F482583

General Info

Members Datasets Scaffolds Average Seq Length
828 370 810 294

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928519762|2928520313
Length 276
Sequence IQGLGEMGASLASALSQRVENHVIGIDNQLLSRQYAMANNIVDETATSLADVVSRAEVIILATPIAVIKQTLKQLAVLPLKSNVIITDTGSTKSEIMSLAEAFVPKTATFIGGHAMAGTQNSGVSAANSDLYREVPYFLVTKHAPKETVIKLQSILAPIAARFIEIDAQQHDELVSWISDVPHIVSFALMNAVMQHFHSVSDFGPYVAGGFKDTTRIAASNPEVWRDILLSNKAAILSSNQDLIDELHRFNQVLRQNDSLGLEKLITQAQHARQQL

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
11 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
12 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221656 Pelomonas sp. Root405 Isolate Unclassified
15 2643221660 Methylibium sp. Root1272 Isolate Unclassified
16 2738541337 Pelomonas sp. BT06 Isolate Unclassified
17 2831864461 Roseateles noduli HZ7 Isolate Nodule
18 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
238 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
239 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
240 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
241 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
242 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
243 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
244 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
247 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
248 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
249 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
327 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
328 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
329 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
330 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
331 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
332 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
333 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
334 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
335 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
336 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
337 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
355 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
356 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
357 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
358 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
359 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
360 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
361 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
366 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
367 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
370 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0.24
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.06
Nodule 0.48
Rhizoplane 3.26
Rhizosphere 72.58
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001351 3300002773 Bacteria 10741
2 JGI25150J39212_1010495 3300002774 Bacteria 1719
3 JGI25153J46596_10003961 3300003215 Bacteria 8107
4 JGI25153J46596_10013555 3300003215 Bacteria 3437
5 rootH1_10027020 3300003316 Bacteria 7084
6 rootL2_10001380 3300003322 Bacteria 8605
7 rootL2_10022824 3300003322 Bacteria 4420
8 rootH1_10158640 3300003323 Bacteria 2487
9 JGI26128J50194_1000258 3300003347 Bacteria 2636
10 Ga0055526_1008178 3300003771 Bacteria 5262
11 Ga0055524_1000102 3300003775 Bacteria 105348
12 Ga0055530_10006141 3300003791 Bacteria 5455
13 Ga0055530_10014378 3300003791 Bacteria 2641
14 Ga0055540_1000002 3300003792 Bacteria 436954
15 Ga0055531_10000107 3300003794 Bacteria 91062
16 Ga0055531_10001967 3300003794 Bacteria 14330
17 Ga0055531_10003060 3300003794 Bacteria 10825
18 Ga0065165_1001184 3300005262 Bacteria 30266
19 Ga0065707_10084028 3300005295 Bacteria 7807
20 Ga0070658_10029927 3300005327 Bacteria 4375
21 Ga0070658_10105786 3300005327 Bacteria 2328
22 Ga0070658_10121654 3300005327 Bacteria 2169
23 Ga0070658_10179881 3300005327 Bacteria 1779
24 Ga0070658_10244441 3300005327 Bacteria 1522
25 Ga0070676_10004596 3300005328 Bacteria 7276
26 Ga0070676_10010958 3300005328 Bacteria 4926
27 Ga0070676_10093856 3300005328 Bacteria 1843
28 Ga0070676_10280031 3300005328 Bacteria 1123
29 Ga0070683_100092942 3300005329 Bacteria 2833
30 Ga0070690_100011621 3300005330 Bacteria 5154
31 Ga0070690_100071956 3300005330 Bacteria 2247
32 Ga0070670_100002048 3300005331 Bacteria 16500
33 Ga0070670_100008361 3300005331 Bacteria 8822
34 Ga0070670_100021861 3300005331 Bacteria 5502
35 Ga0070670_100025406 3300005331 Bacteria 5096
36 Ga0070670_100093319 3300005331 Bacteria 2589
37 Ga0070670_100121872 3300005331 Bacteria 2249
38 Ga0070670_100133015 3300005331 Bacteria 2148
39 Ga0070670_100158433 3300005331 Bacteria 1961
40 Ga0070677_10008624 3300005333 Bacteria 3436
41 Ga0068869_100019801 3300005334 Bacteria 4606
42 Ga0068869_100020284 3300005334 Bacteria 4556
43 Ga0068869_100103271 3300005334 Bacteria 2159
44 Ga0068869_100170879 3300005334 Bacteria 1698
45 Ga0070666_10020859 3300005335 Bacteria 4240
46 Ga0070666_10033849 3300005335 Bacteria 3385
47 Ga0070666_10253599 3300005335 Bacteria 1246
48 Ga0070680_100037136 3300005336 Bacteria 3936
49 Ga0068868_100013349 3300005338 Bacteria 6023
50 Ga0068868_100021229 3300005338 Bacteria 4890
51 Ga0068868_100024067 3300005338 Bacteria 4616
52 Ga0068868_100029737 3300005338 Bacteria 4185
53 Ga0070660_100009492 3300005339 Bacteria 6846
54 Ga0070660_100037209 3300005339 Bacteria 3689
55 Ga0070660_100046031 3300005339 Bacteria 3343
56 Ga0070661_100010860 3300005344 Bacteria 6342
57 Ga0070661_100025314 3300005344 Bacteria 4263
58 Ga0070661_100067906 3300005344 Bacteria 2620
59 Ga0070661_100169216 3300005344 Bacteria 1659
60 Ga0070668_100016454 3300005347 Bacteria 5529
61 Ga0070668_100047777 3300005347 Bacteria 3291
62 Ga0070669_100030988 3300005353 Bacteria 3861
63 Ga0070669_100041356 3300005353 Bacteria 3352
64 Ga0070669_100055512 3300005353 Bacteria 2902
65 Ga0070669_100058881 3300005353 Bacteria 2820
66 Ga0070669_100441712 3300005353 Bacteria 1071
67 Ga0070675_100006469 3300005354 Bacteria 8996
68 Ga0070675_100008748 3300005354 Bacteria 7864
69 Ga0070675_100044056 3300005354 Bacteria 3649
70 Ga0070675_100046192 3300005354 Bacteria 3565
71 Ga0070675_100078021 3300005354 Bacteria 2758
72 Ga0070675_100094373 3300005354 Bacteria 2510
73 Ga0070675_100160606 3300005354 Bacteria 1932
74 Ga0070671_100005645 3300005355 Bacteria 9957
75 Ga0070671_100008532 3300005355 Bacteria 8216
76 Ga0070671_100013751 3300005355 Bacteria 6529
77 Ga0070671_100022683 3300005355 Bacteria 5128
78 Ga0070671_100045805 3300005355 Bacteria 3636
79 Ga0070671_100067597 3300005355 Bacteria 2980
80 Ga0070671_100095140 3300005355 Bacteria 2497
81 Ga0070671_100181333 3300005355 Bacteria 1783
82 Ga0070671_100193312 3300005355 Bacteria 1725
83 Ga0070674_100012126 3300005356 Bacteria 5282
84 Ga0070674_100025563 3300005356 Bacteria 3846
85 Ga0070674_100071600 3300005356 Bacteria 2452
86 Ga0070674_100079278 3300005356 Bacteria 2343
87 Ga0070674_100132244 3300005356 Bacteria 1862
88 Ga0070674_100167505 3300005356 Bacteria 1672
89 Ga0070673_100009255 3300005364 Bacteria 6609
90 Ga0070673_100023993 3300005364 Bacteria 4464
91 Ga0070673_100216347 3300005364 Bacteria 1656
92 Ga0070659_100059640 3300005366 Bacteria 3013
93 Ga0070659_100393377 3300005366 Bacteria 1169
94 Ga0070667_100011064 3300005367 Bacteria 7463
95 Ga0070667_100023847 3300005367 Bacteria 5080
96 Ga0070667_100025961 3300005367 Bacteria 4872
97 Ga0070667_100586785 3300005367 Bacteria 1026
98 Ga0070700_100008788 3300005441 Bacteria 5517
99 Ga0070663_100007158 3300005455 Bacteria 6776
100 Ga0070663_100020351 3300005455 Bacteria 4392
101 Ga0070663_100110921 3300005455 Bacteria 2061
102 Ga0070678_100136783 3300005456 Bacteria 1955
103 Ga0070678_100201819 3300005456 Bacteria 1642
104 Ga0070678_100227375 3300005456 Bacteria 1554
105 Ga0070662_100004772 3300005457 Bacteria 8589
106 Ga0070662_100020745 3300005457 Bacteria 4480
107 Ga0070662_100022096 3300005457 Bacteria 4350
108 Ga0070662_100052621 3300005457 Bacteria 2944
109 Ga0070662_100099349 3300005457 Bacteria 2200
110 Ga0070662_100205977 3300005457 Bacteria 1563
111 Ga0068867_100000642 3300005459 Bacteria 23127
112 Ga0068867_100004124 3300005459 Bacteria 10204
113 Ga0068867_100005865 3300005459 Bacteria 8714
114 Ga0068867_100015749 3300005459 Bacteria 5366
115 Ga0068867_100050133 3300005459 Bacteria 3075
116 Ga0068867_100205067 3300005459 Bacteria 1580
117 Ga0068867_100434613 3300005459 Bacteria 1115
118 Ga0070685_10116127 3300005466 Bacteria 1656
119 Ga0070706_100002793 3300005467 Bacteria 17459
120 Ga0070707_100105284 3300005468 Bacteria 2735
121 Ga0070679_100328672 3300005530 Bacteria 1477
122 Ga0068853_100021319 3300005539 Bacteria 5401
123 Ga0068853_100026405 3300005539 Bacteria 4875
124 Ga0070672_100004613 3300005543 Bacteria 9024
125 Ga0070672_100011208 3300005543 Bacteria 6249
126 Ga0070672_100015698 3300005543 Bacteria 5406
127 Ga0070672_100023554 3300005543 Bacteria 4540
128 Ga0070672_100034805 3300005543 Bacteria 3824
129 Ga0070672_100083301 3300005543 Bacteria 2567
130 Ga0070672_100408634 3300005543 Bacteria 1164
131 Ga0070672_100420968 3300005543 Bacteria 1147
132 Ga0070665_100016656 3300005548 Bacteria 7366
133 Ga0068855_100032561 3300005563 Bacteria 6223
134 Ga0068855_100382622 3300005563 Bacteria 1545
135 Ga0070664_100006429 3300005564 Bacteria 9478
136 Ga0070664_100040387 3300005564 Bacteria 3933
137 Ga0070664_100072443 3300005564 Bacteria 2955
138 Ga0070664_100154891 3300005564 Bacteria 2024
139 Ga0070664_100194418 3300005564 Bacteria 1808
140 Ga0068854_100037510 3300005578 Bacteria 3403
141 Ga0068854_100224210 3300005578 Bacteria 1489
142 Ga0068856_100006124 3300005614 Bacteria 11806
143 Ga0068856_100123364 3300005614 Bacteria 2593
144 Ga0068852_100023193 3300005616 Bacteria 4990
145 Ga0068852_100027990 3300005616 Bacteria 4605
146 Ga0068852_100039338 3300005616 Bacteria 3981
147 Ga0068852_100109473 3300005616 Bacteria 2509
148 Ga0068852_100166749 3300005616 Bacteria 2061
149 Ga0068852_100248668 3300005616 Bacteria 1703
150 Ga0068852_100328211 3300005616 Bacteria 1488
151 Ga0068852_100447148 3300005616 Bacteria 1279
152 Ga0068852_100483701 3300005616 Bacteria 1230
153 Ga0068852_100585957 3300005616 Bacteria 1118
154 Ga0068864_100007037 3300005618 Bacteria 9235
155 Ga0068864_100015754 3300005618 Bacteria 6289
156 Ga0068864_100019407 3300005618 Bacteria 5685
157 Ga0068864_100023608 3300005618 Bacteria 5166
158 Ga0068866_10213288 3300005718 Bacteria 1160
159 Ga0068861_100006036 3300005719 Bacteria 8238
160 Ga0068861_100011309 3300005719 Bacteria 6198
161 Ga0068861_100014671 3300005719 Bacteria 5502
162 Ga0068861_100031192 3300005719 Bacteria 3913
163 Ga0068851_10002716 3300005834 Bacteria 7791
164 Ga0068851_10008035 3300005834 Bacteria 4867
165 Ga0068851_10089775 3300005834 Bacteria 1616
166 Ga0068870_10169441 3300005840 Bacteria 1302
167 Ga0068863_100038795 3300005841 Bacteria 4532
168 Ga0068863_100051820 3300005841 Bacteria 3889
169 Ga0068863_100162094 3300005841 Bacteria 2143
170 Ga0068863_100511226 3300005841 Bacteria 1183
171 Ga0068858_100002454 3300005842 Bacteria 18720
172 Ga0068858_100031054 3300005842 Bacteria 4961
173 Ga0068858_100035742 3300005842 Bacteria 4607
174 Ga0068858_100249447 3300005842 Bacteria 1686
175 Ga0068858_100439715 3300005842 Bacteria 1256
176 Ga0068860_100001400 3300005843 Bacteria 26146
177 Ga0068860_100022638 3300005843 Bacteria 6075
178 Ga0068860_100044197 3300005843 Bacteria 4246
179 Ga0068862_100036687 3300005844 Bacteria 4155
180 Ga0068862_100087461 3300005844 Bacteria 2710
181 Ga0075365_10015096 3300006038 Bacteria 4663
182 Ga0075368_10004264 3300006042 Bacteria 4828
183 Ga0075368_10083443 3300006042 Bacteria 1302
