |
| 563 | 3300005458 | Ga0070681_10027480 | Ga0070681_100274805 | 347 |
| 564 | 3300005530 | Ga0070679_100008876 | Ga0070679_10000887610 | 347 |
| 565 | 3300005535 | Ga0070684_100013362 | Ga0070684_1000133625 | 347 |
| 566 | 3300005536 | Ga0070697_100013035 | Ga0070697_1000130353 | 347 |
| 567 | 3300005536 | Ga0070697_100057019 | Ga0070697_1000570193 | 347 |
| 568 | 3300005539 | Ga0068853_100001657 | Ga0068853_1000016575 | 347 |
| 569 | 3300005543 | Ga0070672_100005169 | Ga0070672_1000051696 | 347 |
| 570 | 3300005544 | Ga0070686_100002196 | Ga0070686_1000021962 | 347 |
| 571 | 3300005544 | Ga0070686_100157552 | Ga0070686_1001575521 | 347 |
| 572 | 3300005545 | Ga0070695_100000560 | Ga0070695_1000005605 | 347 |
| 573 | 3300005548 | Ga0070665_100144581 | Ga0070665_1001445812 | 347 |
| 574 | 3300005549 | Ga0070704_100001082 | Ga0070704_10000108214 | 347 |
| 575 | 3300005564 | Ga0070664_100000182 | Ga0070664_1000001824 | 347 |
| 576 | 3300005577 | Ga0068857_100002534 | Ga0068857_10000253413 | 347 |
| 577 | 3300005578 | Ga0068854_100000423 | Ga0068854_10000042326 | 347 |
| 578 | 3300005614 | Ga0068856_100005230 | Ga0068856_10000523013 | 347 |
| 579 | 3300005615 | Ga0070702_100000037 | Ga0070702_1000000374 | 347 |
| 580 | 3300005615 | Ga0070702_100072164 | Ga0070702_1000721642 | 347 |
| 581 | 3300005616 | Ga0068852_100009229 | Ga0068852_1000092295 | 347 |
| 582 | 3300005617 | Ga0068859_100009627 | Ga0068859_1000096279 | 347 |
| 583 | 3300005618 | Ga0068864_100002959 | Ga0068864_1000029595 | 347 |
| 584 | 3300005718 | Ga0068866_10001701 | Ga0068866_100017015 | 347 |
| 585 | 3300005719 | Ga0068861_100032234 | Ga0068861_1000322343 | 347 |
| 586 | 3300005834 | Ga0068851_10007794 | Ga0068851_100077945 | 347 |
| 587 | 3300005841 | Ga0068863_100001181 | Ga0068863_1000011813 | 347 |
| 588 | 3300005843 | Ga0068860_100002535 | Ga0068860_10000253518 | 347 |
| 589 | 3300005844 | Ga0068862_100053488 | Ga0068862_1000534884 | 347 |
| 590 | 3300005937 | Ga0081455_10025826 | Ga0081455_100258265 | 347 |
| 591 | 3300006058 | Ga0075432_10034867 | Ga0075432_100348672 | 347 |
| 592 | 3300006163 | Ga0070715_10003008 | Ga0070715_100030084 | 347 |
| 593 | 3300006173 | Ga0070716_100002195 | Ga0070716_1000021957 | 347 |
| 594 | 3300006173 | Ga0070716_100251186 | Ga0070716_1002511861 | 347 |
| 595 | 3300006175 | Ga0070712_100002422 | Ga0070712_10000242210 | 347 |
| 596 | 3300006237 | Ga0097621_100027332 | Ga0097621_1000273325 | 347 |
| 597 | 3300006844 | Ga0075428_100053187 | Ga0075428_1000531875 | 347 |
| 598 | 3300006846 | Ga0075430_100088198 | Ga0075430_1000881983 | 347 |
| 599 | 3300006852 | Ga0075433_10022460 | Ga0075433_100224602 | 347 |
| 600 | 3300006880 | Ga0075429_100036114 | Ga0075429_1000361142 | 347 |