184 Ga0075363_100038499 3300006048 Bacteria 2515
185 Ga0075363_100104865 3300006048 Bacteria 1567
186 Ga0075364_10010325 3300006051 Bacteria 5636
187 Ga0075362_10003880 3300006177 Bacteria 5311
188 Ga0075362_10006506 3300006177 Bacteria 4360
189 Ga0075362_10015691 3300006177 Bacteria 3086
190 Ga0075362_10055107 3300006177 Bacteria 1788
191 Ga0075367_10005372 3300006178 Bacteria 6354
192 Ga0075367_10007232 3300006178 Bacteria 5673
193 Ga0075367_10055276 3300006178 Bacteria 2356
194 Ga0075369_10012194 3300006186 Bacteria 3394
195 Ga0075366_10003606 3300006195 Bacteria 8200
196 Ga0075366_10005541 3300006195 Bacteria 6841
197 Ga0075366_10005863 3300006195 Bacteria 6680
198 Ga0075366_10007743 3300006195 Bacteria 5949
199 Ga0075366_10008443 3300006195 Bacteria 5728
200 Ga0075366_10012804 3300006195 Bacteria 4767
201 Ga0075366_10026411 3300006195 Bacteria 3401
202 Ga0075366_10036785 3300006195 Bacteria 2887
203 Ga0075366_10051997 3300006195 Bacteria 2434
204 Ga0075366_10059162 3300006195 Bacteria 2276
205 Ga0075366_10080298 3300006195 Bacteria 1948
206 Ga0075366_10159899 3300006195 Bacteria 1365
207 Ga0075366_10214028 3300006195 Bacteria 1173
208 Ga0097621_100035033 3300006237 Bacteria 4008
209 Ga0097621_100060516 3300006237 Bacteria 3104
210 Ga0097621_100133673 3300006237 Bacteria 2114
211 Ga0097621_100312173 3300006237 Bacteria 1391
212 Ga0075370_10004685 3300006353 Bacteria 6673
213 Ga0075370_10008432 3300006353 Bacteria 5303
214 Ga0075370_10008717 3300006353 Bacteria 5231
215 Ga0075370_10014080 3300006353 Bacteria 4260
216 Ga0075370_10014150 3300006353 Bacteria 4251
217 Ga0075370_10019838 3300006353 Bacteria 3664
218 Ga0075370_10056044 3300006353 Bacteria 2240
219 Ga0075370_10068742 3300006353 Bacteria 2023
220 Ga0075370_10117372 3300006353 Bacteria 1547
221 Ga0075370_10250138 3300006353 Bacteria 1050
222 Ga0068871_100018527 3300006358 Bacteria 5293
223 Ga0068871_100018943 3300006358 Bacteria 5246
224 Ga0068871_100027282 3300006358 Bacteria 4465
225 Ga0068871_100093142 3300006358 Bacteria 2513
226 Ga0068871_100163356 3300006358 Bacteria 1905
227 Ga0075429_100014052 3300006880 Bacteria 6939
228 Ga0068865_100016820 3300006881 Bacteria 4689
229 Ga0068865_100038534 3300006881 Bacteria 3236
230 Ga0068865_100059102 3300006881 Bacteria 2681
231 Ga0099823_1020572 3300006944 Bacteria 6227
232 Ga0079104_1000688 3300006946 Bacteria 31113
233 Ga0075435_100479101 3300007076 Bacteria 1075
234 Ga0105240_10015269 3300009093 Bacteria 10451
235 Ga0105240_10392070 3300009093 Bacteria 1566
236 Ga0105245_10029559 3300009098 Bacteria 4843
237 Ga0105245_10035827 3300009098 Bacteria 4405
238 Ga0105245_10175292 3300009098 Bacteria 2045
239 Ga0105245_10439222 3300009098 Bacteria 1311
240 Ga0114129_10172375 3300009147 Bacteria 2949
241 Ga0114129_10689616 3300009147 Bacteria 1314
242 Ga0105243_10008061 3300009148 Bacteria 8088
243 Ga0105243_10008164 3300009148 Bacteria 8039
244 Ga0105243_10214660 3300009148 Bacteria 1696
245 Ga0105243_10276144 3300009148 Bacteria 1511
246 Ga0105248_10000644 3300009177 Bacteria 39638
247 Ga0105237_10001569 3300009545 Bacteria 29799
248 Ga0105237_10060506 3300009545 Bacteria 3789
249 Ga0105237_10060893 3300009545 Bacteria 3775
250 Ga0105237_10161907 3300009545 Bacteria 2236
251 Ga0105238_10015851 3300009551 Bacteria 7630
252 Ga0105238_10019682 3300009551 Bacteria 6873
253 Ga0105249_10140797 3300009553 Bacteria 2313
254 Ga0105249_10245605 3300009553 Bacteria 1772
255 Ga0105249_10267592 3300009553 Bacteria 1701
256 Ga0105239_10000486 3300010375 Bacteria 57901
257 Ga0105239_10096543 3300010375 Bacteria 3265
258 Ga0157319_1000001 3300012497 Bacteria 423237
259 Ga0157371_10079787 3300013102 Bacteria 2318
260 Ga0157369_10005235 3300013105 Bacteria 15129
261 Ga0157369_10441041 3300013105 Bacteria 1349
262 Ga0157374_10069109 3300013296 Bacteria 3325
263 Ga0157374_10106448 3300013296 Bacteria 2694
264 Ga0157374_10128359 3300013296 Bacteria 2452
265 Ga0157378_10020688 3300013297 Bacteria 5788
266 Ga0157378_10153560 3300013297 Bacteria 2146
267 Ga0163162_10003214 3300013306 Bacteria 15630
268 Ga0163162_10051816 3300013306 Bacteria 4120
269 Ga0163162_10073008 3300013306 Bacteria 3486
270 Ga0163162_10273416 3300013306 Bacteria 1821
271 Ga0157372_10014610 3300013307 Bacteria 8399
272 Ga0157372_10078250 3300013307 Bacteria 3736
273 Ga0157375_10037016 3300013308 Bacteria 4672
274 Ga0157375_10083876 3300013308 Bacteria 3233
275 Ga0157375_10149165 3300013308 Bacteria 2472
276 Ga0157375_10321526 3300013308 Bacteria 1712
277 Ga0163163_10063939 3300014325 Bacteria 3651
278 Ga0163163_10226094 3300014325 Bacteria 1920
279 Ga0163163_10259222 3300014325 Bacteria 1789
280 Ga0157380_10009160 3300014326 Bacteria 7082
281 Ga0157380_10015002 3300014326 Bacteria 5685
282 Ga0157380_10715303 3300014326 Bacteria 1008
283 Ga0157377_10000052 3300014745 Bacteria 89846
284 Ga0157377_10001746 3300014745 Bacteria 9477
285 Ga0157379_10011097 3300014968 Bacteria 7855
286 Ga0157379_10015903 3300014968 Bacteria 6614
287 Ga0157379_10050583 3300014968 Bacteria 3710
288 Ga0157379_10179771 3300014968 Bacteria 1911
289 Ga0157376_10129080 3300014969 Bacteria 2253
290 Ga0163161_10014307 3300017792 Bacteria 5523
291 Ga0163161_10138152 3300017792 Bacteria 1843
292 Ga0213872_10000016 3300021361 Bacteria 180524
293 Ga0213872_10000036 3300021361 Bacteria 129233
294 Ga0213872_10000804 3300021361 Bacteria 22814
295 Ga0213872_10005088 3300021361 Bacteria 6818
296 Ga0209563_100005 3300025230 Bacteria 1774893
297 Ga0207425_1001369 3300025245 Bacteria 10334
298 Ga0209129_1000012 3300025258 Bacteria 541516
299 Ga0209129_1015421 3300025258 Bacteria 1574
300 Ga0209673_1005911 3300025273 Bacteria 6046
301 Ga0209673_1009588 3300025273 Bacteria 4169
302 Ga0209673_1012584 3300025273 Bacteria 3399
303 Ga0209564_1000005 3300025295 Bacteria 1147192
304 Ga0209564_1000022 3300025295 Bacteria 555109
305 Ga0209758_1000099 3300025297 Bacteria 230054
306 Ga0209758_1000233 3300025297 Bacteria 116640
307 Ga0209050_1000165 3300025298 Bacteria 152109
308 Ga0209050_1003454 3300025298 Bacteria 11619
309 Ga0209050_1005020 3300025298 Bacteria 8594
310 Ga0209050_1005104 3300025298 Bacteria 8455
311 Ga0209256_1000011 3300025299 Bacteria 865309
312 Ga0209256_1000213 3300025299 Bacteria 108298
313 Ga0209256_1019763 3300025299 Bacteria 2130
314 Ga0209051_1000024 3300025303 Bacteria 437007
315 Ga0209051_1003799 3300025303 Bacteria 9660
316 Ga0209051_1017492 3300025303 Bacteria 3202
317 Ga0209051_1050987 3300025303 Bacteria 1381
318 Ga0209257_1000032 3300025304 Bacteria 680354
319 Ga0209257_1000079 3300025304 Bacteria 316420
320 Ga0209257_1004314 3300025304 Bacteria 11173
321 Ga0209257_1005076 3300025304 Bacteria 9557
322 Ga0209257_1015488 3300025304 Bacteria 3169
323 Ga0207697_10035759 3300025315 Bacteria 2034
324 Ga0207697_10146054 3300025315 Bacteria 1027
325 Ga0207656_10035874 3300025321 Bacteria 2079
326 Ga0207682_10007137 3300025893 Bacteria 4468
327 Ga0207682_10027910 3300025893 Bacteria 2249
328 Ga0207642_10038964 3300025899 Bacteria 2061
329 Ga0207710_10104713 3300025900 Bacteria 1338
330 Ga0207688_10038739 3300025901 Bacteria 2646
331 Ga0207688_10149739 3300025901 Bacteria 1378
332 Ga0207680_10029456 3300025903 Bacteria 3084
333 Ga0207680_10051294 3300025903 Bacteria 2467
334 Ga0207647_10080814 3300025904 Bacteria 1949
335 Ga0207645_10004234 3300025907 Bacteria 10652
336 Ga0207645_10012569 3300025907 Bacteria 5741
337 Ga0207645_10029621 3300025907 Bacteria 3528
338 Ga0207645_10102360 3300025907 Bacteria 1848
339 Ga0207705_10290717 3300025909 Bacteria 1252
340 Ga0207707_10174785 3300025912 Bacteria 1876
341 Ga0207695_10008032 3300025913 Bacteria 13283
342 Ga0207695_10274765 3300025913 Bacteria 1580
343 Ga0207671_10001963 3300025914 Bacteria 22689
344 Ga0207671_10357467 3300025914 Bacteria 1159
345 Ga0207660_10020015 3300025917 Bacteria 4484
346 Ga0207657_10014336 3300025919 Bacteria 7740
347 Ga0207657_10144514 3300025919 Bacteria 1941
348 Ga0207649_10008710 3300025920 Bacteria 5539
349 Ga0207681_10016288 3300025923 Bacteria 4648
350 Ga0207681_10047471 3300025923 Bacteria 2893
351 Ga0207681_10321680 3300025923 Bacteria 1230
352 Ga0207681_10419031 3300025923 Bacteria 1084
353 Ga0207694_10024236 3300025924 Bacteria 4607
354 Ga0207694_10143980 3300025924 Bacteria 1918
355 Ga0207650_10000348 3300025925 Bacteria 44624
356 Ga0207650_10008918 3300025925 Bacteria 6854
357 Ga0207650_10061253 3300025925 Bacteria 2809
358 Ga0207650_10122449 3300025925 Bacteria 2027
359 Ga0207650_10194507 3300025925 Bacteria 1622
360 Ga0207650_10198936 3300025925 Bacteria 1604
361 Ga0207650_10245846 3300025925 Bacteria 1447
362 Ga0207650_10360059 3300025925 Bacteria 1198
363 Ga0207659_10000583 3300025926 Bacteria 21821
364 Ga0207659_10002553 3300025926 Bacteria 10833
365 Ga0207659_10014174 3300025926 Bacteria 5132
366 Ga0207687_10169937 3300025927 Bacteria 1681
367 Ga0207687_10340736 3300025927 Bacteria 1219
368 Ga0207644_10000492 3300025931 Bacteria 25386
369 Ga0207644_10010547 3300025931 Bacteria 6091
370 Ga0207644_10023599 3300025931 Bacteria 4216
371 Ga0207644_10034408 3300025931 Bacteria 3545
372 Ga0207644_10058968 3300025931 Bacteria 2775
373 Ga0207644_10105696 3300025931 Bacteria 2121
374 Ga0207644_10199678 3300025931 Bacteria 1577
375 Ga0207644_10249044 3300025931 Bacteria 1417
376 Ga0207690_10020627 3300025932 Bacteria 4076
377 Ga0207690_10044370 3300025932 Bacteria 2930
378 Ga0207690_10125427 3300025932 Bacteria 1871
379 Ga0207690_10261190 3300025932 Bacteria 1342
380 Ga0207706_10015888 3300025933 Bacteria 6805
381 Ga0207706_10022266 3300025933 Bacteria 5687
382 Ga0207706_10025041 3300025933 Bacteria 5350
383 Ga0207706_10133552 3300025933 Bacteria 2183
384 Ga0207686_10043061 3300025934 Bacteria 2764
385 Ga0207686_10184100 3300025934 Bacteria 1483
386 Ga0207709_10004530 3300025935 Bacteria 8016
387 Ga0207709_10080541 3300025935 Bacteria 2097
388 Ga0207709_10095073 3300025935 Bacteria 1957
389 Ga0207709_10127319 3300025935 Bacteria 1730
390 Ga0207670_10009907 3300025936 Bacteria 5459
391 Ga0207670_10075551 3300025936 Bacteria 2342
392 Ga0207669_10003686 3300025937 Bacteria 6659
393 Ga0207669_10006877 3300025937 Bacteria 5230
394 Ga0207669_10018316 3300025937 Bacteria 3617
395 Ga0207669_10103966 3300025937 Bacteria 1885
396 Ga0207704_10009288 3300025938 Bacteria 4734
397 Ga0207704_10039296 3300025938 Bacteria 2754
398 Ga0207704_10042130 3300025938 Bacteria 2684
399 Ga0207691_10007412 3300025940 Bacteria 10562
400 Ga0207691_10020182 3300025940 Bacteria 6303
401 Ga0207691_10025082 3300025940 Bacteria 5600
402 Ga0207691_10036069 3300025940 Bacteria 4583
403 Ga0207691_10165140 3300025940 Bacteria 1941
404 Ga0207691_10220038 3300025940 Bacteria 1647
405 Ga0207711_10014620 3300025941 Bacteria 6523
406 Ga0207689_10010704 3300025942 Bacteria 7891
407 Ga0207661_10011795 3300025944 Bacteria 6345
408 Ga0207679_10000351 3300025945 Bacteria 33566
409 Ga0207679_10022902 3300025945 Bacteria 4261
410 Ga0207679_10071459 3300025945 Bacteria 2618
411 Ga0207679_10100490 3300025945 Bacteria 2260
412 Ga0207679_10125660 3300025945 Bacteria 2049
413 Ga0207679_10151534 3300025945 Bacteria 1888
414 Ga0207667_10119729 3300025949 Bacteria 2713
415 Ga0207651_10008816 3300025960 Bacteria 5473
416 Ga0207651_10010527 3300025960 Bacteria 5130
417 Ga0207712_10059781 3300025961 Bacteria 2699
418 Ga0207712_10130523 3300025961 Bacteria 1914
419 Ga0207668_10033023 3300025972 Bacteria 3426
420 Ga0207668_10040810 3300025972 Bacteria 3133
421 Ga0207668_10197810 3300025972 Bacteria 1598
422 Ga0207668_10614715 3300025972 Bacteria 948
423 Ga0207640_10258091 3300025981 Bacteria 1356
424 Ga0207658_10008172 3300025986 Bacteria 7125
425 Ga0207658_10016467 3300025986 Bacteria 5084
426 Ga0207658_10086291 3300025986 Bacteria 2420
427 Ga0207658_10126476 3300025986 Bacteria 2046
428 Ga0207677_10006793 3300026023 Bacteria 6282
429 Ga0207677_10008408 3300026023 Bacteria 5760
430 Ga0207677_10011753 3300026023 Bacteria 5004
431 Ga0207677_10039580 3300026023 Bacteria 3101
432 Ga0207677_10067627 3300026023 Bacteria 2504
433 Ga0207677_10071978 3300026023 Bacteria 2442
434 Ga0207703_10006182 3300026035 Bacteria 9582
435 Ga0207703_10042180 3300026035 Bacteria 3659
436 Ga0207703_10043436 3300026035 Bacteria 3607
437 Ga0207703_10172459 3300026035 Bacteria 1904
438 Ga0207639_10138046 3300026041 Bacteria 2028
439 Ga0207639_10303529 3300026041 Bacteria 1412
440 Ga0207678_10019654 3300026067 Bacteria 5940
441 Ga0207678_10051289 3300026067 Bacteria 3562
442 Ga0207678_10132803 3300026067 Bacteria 2124
443 Ga0207678_10448492 3300026067 Bacteria 1121
444 Ga0207678_10494600 3300026067 Bacteria 1066
445 Ga0207708_10013481 3300026075 Bacteria 6112
446 Ga0207702_10080509 3300026078 Bacteria 2826
447 Ga0207702_10122704 3300026078 Bacteria 2327
448 Ga0207702_10289979 3300026078 Bacteria 1550
449 Ga0207702_10387151 3300026078 Bacteria 1346
450 Ga0207641_10015872 3300026088 Bacteria 6167
451 Ga0207641_10153653 3300026088 Bacteria 2086
452 Ga0207648_10006696 3300026089 Bacteria 11428
453 Ga0207648_10006922 3300026089 Bacteria 11237
454 Ga0207648_10006965 3300026089 Bacteria 11188
455 Ga0207648_10013294 3300026089 Bacteria 7667
456 Ga0207648_10085172 3300026089 Bacteria 2757
457 Ga0207648_10094768 3300026089 Bacteria 2610
458 Ga0207648_10104408 3300026089 Bacteria 2485
459 Ga0207648_10149415 3300026089 Bacteria 2061
460 Ga0207648_10344551 3300026089 Bacteria 1342
461 Ga0207676_10001822 3300026095 Bacteria 15609
462 Ga0207676_10011015 3300026095 Bacteria 6455
463 Ga0207676_10019239 3300026095 Bacteria 4978
464 Ga0207676_10104531 3300026095 Bacteria 2356
465 Ga0207676_10489259 3300026095 Bacteria 1166
466 Ga0207674_10038138 3300026116 Bacteria 4992
467 Ga0207675_100004540 3300026118 Bacteria 13390
468 Ga0207675_100004707 3300026118 Bacteria 13136
469 Ga0207675_100014213 3300026118 Bacteria 7423
470 Ga0207675_100101496 3300026118 Bacteria 2711
471 Ga0207683_10020842 3300026121 Bacteria 5608
472 Ga0207683_10034755 3300026121 Bacteria 4382
473 Ga0207683_10056782 3300026121 Bacteria 3435
474 Ga0207683_10143025 3300026121 Bacteria 2156
475 Ga0207683_10147666 3300026121 Bacteria 2121
476 Ga0207683_10212812 3300026121 Bacteria 1760
477 Ga0207698_10030706 3300026142 Bacteria 3869
478 Ga0207698_10063072 3300026142 Bacteria 2898
479 Ga0207698_10081370 3300026142 Bacteria 2614
480 Ga0207698_10082403 3300026142 Bacteria 2600
481 Ga0207698_10084701 3300026142 Bacteria 2571
482 Ga0207698_10113956 3300026142 Bacteria 2273
483 Ga0207698_10164030 3300026142 Bacteria 1947
484 Ga0207698_10256973 3300026142 Bacteria 1602
485 Ga0207698_10426131 3300026142 Bacteria 1274
486 Ga0209281_1000042 3300027111 Bacteria 344748
487 Ga0209969_1004201 3300027360 Bacteria 2018
488 Ga0209968_1000176 3300027526 Bacteria 11068
489 Ga0209966_1000006 3300027695 Bacteria 102095
490 Ga0209998_10009287 3300027717 Bacteria 2042
491 Ga0209974_10016459 3300027876 Bacteria 2456
492 Ga0268266_10300460 3300028379 Bacteria 1497
493 Ga0268265_10008394 3300028380 Bacteria 6975
494 Ga0268265_10031149 3300028380 Bacteria 3850
495 Ga0268265_10167719 3300028380 Bacteria 1873
496 Ga0268265_10553428 3300028380 Bacteria 1092
497 Ga0268264_10005037 3300028381 Bacteria 11180
498 Ga0268264_10072163 3300028381 Bacteria 2927
499 Ga0268264_10208985 3300028381 Bacteria 1790
500 Ga0268264_10272318 3300028381 Bacteria 1582
501 Ga0268264_10320382 3300028381 Bacteria 1466
502 Ga0307517_10004982 3300028786 Bacteria 20222
503 Ga0307517_10087446 3300028786 Bacteria 2589
504 Ga0307517_10152281 3300028786 Bacteria 1582
505 Ga0307517_10185718 3300028786 Bacteria 1331
506 Ga0307515_10000020 3300028794 Bacteria 411735
507 Ga0307515_10000525 3300028794 Bacteria 91297
508 Ga0307515_10001622 3300028794 Bacteria 50061
509 Ga0307515_10015131 3300028794 Bacteria 14230
510 Ga0307515_10015416 3300028794 Bacteria 14081
511 Ga0307515_10016824 3300028794 Bacteria 13369
512 Ga0307515_10086229 3300028794 Bacteria 4005
513 Ga0307515_10164487 3300028794 Bacteria 2244
514 Ga0307515_10239809 3300028794 Bacteria 1587
515 Ga0307512_10063200 3300030522 Bacteria 2832
516 Ga0307513_10002553 3300031456 Bacteria 25147
517 Ga0307513_10039012 3300031456 Bacteria 5269
518 Ga0307513_10040644 3300031456 Bacteria 5141
519 Ga0307513_10044803 3300031456 Bacteria 4842
520 Ga0307513_10229244 3300031456 Bacteria 1671
521 Ga0307513_10280163 3300031456 Bacteria 1445
522 Ga0307509_10005169 3300031507 Bacteria 18309
523 Ga0307509_10023117 3300031507 Bacteria 6989
524 Ga0307509_10039152 3300031507 Bacteria 5166
525 Ga0307509_10052887 3300031507 Bacteria 4334
526 Ga0307509_10150861 3300031507 Bacteria 2240
527 Ga0307509_10206828 3300031507 Bacteria 1792
528 Ga0307509_10301794 3300031507 Bacteria 1349
529 Ga0307408_100000038 3300031548 Bacteria 183170
530 Ga0307408_100023553 3300031548 Bacteria 4196
531 Ga0307408_100096268 3300031548 Bacteria 2245
532 Ga0307408_100430525 3300031548 Bacteria 1140
533 Ga0307408_100515310 3300031548 Bacteria 1049
534 Ga0307508_10000007 3300031616 Bacteria 268359
535 Ga0307508_10000738 3300031616 Bacteria 38723
536 Ga0307508_10042723 3300031616 Bacteria 4064
537 Ga0307508_10134438 3300031616 Bacteria 2076
538 Ga0307514_10014340 3300031649 Bacteria 6562
539 Ga0307516_10003350 3300031730 Bacteria 20726
540 Ga0307516_10005683 3300031730 Bacteria 14791
541 Ga0307516_10007148 3300031730 Bacteria 12888
542 Ga0307516_10012873 3300031730 Bacteria 8976
543 Ga0307516_10047797 3300031730 Bacteria 4213
544 Ga0307516_10055228 3300031730 Bacteria 3878
545 Ga0307405_10037541 3300031731 Bacteria 2912
546 Ga0307413_10004001 3300031824 Bacteria 6333
547 Ga0307410_10013145 3300031852 Bacteria 4818
548 Ga0307406_10007866 3300031901 Bacteria 5934
549 Ga0307406_10070873 3300031901 Bacteria 2283
550 Ga0307407_10038907 3300031903 Bacteria 2640
551 Ga0307407_10097516 3300031903 Bacteria 1817
552 Ga0307412_10007008 3300031911 Bacteria 6397
553 Ga0307412_10499754 3300031911 Bacteria 1012
554 Ga0307409_100000998 3300031995 Bacteria 13235
555 Ga0307409_100024853 3300031995 Bacteria 4188
556 Ga0307409_100232311 3300031995 Bacteria 1673
557 Ga0307416_100010514 3300032002 Bacteria 6117
558 Ga0307416_100114686 3300032002 Bacteria 2384
559 Ga0307414_10050194 3300032004 Bacteria 2889
560 Ga0307414_10208028 3300032004 Bacteria 1597
561 Ga0307411_10000979 3300032005 Bacteria 10978
562 Ga0307411_10019052 3300032005 Bacteria 3953
563 Ga0307411_10285897 3300032005 Bacteria 1315
564 Ga0307415_100031801 3300032126 Bacteria 3405
565 Ga0307415_100051892 3300032126 Bacteria 2786
566 Ga0307507_10032760 3300033179 Bacteria 5415
567 Ga0307507_10119882 3300033179 Bacteria 2109
568 Ga0307510_10027873 3300033180 Bacteria 6461
569 Ga0307510_10036903 3300033180 Bacteria 5433
570 Ga0307510_10075055 3300033180 Bacteria 3336
571 Ga0307510_10213471 3300033180 Bacteria 1449
572 Ga0373936_0113328 3300035113 Bacteria 1153
573 Ga0373939_0000473 3300035114 Bacteria 10147
574 Ga0373945_0044197 3300035116 Bacteria 1619
575 Ga0373954_0056738 3300035118 Bacteria 1844
576 Ga0373943_0172921 3300035170 Bacteria 1183
577 Ga0373946_0055697 3300035171 Bacteria 1668
578 Ga0373955_0033098 3300035172 Bacteria 2720
579 Ga0373962_0093956 3300035242 Bacteria 927
580 Ga0373931_0000592 3300035691 Bacteria 14947
581 Ga0373931_0003802 3300035691 Bacteria 6830
582 Ga0373931_0014685 3300035691 Bacteria 3833
583 Ga0373927_0220710 3300035695 Bacteria 1245
584 Ga0373937_0027070 3300036401 Bacteria 5183
585 Ga0373937_0068865 3300036401 Bacteria 3262
586 Ga0373925_0182142 3300037068 Bacteria 1663
587 Ga0395900_0000378 3300037418 Bacteria 64374
588 Ga0395898_0001418 3300037466 Bacteria 34116
589 Ga0395905_0000140 3300037471 Bacteria 120221
590 Ga0395905_0010601 3300037471 Bacteria 8946
591 Ga0395905_0046174 3300037471 Bacteria 4084
592 Ga0395905_0071504 3300037471 Bacteria 3252
593 Ga0436361_0176167 3300039447 Bacteria 2834
594 Ga0436361_0376061 3300039447 Bacteria 200571
595 Ga0436361_0661219 3300039447 Bacteria 16120
596 Ga0436361_0850318 3300039447 Bacteria 4805
597 Ga0436361_1188656 3300039447 Bacteria 7770
598 Ga0439465_0040569 3300041413 Bacteria 1505
599 Ga0451795_1472563 3300041456 Bacteria 1594
600 Ga0451800_1509975 3300041459 Bacteria 1169
601 Ga0451802_0268620 3300041460 Bacteria 2271
602 Ga0451802_1769615 3300041460 Bacteria 1304
603 Ga0451807_0320661 3300041486 Bacteria 1563
604 Ga0439437_000875 3300042000 Bacteria 3132
605 Ga0439437_004926 3300042000 Bacteria 1464
606 Ga0439449_0018927 3300042007 Bacteria 2582
607 Ga0439450_006794 3300042008 Bacteria 2072
608 Ga0439454_014139 3300042011 Bacteria 1103
609 Ga0450917_000152 3300042120 Bacteria 4594
610 Ga0450890_000380 3300042127 Bacteria 6485
611 Ga0450890_001531 3300042127 Bacteria 3322
612 Ga0450891_000009 3300042129 Bacteria 14978
613 Ga0450892_001075 3300042130 Bacteria 2858
614 Ga0450898_024535 3300042134 Bacteria 1078
615 Ga0450899_001706 3300042135 Bacteria 2431
616 Ga0450889_000322 3300042144 Bacteria 5345
617 Ga0439446_0012141 3300042156 Bacteria 2350
618 Ga0439459_0001206 3300042438 Bacteria 3774
619 Ga0450916_011857 3300042530 Bacteria 1106
620 Ga0450918_000032 3300042531 Bacteria 28506
621 Ga0450893_0007029 3300042532 Bacteria 1824
622 Ga0451577_0016311 3300042876 Bacteria 6882
623 Ga0451577_0016490 3300042876 Bacteria 6840
624 Ga0451577_0018894 3300042876 Bacteria 6344
625 Ga0451577_0111724 3300042876 Bacteria 2445
626 Ga0466969_0000595 3300044656 Bacteria 19624
627 Ga0466969_0031112 3300044656 Bacteria 2717
628 Ga0466972_0004708 3300044658 Bacteria 6833
629 Ga0466972_0023937 3300044658 Bacteria 3034
630 Ga0466972_0092783 3300044658 Bacteria 1431
631 Ga0466965_0079289 3300044683 Bacteria 1658
632 Ga0466965_0163086 3300044683 Bacteria 1169
633 Ga0466966_0020813 3300044684 Bacteria 4312
634 Ga0466966_0072535 3300044684 Bacteria 2155
635 Ga0466961_0010868 3300044693 Bacteria 5814
636 Ga0466961_0022304 3300044693 Bacteria 4073
637 Ga0466963_0087157 3300044694 Bacteria 2122
638 Ga0466963_0191646 3300044694 Bacteria 1428
639 Ga0466964_0013194 3300044706 Bacteria 3132
640 Ga0453684_0052450 3300044712 Bacteria 5332
641 Ga0453684_0144500 3300044712 Bacteria 2836
642 Ga0453684_0162760 3300044712 Bacteria 2637
643 Ga0453684_0270026 3300044712 Bacteria 1944
644 Ga0453684_0284315 3300044712 Bacteria 1885
645 Ga0466970_0054937 3300044765 Bacteria 2126
646 Ga0466970_0063142 3300044765 Bacteria 1986
647 Ga0466957_0176607 3300044842 Bacteria 1393
648 Ga0466957_0198590 3300044842 Bacteria 1316
649 Ga0466960_0054584 3300044901 Bacteria 1940
650 Ga0466959_0016680 3300045049 Bacteria 5371
651 Ga0451576_0031221 3300045051 Bacteria 5682
652 Ga0451576_0057090 3300045051 Bacteria 4081
653 Ga0451576_0273449 3300045051 Bacteria 1766
654 Ga0451576_0339540 3300045051 Bacteria 1572
655 Ga0466967_0073560 3300045976 Bacteria 3066
656 Ga0495592_0015031 3300046454 Bacteria 5877
657 Ga0495629_0132975 3300046459 Bacteria 1733
658 Ga0495638_0059719 3300046460 Bacteria 2360
659 Ga0495650_0009265 3300046471 Bacteria 5622
660 Ga0495580_0038552 3300046472 Bacteria 3422
661 Ga0495580_0128718 3300046472 Bacteria 1757
662 Ga0495605_0068331 3300046474 Bacteria 1684
663 Ga0495664_0047649 3300046477 Bacteria 2544
664 Ga0495610_0058151 3300046512 Bacteria 1851
665 Ga0495620_0030046 3300046515 Bacteria 2507
666 Ga0495631_0086079 3300046518 Bacteria 1354
667 Ga0495632_0010505 3300046519 Bacteria 5474
668 Ga0495632_0012778 3300046519 Bacteria 4820
669 Ga0495632_0018008 3300046519 Bacteria 3884
670 Ga0495632_0042105 3300046519 Bacteria 2291