| 601 | 3300006914 | Ga0075436_100006152 | Ga0075436_1000061526 | 347 |
| 602 | 3300006931 | Ga0097620_100009627 | Ga0097620_1000096279 | 347 |
| 603 | 3300009092 | Ga0105250_10013946 | Ga0105250_100139463 | 347 |
| 604 | 3300009094 | Ga0111539_10243260 | Ga0111539_102432602 | 347 |
| 605 | 3300009098 | Ga0105245_10004513 | Ga0105245_1000451312 | 347 |
| 606 | 3300009098 | Ga0105245_10068581 | Ga0105245_100685812 | 347 |
| 607 | 3300009101 | Ga0105247_10000582 | Ga0105247_1000058230 | 347 |
| 608 | 3300009148 | Ga0105243_10001048 | Ga0105243_1000104823 | 347 |
| 609 | 3300009174 | Ga0105241_10000744 | Ga0105241_100007445 | 347 |
| 610 | 3300009176 | Ga0105242_10001197 | Ga0105242_1000119718 | 347 |
| 611 | 3300009177 | Ga0105248_10001853 | Ga0105248_1000185322 | 347 |
| 612 | 3300009545 | Ga0105237_10003908 | Ga0105237_1000390816 | 347 |
| 613 | 3300009551 | Ga0105238_10052463 | Ga0105238_100524633 | 347 |
| 614 | 3300009553 | Ga0105249_10000702 | Ga0105249_1000070225 | 347 |
| 615 | 3300010375 | Ga0105239_10005973 | Ga0105239_100059732 | 347 |
| 616 | 3300010375 | Ga0105239_10398220 | Ga0105239_103982202 | 347 |
| 617 | 3300011119 | Ga0105246_10000802 | Ga0105246_1000080216 | 347 |
| 618 | 3300013100 | Ga0157373_10009574 | Ga0157373_100095745 | 347 |
| 619 | 3300013102 | Ga0157371_10012903 | Ga0157371_100129034 | 347 |
| 620 | 3300013105 | Ga0157369_10005142 | Ga0157369_100051424 | 347 |
| 621 | 3300013296 | Ga0157374_10010830 | Ga0157374_100108302 | 347 |
| 622 | 3300013297 | Ga0157378_10034098 | Ga0157378_100340982 | 347 |
| 623 | 3300013306 | Ga0163162_10035022 | Ga0163162_100350227 | 347 |
| 624 | 3300013307 | Ga0157372_10004763 | Ga0157372_1000476314 | 347 |
| 625 | 3300013307 | Ga0157372_10197437 | Ga0157372_101974371 | 347 |
| 626 | 3300013308 | Ga0157375_10000519 | Ga0157375_1000051930 | 347 |
| 627 | 3300013308 | Ga0157375_10004901 | Ga0157375_1000490110 | 347 |
| 628 | 3300014325 | Ga0163163_10002649 | Ga0163163_100026492 | 347 |
| 629 | 3300014326 | Ga0157380_10008349 | Ga0157380_100083495 | 347 |
| 630 | 3300014326 | Ga0157380_10021746 | Ga0157380_100217464 | 347 |
| 631 | 3300014745 | Ga0157377_10006697 | Ga0157377_100066974 | 347 |
| 632 | 3300014745 | Ga0157377_10130722 | Ga0157377_101307222 | 347 |
| 633 | 3300014968 | Ga0157379_10000158 | Ga0157379_1000015849 | 347 |
| 634 | 3300014968 | Ga0157379_10096803 | Ga0157379_100968033 | 347 |
| 635 | 3300014969 | Ga0157376_10004180 | Ga0157376_100041805 | 347 |
| 636 | 3300014969 | Ga0157376_10014743 | Ga0157376_100147435 | 347 |
| 637 | 3300017792 | Ga0163161_10003786 | Ga0163161_100037869 | 347 |
| 638 | 3300025898 | Ga0207692_10012156 | Ga0207692_100121564 | 347 |
| 639 | 3300025900 | Ga0207710_10008712 | Ga0207710_100087124 | 347 |
| 640 | 3300025901 | Ga0207688_10003365 | Ga0207688_100033657 | 347 |
| 641 | 3300025903 | Ga0207680_10010262 | Ga0207680_100102625 | 347 |
| 642 | 3300025904 | Ga0207647_10001406 | Ga0207647_1000140617 | 347 |
| 643 | 3300025906 | Ga0207699_10066640 | Ga0207699_100666402 | 347 |
| 644 | 3300025912 | Ga0207707_10100673 | Ga0207707_101006732 | 347 |
| 645 | 3300025914 | Ga0207671_10033119 | Ga0207671_100331195 | 347 |
| 646 | 3300025915 | Ga0207693_10000238 | Ga0207693_1000023850 | 347 |
| 647 | 3300025916 | Ga0207663_10000287 | Ga0207663_100002877 | 347 |
| 648 | 3300025917 | Ga0207660_10067077 | Ga0207660_100670773 | 347 |
| 649 | 3300025919 | Ga0207657_10000279 | Ga0207657_1000027956 | 347 |
| 650 | 3300025921 | Ga0207652_10092478 | Ga0207652_100924783 | 347 |
| 651 | 3300025923 | Ga0207681_10055945 | Ga0207681_100559452 | 347 |
| 652 | 3300025924 | Ga0207694_10036825 | Ga0207694_100368253 | 347 |
| 653 | 3300025926 | Ga0207659_10041965 | Ga0207659_100419654 | 347 |
| 654 | 3300025927 | Ga0207687_10005003 | Ga0207687_100050034 | 347 |
| 655 | 3300025928 | Ga0207700_10015205 | Ga0207700_100152054 | 347 |
| 656 | 3300025929 | Ga0207664_10126779 | Ga0207664_101267792 | 347 |
| 657 | 3300025931 | Ga0207644_10071062 | Ga0207644_100710622 | 347 |
| 658 | 3300025932 | Ga0207690_10005905 | Ga0207690_100059055 | 347 |
| 659 | 3300025933 | Ga0207706_10000298 | Ga0207706_1000029855 | 347 |
| 660 | 3300025934 | Ga0207686_10030075 | Ga0207686_100300754 | 347 |
| 661 | 3300025935 | Ga0207709_10022986 | Ga0207709_100229862 | 347 |
| 662 | 3300025936 | Ga0207670_10039131 | Ga0207670_100391312 | 347 |
| 663 | 3300025937 | Ga0207669_10001168 | Ga0207669_1000116812 | 347 |
| 664 | 3300025939 | Ga0207665_10001494 | Ga0207665_1000149414 | 347 |
| 665 | 3300025940 | Ga0207691_10015272 | Ga0207691_100152725 | 347 |
| 666 | 3300025941 | Ga0207711_10031576 | Ga0207711_100315763 | 347 |
| 667 | 3300025942 | Ga0207689_10026905 | Ga0207689_100269055 | 347 |
| 668 | 3300025944 | Ga0207661_10106700 | Ga0207661_101067002 | 347 |
| 669 | 3300025945 | Ga0207679_10009757 | Ga0207679_100097573 | 347 |
| 670 | 3300025960 | Ga0207651_10079884 | Ga0207651_100798842 | 347 |
| 671 | 3300025961 | Ga0207712_10071366 | Ga0207712_100713662 | 347 |
| 672 | 3300025972 | Ga0207668_10019174 | Ga0207668_100191745 | 347 |
| 673 | 3300025981 | Ga0207640_10177932 | Ga0207640_101779321 | 347 |
| 674 | 3300025986 | Ga0207658_10010080 | Ga0207658_100100803 | 347 |
| 675 | 3300026035 | Ga0207703_10008056 | Ga0207703_100080563 | 347 |
| 676 | 3300026041 | Ga0207639_10009775 | Ga0207639_100097755 | 347 |
| 677 | 3300026067 | Ga0207678_10000147 | Ga0207678_1000014755 | 347 |