671 Ga0495643_0015622 3300046522 Bacteria 4481
672 Ga0495648_0065053 3300046524 Bacteria 2146
673 Ga0495648_0192729 3300046524 Bacteria 1027
674 Ga0495642_0063505 3300046528 Bacteria 1535
675 Ga0495586_0191238 3300046535 Bacteria 1159
676 Ga0495598_0035924 3300046537 Bacteria 1421
677 Ga0495621_0004199 3300046539 Bacteria 4024
678 Ga0495597_0108654 3300046542 Bacteria 1164
679 Ga0495645_0056885 3300046543 Bacteria 2840
680 Ga0495645_0131680 3300046543 Bacteria 1752
681 Ga0495622_0018138 3300046557 Bacteria 3278
682 Ga0495667_0198994 3300046559 Bacteria 1283
683 Ga0495611_0111293 3300046648 Bacteria 1275
684 Ga0495625_0056756 3300046660 Bacteria 2786
685 Ga0495635_0215317 3300046663 Bacteria 1300
686 Ga0495647_0009330 3300046681 Bacteria 3321
687 Ga0495658_0184818 3300046683 Bacteria 1294
688 Ga0495624_0064038 3300046690 Bacteria 2298
689 Ga0495670_0166774 3300046691 Bacteria 1159
690 Ga0495649_0003169 3300046694 Bacteria 11245
691 Ga0495649_0259629 3300046694 Bacteria 891
692 Ga0495600_0219065 3300046809 Bacteria 1218
693 Ga0495660_0026700 3300046810 Bacteria 3271
694 Ga0495687_008688 3300047443 Bacteria 5779
695 Ga0495684_0099654 3300047471 Bacteria 2197
696 Ga0495686_0019240 3300047472 Bacteria 4566
697 Ga0495686_0159652 3300047472 Bacteria 1318
698 Ga0495593_0021198 3300047673 Bacteria 3633
699 Ga0495602_0436431 3300048088 Bacteria 927
700 Ga0496102_0019412 3300048905 Bacteria 5988
701 Ga0496102_0019732 3300048905 Bacteria 5942
702 Ga0496104_0031558 3300048907 Bacteria 4928
703 Ga0496104_0042098 3300048907 Bacteria 4285
704 Ga0496104_0063012 3300048907 Bacteria 3516
705 Ga0496105_0232127 3300048908 Bacteria 1499
706 Ga0496106_0036433 3300048909 Bacteria 3680
707 Ga0496107_0020662 3300048910 Bacteria 4652
708 Ga0496108_0054149 3300048911 Bacteria 3367
709 Ga0496108_0059750 3300048911 Bacteria 3206
710 Ga0496108_0074503 3300048911 Bacteria 2866
711 Ga0496108_0396000 3300048911 Bacteria 1206
712 Ga0496109_0048691 3300048912 Bacteria 3856
713 Ga0496109_0158807 3300048912 Bacteria 2118
714 Ga0496110_0107019 3300048913 Bacteria 2510
715 Ga0496110_0221703 3300048913 Bacteria 1720
716 Ga0496111_0066936 3300048914 Bacteria 2609
717 Ga0496112_0138311 3300048915 Bacteria 2405
718 Ga0496113_0064832 3300048916 Bacteria 2763
719 Ga0496114_0020018 3300048917 Bacteria 5428
720 Ga0496114_0153338 3300048917 Bacteria 1999
721 Ga0496115_0020021 3300048918 Bacteria 5155
722 Ga0496121_0016606 3300048924 Bacteria 7587
723 Ga0496124_0000161 3300048927 Bacteria 136651
724 Ga0496125_0017717 3300048928 Bacteria 6780
725 Ga0501309_010734 3300049129 Bacteria 1185
726 Ga0501310_002501 3300049130 Bacteria 1751
727 Ga0501292_001467 3300049515 Bacteria 2907
728 Ga0501034_0116252 3300049571 Bacteria 2663
729 Ga0501039_0355635 3300049575 Bacteria 1151
730 Ga0501043_0013188 3300049579 Bacteria 6464
731 Ga0501046_0000049 3300049580 Bacteria 135088
732 Ga0501047_0000039 3300049581 Bacteria 187849
733 Ga0501048_0015557 3300049582 Bacteria 5619
734 Ga0501198_000166 3300049649 Bacteria 8715
735 Ga0501206_011526 3300049653 Bacteria 1194
736 Ga0501211_000398 3300049658 Bacteria 4143
737 Ga0501222_000256 3300049662 Bacteria 8961
738 Ga0501222_003094 3300049662 Bacteria 2285
739 Ga0501252_001271 3300049682 Bacteria 2281
740 Ga0501253_007103 3300049683 Bacteria 1550
741 Ga0501255_009784 3300049684 Bacteria 1071
742 Ga0501257_028200 3300049686 Bacteria 1346
743 Ga0501258_000887 3300049687 Bacteria 2249
744 Ga0501221_007219 3300049704 Bacteria 1899
745 Ga0501225_0020353 3300049705 Bacteria 1834
746 Ga0501267_001944 3300049764 Bacteria 1823
747 Ga0501035_0143246 3300049822 Bacteria 2077
748 Ga0501035_0332354 3300049822 Bacteria 1275
749 Ga0501044_0278747 3300049823 Bacteria 1606
750 Ga0501045_0024117 3300049824 Bacteria 4366
751 nmdc:mga03683_129445_c1 3300050489 Bacteria 1128
752 nmdc:mga03683_44576_c1 3300050489 Bacteria 1833
753 nmdc:mga03n38_74311_c1 3300050490 Bacteria 1581
754 nmdc:mga0k408_102377_c1 3300050493 Bacteria 1689
755 nmdc:mga0k408_10775_c2 3300050493 Bacteria 2658
756 nmdc:mga0k408_1102_c1 3300050493 Bacteria 14783
757 nmdc:mga0k408_121448_c1 3300050493 Bacteria 1547
758 nmdc:mga0k408_14563_c1 3300050493 Bacteria 4337
759 nmdc:mga0k408_183701_c1 3300050493 Bacteria 1247
760 nmdc:mga0k408_220299_c1 3300050493 Bacteria 1133
761 nmdc:mga0k408_3182_c1 3300050493 Bacteria 8694
762 nmdc:mga0k408_3241_c1 3300050493 Bacteria 8614
763 nmdc:mga0k408_3706_c1 3300050493 Bacteria 8095
764 nmdc:mga0k408_4690_c1 3300050493 Bacteria 7247
765 nmdc:mga0k408_4692_c1 3300050493 Bacteria 7245
766 nmdc:mga0k408_55825_c1 3300050493 Bacteria 2290
767 nmdc:mga0k408_66978_c1 3300050493 Bacteria 2092
768 nmdc:mga0k408_67756_c1 3300050493 Bacteria 2081
769 nmdc:mga0k408_69545_c1 3300050493 Bacteria 2055
770 nmdc:mga06z11_214880_c1 3300050494 Bacteria 1122
771 nmdc:mga06z11_22764_c1 3300050494 Bacteria 2932
772 nmdc:mga06z11_6551_c1 3300050494 Bacteria 4748
773 nmdc:mga04h51_10773_c1 3300050495 Bacteria 2521
774 nmdc:mga07m45_11905_c1 3300050496 Bacteria 4583
775 nmdc:mga07m45_2726_c1 3300050496 Bacteria 8326
776 nmdc:mga07m45_29645_c1 3300050496 Bacteria 3028
777 nmdc:mga07m45_44795_c1 3300050496 Bacteria 2483
778 nmdc:mga07m45_521_c1 3300050496 Bacteria 16326
779 nmdc:mga07m45_6176_c1 3300050496 Bacteria 6041
780 nmdc:mga05p37_219315_c1 3300050507 Bacteria 2296
781 nmdc:mga09592_28321_c1 3300050508 Bacteria 4654
782 nmdc:mga08y16_210159_c1 3300050511 Bacteria 2015
783 nmdc:mga0sz30_3842_c1 3300050516 Bacteria 5416
784 Ga0495601_0261976 3300053077 Bacteria 1128
785 Ga0500578_0000007 3300053086 Bacteria 229642
786 Ga0500644_0007389 3300053088 Bacteria 2860
787 Ga0500644_0020243 3300053088 Bacteria 1975
788 Ga0500644_0048148 3300053088 Bacteria 1449
789 Ga0500646_0014730 3300053090 Bacteria 2031
790 Ga0500651_0028496 3300053093 Bacteria 3511
791 Ga0500651_0094844 3300053093 Bacteria 1834
792 Ga0500556_0066206 3300053104 Bacteria 1341
793 Ga0500569_026989 3300053109 Bacteria 1579
794 Ga0500593_004305 3300053117 Bacteria 5501
795 Ga0500628_005054 3300053129 Bacteria 2191
796 Ga0500652_001774 3300053131 Bacteria 6541
797 Ga0500655_008958 3300053133 Bacteria 1800
798 Ga0500658_0009620 3300053134 Bacteria 3564
799 Ga0500658_0011046 3300053134 Bacteria 3329
800 Ga0500559_0000262 3300053136 Bacteria 41173
801 Ga0500568_0013553 3300053139 Bacteria 3713
802 Ga0500568_0045798 3300053139 Bacteria 1739
803 Ga0500568_0062489 3300053139 Bacteria 1438
804 Ga0500577_0019925 3300053142 Bacteria 2184
805 Ga0500590_006823 3300053148 Bacteria 5588
806 Ga0500619_000525 3300053154 Bacteria 6630
807 Ga0500622_0000359 3300053156 Bacteria 44261
808 Ga0500622_0003431 3300053156 Bacteria 10597
809 Ga0500645_004369 3300053730 Bacteria 5435
810 Ga0500587_001082 3300053739 Bacteria 3732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2928519762 2928520313 273
2 3300031730 Ga0307516_10007148 Ga0307516_100071483 280
3 3300035242 Ga0373962_0093956 Ga0373962_0093956_60_908 282
4 3300035695 Ga0373927_0220710 Ga0373927_0220710_202_1116 282
5 3300046694 Ga0495649_0259629 Ga0495649_0259629_18_866 282
6 3300048088 Ga0495602_0436431 Ga0495602_0436431_29_877 282
7 3300005295 Ga0065707_10084028 Ga0065707_100840283 284
8 3300005842 Ga0068858_100439715 Ga0068858_1004397151 284
9 3300046477 Ga0495664_0047649 Ga0495664_0047649_734_1615 284
10 3300046472 Ga0495580_0128718 Ga0495580_0128718_541_1401 286
11 3300025295 Ga0209564_1000005 Ga0209564_1000005366 288
12 3300028794 Ga0307515_10086229 Ga0307515_100862293 289
13 3300053139 Ga0500568_0013553 Ga0500568_0013553_2191_3063 289
14 3300005355 Ga0070671_100005645 Ga0070671_1000056454 290
15 3300005618 Ga0068864_100019407 Ga0068864_1000194073 290
16 3300009177 Ga0105248_10000644 Ga0105248_1000064419 290
17 3300025941 Ga0207711_10014620 Ga0207711_100146204 290
18 3300026095 Ga0207676_10104531 Ga0207676_101045311 290
19 3300028794 Ga0307515_10239809 Ga0307515_102398092 290
20 3300048907 Ga0496104_0042098 Ga0496104_0042098_916_1791 290
21 3300048908 Ga0496105_0232127 Ga0496105_0232127_361_1236 290
22 3300048911 Ga0496108_0074503 Ga0496108_0074503_649_1524 290
23 3300048915 Ga0496112_0138311 Ga0496112_0138311_710_1585 290
24 iso_pu_bacteria 2585428057 2587728244 290
25 iso_pu_bacteria 2585428058 2587734550 290
26 iso_pu_bacteria 2585428062 2587755467 290
27 iso_pu_bacteria 2588253510 2588295702 290
28 iso_pu_bacteria 2643221592 2643971114 290
29 iso_pu_bacteria 2643221625 2644142119 290
30 iso_pu_bacteria 2643221644 2644246044 290
31 iso_pu_bacteria 2643221648 2644275371 290
32 iso_pu_bacteria 2643221654 2644304095 290
33 iso_pu_bacteria 2643221660 2644337335 290
34 3300009147 Ga0114129_10172375 Ga0114129_101723752 291
35 3300021361 Ga0213872_10000804 Ga0213872_1000080416 291
36 3300039447 Ga0436361_0176167 Ga0436361_0176167_16_891 291
37 3300039447 Ga0436361_0661219 Ga0436361_0661219_4614_5507 291
38 3300050507 nmdc:mga05p37_219315_c1 nmdc:mga05p37_219315_c1_651_1529 291
39 iso_pu_bacteria 2643221544 2643746796 291
40 iso_pu_bacteria 2643221585 2643935663 291
41 iso_pu_bacteria 2643221639 2644221134 291
42 iso_pu_bacteria 2643221646 2644259976 291
43 iso_pu_bacteria 2643221656 2644317446 291
44 iso_pu_bacteria 2738541337 2739057628 291
45 iso_pu_bacteria 2831864461 2831866675 291
46 3300005366 Ga0070659_100393377 Ga0070659_1003933771 292
47 3300005456 Ga0070678_100136783 Ga0070678_1001367832 292
48 3300009093 Ga0105240_10015269 Ga0105240_100152699 292
49 3300009545 Ga0105237_10001569 Ga0105237_1000156916 292
50 3300009551 Ga0105238_10015851 Ga0105238_100158513 292
51 3300010375 Ga0105239_10000486 Ga0105239_1000048622 292
52 3300014326 Ga0157380_10715303 Ga0157380_107153032 292
53 3300021361 Ga0213872_10000036 Ga0213872_1000003678 292
54 3300021361 Ga0213872_10005088 Ga0213872_100050884 292
55 3300025913 Ga0207695_10008032 Ga0207695_1000803211 292
56 3300025914 Ga0207671_10001963 Ga0207671_1000196319 292
57 3300025924 Ga0207694_10024236 Ga0207694_100242363 292
58 3300025932 Ga0207690_10261190 Ga0207690_102611902 292
59 3300026041 Ga0207639_10303529 Ga0207639_103035292 292
60 3300026121 Ga0207683_10147666 Ga0207683_101476662 292
61 3300026142 Ga0207698_10084701 Ga0207698_100847012 292
62 3300028794 Ga0307515_10016824 Ga0307515_100168249 292
63 3300031730 Ga0307516_10005683 Ga0307516_1000568310 292
64 3300037471 Ga0395905_0000140 Ga0395905_0000140_100974_101855 292
65 3300039447 Ga0436361_0850318 Ga0436361_0850318_2397_3278 292
66 3300039447 Ga0436361_1188656 Ga0436361_1188656_3857_4735 292
67 3300041460 Ga0451802_1769615 Ga0451802_1769615_230_1111 292
68 3300042876 Ga0451577_0016311 Ga0451577_0016311_1581_2468 292
69 3300042876 Ga0451577_0111724 Ga0451577_0111724_672_1550 292
70 3300044656 Ga0466969_0000595 Ga0466969_0000595_2983_3861 292
71 3300044658 Ga0466972_0023937 Ga0466972_0023937_396_1277 292
72 3300044684 Ga0466966_0072535 Ga0466966_0072535_1167_2045 292
73 3300044693 Ga0466961_0022304 Ga0466961_0022304_836_1714 292
74 3300044712 Ga0453684_0284315 Ga0453684_0284315_765_1643 292
75 3300006195 Ga0075366_10080298 Ga0075366_100802982 293
76 3300006880 Ga0075429_100014052 Ga0075429_1000140524 293
77 3300021361 Ga0213872_10000016 Ga0213872_10000016129 293
78 3300025230 Ga0209563_100005 Ga0209563_1000051270 293
79 3300025949 Ga0207667_10119729 Ga0207667_101197292 293
80 3300031456 Ga0307513_10002553 Ga0307513_100025537 293
81 3300031730 Ga0307516_10047797 Ga0307516_100477975 293
82 3300039447 Ga0436361_0376061 Ga0436361_0376061_156892_157785 293
83 3300041413 Ga0439465_0040569 Ga0439465_0040569_415_1299 293
84 3300042134 Ga0450898_024535 Ga0450898_024535_164_1048 293
85 3300042876 Ga0451577_0018894 Ga0451577_0018894_2841_3725 293
86 3300044712 Ga0453684_0144500 Ga0453684_0144500_403_1287 293