| 678 | 3300026075 | Ga0207708_10006016 | Ga0207708_100060167 | 347 |
| 679 | 3300026078 | Ga0207702_10036429 | Ga0207702_100364293 | 347 |
| 680 | 3300026088 | Ga0207641_10017382 | Ga0207641_100173822 | 347 |
| 681 | 3300026089 | Ga0207648_10037564 | Ga0207648_100375642 | 347 |
| 682 | 3300026095 | Ga0207676_10008137 | Ga0207676_100081376 | 347 |
| 683 | 3300026116 | Ga0207674_10001015 | Ga0207674_100010156 | 347 |
| 684 | 3300026118 | Ga0207675_100000256 | Ga0207675_10000025652 | 347 |
| 685 | 3300026121 | Ga0207683_10000481 | Ga0207683_1000048135 | 347 |
| 686 | 3300026142 | Ga0207698_10006361 | Ga0207698_100063615 | 347 |
| 687 | 3300028379 | Ga0268266_10054369 | Ga0268266_100543692 | 347 |
| 688 | 3300028380 | Ga0268265_10024682 | Ga0268265_100246823 | 347 |
| 689 | 3300028381 | Ga0268264_10044357 | Ga0268264_100443574 | 347 |
| 690 | 3300032133 | Ga0316583_10011203 | Ga0316583_100112032 | 347 |
| 691 | 3300035114 | Ga0373939_0031996 | Ga0373939_0031996_27_1070 | 347 |
| 692 | 3300035691 | Ga0373931_0034854 | Ga0373931_0034854_1449_2492 | 347 |
| 693 | 3300036647 | Ga0316582_0010864 | Ga0316582_0010864_3000_4043 | 347 |
| 694 | 3300037312 | Ga0395899_0285191 | Ga0395899_0285191_47_1090 | 347 |
| 695 | 3300037418 | Ga0395900_0043778 | Ga0395900_0043778_226_1269 | 347 |
| 696 | 3300037466 | Ga0395898_0013577 | Ga0395898_0013577_2265_3308 | 347 |
| 697 | 3300037471 | Ga0395905_0005466 | Ga0395905_0005466_7917_8960 | 347 |
| 698 | 3300037588 | Ga0316581_0007757 | Ga0316581_0007757_640_1683 | 347 |
| 699 | 3300038443 | Ga0395901_0038344 | Ga0395901_0038344_3042_4085 | 347 |
| 700 | 3300046491 | Ga0495584_0008789 | Ga0495584_0008789_2980_4023 | 347 |
| 701 | 3300046523 | Ga0495644_0043075 | Ga0495644_0043075_59_1102 | 347 |
| 702 | 3300046615 | Ga0495656_0013509 | Ga0495656_0013509_1844_2887 | 347 |
| 703 | 3300047321 | Ga0495676_0195687 | Ga0495676_0195687_323_1366 | 347 |
| 704 | 3300048903 | Ga0496100_0027864 | Ga0496100_0027864_521_1564 | 347 |
| 705 | 3300048904 | Ga0496101_0003051 | Ga0496101_0003051_8518_9561 | 347 |
| 706 | 3300048905 | Ga0496102_0026327 | Ga0496102_0026327_1517_2560 | 347 |
| 707 | 3300048905 | Ga0496102_0039066 | Ga0496102_0039066_2368_3411 | 347 |
| 708 | 3300048905 | Ga0496102_0149761 | Ga0496102_0149761_300_1343 | 347 |
| 709 | 3300048906 | Ga0496103_0016875 | Ga0496103_0016875_2100_3143 | 347 |
| 710 | 3300048906 | Ga0496103_0077622 | Ga0496103_0077622_178_1221 | 347 |
| 711 | 3300048907 | Ga0496104_0005722 | Ga0496104_0005722_6771_7814 | 347 |
| 712 | 3300048907 | Ga0496104_0030057 | Ga0496104_0030057_2368_3411 | 347 |
| 713 | 3300048907 | Ga0496104_0118063 | Ga0496104_0118063_855_1898 | 347 |
| 714 | 3300048907 | Ga0496104_0221501 | Ga0496104_0221501_112_1155 | 347 |
| 715 | 3300048908 | Ga0496105_0012770 | Ga0496105_0012770_2579_3622 | 347 |
| 716 | 3300048908 | Ga0496105_0014052 | Ga0496105_0014052_3436_4479 | 347 |
| 717 | 3300048908 | Ga0496105_0148154 | Ga0496105_0148154_157_1200 | 347 |
| 718 | 3300048909 | Ga0496106_0023465 | Ga0496106_0023465_1016_2059 | 347 |
| 719 | 3300048909 | Ga0496106_0033436 | Ga0496106_0033436_426_1469 | 347 |
| 720 | 3300048910 | Ga0496107_0018774 | Ga0496107_0018774_3040_4083 | 347 |
| 721 | 3300048910 | Ga0496107_0036689 | Ga0496107_0036689_219_1262 | 347 |
| 722 | 3300048910 | Ga0496107_0048501 | Ga0496107_0048501_569_1612 | 347 |
| 723 | 3300048910 | Ga0496107_0090042 | Ga0496107_0090042_449_1492 | 347 |
| 724 | 3300048911 | Ga0496108_0021693 | Ga0496108_0021693_775_1818 | 347 |
| 725 | 3300048911 | Ga0496108_0202542 | Ga0496108_0202542_273_1316 | 347 |
| 726 | 3300048912 | Ga0496109_0035964 | Ga0496109_0035964_1319_2362 | 347 |
| 727 | 3300048912 | Ga0496109_0041180 | Ga0496109_0041180_775_1818 | 347 |
| 728 | 3300048912 | Ga0496109_0049798 | Ga0496109_0049798_2206_3249 | 347 |
| 729 | 3300048912 | Ga0496109_0238586 | Ga0496109_0238586_169_1212 | 347 |
| 730 | 3300048913 | Ga0496110_0047849 | Ga0496110_0047849_2166_3209 | 347 |
| 731 | 3300048914 | Ga0496111_0014031 | Ga0496111_0014031_2972_4015 | 347 |
| 732 | 3300048914 | Ga0496111_0128705 | Ga0496111_0128705_420_1463 | 347 |
| 733 | 3300048915 | Ga0496112_0003536 | Ga0496112_0003536_2356_3399 | 347 |
| 734 | 3300048915 | Ga0496112_0013959 | Ga0496112_0013959_5981_7024 | 347 |
| 735 | 3300048916 | Ga0496113_0015547 | Ga0496113_0015547_2975_4018 | 347 |
| 736 | 3300048916 | Ga0496113_0063345 | Ga0496113_0063345_1477_2520 | 347 |
| 737 | 3300048917 | Ga0496114_0011742 | Ga0496114_0011742_1218_2261 | 347 |
| 738 | 3300048917 | Ga0496114_0063446 | Ga0496114_0063446_1195_2238 | 347 |
| 739 | 3300048918 | Ga0496115_0004532 | Ga0496115_0004532_3305_4348 | 347 |
| 740 | 3300048918 | Ga0496115_0007837 | Ga0496115_0007837_473_1516 | 347 |
| 741 | 3300049568 | Ga0501031_0032572 | Ga0501031_0032572_2038_3081 | 347 |
| 742 | 3300049568 | Ga0501031_0267329 | Ga0501031_0267329_37_1080 | 347 |
| 743 | 3300049569 | Ga0501032_0134508 | Ga0501032_0134508_402_1445 | 347 |
| 744 | 3300049569 | Ga0501032_0154909 | Ga0501032_0154909_351_1394 | 347 |
| 745 | 3300049572 | Ga0501036_0433179 | Ga0501036_0433179_22_1065 | 347 |
| 746 | 3300049573 | Ga0501037_0100717 | Ga0501037_0100717_404_1447 | 347 |
| 747 | 3300049574 | Ga0501038_0042838 | Ga0501038_0042838_2137_3180 | 347 |
| 748 | 3300049574 | Ga0501038_0166790 | Ga0501038_0166790_353_1396 | 347 |
| 749 | 3300049574 | Ga0501038_0278022 | Ga0501038_0278022_74_1150 | 347 |