87 3300044712 Ga0453684_0162760 Ga0453684_0162760_374_1279 293
88 3300045051 Ga0451576_0339540 Ga0451576_0339540_327_1211 293
89 3300046471 Ga0495650_0009265 Ga0495650_0009265_2238_3122 293
90 3300047472 Ga0495686_0019240 Ga0495686_0019240_855_1739 293
91 3300049571 Ga0501034_0116252 Ga0501034_0116252_20_904 293
92 3300050493 nmdc:mga0k408_121448_c1 nmdc:mga0k408_121448_c1_503_1393 293
93 3300050508 nmdc:mga09592_28321_c1 nmdc:mga09592_28321_c1_1495_2376 293
94 3300003215 JGI25153J46596_10003961 JGI25153J46596_100039615 294
95 3300003316 rootH1_10027020 rootH1_100270203 294
96 3300003322 rootL2_10001380 rootL2_100013804 294
97 3300003347 JGI26128J50194_1000258 JGI26128J50194_10002582 294
98 3300003775 Ga0055524_1000102 Ga0055524_100010299 294
99 3300003791 Ga0055530_10006141 Ga0055530_100061412 294
100 3300003791 Ga0055530_10014378 Ga0055530_100143783 294
101 3300003792 Ga0055540_1000002 Ga0055540_100000298 294
102 3300003794 Ga0055531_10001967 Ga0055531_1000196711 294
103 3300003794 Ga0055531_10003060 Ga0055531_100030607 294
104 3300005262 Ga0065165_1001184 Ga0065165_10011842 294
105 3300005327 Ga0070658_10029927 Ga0070658_100299274 294
106 3300005327 Ga0070658_10105786 Ga0070658_101057862 294
107 3300005327 Ga0070658_10121654 Ga0070658_101216542 294
108 3300005327 Ga0070658_10179881 Ga0070658_101798812 294
109 3300005327 Ga0070658_10244441 Ga0070658_102444412 294
110 3300005328 Ga0070676_10004596 Ga0070676_100045964 294
111 3300005328 Ga0070676_10010958 Ga0070676_100109582 294
112 3300005328 Ga0070676_10093856 Ga0070676_100938562 294
113 3300005328 Ga0070676_10280031 Ga0070676_102800312 294
114 3300005329 Ga0070683_100092942 Ga0070683_1000929422 294
115 3300005330 Ga0070690_100011621 Ga0070690_1000116213 294
116 3300005330 Ga0070690_100071956 Ga0070690_1000719562 294
117 3300005331 Ga0070670_100002048 Ga0070670_10000204811 294
118 3300005331 Ga0070670_100008361 Ga0070670_1000083615 294
119 3300005331 Ga0070670_100021861 Ga0070670_1000218614 294
120 3300005331 Ga0070670_100025406 Ga0070670_1000254064 294
121 3300005331 Ga0070670_100093319 Ga0070670_1000933191 294
122 3300005331 Ga0070670_100121872 Ga0070670_1001218722 294
123 3300005331 Ga0070670_100133015 Ga0070670_1001330152 294
124 3300005331 Ga0070670_100158433 Ga0070670_1001584332 294
125 3300005333 Ga0070677_10008624 Ga0070677_100086244 294
126 3300005334 Ga0068869_100019801 Ga0068869_1000198012 294
127 3300005334 Ga0068869_100020284 Ga0068869_1000202844 294
128 3300005334 Ga0068869_100103271 Ga0068869_1001032712 294
129 3300005334 Ga0068869_100170879 Ga0068869_1001708792 294
130 3300005335 Ga0070666_10020859 Ga0070666_100208594 294
131 3300005335 Ga0070666_10033849 Ga0070666_100338492 294
132 3300005335 Ga0070666_10253599 Ga0070666_102535991 294
133 3300005336 Ga0070680_100037136 Ga0070680_1000371362 294
134 3300005338 Ga0068868_100013349 Ga0068868_1000133492 294
135 3300005338 Ga0068868_100021229 Ga0068868_1000212292 294
136 3300005338 Ga0068868_100024067 Ga0068868_1000240673 294
137 3300005338 Ga0068868_100029737 Ga0068868_1000297371 294
138 3300005339 Ga0070660_100009492 Ga0070660_1000094922 294
139 3300005339 Ga0070660_100037209 Ga0070660_1000372092 294
140 3300005339 Ga0070660_100046031 Ga0070660_1000460312 294
141 3300005344 Ga0070661_100010860 Ga0070661_1000108603 294
142 3300005344 Ga0070661_100025314 Ga0070661_1000253142 294
143 3300005344 Ga0070661_100067906 Ga0070661_1000679062 294
144 3300005344 Ga0070661_100169216 Ga0070661_1001692161 294
145 3300005347 Ga0070668_100016454 Ga0070668_1000164543 294
146 3300005347 Ga0070668_100047777 Ga0070668_1000477772 294
147 3300005353 Ga0070669_100030988 Ga0070669_1000309883 294
148 3300005353 Ga0070669_100041356 Ga0070669_1000413562 294
149 3300005353 Ga0070669_100055512 Ga0070669_1000555122 294
150 3300005353 Ga0070669_100058881 Ga0070669_1000588812 294
151 3300005353 Ga0070669_100441712 Ga0070669_1004417121 294
152 3300005354 Ga0070675_100006469 Ga0070675_1000064695 294
153 3300005354 Ga0070675_100008748 Ga0070675_1000087485 294
154 3300005354 Ga0070675_100044056 Ga0070675_1000440563 294
155 3300005354 Ga0070675_100046192 Ga0070675_1000461922 294
156 3300005354 Ga0070675_100078021 Ga0070675_1000780212 294
157 3300005354 Ga0070675_100094373 Ga0070675_1000943732 294
158 3300005354 Ga0070675_100160606 Ga0070675_1001606062 294
159 3300005355 Ga0070671_100008532 Ga0070671_1000085324 294
160 3300005355 Ga0070671_100013751 Ga0070671_1000137514 294
161 3300005355 Ga0070671_100022683 Ga0070671_1000226834 294
162 3300005355 Ga0070671_100045805 Ga0070671_1000458052 294
163 3300005355 Ga0070671_100067597 Ga0070671_1000675972 294
164 3300005355 Ga0070671_100095140 Ga0070671_1000951402 294
165 3300005355 Ga0070671_100181333 Ga0070671_1001813331 294
166 3300005355 Ga0070671_100193312 Ga0070671_1001933122 294
167 3300005356 Ga0070674_100012126 Ga0070674_1000121262 294
168 3300005356 Ga0070674_100025563 Ga0070674_1000255632 294
169 3300005356 Ga0070674_100071600 Ga0070674_1000716002 294
170 3300005356 Ga0070674_100079278 Ga0070674_1000792782 294
171 3300005356 Ga0070674_100132244 Ga0070674_1001322442 294
172 3300005356 Ga0070674_100167505 Ga0070674_1001675052 294
173 3300005364 Ga0070673_100009255 Ga0070673_1000092554 294
174 3300005364 Ga0070673_100023993 Ga0070673_1000239932 294
175 3300005364 Ga0070673_100216347 Ga0070673_1002163472 294
176 3300005366 Ga0070659_100059640 Ga0070659_1000596402 294
177 3300005367 Ga0070667_100011064 Ga0070667_1000110643 294
178 3300005367 Ga0070667_100023847 Ga0070667_1000238473 294
179 3300005367 Ga0070667_100025961 Ga0070667_1000259614 294
180 3300005367 Ga0070667_100586785 Ga0070667_1005867851 294
181 3300005441 Ga0070700_100008788 Ga0070700_1000087883 294
182 3300005455 Ga0070663_100007158 Ga0070663_1000071582 294
183 3300005455 Ga0070663_100020351 Ga0070663_1000203512 294
184 3300005455 Ga0070663_100110921 Ga0070663_1001109212 294
185 3300005456 Ga0070678_100201819 Ga0070678_1002018192 294
186 3300005456 Ga0070678_100227375 Ga0070678_1002273752 294
187 3300005457 Ga0070662_100004772 Ga0070662_1000047725 294
188 3300005457 Ga0070662_100020745 Ga0070662_1000207452 294
189 3300005457 Ga0070662_100022096 Ga0070662_1000220963 294
190 3300005457 Ga0070662_100052621 Ga0070662_1000526212 294
191 3300005457 Ga0070662_100099349 Ga0070662_1000993492 294
192 3300005457 Ga0070662_100205977 Ga0070662_1002059772 294
193 3300005459 Ga0068867_100000642 Ga0068867_10000064218 294
194 3300005459 Ga0068867_100004124 Ga0068867_1000041246 294
195 3300005459 Ga0068867_100005865 Ga0068867_1000058653 294
196 3300005459 Ga0068867_100015749 Ga0068867_1000157493 294
197 3300005459 Ga0068867_100050133 Ga0068867_1000501332 294
198 3300005459 Ga0068867_100205067 Ga0068867_1002050671 294
199 3300005459 Ga0068867_100434613 Ga0068867_1004346131 294
200 3300005466 Ga0070685_10116127 Ga0070685_101161272 294
201 3300005467 Ga0070706_100002793 Ga0070706_1000027933 294
202 3300005468 Ga0070707_100105284 Ga0070707_1001052842 294
203 3300005530 Ga0070679_100328672 Ga0070679_1003286722 294
204 3300005539 Ga0068853_100021319 Ga0068853_1000213192 294
205 3300005539 Ga0068853_100026405 Ga0068853_1000264052 294
206 3300005543 Ga0070672_100004613 Ga0070672_1000046135 294
207 3300005543 Ga0070672_100011208 Ga0070672_1000112082 294
208 3300005543 Ga0070672_100015698 Ga0070672_1000156983 294
209 3300005543 Ga0070672_100023554 Ga0070672_1000235543 294
210 3300005543 Ga0070672_100034805 Ga0070672_1000348052 294
211 3300005543 Ga0070672_100083301 Ga0070672_1000833013 294
212 3300005543 Ga0070672_100408634 Ga0070672_1004086342 294
213 3300005543 Ga0070672_100420968 Ga0070672_1004209682 294
214 3300005548 Ga0070665_100016656 Ga0070665_1000166566 294
215 3300005563 Ga0068855_100032561 Ga0068855_1000325613 294
216 3300005563 Ga0068855_100382622 Ga0068855_1003826222 294
217 3300005564 Ga0070664_100006429 Ga0070664_1000064295 294
218 3300005564 Ga0070664_100040387 Ga0070664_1000403874 294
219 3300005564 Ga0070664_100072443 Ga0070664_1000724433 294
220 3300005564 Ga0070664_100154891 Ga0070664_1001548912 294
221 3300005564 Ga0070664_100194418 Ga0070664_1001944182 294
222 3300005578 Ga0068854_100037510 Ga0068854_1000375104 294
223 3300005578 Ga0068854_100224210 Ga0068854_1002242102 294
224 3300005614 Ga0068856_100006124 Ga0068856_1000061242 294
225 3300005614 Ga0068856_100123364 Ga0068856_1001233642 294
226 3300005616 Ga0068852_100023193 Ga0068852_1000231932 294
227 3300005616 Ga0068852_100027990 Ga0068852_1000279904 294
228 3300005616 Ga0068852_100039338 Ga0068852_1000393382 294
229 3300005616 Ga0068852_100109473 Ga0068852_1001094731 294
230 3300005616 Ga0068852_100166749 Ga0068852_1001667492 294
231 3300005616 Ga0068852_100248668 Ga0068852_1002486682 294
232 3300005616 Ga0068852_100328211 Ga0068852_1003282112 294
233 3300005616 Ga0068852_100447148 Ga0068852_1004471482 294
234 3300005616 Ga0068852_100483701 Ga0068852_1004837012 294
235 3300005616 Ga0068852_100585957 Ga0068852_1005859572 294
236 3300005618 Ga0068864_100007037 Ga0068864_1000070373 294
237 3300005618 Ga0068864_100015754 Ga0068864_1000157544 294
238 3300005618 Ga0068864_100023608 Ga0068864_1000236084 294
239 3300005718 Ga0068866_10213288 Ga0068866_102132881 294
240 3300005719 Ga0068861_100006036 Ga0068861_1000060366 294
241 3300005719 Ga0068861_100011309 Ga0068861_1000113094 294
242 3300005719 Ga0068861_100014671 Ga0068861_1000146712 294
243 3300005719 Ga0068861_100031192 Ga0068861_1000311923 294
244 3300005834 Ga0068851_10002716 Ga0068851_100027163 294
245 3300005834 Ga0068851_10008035 Ga0068851_100080354 294
246 3300005834 Ga0068851_10089775 Ga0068851_100897752 294
247 3300005840 Ga0068870_10169441 Ga0068870_101694412 294
248 3300005841 Ga0068863_100038795 Ga0068863_1000387954 294
249 3300005841 Ga0068863_100051820 Ga0068863_1000518202 294
250 3300005841 Ga0068863_100162094 Ga0068863_1001620942 294
251 3300005841 Ga0068863_100511226 Ga0068863_1005112262 294
252 3300005842 Ga0068858_100002454 Ga0068858_10000245417 294
253 3300005842 Ga0068858_100031054 Ga0068858_1000310543 294
254 3300005842 Ga0068858_100035742 Ga0068858_1000357422 294
255 3300005842 Ga0068858_100249447 Ga0068858_1002494472 294
256 3300005843 Ga0068860_100001400 Ga0068860_1000014003 294
257 3300005843 Ga0068860_100022638 Ga0068860_1000226384 294
258 3300005843 Ga0068860_100044197 Ga0068860_1000441972 294
259 3300005844 Ga0068862_100036687 Ga0068862_1000366872 294
260 3300005844 Ga0068862_100087461 Ga0068862_1000874612 294
261 3300006038 Ga0075365_10015096 Ga0075365_100150962 294
262 3300006042 Ga0075368_10004264 Ga0075368_100042642 294
263 3300006042 Ga0075368_10083443 Ga0075368_100834431 294
264 3300006048 Ga0075363_100038499 Ga0075363_1000384992 294
265 3300006048 Ga0075363_100104865 Ga0075363_1001048652 294
266 3300006051 Ga0075364_10010325 Ga0075364_100103254 294
267 3300006177 Ga0075362_10003880 Ga0075362_100038803 294
268 3300006177 Ga0075362_10006506 Ga0075362_100065062 294
269 3300006177 Ga0075362_10015691 Ga0075362_100156912 294
270 3300006177 Ga0075362_10055107 Ga0075362_100551072 294
271 3300006178 Ga0075367_10005372 Ga0075367_100053723 294
272 3300006178 Ga0075367_10007232 Ga0075367_100072323 294
273 3300006178 Ga0075367_10055276 Ga0075367_100552762 294
274 3300006186 Ga0075369_10012194 Ga0075369_100121942 294
275 3300006195 Ga0075366_10003606 Ga0075366_100036065 294
276 3300006195 Ga0075366_10005541 Ga0075366_100055413 294
277 3300006195 Ga0075366_10005863 Ga0075366_100058633 294
278 3300006195 Ga0075366_10007743 Ga0075366_100077434 294
279 3300006195 Ga0075366_10008443 Ga0075366_100084435 294
280 3300006195 Ga0075366_10012804 Ga0075366_100128042 294
281 3300006195 Ga0075366_10026411 Ga0075366_100264113 294
282 3300006195 Ga0075366_10036785 Ga0075366_100367852 294
283 3300006195 Ga0075366_10051997 Ga0075366_100519971 294
284 3300006195 Ga0075366_10059162 Ga0075366_100591622 294
285 3300006195 Ga0075366_10159899 Ga0075366_101598992 294
286 3300006195 Ga0075366_10214028 Ga0075366_102140281 294
287 3300006237 Ga0097621_100035033 Ga0097621_1000350332 294
288 3300006237 Ga0097621_100060516 Ga0097621_1000605162 294
289 3300006237 Ga0097621_100133673 Ga0097621_1001336732 294
290 3300006237 Ga0097621_100312173 Ga0097621_1003121732 294
291 3300006353 Ga0075370_10004685 Ga0075370_100046852 294
292 3300006353 Ga0075370_10008432 Ga0075370_100084323 294
293 3300006353 Ga0075370_10008717 Ga0075370_100087173 294
294 3300006353 Ga0075370_10014080 Ga0075370_100140802 294
295 3300006353 Ga0075370_10014150 Ga0075370_100141504 294
296 3300006353 Ga0075370_10019838 Ga0075370_100198384 294
297 3300006353 Ga0075370_10056044 Ga0075370_100560442 294
298 3300006353 Ga0075370_10117372 Ga0075370_101173722 294
299 3300006353 Ga0075370_10250138 Ga0075370_102501382 294
300 3300006358 Ga0068871_100018527 Ga0068871_1000185274 294
301 3300006358 Ga0068871_100018943 Ga0068871_1000189434 294
302 3300006358 Ga0068871_100027282 Ga0068871_1000272824 294
303 3300006358 Ga0068871_100093142 Ga0068871_1000931422 294
304 3300006358 Ga0068871_100163356 Ga0068871_1001633562 294
305 3300006881 Ga0068865_100016820 Ga0068865_1000168203 294
306 3300006881 Ga0068865_100038534 Ga0068865_1000385342 294
307 3300006881 Ga0068865_100059102 Ga0068865_1000591022 294
308 3300006944 Ga0099823_1020572 Ga0099823_10205723 294
309 3300006946 Ga0079104_1000688 Ga0079104_10006885 294
310 3300007076 Ga0075435_100479101 Ga0075435_1004791012 294
311 3300009093 Ga0105240_10392070 Ga0105240_103920702 294
312 3300009098 Ga0105245_10029559 Ga0105245_100295593 294
313 3300009098 Ga0105245_10035827 Ga0105245_100358274 294
314 3300009098 Ga0105245_10175292 Ga0105245_101752922 294
315 3300009098 Ga0105245_10439222 Ga0105245_104392222 294
316 3300009147 Ga0114129_10689616 Ga0114129_106896162 294
317 3300009148 Ga0105243_10008061 Ga0105243_100080614 294
318 3300009148 Ga0105243_10008164 Ga0105243_100081644 294
319 3300009148 Ga0105243_10276144 Ga0105243_102761442 294
320 3300009545 Ga0105237_10060506 Ga0105237_100605061 294
321 3300009545 Ga0105237_10060893 Ga0105237_100608934 294
322 3300009545 Ga0105237_10161907 Ga0105237_101619072 294
323 3300009551 Ga0105238_10019682 Ga0105238_100196824 294
324 3300009553 Ga0105249_10140797 Ga0105249_101407972 294
325 3300009553 Ga0105249_10245605 Ga0105249_102456052 294
326 3300009553 Ga0105249_10267592 Ga0105249_102675922 294
327 3300010375 Ga0105239_10096543 Ga0105239_100965432 294
328 3300012497 Ga0157319_1000001 Ga0157319_1000001121 294
329 3300013102 Ga0157371_10079787 Ga0157371_100797872 294
330 3300013105 Ga0157369_10005235 Ga0157369_100052352 294
331 3300013105 Ga0157369_10441041 Ga0157369_104410412 294
332 3300013296 Ga0157374_10069109 Ga0157374_100691092 294
333 3300013296 Ga0157374_10106448 Ga0157374_101064482 294
334 3300013296 Ga0157374_10128359 Ga0157374_101283592 294
335 3300013297 Ga0157378_10020688 Ga0157378_100206883 294
336 3300013297 Ga0157378_10153560 Ga0157378_101535602 294
337 3300013306 Ga0163162_10003214 Ga0163162_100032147 294
338 3300013306 Ga0163162_10051816 Ga0163162_100518162 294
339 3300013306 Ga0163162_10073008 Ga0163162_100730082 294
340 3300013306 Ga0163162_10273416 Ga0163162_102734162 294
341 3300013307 Ga0157372_10014610 Ga0157372_100146103 294
342 3300013307 Ga0157372_10078250 Ga0157372_100782504 294
343 3300013308 Ga0157375_10037016 Ga0157375_100370163 294
344 3300013308 Ga0157375_10083876 Ga0157375_100838763 294
345 3300013308 Ga0157375_10149165 Ga0157375_101491652 294
346 3300013308 Ga0157375_10321526 Ga0157375_103215262 294
347 3300014325 Ga0163163_10063939 Ga0163163_100639392 294
348 3300014325 Ga0163163_10226094 Ga0163163_102260942 294
349 3300014325 Ga0163163_10259222 Ga0163163_102592221 294
350 3300014326 Ga0157380_10009160 Ga0157380_100091603 294
351 3300014326 Ga0157380_10015002 Ga0157380_100150024 294
352 3300014745 Ga0157377_10000052 Ga0157377_100000527 294
353 3300014745 Ga0157377_10001746 Ga0157377_100017464 294
354 3300014968 Ga0157379_10011097 Ga0157379_100110974 294
355 3300014968 Ga0157379_10015903 Ga0157379_100159034 294
356 3300014968 Ga0157379_10050583 Ga0157379_100505833 294
357 3300014968 Ga0157379_10179771 Ga0157379_101797712 294
358 3300014969 Ga0157376_10129080 Ga0157376_101290802 294
359 3300017792 Ga0163161_10014307 Ga0163161_100143073 294
360 3300017792 Ga0163161_10138152 Ga0163161_101381522 294
361 3300025258 Ga0209129_1015421 Ga0209129_10154211 294
362 3300025273 Ga0209673_1005911 Ga0209673_10059112 294
363 3300025273 Ga0209673_1009588 Ga0209673_10095883 294
364 3300025297 Ga0209758_1000099 Ga0209758_1000099138 294
365 3300025298 Ga0209050_1000165 Ga0209050_100016571 294
366 3300025298 Ga0209050_1003454 Ga0209050_10034548 294
367 3300025298 Ga0209050_1005104 Ga0209050_10051047 294
368 3300025299 Ga0209256_1000011 Ga0209256_1000011780 294
369 3300025299 Ga0209256_1000213 Ga0209256_100021321 294
370 3300025303 Ga0209051_1000024 Ga0209051_100002499 294
371 3300025303 Ga0209051_1003799 Ga0209051_10037993 294
372 3300025303 Ga0209051_1017492 Ga0209051_10174923 294
373 3300025304 Ga0209257_1000079 Ga0209257_100007999 294
374 3300025304 Ga0209257_1004314 Ga0209257_10043146 294
375 3300025304 Ga0209257_1005076 Ga0209257_10050765 294
376 3300025315 Ga0207697_10035759 Ga0207697_100357592 294
377 3300025315 Ga0207697_10146054 Ga0207697_101460541 294
378 3300025321 Ga0207656_10035874 Ga0207656_100358742 294
379 3300025893 Ga0207682_10007137 Ga0207682_100071373 294
380 3300025893 Ga0207682_10027910 Ga0207682_100279102 294
381 3300025899 Ga0207642_10038964 Ga0207642_100389642 294
382 3300025900 Ga0207710_10104713 Ga0207710_101047132 294
383 3300025901 Ga0207688_10038739 Ga0207688_100387392 294
384 3300025901 Ga0207688_10149739 Ga0207688_101497392 294
385 3300025903 Ga0207680_10029456 Ga0207680_100294562 294
386 3300025903 Ga0207680_10051294 Ga0207680_100512942 294
387 3300025904 Ga0207647_10080814 Ga0207647_100808142 294
388 3300025907 Ga0207645_10004234 Ga0207645_100042343 294
389 3300025907 Ga0207645_10012569 Ga0207645_100125692 294
390 3300025907 Ga0207645_10029621 Ga0207645_100296213 294
391 3300025907 Ga0207645_10102360 Ga0207645_101023602 294
392 3300025909 Ga0207705_10290717 Ga0207705_102907172 294
393 3300025912 Ga0207707_10174785 Ga0207707_101747852 294
394 3300025913 Ga0207695_10274765 Ga0207695_102747653 294
395 3300025914 Ga0207671_10357467 Ga0207671_103574672 294
396 3300025917 Ga0207660_10020015 Ga0207660_100200153 294
397 3300025919 Ga0207657_10014336 Ga0207657_100143363 294
398 3300025919 Ga0207657_10144514 Ga0207657_101445142 294
399 3300025920 Ga0207649_10008710 Ga0207649_100087102 294
400 3300025923 Ga0207681_10016288 Ga0207681_100162882 294
401 3300025923 Ga0207681_10047471 Ga0207681_100474712 294
402 3300025923 Ga0207681_10321680 Ga0207681_103216802 294
403 3300025923 Ga0207681_10419031 Ga0207681_104190312 294
404 3300025924 Ga0207694_10143980 Ga0207694_101439802 294
405 3300025925 Ga0207650_10000348 Ga0207650_100003488 294
406 3300025925 Ga0207650_10008918 Ga0207650_100089184 294
407 3300025925 Ga0207650_10061253 Ga0207650_100612532 294
408 3300025925 Ga0207650_10122449 Ga0207650_101224492 294
409 3300025925 Ga0207650_10194507 Ga0207650_101945072 294
410 3300025925 Ga0207650_10198936 Ga0207650_101989362 294
411 3300025925 Ga0207650_10245846 Ga0207650_102458462 294
412 3300025925 Ga0207650_10360059 Ga0207650_103600592 294
413 3300025926 Ga0207659_10000583 Ga0207659_100005835 294
414 3300025926 Ga0207659_10002553 Ga0207659_100025533 294
415 3300025926 Ga0207659_10014174 Ga0207659_100141742 294
416 3300025927 Ga0207687_10169937 Ga0207687_101699371 294
417 3300025927 Ga0207687_10340736 Ga0207687_103407362 294
418 3300025931 Ga0207644_10000492 Ga0207644_1000049215 294
419 3300025931 Ga0207644_10010547 Ga0207644_100105474 294
420 3300025931 Ga0207644_10023599 Ga0207644_100235994 294
421 3300025931 Ga0207644_10034408 Ga0207644_100344082 294
422 3300025931 Ga0207644_10058968 Ga0207644_100589682 294
423 3300025931 Ga0207644_10105696 Ga0207644_101056962 294
424 3300025931 Ga0207644_10199678 Ga0207644_101996781 294
425 3300025931 Ga0207644_10249044 Ga0207644_102490442 294
426 3300025932 Ga0207690_10020627 Ga0207690_100206272 294
427 3300025932 Ga0207690_10044370 Ga0207690_100443703 294
428 3300025932 Ga0207690_10125427 Ga0207690_101254272 294
429 3300025933 Ga0207706_10015888 Ga0207706_100158883 294
430 3300025933 Ga0207706_10022266 Ga0207706_100222663 294
431 3300025933 Ga0207706_10025041 Ga0207706_100250412 294
432 3300025933 Ga0207706_10133552 Ga0207706_101335522 294
433 3300025934 Ga0207686_10043061 Ga0207686_100430612 294
434 3300025934 Ga0207686_10184100 Ga0207686_101841002 294
435 3300025935 Ga0207709_10004530 Ga0207709_100045303 294
436 3300025935 Ga0207709_10080541 Ga0207709_100805412 294
437 3300025935 Ga0207709_10095073 Ga0207709_100950732 294
438 3300025936 Ga0207670_10009907 Ga0207670_100099074 294
439 3300025936 Ga0207670_10075551 Ga0207670_100755512 294
440 3300025937 Ga0207669_10003686 Ga0207669_100036863 294
441 3300025937 Ga0207669_10006877 Ga0207669_100068773 294
442 3300025937 Ga0207669_10018316 Ga0207669_100183162 294
443 3300025937 Ga0207669_10103966 Ga0207669_101039662 294
444 3300025938 Ga0207704_10009288 Ga0207704_100092882 294
445 3300025938 Ga0207704_10039296 Ga0207704_100392963 294
446 3300025938 Ga0207704_10042130 Ga0207704_100421302 294
447 3300025940 Ga0207691_10007412 Ga0207691_100074123 294
448 3300025940 Ga0207691_10020182 Ga0207691_100201822 294
449 3300025940 Ga0207691_10025082 Ga0207691_100250822 294
450 3300025940 Ga0207691_10036069 Ga0207691_100360693 294
451 3300025940 Ga0207691_10165140 Ga0207691_101651402 294
452 3300025940 Ga0207691_10220038 Ga0207691_102200382 294
453 3300025942 Ga0207689_10010704 Ga0207689_100107043 294
454 3300025944 Ga0207661_10011795 Ga0207661_100117952 294
455 3300025945 Ga0207679_10000351 Ga0207679_1000035128 294
456 3300025945 Ga0207679_10022902 Ga0207679_100229022 294
457 3300025945 Ga0207679_10071459 Ga0207679_100714591 294
458 3300025945 Ga0207679_10100490 Ga0207679_101004902 294
459 3300025945 Ga0207679_10125660 Ga0207679_101256602 294
460 3300025945 Ga0207679_10151534 Ga0207679_101515342 294
461 3300025960 Ga0207651_10008816 Ga0207651_100088164 294
462 3300025960 Ga0207651_10010527 Ga0207651_100105271 294
463 3300025961 Ga0207712_10059781 Ga0207712_100597812 294
464 3300025961 Ga0207712_10130523 Ga0207712_101305232 294
465 3300025972 Ga0207668_10033023 Ga0207668_100330232 294
466 3300025972 Ga0207668_10040810 Ga0207668_100408102 294
467 3300025972 Ga0207668_10197810 Ga0207668_101978102 294
468 3300025972 Ga0207668_10614715 Ga0207668_106147151 294
469 3300025981 Ga0207640_10258091 Ga0207640_102580912 294
470 3300025986 Ga0207658_10008172 Ga0207658_100081722 294
471 3300025986 Ga0207658_10016467 Ga0207658_100164672 294
472 3300025986 Ga0207658_10086291 Ga0207658_100862912 294
473 3300025986 Ga0207658_10126476 Ga0207658_101264762 294
474 3300026023 Ga0207677_10006793 Ga0207677_100067933 294
475 3300026023 Ga0207677_10008408 Ga0207677_100084082 294
476 3300026023 Ga0207677_10011753 Ga0207677_100117532 294
477 3300026023 Ga0207677_10039580 Ga0207677_100395803 294
478 3300026023 Ga0207677_10067627 Ga0207677_100676272 294
479 3300026023 Ga0207677_10071978 Ga0207677_100719781 294
480 3300026035 Ga0207703_10006182 Ga0207703_100061823 294
481 3300026035 Ga0207703_10042180 Ga0207703_100421803 294
482 3300026035 Ga0207703_10043436 Ga0207703_100434363 294
483 3300026035 Ga0207703_10172459 Ga0207703_101724592 294