| 750 | 3300049575 | Ga0501039_0050030 | Ga0501039_0050030_2126_3169 | 347 |
| 751 | 3300049576 | Ga0501040_0019021 | Ga0501040_0019021_3429_4472 | 347 |
| 752 | 3300049576 | Ga0501040_0069979 | Ga0501040_0069979_502_1545 | 347 |
| 753 | 3300049577 | Ga0501041_0011323 | Ga0501041_0011323_1997_3040 | 347 |
| 754 | 3300049577 | Ga0501041_0022453 | Ga0501041_0022453_448_1491 | 347 |
| 755 | 3300049577 | Ga0501041_0053028 | Ga0501041_0053028_981_2024 | 347 |
| 756 | 3300049577 | Ga0501041_0083261 | Ga0501041_0083261_712_1755 | 347 |
| 757 | 3300049577 | Ga0501041_0087204 | Ga0501041_0087204_556_1599 | 347 |
| 758 | 3300049578 | Ga0501042_0039929 | Ga0501042_0039929_1189_2232 | 347 |
| 759 | 3300049578 | Ga0501042_0087879 | Ga0501042_0087879_1058_2101 | 347 |
| 760 | 3300049578 | Ga0501042_0107026 | Ga0501042_0107026_511_1554 | 347 |
| 761 | 3300049579 | Ga0501043_0061995 | Ga0501043_0061995_605_1648 | 347 |
| 762 | 3300049579 | Ga0501043_0173619 | Ga0501043_0173619_544_1587 | 347 |
| 763 | 3300049580 | Ga0501046_0051777 | Ga0501046_0051777_1724_2767 | 347 |
| 764 | 3300049580 | Ga0501046_0064791 | Ga0501046_0064791_647_1690 | 347 |
| 765 | 3300049580 | Ga0501046_0176533 | Ga0501046_0176533_430_1473 | 347 |
| 766 | 3300049582 | Ga0501048_0034825 | Ga0501048_0034825_1122_2165 | 347 |
| 767 | 3300049582 | Ga0501048_0136010 | Ga0501048_0136010_370_1413 | 347 |
| 768 | 3300049582 | Ga0501048_0148190 | Ga0501048_0148190_329_1372 | 347 |
| 769 | 3300049582 | Ga0501048_0238124 | Ga0501048_0238124_91_1134 | 347 |
| 770 | 3300049584 | Ga0501068_0013109 | Ga0501068_0013109_2399_3442 | 347 |
| 771 | 3300049587 | Ga0501071_0011812 | Ga0501071_0011812_2733_3776 | 347 |
| 772 | 3300049587 | Ga0501071_0158670 | Ga0501071_0158670_423_1466 | 347 |
| 773 | 3300049587 | Ga0501071_0202563 | Ga0501071_0202563_85_1128 | 347 |
| 774 | 3300049588 | Ga0501072_0018777 | Ga0501072_0018777_795_1838 | 347 |
| 775 | 3300049588 | Ga0501072_0033228 | Ga0501072_0033228_2522_3565 | 347 |
| 776 | 3300049588 | Ga0501072_0058644 | Ga0501072_0058644_1929_2972 | 347 |
| 777 | 3300049588 | Ga0501072_0074870 | Ga0501072_0074870_847_1890 | 347 |
| 778 | 3300049588 | Ga0501072_0092065 | Ga0501072_0092065_310_1353 | 347 |
| 779 | 3300049588 | Ga0501072_0164154 | Ga0501072_0164154_53_1096 | 347 |
| 780 | 3300049590 | Ga0501074_0006129 | Ga0501074_0006129_5414_6457 | 347 |
| 781 | 3300049590 | Ga0501074_0036341 | Ga0501074_0036341_1005_2048 | 347 |
| 782 | 3300049590 | Ga0501074_0212053 | Ga0501074_0212053_74_1117 | 347 |
| 783 | 3300049591 | Ga0501075_0014112 | Ga0501075_0014112_2185_3228 | 347 |
| 784 | 3300049591 | Ga0501075_0081325 | Ga0501075_0081325_851_1894 | 347 |