484 3300026041 Ga0207639_10138046 Ga0207639_101380462 294
485 3300026067 Ga0207678_10019654 Ga0207678_100196541 294
486 3300026067 Ga0207678_10051289 Ga0207678_100512894 294
487 3300026067 Ga0207678_10132803 Ga0207678_101328032 294
488 3300026067 Ga0207678_10448492 Ga0207678_104484922 294
489 3300026067 Ga0207678_10494600 Ga0207678_104946001 294
490 3300026075 Ga0207708_10013481 Ga0207708_100134813 294
491 3300026078 Ga0207702_10080509 Ga0207702_100805093 294
492 3300026078 Ga0207702_10122704 Ga0207702_101227042 294
493 3300026078 Ga0207702_10289979 Ga0207702_102899792 294
494 3300026078 Ga0207702_10387151 Ga0207702_103871512 294
495 3300026088 Ga0207641_10015872 Ga0207641_100158724 294
496 3300026088 Ga0207641_10153653 Ga0207641_101536532 294
497 3300026089 Ga0207648_10006696 Ga0207648_100066967 294
498 3300026089 Ga0207648_10006922 Ga0207648_100069223 294
499 3300026089 Ga0207648_10006965 Ga0207648_100069653 294
500 3300026089 Ga0207648_10013294 Ga0207648_100132943 294
501 3300026089 Ga0207648_10085172 Ga0207648_100851722 294
502 3300026089 Ga0207648_10094768 Ga0207648_100947682 294
503 3300026089 Ga0207648_10104408 Ga0207648_101044082 294
504 3300026089 Ga0207648_10149415 Ga0207648_101494152 294
505 3300026089 Ga0207648_10344551 Ga0207648_103445512 294
506 3300026095 Ga0207676_10001822 Ga0207676_1000182213 294
507 3300026095 Ga0207676_10011015 Ga0207676_100110152 294
508 3300026095 Ga0207676_10019239 Ga0207676_100192394 294
509 3300026095 Ga0207676_10489259 Ga0207676_104892592 294
510 3300026116 Ga0207674_10038138 Ga0207674_100381382 294
511 3300026118 Ga0207675_100004540 Ga0207675_1000045406 294
512 3300026118 Ga0207675_100004707 Ga0207675_10000470710 294
513 3300026118 Ga0207675_100014213 Ga0207675_1000142133 294
514 3300026118 Ga0207675_100101496 Ga0207675_1001014962 294
515 3300026121 Ga0207683_10020842 Ga0207683_100208423 294
516 3300026121 Ga0207683_10034755 Ga0207683_100347552 294
517 3300026121 Ga0207683_10056782 Ga0207683_100567823 294
518 3300026121 Ga0207683_10143025 Ga0207683_101430252 294
519 3300026121 Ga0207683_10212812 Ga0207683_102128122 294
520 3300026142 Ga0207698_10030706 Ga0207698_100307062 294
521 3300026142 Ga0207698_10063072 Ga0207698_100630722 294
522 3300026142 Ga0207698_10081370 Ga0207698_100813702 294
523 3300026142 Ga0207698_10082403 Ga0207698_100824032 294
524 3300026142 Ga0207698_10113956 Ga0207698_101139562 294
525 3300026142 Ga0207698_10164030 Ga0207698_101640302 294
526 3300026142 Ga0207698_10256973 Ga0207698_102569732 294
527 3300026142 Ga0207698_10426131 Ga0207698_104261312 294
528 3300027111 Ga0209281_1000042 Ga0209281_10000425 294
529 3300027360 Ga0209969_1004201 Ga0209969_10042012 294
530 3300027526 Ga0209968_1000176 Ga0209968_10001763 294
531 3300027695 Ga0209966_1000006 Ga0209966_100000661 294
532 3300027717 Ga0209998_10009287 Ga0209998_100092872 294
533 3300027876 Ga0209974_10016459 Ga0209974_100164592 294
534 3300028379 Ga0268266_10300460 Ga0268266_103004602 294
535 3300028380 Ga0268265_10008394 Ga0268265_100083943 294
536 3300028380 Ga0268265_10031149 Ga0268265_100311493 294
537 3300028380 Ga0268265_10167719 Ga0268265_101677191 294
538 3300028380 Ga0268265_10553428 Ga0268265_105534281 294
539 3300028381 Ga0268264_10005037 Ga0268264_100050373 294
540 3300028381 Ga0268264_10072163 Ga0268264_100721633 294
541 3300028381 Ga0268264_10208985 Ga0268264_102089852 294
542 3300028381 Ga0268264_10272318 Ga0268264_102723182 294
543 3300028381 Ga0268264_10320382 Ga0268264_103203821 294
544 3300028786 Ga0307517_10004982 Ga0307517_100049824 294
545 3300028786 Ga0307517_10087446 Ga0307517_100874462 294
546 3300028786 Ga0307517_10152281 Ga0307517_101522812 294
547 3300028786 Ga0307517_10185718 Ga0307517_101857182 294
548 3300028794 Ga0307515_10000020 Ga0307515_1000002070 294
549 3300028794 Ga0307515_10000525 Ga0307515_100005257 294
550 3300028794 Ga0307515_10001622 Ga0307515_1000162221 294
551 3300028794 Ga0307515_10015131 Ga0307515_100151318 294
552 3300028794 Ga0307515_10015416 Ga0307515_1001541612 294
553 3300028794 Ga0307515_10164487 Ga0307515_101644872 294
554 3300030522 Ga0307512_10063200 Ga0307512_100632002 294
555 3300031456 Ga0307513_10039012 Ga0307513_100390123 294
556 3300031456 Ga0307513_10040644 Ga0307513_100406442 294
557 3300031456 Ga0307513_10044803 Ga0307513_100448034 294
558 3300031456 Ga0307513_10229244 Ga0307513_102292442 294
559 3300031456 Ga0307513_10280163 Ga0307513_102801631 294
560 3300031507 Ga0307509_10005169 Ga0307509_100051693 294
561 3300031507 Ga0307509_10023117 Ga0307509_100231172 294
562 3300031507 Ga0307509_10039152 Ga0307509_100391524 294
563 3300031507 Ga0307509_10052887 Ga0307509_100528871 294
564 3300031507 Ga0307509_10150861 Ga0307509_101508612 294
565 3300031507 Ga0307509_10206828 Ga0307509_102068282 294
566 3300031507 Ga0307509_10301794 Ga0307509_103017942 294
567 3300031548 Ga0307408_100023553 Ga0307408_1000235532 294
568 3300031548 Ga0307408_100096268 Ga0307408_1000962682 294
569 3300031548 Ga0307408_100430525 Ga0307408_1004305252 294
570 3300031616 Ga0307508_10000007 Ga0307508_10000007148 294
571 3300031616 Ga0307508_10000738 Ga0307508_100007383 294
572 3300031616 Ga0307508_10042723 Ga0307508_100427231 294
573 3300031616 Ga0307508_10134438 Ga0307508_101344382 294
574 3300031649 Ga0307514_10014340 Ga0307514_100143403 294
575 3300031730 Ga0307516_10003350 Ga0307516_1000335015 294
576 3300031730 Ga0307516_10012873 Ga0307516_100128734 294
577 3300031730 Ga0307516_10055228 Ga0307516_100552282 294
578 3300031731 Ga0307405_10037541 Ga0307405_100375413 294
579 3300031824 Ga0307413_10004001 Ga0307413_100040014 294
580 3300031852 Ga0307410_10013145 Ga0307410_100131452 294
581 3300031901 Ga0307406_10007866 Ga0307406_100078664 294
582 3300031901 Ga0307406_10070873 Ga0307406_100708732 294
583 3300031903 Ga0307407_10038907 Ga0307407_100389073 294
584 3300031903 Ga0307407_10097516 Ga0307407_100975162 294
585 3300031911 Ga0307412_10007008 Ga0307412_100070082 294
586 3300031911 Ga0307412_10499754 Ga0307412_104997541 294
587 3300031995 Ga0307409_100000998 Ga0307409_1000009982 294
588 3300031995 Ga0307409_100024853 Ga0307409_1000248533 294
589 3300031995 Ga0307409_100232311 Ga0307409_1002323112 294
590 3300032002 Ga0307416_100010514 Ga0307416_1000105142 294
591 3300032002 Ga0307416_100114686 Ga0307416_1001146862 294
592 3300032004 Ga0307414_10050194 Ga0307414_100501942 294
593 3300032004 Ga0307414_10208028 Ga0307414_102080282 294
594 3300032005 Ga0307411_10019052 Ga0307411_100190522 294
595 3300032005 Ga0307411_10285897 Ga0307411_102858972 294
596 3300032126 Ga0307415_100031801 Ga0307415_1000318013 294
597 3300032126 Ga0307415_100051892 Ga0307415_1000518922 294
598 3300033179 Ga0307507_10032760 Ga0307507_100327604 294
599 3300033179 Ga0307507_10119882 Ga0307507_101198822 294
600 3300033180 Ga0307510_10027873 Ga0307510_100278734 294
601 3300033180 Ga0307510_10036903 Ga0307510_100369032 294
602 3300033180 Ga0307510_10075055 Ga0307510_100750552 294
603 3300033180 Ga0307510_10213471 Ga0307510_102134712 294
604 3300035113 Ga0373936_0113328 Ga0373936_0113328_18_902 294
605 3300035116 Ga0373945_0044197 Ga0373945_0044197_347_1231 294
606 3300035118 Ga0373954_0056738 Ga0373954_0056738_817_1701 294
607 3300035170 Ga0373943_0172921 Ga0373943_0172921_206_1090 294
608 3300035171 Ga0373946_0055697 Ga0373946_0055697_333_1217 294
609 3300035172 Ga0373955_0033098 Ga0373955_0033098_546_1430 294
610 3300035691 Ga0373931_0003802 Ga0373931_0003802_4528_5412 294
611 3300035691 Ga0373931_0014685 Ga0373931_0014685_594_1478 294
612 3300036401 Ga0373937_0027070 Ga0373937_0027070_739_1623 294
613 3300036401 Ga0373937_0068865 Ga0373937_0068865_1373_2257 294
614 3300037068 Ga0373925_0182142 Ga0373925_0182142_433_1317 294
615 3300037418 Ga0395900_0000378 Ga0395900_0000378_50764_51648 294
616 3300037466 Ga0395898_0001418 Ga0395898_0001418_27226_28110 294
617 3300037471 Ga0395905_0010601 Ga0395905_0010601_861_1745 294
618 3300037471 Ga0395905_0046174 Ga0395905_0046174_2210_3094 294
619 3300037471 Ga0395905_0071504 Ga0395905_0071504_1442_2332 294
620 3300041456 Ga0451795_1472563 Ga0451795_1472563_525_1409 294
621 3300041459 Ga0451800_1509975 Ga0451800_1509975_234_1118 294
622 3300041460 Ga0451802_0268620 Ga0451802_0268620_50_934 294
623 3300041486 Ga0451807_0320661 Ga0451807_0320661_236_1120 294
624 3300042000 Ga0439437_004926 Ga0439437_004926_86_970 294
625 3300042007 Ga0439449_0018927 Ga0439449_0018927_956_1840 294
626 3300042008 Ga0439450_006794 Ga0439450_006794_381_1265 294
627 3300042011 Ga0439454_014139 Ga0439454_014139_182_1072 294
628 3300042127 Ga0450890_001531 Ga0450890_001531_1152_2042 294
629 3300042135 Ga0450899_001706 Ga0450899_001706_664_1548 294
630 3300042156 Ga0439446_0012141 Ga0439446_0012141_182_1075 294
631 3300042438 Ga0439459_0001206 Ga0439459_0001206_1630_2520 294
632 3300042531 Ga0450918_000032 Ga0450918_000032_24724_25608 294
633 3300042876 Ga0451577_0016490 Ga0451577_0016490_3506_4399 294
634 3300044656 Ga0466969_0031112 Ga0466969_0031112_1166_2050 294
635 3300044658 Ga0466972_0004708 Ga0466972_0004708_2999_3883 294
636 3300044658 Ga0466972_0092783 Ga0466972_0092783_157_1044 294
637 3300044683 Ga0466965_0079289 Ga0466965_0079289_607_1494 294
638 3300044683 Ga0466965_0163086 Ga0466965_0163086_259_1143 294
639 3300044684 Ga0466966_0020813 Ga0466966_0020813_2004_2888 294
640 3300044693 Ga0466961_0010868 Ga0466961_0010868_743_1627 294
641 3300044694 Ga0466963_0087157 Ga0466963_0087157_211_1095 294
642 3300044694 Ga0466963_0191646 Ga0466963_0191646_372_1259 294
643 3300044706 Ga0466964_0013194 Ga0466964_0013194_1207_2091 294
644 3300044712 Ga0453684_0052450 Ga0453684_0052450_1920_2804 294
645 3300044712 Ga0453684_0270026 Ga0453684_0270026_556_1443 294
646 3300044765 Ga0466970_0054937 Ga0466970_0054937_620_1504 294
647 3300044765 Ga0466970_0063142 Ga0466970_0063142_451_1335 294
648 3300044842 Ga0466957_0176607 Ga0466957_0176607_430_1314 294
649 3300044842 Ga0466957_0198590 Ga0466957_0198590_36_920 294
650 3300044901 Ga0466960_0054584 Ga0466960_0054584_315_1202 294
651 3300045049 Ga0466959_0016680 Ga0466959_0016680_2981_3865 294
652 3300045051 Ga0451576_0031221 Ga0451576_0031221_1942_2829 294
653 3300045051 Ga0451576_0273449 Ga0451576_0273449_783_1667 294
654 3300045976 Ga0466967_0073560 Ga0466967_0073560_538_1422 294
655 3300046454 Ga0495592_0015031 Ga0495592_0015031_2804_3688 294
656 3300046459 Ga0495629_0132975 Ga0495629_0132975_621_1505 294
657 3300046460 Ga0495638_0059719 Ga0495638_0059719_624_1508 294
658 3300046472 Ga0495580_0038552 Ga0495580_0038552_2299_3183 294
659 3300046474 Ga0495605_0068331 Ga0495605_0068331_410_1294 294
660 3300046512 Ga0495610_0058151 Ga0495610_0058151_580_1464 294
661 3300046515 Ga0495620_0030046 Ga0495620_0030046_1332_2216 294
662 3300046518 Ga0495631_0086079 Ga0495631_0086079_271_1155 294
663 3300046519 Ga0495632_0010505 Ga0495632_0010505_742_1626 294
664 3300046519 Ga0495632_0012778 Ga0495632_0012778_502_1386 294
665 3300046519 Ga0495632_0018008 Ga0495632_0018008_2758_3642 294
666 3300046519 Ga0495632_0042105 Ga0495632_0042105_1266_2150 294
667 3300046522 Ga0495643_0015622 Ga0495643_0015622_3047_3931 294
668 3300046524 Ga0495648_0065053 Ga0495648_0065053_443_1327 294
669 3300046524 Ga0495648_0192729 Ga0495648_0192729_15_899 294
670 3300046528 Ga0495642_0063505 Ga0495642_0063505_318_1202 294
671 3300046535 Ga0495586_0191238 Ga0495586_0191238_201_1085 294
672 3300046537 Ga0495598_0035924 Ga0495598_0035924_278_1162 294
673 3300046539 Ga0495621_0004199 Ga0495621_0004199_284_1168 294
674 3300046542 Ga0495597_0108654 Ga0495597_0108654_126_1010 294
675 3300046543 Ga0495645_0056885 Ga0495645_0056885_1905_2789 294
676 3300046543 Ga0495645_0131680 Ga0495645_0131680_236_1120 294