| 785 | 3300049591 | Ga0501075_0099884 | Ga0501075_0099884_829_1872 | 347 |
| 786 | 3300049591 | Ga0501075_0141760 | Ga0501075_0141760_595_1638 | 347 |
| 787 | 3300049591 | Ga0501075_0179888 | Ga0501075_0179888_75_1118 | 347 |
| 788 | 3300049592 | Ga0501076_0005491 | Ga0501076_0005491_3303_4346 | 347 |
| 789 | 3300049592 | Ga0501076_0036967 | Ga0501076_0036967_787_1830 | 347 |
| 790 | 3300049592 | Ga0501076_0037909 | Ga0501076_0037909_620_1663 | 347 |
| 791 | 3300049593 | Ga0501077_0007434 | Ga0501077_0007434_3186_4229 | 347 |
| 792 | 3300049593 | Ga0501077_0035201 | Ga0501077_0035201_974_2017 | 347 |
| 793 | 3300049593 | Ga0501077_0049569 | Ga0501077_0049569_614_1657 | 347 |
| 794 | 3300049741 | Ga0501079_0015639 | Ga0501079_0015639_4457_5500 | 347 |
| 795 | 3300049742 | Ga0501080_0068732 | Ga0501080_0068732_516_1559 | 347 |
| 796 | 3300049742 | Ga0501080_0078421 | Ga0501080_0078421_1339_2382 | 347 |
| 797 | 3300049742 | Ga0501080_0250735 | Ga0501080_0250735_290_1333 | 347 |
| 798 | 3300049742 | Ga0501080_0443156 | Ga0501080_0443156_73_1116 | 347 |
| 799 | 3300049743 | Ga0501081_0013258 | Ga0501081_0013258_2480_3523 | 347 |
| 800 | 3300049743 | Ga0501081_0034250 | Ga0501081_0034250_1557_2600 | 347 |
| 801 | 3300049743 | Ga0501081_0154902 | Ga0501081_0154902_185_1228 | 347 |
| 802 | 3300049743 | Ga0501081_0169781 | Ga0501081_0169781_274_1317 | 347 |
| 803 | 3300049744 | Ga0501083_0123486 | Ga0501083_0123486_180_1223 | 347 |
| 804 | 3300049744 | Ga0501083_0143303 | Ga0501083_0143303_504_1547 | 347 |
| 805 | 3300049822 | Ga0501035_0091071 | Ga0501035_0091071_296_1339 | 347 |
| 806 | 3300049822 | Ga0501035_0099632 | Ga0501035_0099632_905_1948 | 347 |
| 807 | 3300049822 | Ga0501035_0114014 | Ga0501035_0114014_252_1295 | 347 |
| 808 | 3300049822 | Ga0501035_0152089 | Ga0501035_0152089_266_1309 | 347 |
| 809 | 3300049824 | Ga0501045_0005186 | Ga0501045_0005186_3619_4662 | 347 |
| 810 | 3300049824 | Ga0501045_0018625 | Ga0501045_0018625_2867_3910 | 347 |
| 811 | 3300049824 | Ga0501045_0180192 | Ga0501045_0180192_378_1421 | 347 |
| 812 | 3300050507 | nmdc:mga05p37_65041_c1 | nmdc:mga05p37_65041_c1_1838_2881 | 347 |
| 813 | 3300050509 | nmdc:mga0qj67_157229_c1 | nmdc:mga0qj67_157229_c1_570_1613 | 347 |
| 814 | 3300050510 | nmdc:mga06r32_74289_c1 | nmdc:mga06r32_74289_c1_807_1850 | 347 |
| 815 | 3300050511 | nmdc:mga08y16_278027_c1 | nmdc:mga08y16_278027_c1_426_1469 | 347 |
| 816 | 3300050511 | nmdc:mga08y16_529365_c1 | nmdc:mga08y16_529365_c1_53_1096 | 347 |
| 817 | 3300050513 | nmdc:mga0rr50_17468_c1 | nmdc:mga0rr50_17468_c1_1650_2693 | 347 |
| 818 | 3300050515 | nmdc:mga0a205_72477_c1 | nmdc:mga0a205_72477_c1_596_1639 | 347 |
| 819 | 3300053083 | Ga0495655_0013726 | Ga0495655_0013726_581_1624 | 347 |