677 3300046557 Ga0495622_0018138 Ga0495622_0018138_1882_2766 294
678 3300046559 Ga0495667_0198994 Ga0495667_0198994_245_1129 294
679 3300046648 Ga0495611_0111293 Ga0495611_0111293_229_1113 294
680 3300046660 Ga0495625_0056756 Ga0495625_0056756_429_1313 294
681 3300046663 Ga0495635_0215317 Ga0495635_0215317_399_1283 294
682 3300046681 Ga0495647_0009330 Ga0495647_0009330_935_1819 294
683 3300046683 Ga0495658_0184818 Ga0495658_0184818_210_1094 294
684 3300046690 Ga0495624_0064038 Ga0495624_0064038_935_1819 294
685 3300046691 Ga0495670_0166774 Ga0495670_0166774_226_1110 294
686 3300046694 Ga0495649_0003169 Ga0495649_0003169_3151_4035 294
687 3300046809 Ga0495600_0219065 Ga0495600_0219065_68_952 294
688 3300046810 Ga0495660_0026700 Ga0495660_0026700_372_1256 294
689 3300047443 Ga0495687_008688 Ga0495687_008688_2367_3251 294
690 3300047471 Ga0495684_0099654 Ga0495684_0099654_747_1631 294
691 3300047472 Ga0495686_0159652 Ga0495686_0159652_80_964 294
692 3300047673 Ga0495593_0021198 Ga0495593_0021198_624_1508 294
693 3300048905 Ga0496102_0019412 Ga0496102_0019412_2369_3256 294
694 3300048905 Ga0496102_0019732 Ga0496102_0019732_2719_3603 294
695 3300048907 Ga0496104_0031558 Ga0496104_0031558_3496_4380 294
696 3300048907 Ga0496104_0063012 Ga0496104_0063012_284_1168 294
697 3300048909 Ga0496106_0036433 Ga0496106_0036433_278_1162 294
698 3300048910 Ga0496107_0020662 Ga0496107_0020662_1286_2170 294
699 3300048911 Ga0496108_0054149 Ga0496108_0054149_374_1258 294
700 3300048911 Ga0496108_0059750 Ga0496108_0059750_58_942 294
701 3300048911 Ga0496108_0396000 Ga0496108_0396000_67_951 294
702 3300048912 Ga0496109_0048691 Ga0496109_0048691_802_1686 294
703 3300048912 Ga0496109_0158807 Ga0496109_0158807_448_1332 294
704 3300048913 Ga0496110_0107019 Ga0496110_0107019_1423_2307 294
705 3300048913 Ga0496110_0221703 Ga0496110_0221703_577_1461 294
706 3300048914 Ga0496111_0066936 Ga0496111_0066936_522_1406 294
707 3300048916 Ga0496113_0064832 Ga0496113_0064832_351_1235 294
708 3300048917 Ga0496114_0020018 Ga0496114_0020018_1519_2403 294
709 3300048917 Ga0496114_0153338 Ga0496114_0153338_435_1319 294
710 3300048918 Ga0496115_0020021 Ga0496115_0020021_1655_2539 294
711 3300048924 Ga0496121_0016606 Ga0496121_0016606_3982_4869 294
712 3300048927 Ga0496124_0000161 Ga0496124_0000161_104565_105452 294
713 3300048928 Ga0496125_0017717 Ga0496125_0017717_2765_3652 294
714 3300049515 Ga0501292_001467 Ga0501292_001467_685_1569 294
715 3300049575 Ga0501039_0355635 Ga0501039_0355635_156_1040 294
716 3300049579 Ga0501043_0013188 Ga0501043_0013188_3235_4122 294
717 3300049580 Ga0501046_0000049 Ga0501046_0000049_131897_132784 294
718 3300049581 Ga0501047_0000039 Ga0501047_0000039_55089_55976 294
719 3300049582 Ga0501048_0015557 Ga0501048_0015557_2581_3468 294
720 3300049649 Ga0501198_000166 Ga0501198_000166_2906_3790 294
721 3300049662 Ga0501222_000256 Ga0501222_000256_4939_5823 294
722 3300049682 Ga0501252_001271 Ga0501252_001271_799_1683 294
723 3300049683 Ga0501253_007103 Ga0501253_007103_622_1506 294
724 3300049686 Ga0501257_028200 Ga0501257_028200_251_1135 294
725 3300049822 Ga0501035_0332354 Ga0501035_0332354_29_913 294
726 3300049823 Ga0501044_0278747 Ga0501044_0278747_252_1139 294
727 3300049824 Ga0501045_0024117 Ga0501045_0024117_494_1381 294
728 3300050489 nmdc:mga03683_129445_c1 nmdc:mga03683_129445_c1_149_1033 294
729 3300050489 nmdc:mga03683_44576_c1 nmdc:mga03683_44576_c1_645_1529 294
730 3300050490 nmdc:mga03n38_74311_c1 nmdc:mga03n38_74311_c1_667_1551 294
731 3300050493 nmdc:mga0k408_102377_c1 nmdc:mga0k408_102377_c1_317_1201 294
732 3300050493 nmdc:mga0k408_10775_c2 nmdc:mga0k408_10775_c2_39_923 294
733 3300050493 nmdc:mga0k408_1102_c1 nmdc:mga0k408_1102_c1_1074_1958 294
734 3300050493 nmdc:mga0k408_14563_c1 nmdc:mga0k408_14563_c1_642_1526 294
735 3300050493 nmdc:mga0k408_220299_c1 nmdc:mga0k408_220299_c1_77_961 294
736 3300050493 nmdc:mga0k408_3182_c1 nmdc:mga0k408_3182_c1_2907_3791 294
737 3300050493 nmdc:mga0k408_3241_c1 nmdc:mga0k408_3241_c1_7687_8571 294
738 3300050493 nmdc:mga0k408_3706_c1 nmdc:mga0k408_3706_c1_4827_5711 294
739 3300050493 nmdc:mga0k408_4690_c1 nmdc:mga0k408_4690_c1_3725_4609 294
740 3300050493 nmdc:mga0k408_4692_c1 nmdc:mga0k408_4692_c1_3580_4467 294
741 3300050493 nmdc:mga0k408_55825_c1 nmdc:mga0k408_55825_c1_168_1058 294
742 3300050493 nmdc:mga0k408_66978_c1 nmdc:mga0k408_66978_c1_674_1558 294
743 3300050493 nmdc:mga0k408_67756_c1 nmdc:mga0k408_67756_c1_919_1803 294
744 3300050493 nmdc:mga0k408_69545_c1 nmdc:mga0k408_69545_c1_918_1802 294
745 3300050494 nmdc:mga06z11_214880_c1 nmdc:mga06z11_214880_c1_68_952 294
746 3300050494 nmdc:mga06z11_22764_c1 nmdc:mga06z11_22764_c1_1831_2715 294
747 3300050494 nmdc:mga06z11_6551_c1 nmdc:mga06z11_6551_c1_1606_2490 294
748 3300050495 nmdc:mga04h51_10773_c1 nmdc:mga04h51_10773_c1_501_1385 294
749 3300050496 nmdc:mga07m45_11905_c1 nmdc:mga07m45_11905_c1_2703_3593 294
750 3300050496 nmdc:mga07m45_2726_c1 nmdc:mga07m45_2726_c1_4015_4899 294
751 3300050496 nmdc:mga07m45_29645_c1 nmdc:mga07m45_29645_c1_2002_2886 294
752 3300050496 nmdc:mga07m45_44795_c1 nmdc:mga07m45_44795_c1_626_1510 294
753 3300050496 nmdc:mga07m45_521_c1 nmdc:mga07m45_521_c1_2346_3230 294
754 3300050496 nmdc:mga07m45_6176_c1 nmdc:mga07m45_6176_c1_276_1160 294
755 3300050511 nmdc:mga08y16_210159_c1 nmdc:mga08y16_210159_c1_371_1255 294
756 3300050516 nmdc:mga0sz30_3842_c1 nmdc:mga0sz30_3842_c1_405_1289 294
757 3300053077 Ga0495601_0261976 Ga0495601_0261976_143_1027 294
758 3300053086 Ga0500578_0000007 Ga0500578_0000007_201142_202026 294
759 3300053088 Ga0500644_0007389 Ga0500644_0007389_653_1537 294
760 3300053088 Ga0500644_0020243 Ga0500644_0020243_113_997 294
761 3300053088 Ga0500644_0048148 Ga0500644_0048148_298_1182 294
762 3300053090 Ga0500646_0014730 Ga0500646_0014730_1016_1900 294
763 3300053093 Ga0500651_0028496 Ga0500651_0028496_2523_3407 294
764 3300053093 Ga0500651_0094844 Ga0500651_0094844_640_1524 294
765 3300053109 Ga0500569_026989 Ga0500569_026989_173_1057 294
766 3300053117 Ga0500593_004305 Ga0500593_004305_2509_3396 294
767 3300053129 Ga0500628_005054 Ga0500628_005054_1243_2127 294
768 3300053131 Ga0500652_001774 Ga0500652_001774_3042_3926 294
769 3300053133 Ga0500655_008958 Ga0500655_008958_660_1544 294
770 3300053134 Ga0500658_0009620 Ga0500658_0009620_127_1011 294
771 3300053134 Ga0500658_0011046 Ga0500658_0011046_334_1218 294
772 3300053136 Ga0500559_0000262 Ga0500559_0000262_11640_12524 294
773 3300053139 Ga0500568_0045798 Ga0500568_0045798_205_1089 294
774 3300053139 Ga0500568_0062489 Ga0500568_0062489_294_1178 294
775 3300053142 Ga0500577_0019925 Ga0500577_0019925_1025_1909 294
776 3300053148 Ga0500590_006823 Ga0500590_006823_1497_2381 294
777 3300053154 Ga0500619_000525 Ga0500619_000525_3134_4021 294
778 3300053156 Ga0500622_0000359 Ga0500622_0000359_2545_3429 294
779 3300053156 Ga0500622_0003431 Ga0500622_0003431_8195_9079 294
780 3300053730 Ga0500645_004369 Ga0500645_004369_2343_3227 294
781 3300053739 Ga0500587_001082 Ga0500587_001082_565_1449 294
782 3300002773 JGI25152J39213_1001351 JGI25152J39213_10013512 295
783 3300002774 JGI25150J39212_1010495 JGI25150J39212_10104952 295
784 3300003215 JGI25153J46596_10013555 JGI25153J46596_100135553 295
785 3300003322 rootL2_10022824 rootL2_100228243 295
786 3300003323 rootH1_10158640 rootH1_101586405 295
787 3300003771 Ga0055526_1008178 Ga0055526_10081785 295
788 3300003794 Ga0055531_10000107 Ga0055531_1000010783 295
789 3300006353 Ga0075370_10068742 Ga0075370_100687422 295
790 3300009148 Ga0105243_10214660 Ga0105243_102146602 295
791 3300025245 Ga0207425_1001369 Ga0207425_10013695 295
792 3300025258 Ga0209129_1000012 Ga0209129_1000012403 295
793 3300025273 Ga0209673_1012584 Ga0209673_10125843 295
794 3300025295 Ga0209564_1000022 Ga0209564_1000022111 295
795 3300025297 Ga0209758_1000233 Ga0209758_1000233110 295
796 3300025298 Ga0209050_1005020 Ga0209050_10050202 295
797 3300025299 Ga0209256_1019763 Ga0209256_10197632 295
798 3300025303 Ga0209051_1050987 Ga0209051_10509872 295
799 3300025304 Ga0209257_1000032 Ga0209257_10000322 295
800 3300025304 Ga0209257_1015488 Ga0209257_10154882 295
801 3300025935 Ga0207709_10127319 Ga0207709_101273192 295
802 3300031548 Ga0307408_100000038 Ga0307408_10000003829 295
803 3300031548 Ga0307408_100515310 Ga0307408_1005153101 295
804 3300032005 Ga0307411_10000979 Ga0307411_100009794 295
805 3300035114 Ga0373939_0000473 Ga0373939_0000473_2552_3448 295
806 3300035691 Ga0373931_0000592 Ga0373931_0000592_13704_14600 295
807 3300042000 Ga0439437_000875 Ga0439437_000875_1307_2203 295
808 3300042120 Ga0450917_000152 Ga0450917_000152_2735_3631 295
809 3300042127 Ga0450890_000380 Ga0450890_000380_1918_2814 295
810 3300042129 Ga0450891_000009 Ga0450891_000009_12564_13460 295
811 3300042130 Ga0450892_001075 Ga0450892_001075_218_1114 295
812 3300042144 Ga0450889_000322 Ga0450889_000322_934_1830 295
813 3300042530 Ga0450916_011857 Ga0450916_011857_42_938 295
814 3300042532 Ga0450893_0007029 Ga0450893_0007029_785_1681 295
815 3300045051 Ga0451576_0057090 Ga0451576_0057090_963_1862 295
816 3300049129 Ga0501309_010734 Ga0501309_010734_29_925 295
817 3300049130 Ga0501310_002501 Ga0501310_002501_106_1002 295
818 3300049653 Ga0501206_011526 Ga0501206_011526_210_1106 295
819 3300049658 Ga0501211_000398 Ga0501211_000398_27_923 295
820 3300049662 Ga0501222_003094 Ga0501222_003094_370_1266 295
821 3300049684 Ga0501255_009784 Ga0501255_009784_67_963 295
822 3300049687 Ga0501258_000887 Ga0501258_000887_921_1817 295
823 3300049704 Ga0501221_007219 Ga0501221_007219_367_1263 295
824 3300049705 Ga0501225_0020353 Ga0501225_0020353_572_1468 295
825 3300049764 Ga0501267_001944 Ga0501267_001944_235_1131 295
826 3300049822 Ga0501035_0143246 Ga0501035_0143246_653_1546 295
827 3300050493 nmdc:mga0k408_183701_c1 nmdc:mga0k408_183701_c1_312_1208 295
828 3300053104 Ga0500556_0066206 Ga0500556_0066206_293_1183 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20463

PDH_C

Prephenate dehydrogenase, dimerization domain

167

268

0.95

PF02153

PDH_N

Prephenate dehydrogenase, nucleotide-binding domain

11

165

0.94

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

1

90

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9298 2 280
2g5c-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from aquifex aeolicus 0.9144 1 280
2g5c-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from aquifex aeolicus 0.9019 1 280
3ggp-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ 0.8992 1 280
3dzb-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.8979 3 281
ID Description Score Start End Superfamily
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9412 4 174 3.40.50.720
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9302 4 174 3.40.50.720
2g5cD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9178 3 171 3.40.50.720
af_O69721_5_180_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8991 2 177 3.40.50.720
2g5cD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.897 3 171 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519I2I5-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 1 1 93 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A519I2I5-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 0.9897 1 93 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A0F9J666-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9828 1 180 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A3D1CP08-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 0.9757 1 126 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A432J8H5-F1-model_v4 deleted 0.9704 1 110

Feature Viewer

pLDDT pTM Quality
93.38 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map