| 820 | 3300054114 | Ga0501084_0035441 | Ga0501084_0035441_2899_3942 | 347 |
| 821 | 3300054114 | Ga0501084_0048951 | Ga0501084_0048951_695_1738 | 347 |
| 822 | 3300054114 | Ga0501084_0112004 | Ga0501084_0112004_1201_2244 | 347 |
| 823 | 3300060353 | Ga0501082_0004740 | Ga0501082_0004740_209_1252 | 347 |
| 824 | 3300060353 | Ga0501082_0031797 | Ga0501082_0031797_1579_2622 | 347 |
| 825 | 3300060353 | Ga0501082_0058326 | Ga0501082_0058326_1107_2150 | 347 |
| 826 | 3300061734 | Ga0530510_0001990 | Ga0530510_0001990_12240_13283 | 347 |
| 827 | 3300061734 | Ga0530510_0022809 | Ga0530510_0022809_1951_2994 | 347 |
| 828 | 3300061734 | Ga0530510_0027933 | Ga0530510_0027933_2151_3194 | 347 |
| 829 | 3300061734 | Ga0530510_0055856 | Ga0530510_0055856_971_2014 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6a1k-assembly1.cif.gz_B | phosphate acyltransferase plsx from b.subtilis | 0.8962 | 5 | 332 |
| 6a1k-assembly1.cif.gz_B | phosphate acyltransferase plsx from b.subtilis | 0.891 | 5 | 332 |
| 1vi1-assembly1.cif.gz_A | crystal structure of a fatty acid/phospholipid synthesis protein | 0.8838 | 5 | 334 |
| 1u7n-assembly1.cif.gz_A | crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 | 0.8795 | 5 | 332 |
| 1vi1-assembly2.cif.gz_B | crystal structure of a fatty acid/phospholipid synthesis protein | 0.8725 | 5 | 335 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P27247_3_343_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9378 | 5 | 339 | 3.40.718.10 |
| af_P27247_3_343_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9192 | 5 | 339 | 3.40.718.10 |
| 1u7nB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8612 | 7 | 332 | 3.40.718.10 |
| 1u7nB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8509 | 7 | 332 | 3.40.718.10 |
| 1vmiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isocitrate/Isopropylmalate dehydrogenase-like | 0.7621 | 125 | 244 | 3.40.50.10750 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436RKA8-F1-model_v4 | phosphate acyltransferase (EC 2.3.1.274) | 0.9752 | 5 | 100 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
| AF-A0A2A4LCX3-F1-model_v4 | Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) | 0.9743 | 1 | 339 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
| AF-A0A3C1B4Q7-F1-model_v4 | phosphate acyltransferase (EC 2.3.1.274) | 0.9724 | 1 | 119 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
| AF-A0A7C1SU67-F1-model_v4 | phosphate acyltransferase (EC 2.3.1.274) | 0.9723 | 5 | 165 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
| AF-A0A0A8K3G6-F1-model_v4 | Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) | 0.9672 | 22 | 347 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar