F482583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 828 | 370 | 810 | 294 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2928519762|2928520313 |
| Length | 276 |
| Sequence | IQGLGEMGASLASALSQRVENHVIGIDNQLLSRQYAMANNIVDETATSLADVVSRAEVIILATPIAVIKQTLKQLAVLPLKSNVIITDTGSTKSEIMSLAEAFVPKTATFIGGHAMAGTQNSGVSAANSDLYREVPYFLVTKHAPKETVIKLQSILAPIAARFIEIDAQQHDELVSWISDVPHIVSFALMNAVMQHFHSVSDFGPYVAGGFKDTTRIAASNPEVWRDILLSNKAAILSSNQDLIDELHRFNQVLRQNDSLGLEKLITQAQHARQQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 8 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 9 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 10 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 11 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 12 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 13 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 14 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 15 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 16 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 17 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 18 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 19 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 20 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 194 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 195 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 198 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 235 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 236 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 237 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 238 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 239 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 240 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 241 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 242 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 243 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 244 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 245 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 246 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 247 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 248 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 249 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 328 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 330 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 331 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 332 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 333 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 334 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 336 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 353 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 355 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 356 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 358 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 359 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 360 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 361 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 362 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 366 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 367 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 369 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 370 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 0.24 |
| Isolates | 2.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.06 |
| Nodule | 0.48 |
| Rhizoplane | 3.26 |
| Rhizosphere | 72.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1001351 | 3300002773 | Bacteria | 10741 |
| 2 | JGI25150J39212_1010495 | 3300002774 | Bacteria | 1719 |
| 3 | JGI25153J46596_10003961 | 3300003215 | Bacteria | 8107 |
| 4 | JGI25153J46596_10013555 | 3300003215 | Bacteria | 3437 |
| 5 | rootH1_10027020 | 3300003316 | Bacteria | 7084 |
| 6 | rootL2_10001380 | 3300003322 | Bacteria | 8605 |
| 7 | rootL2_10022824 | 3300003322 | Bacteria | 4420 |
| 8 | rootH1_10158640 | 3300003323 | Bacteria | 2487 |
| 9 | JGI26128J50194_1000258 | 3300003347 | Bacteria | 2636 |
| 10 | Ga0055526_1008178 | 3300003771 | Bacteria | 5262 |
| 11 | Ga0055524_1000102 | 3300003775 | Bacteria | 105348 |
| 12 | Ga0055530_10006141 | 3300003791 | Bacteria | 5455 |
| 13 | Ga0055530_10014378 | 3300003791 | Bacteria | 2641 |
| 14 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 15 | Ga0055531_10000107 | 3300003794 | Bacteria | 91062 |
| 16 | Ga0055531_10001967 | 3300003794 | Bacteria | 14330 |
| 17 | Ga0055531_10003060 | 3300003794 | Bacteria | 10825 |
| 18 | Ga0065165_1001184 | 3300005262 | Bacteria | 30266 |
| 19 | Ga0065707_10084028 | 3300005295 | Bacteria | 7807 |
| 20 | Ga0070658_10029927 | 3300005327 | Bacteria | 4375 |
| 21 | Ga0070658_10105786 | 3300005327 | Bacteria | 2328 |
| 22 | Ga0070658_10121654 | 3300005327 | Bacteria | 2169 |
| 23 | Ga0070658_10179881 | 3300005327 | Bacteria | 1779 |
| 24 | Ga0070658_10244441 | 3300005327 | Bacteria | 1522 |
| 25 | Ga0070676_10004596 | 3300005328 | Bacteria | 7276 |
| 26 | Ga0070676_10010958 | 3300005328 | Bacteria | 4926 |
| 27 | Ga0070676_10093856 | 3300005328 | Bacteria | 1843 |
| 28 | Ga0070676_10280031 | 3300005328 | Bacteria | 1123 |
| 29 | Ga0070683_100092942 | 3300005329 | Bacteria | 2833 |
| 30 | Ga0070690_100011621 | 3300005330 | Bacteria | 5154 |
| 31 | Ga0070690_100071956 | 3300005330 | Bacteria | 2247 |
| 32 | Ga0070670_100002048 | 3300005331 | Bacteria | 16500 |
| 33 | Ga0070670_100008361 | 3300005331 | Bacteria | 8822 |
| 34 | Ga0070670_100021861 | 3300005331 | Bacteria | 5502 |
| 35 | Ga0070670_100025406 | 3300005331 | Bacteria | 5096 |
| 36 | Ga0070670_100093319 | 3300005331 | Bacteria | 2589 |
| 37 | Ga0070670_100121872 | 3300005331 | Bacteria | 2249 |
| 38 | Ga0070670_100133015 | 3300005331 | Bacteria | 2148 |
| 39 | Ga0070670_100158433 | 3300005331 | Bacteria | 1961 |
| 40 | Ga0070677_10008624 | 3300005333 | Bacteria | 3436 |
| 41 | Ga0068869_100019801 | 3300005334 | Bacteria | 4606 |
| 42 | Ga0068869_100020284 | 3300005334 | Bacteria | 4556 |
| 43 | Ga0068869_100103271 | 3300005334 | Bacteria | 2159 |
| 44 | Ga0068869_100170879 | 3300005334 | Bacteria | 1698 |
| 45 | Ga0070666_10020859 | 3300005335 | Bacteria | 4240 |
| 46 | Ga0070666_10033849 | 3300005335 | Bacteria | 3385 |
| 47 | Ga0070666_10253599 | 3300005335 | Bacteria | 1246 |
| 48 | Ga0070680_100037136 | 3300005336 | Bacteria | 3936 |
| 49 | Ga0068868_100013349 | 3300005338 | Bacteria | 6023 |
| 50 | Ga0068868_100021229 | 3300005338 | Bacteria | 4890 |
| 51 | Ga0068868_100024067 | 3300005338 | Bacteria | 4616 |
| 52 | Ga0068868_100029737 | 3300005338 | Bacteria | 4185 |
| 53 | Ga0070660_100009492 | 3300005339 | Bacteria | 6846 |
| 54 | Ga0070660_100037209 | 3300005339 | Bacteria | 3689 |
| 55 | Ga0070660_100046031 | 3300005339 | Bacteria | 3343 |
| 56 | Ga0070661_100010860 | 3300005344 | Bacteria | 6342 |
| 57 | Ga0070661_100025314 | 3300005344 | Bacteria | 4263 |
| 58 | Ga0070661_100067906 | 3300005344 | Bacteria | 2620 |
| 59 | Ga0070661_100169216 | 3300005344 | Bacteria | 1659 |
| 60 | Ga0070668_100016454 | 3300005347 | Bacteria | 5529 |
| 61 | Ga0070668_100047777 | 3300005347 | Bacteria | 3291 |
| 62 | Ga0070669_100030988 | 3300005353 | Bacteria | 3861 |
| 63 | Ga0070669_100041356 | 3300005353 | Bacteria | 3352 |
| 64 | Ga0070669_100055512 | 3300005353 | Bacteria | 2902 |
| 65 | Ga0070669_100058881 | 3300005353 | Bacteria | 2820 |
| 66 | Ga0070669_100441712 | 3300005353 | Bacteria | 1071 |
| 67 | Ga0070675_100006469 | 3300005354 | Bacteria | 8996 |
| 68 | Ga0070675_100008748 | 3300005354 | Bacteria | 7864 |
| 69 | Ga0070675_100044056 | 3300005354 | Bacteria | 3649 |
| 70 | Ga0070675_100046192 | 3300005354 | Bacteria | 3565 |
| 71 | Ga0070675_100078021 | 3300005354 | Bacteria | 2758 |
| 72 | Ga0070675_100094373 | 3300005354 | Bacteria | 2510 |
| 73 | Ga0070675_100160606 | 3300005354 | Bacteria | 1932 |
| 74 | Ga0070671_100005645 | 3300005355 | Bacteria | 9957 |
| 75 | Ga0070671_100008532 | 3300005355 | Bacteria | 8216 |
| 76 | Ga0070671_100013751 | 3300005355 | Bacteria | 6529 |
| 77 | Ga0070671_100022683 | 3300005355 | Bacteria | 5128 |
| 78 | Ga0070671_100045805 | 3300005355 | Bacteria | 3636 |
| 79 | Ga0070671_100067597 | 3300005355 | Bacteria | 2980 |
| 80 | Ga0070671_100095140 | 3300005355 | Bacteria | 2497 |
| 81 | Ga0070671_100181333 | 3300005355 | Bacteria | 1783 |
| 82 | Ga0070671_100193312 | 3300005355 | Bacteria | 1725 |
| 83 | Ga0070674_100012126 | 3300005356 | Bacteria | 5282 |
| 84 | Ga0070674_100025563 | 3300005356 | Bacteria | 3846 |
| 85 | Ga0070674_100071600 | 3300005356 | Bacteria | 2452 |
| 86 | Ga0070674_100079278 | 3300005356 | Bacteria | 2343 |
| 87 | Ga0070674_100132244 | 3300005356 | Bacteria | 1862 |
| 88 | Ga0070674_100167505 | 3300005356 | Bacteria | 1672 |
| 89 | Ga0070673_100009255 | 3300005364 | Bacteria | 6609 |
| 90 | Ga0070673_100023993 | 3300005364 | Bacteria | 4464 |
| 91 | Ga0070673_100216347 | 3300005364 | Bacteria | 1656 |
| 92 | Ga0070659_100059640 | 3300005366 | Bacteria | 3013 |
| 93 | Ga0070659_100393377 | 3300005366 | Bacteria | 1169 |
| 94 | Ga0070667_100011064 | 3300005367 | Bacteria | 7463 |
| 95 | Ga0070667_100023847 | 3300005367 | Bacteria | 5080 |
| 96 | Ga0070667_100025961 | 3300005367 | Bacteria | 4872 |
| 97 | Ga0070667_100586785 | 3300005367 | Bacteria | 1026 |
| 98 | Ga0070700_100008788 | 3300005441 | Bacteria | 5517 |
| 99 | Ga0070663_100007158 | 3300005455 | Bacteria | 6776 |
| 100 | Ga0070663_100020351 | 3300005455 | Bacteria | 4392 |
| 101 | Ga0070663_100110921 | 3300005455 | Bacteria | 2061 |
| 102 | Ga0070678_100136783 | 3300005456 | Bacteria | 1955 |
| 103 | Ga0070678_100201819 | 3300005456 | Bacteria | 1642 |
| 104 | Ga0070678_100227375 | 3300005456 | Bacteria | 1554 |
| 105 | Ga0070662_100004772 | 3300005457 | Bacteria | 8589 |
| 106 | Ga0070662_100020745 | 3300005457 | Bacteria | 4480 |
| 107 | Ga0070662_100022096 | 3300005457 | Bacteria | 4350 |
| 108 | Ga0070662_100052621 | 3300005457 | Bacteria | 2944 |
| 109 | Ga0070662_100099349 | 3300005457 | Bacteria | 2200 |
| 110 | Ga0070662_100205977 | 3300005457 | Bacteria | 1563 |
| 111 | Ga0068867_100000642 | 3300005459 | Bacteria | 23127 |
| 112 | Ga0068867_100004124 | 3300005459 | Bacteria | 10204 |
| 113 | Ga0068867_100005865 | 3300005459 | Bacteria | 8714 |
| 114 | Ga0068867_100015749 | 3300005459 | Bacteria | 5366 |
| 115 | Ga0068867_100050133 | 3300005459 | Bacteria | 3075 |
| 116 | Ga0068867_100205067 | 3300005459 | Bacteria | 1580 |
| 117 | Ga0068867_100434613 | 3300005459 | Bacteria | 1115 |
| 118 | Ga0070685_10116127 | 3300005466 | Bacteria | 1656 |
| 119 | Ga0070706_100002793 | 3300005467 | Bacteria | 17459 |
| 120 | Ga0070707_100105284 | 3300005468 | Bacteria | 2735 |
| 121 | Ga0070679_100328672 | 3300005530 | Bacteria | 1477 |
| 122 | Ga0068853_100021319 | 3300005539 | Bacteria | 5401 |
| 123 | Ga0068853_100026405 | 3300005539 | Bacteria | 4875 |
| 124 | Ga0070672_100004613 | 3300005543 | Bacteria | 9024 |
| 125 | Ga0070672_100011208 | 3300005543 | Bacteria | 6249 |
| 126 | Ga0070672_100015698 | 3300005543 | Bacteria | 5406 |
| 127 | Ga0070672_100023554 | 3300005543 | Bacteria | 4540 |
| 128 | Ga0070672_100034805 | 3300005543 | Bacteria | 3824 |
| 129 | Ga0070672_100083301 | 3300005543 | Bacteria | 2567 |
| 130 | Ga0070672_100408634 | 3300005543 | Bacteria | 1164 |
| 131 | Ga0070672_100420968 | 3300005543 | Bacteria | 1147 |
| 132 | Ga0070665_100016656 | 3300005548 | Bacteria | 7366 |
| 133 | Ga0068855_100032561 | 3300005563 | Bacteria | 6223 |
| 134 | Ga0068855_100382622 | 3300005563 | Bacteria | 1545 |
| 135 | Ga0070664_100006429 | 3300005564 | Bacteria | 9478 |
| 136 | Ga0070664_100040387 | 3300005564 | Bacteria | 3933 |
| 137 | Ga0070664_100072443 | 3300005564 | Bacteria | 2955 |
| 138 | Ga0070664_100154891 | 3300005564 | Bacteria | 2024 |
| 139 | Ga0070664_100194418 | 3300005564 | Bacteria | 1808 |
| 140 | Ga0068854_100037510 | 3300005578 | Bacteria | 3403 |
| 141 | Ga0068854_100224210 | 3300005578 | Bacteria | 1489 |
| 142 | Ga0068856_100006124 | 3300005614 | Bacteria | 11806 |
| 143 | Ga0068856_100123364 | 3300005614 | Bacteria | 2593 |
| 144 | Ga0068852_100023193 | 3300005616 | Bacteria | 4990 |
| 145 | Ga0068852_100027990 | 3300005616 | Bacteria | 4605 |
| 146 | Ga0068852_100039338 | 3300005616 | Bacteria | 3981 |
| 147 | Ga0068852_100109473 | 3300005616 | Bacteria | 2509 |
| 148 | Ga0068852_100166749 | 3300005616 | Bacteria | 2061 |
| 149 | Ga0068852_100248668 | 3300005616 | Bacteria | 1703 |
| 150 | Ga0068852_100328211 | 3300005616 | Bacteria | 1488 |
| 151 | Ga0068852_100447148 | 3300005616 | Bacteria | 1279 |
| 152 | Ga0068852_100483701 | 3300005616 | Bacteria | 1230 |
| 153 | Ga0068852_100585957 | 3300005616 | Bacteria | 1118 |
| 154 | Ga0068864_100007037 | 3300005618 | Bacteria | 9235 |
| 155 | Ga0068864_100015754 | 3300005618 | Bacteria | 6289 |
| 156 | Ga0068864_100019407 | 3300005618 | Bacteria | 5685 |
| 157 | Ga0068864_100023608 | 3300005618 | Bacteria | 5166 |
| 158 | Ga0068866_10213288 | 3300005718 | Bacteria | 1160 |
| 159 | Ga0068861_100006036 | 3300005719 | Bacteria | 8238 |
| 160 | Ga0068861_100011309 | 3300005719 | Bacteria | 6198 |
| 161 | Ga0068861_100014671 | 3300005719 | Bacteria | 5502 |
| 162 | Ga0068861_100031192 | 3300005719 | Bacteria | 3913 |
| 163 | Ga0068851_10002716 | 3300005834 | Bacteria | 7791 |
| 164 | Ga0068851_10008035 | 3300005834 | Bacteria | 4867 |
| 165 | Ga0068851_10089775 | 3300005834 | Bacteria | 1616 |
| 166 | Ga0068870_10169441 | 3300005840 | Bacteria | 1302 |
| 167 | Ga0068863_100038795 | 3300005841 | Bacteria | 4532 |
| 168 | Ga0068863_100051820 | 3300005841 | Bacteria | 3889 |
| 169 | Ga0068863_100162094 | 3300005841 | Bacteria | 2143 |
| 170 | Ga0068863_100511226 | 3300005841 | Bacteria | 1183 |
| 171 | Ga0068858_100002454 | 3300005842 | Bacteria | 18720 |
| 172 | Ga0068858_100031054 | 3300005842 | Bacteria | 4961 |
| 173 | Ga0068858_100035742 | 3300005842 | Bacteria | 4607 |
| 174 | Ga0068858_100249447 | 3300005842 | Bacteria | 1686 |
| 175 | Ga0068858_100439715 | 3300005842 | Bacteria | 1256 |
| 176 | Ga0068860_100001400 | 3300005843 | Bacteria | 26146 |
| 177 | Ga0068860_100022638 | 3300005843 | Bacteria | 6075 |
| 178 | Ga0068860_100044197 | 3300005843 | Bacteria | 4246 |
| 179 | Ga0068862_100036687 | 3300005844 | Bacteria | 4155 |
| 180 | Ga0068862_100087461 | 3300005844 | Bacteria | 2710 |
| 181 | Ga0075365_10015096 | 3300006038 | Bacteria | 4663 |
| 182 | Ga0075368_10004264 | 3300006042 | Bacteria | 4828 |
| 183 | Ga0075368_10083443 | 3300006042 | Bacteria | 1302 |
| 184 | Ga0075363_100038499 | 3300006048 | Bacteria | 2515 |
| 185 | Ga0075363_100104865 | 3300006048 | Bacteria | 1567 |
| 186 | Ga0075364_10010325 | 3300006051 | Bacteria | 5636 |
| 187 | Ga0075362_10003880 | 3300006177 | Bacteria | 5311 |
| 188 | Ga0075362_10006506 | 3300006177 | Bacteria | 4360 |
| 189 | Ga0075362_10015691 | 3300006177 | Bacteria | 3086 |
| 190 | Ga0075362_10055107 | 3300006177 | Bacteria | 1788 |
| 191 | Ga0075367_10005372 | 3300006178 | Bacteria | 6354 |
| 192 | Ga0075367_10007232 | 3300006178 | Bacteria | 5673 |
| 193 | Ga0075367_10055276 | 3300006178 | Bacteria | 2356 |
| 194 | Ga0075369_10012194 | 3300006186 | Bacteria | 3394 |
| 195 | Ga0075366_10003606 | 3300006195 | Bacteria | 8200 |
| 196 | Ga0075366_10005541 | 3300006195 | Bacteria | 6841 |
| 197 | Ga0075366_10005863 | 3300006195 | Bacteria | 6680 |
| 198 | Ga0075366_10007743 | 3300006195 | Bacteria | 5949 |
| 199 | Ga0075366_10008443 | 3300006195 | Bacteria | 5728 |
| 200 | Ga0075366_10012804 | 3300006195 | Bacteria | 4767 |
| 201 | Ga0075366_10026411 | 3300006195 | Bacteria | 3401 |
| 202 | Ga0075366_10036785 | 3300006195 | Bacteria | 2887 |
| 203 | Ga0075366_10051997 | 3300006195 | Bacteria | 2434 |
| 204 | Ga0075366_10059162 | 3300006195 | Bacteria | 2276 |
| 205 | Ga0075366_10080298 | 3300006195 | Bacteria | 1948 |
| 206 | Ga0075366_10159899 | 3300006195 | Bacteria | 1365 |
| 207 | Ga0075366_10214028 | 3300006195 | Bacteria | 1173 |
| 208 | Ga0097621_100035033 | 3300006237 | Bacteria | 4008 |
| 209 | Ga0097621_100060516 | 3300006237 | Bacteria | 3104 |
| 210 | Ga0097621_100133673 | 3300006237 | Bacteria | 2114 |
| 211 | Ga0097621_100312173 | 3300006237 | Bacteria | 1391 |
| 212 | Ga0075370_10004685 | 3300006353 | Bacteria | 6673 |
| 213 | Ga0075370_10008432 | 3300006353 | Bacteria | 5303 |
| 214 | Ga0075370_10008717 | 3300006353 | Bacteria | 5231 |
| 215 | Ga0075370_10014080 | 3300006353 | Bacteria | 4260 |
| 216 | Ga0075370_10014150 | 3300006353 | Bacteria | 4251 |
| 217 | Ga0075370_10019838 | 3300006353 | Bacteria | 3664 |
| 218 | Ga0075370_10056044 | 3300006353 | Bacteria | 2240 |
| 219 | Ga0075370_10068742 | 3300006353 | Bacteria | 2023 |
| 220 | Ga0075370_10117372 | 3300006353 | Bacteria | 1547 |
| 221 | Ga0075370_10250138 | 3300006353 | Bacteria | 1050 |
| 222 | Ga0068871_100018527 | 3300006358 | Bacteria | 5293 |
| 223 | Ga0068871_100018943 | 3300006358 | Bacteria | 5246 |
| 224 | Ga0068871_100027282 | 3300006358 | Bacteria | 4465 |
| 225 | Ga0068871_100093142 | 3300006358 | Bacteria | 2513 |
| 226 | Ga0068871_100163356 | 3300006358 | Bacteria | 1905 |
| 227 | Ga0075429_100014052 | 3300006880 | Bacteria | 6939 |
| 228 | Ga0068865_100016820 | 3300006881 | Bacteria | 4689 |
| 229 | Ga0068865_100038534 | 3300006881 | Bacteria | 3236 |
| 230 | Ga0068865_100059102 | 3300006881 | Bacteria | 2681 |
| 231 | Ga0099823_1020572 | 3300006944 | Bacteria | 6227 |
| 232 | Ga0079104_1000688 | 3300006946 | Bacteria | 31113 |
| 233 | Ga0075435_100479101 | 3300007076 | Bacteria | 1075 |
| 234 | Ga0105240_10015269 | 3300009093 | Bacteria | 10451 |
| 235 | Ga0105240_10392070 | 3300009093 | Bacteria | 1566 |
| 236 | Ga0105245_10029559 | 3300009098 | Bacteria | 4843 |
| 237 | Ga0105245_10035827 | 3300009098 | Bacteria | 4405 |
| 238 | Ga0105245_10175292 | 3300009098 | Bacteria | 2045 |
| 239 | Ga0105245_10439222 | 3300009098 | Bacteria | 1311 |
| 240 | Ga0114129_10172375 | 3300009147 | Bacteria | 2949 |
| 241 | Ga0114129_10689616 | 3300009147 | Bacteria | 1314 |
| 242 | Ga0105243_10008061 | 3300009148 | Bacteria | 8088 |
| 243 | Ga0105243_10008164 | 3300009148 | Bacteria | 8039 |
| 244 | Ga0105243_10214660 | 3300009148 | Bacteria | 1696 |
| 245 | Ga0105243_10276144 | 3300009148 | Bacteria | 1511 |
| 246 | Ga0105248_10000644 | 3300009177 | Bacteria | 39638 |
| 247 | Ga0105237_10001569 | 3300009545 | Bacteria | 29799 |
| 248 | Ga0105237_10060506 | 3300009545 | Bacteria | 3789 |
| 249 | Ga0105237_10060893 | 3300009545 | Bacteria | 3775 |
| 250 | Ga0105237_10161907 | 3300009545 | Bacteria | 2236 |
| 251 | Ga0105238_10015851 | 3300009551 | Bacteria | 7630 |
| 252 | Ga0105238_10019682 | 3300009551 | Bacteria | 6873 |
| 253 | Ga0105249_10140797 | 3300009553 | Bacteria | 2313 |
| 254 | Ga0105249_10245605 | 3300009553 | Bacteria | 1772 |
| 255 | Ga0105249_10267592 | 3300009553 | Bacteria | 1701 |
| 256 | Ga0105239_10000486 | 3300010375 | Bacteria | 57901 |
| 257 | Ga0105239_10096543 | 3300010375 | Bacteria | 3265 |
| 258 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 259 | Ga0157371_10079787 | 3300013102 | Bacteria | 2318 |
| 260 | Ga0157369_10005235 | 3300013105 | Bacteria | 15129 |
| 261 | Ga0157369_10441041 | 3300013105 | Bacteria | 1349 |
| 262 | Ga0157374_10069109 | 3300013296 | Bacteria | 3325 |
| 263 | Ga0157374_10106448 | 3300013296 | Bacteria | 2694 |
| 264 | Ga0157374_10128359 | 3300013296 | Bacteria | 2452 |
| 265 | Ga0157378_10020688 | 3300013297 | Bacteria | 5788 |
| 266 | Ga0157378_10153560 | 3300013297 | Bacteria | 2146 |
| 267 | Ga0163162_10003214 | 3300013306 | Bacteria | 15630 |
| 268 | Ga0163162_10051816 | 3300013306 | Bacteria | 4120 |
| 269 | Ga0163162_10073008 | 3300013306 | Bacteria | 3486 |
| 270 | Ga0163162_10273416 | 3300013306 | Bacteria | 1821 |
| 271 | Ga0157372_10014610 | 3300013307 | Bacteria | 8399 |
| 272 | Ga0157372_10078250 | 3300013307 | Bacteria | 3736 |
| 273 | Ga0157375_10037016 | 3300013308 | Bacteria | 4672 |
| 274 | Ga0157375_10083876 | 3300013308 | Bacteria | 3233 |
| 275 | Ga0157375_10149165 | 3300013308 | Bacteria | 2472 |
| 276 | Ga0157375_10321526 | 3300013308 | Bacteria | 1712 |
| 277 | Ga0163163_10063939 | 3300014325 | Bacteria | 3651 |
| 278 | Ga0163163_10226094 | 3300014325 | Bacteria | 1920 |
| 279 | Ga0163163_10259222 | 3300014325 | Bacteria | 1789 |
| 280 | Ga0157380_10009160 | 3300014326 | Bacteria | 7082 |
| 281 | Ga0157380_10015002 | 3300014326 | Bacteria | 5685 |
| 282 | Ga0157380_10715303 | 3300014326 | Bacteria | 1008 |
| 283 | Ga0157377_10000052 | 3300014745 | Bacteria | 89846 |
| 284 | Ga0157377_10001746 | 3300014745 | Bacteria | 9477 |
| 285 | Ga0157379_10011097 | 3300014968 | Bacteria | 7855 |
| 286 | Ga0157379_10015903 | 3300014968 | Bacteria | 6614 |
| 287 | Ga0157379_10050583 | 3300014968 | Bacteria | 3710 |
| 288 | Ga0157379_10179771 | 3300014968 | Bacteria | 1911 |
| 289 | Ga0157376_10129080 | 3300014969 | Bacteria | 2253 |
| 290 | Ga0163161_10014307 | 3300017792 | Bacteria | 5523 |
| 291 | Ga0163161_10138152 | 3300017792 | Bacteria | 1843 |
| 292 | Ga0213872_10000016 | 3300021361 | Bacteria | 180524 |
| 293 | Ga0213872_10000036 | 3300021361 | Bacteria | 129233 |
| 294 | Ga0213872_10000804 | 3300021361 | Bacteria | 22814 |
| 295 | Ga0213872_10005088 | 3300021361 | Bacteria | 6818 |
| 296 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 297 | Ga0207425_1001369 | 3300025245 | Bacteria | 10334 |
| 298 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 299 | Ga0209129_1015421 | 3300025258 | Bacteria | 1574 |
| 300 | Ga0209673_1005911 | 3300025273 | Bacteria | 6046 |
| 301 | Ga0209673_1009588 | 3300025273 | Bacteria | 4169 |
| 302 | Ga0209673_1012584 | 3300025273 | Bacteria | 3399 |
| 303 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 304 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 305 | Ga0209758_1000099 | 3300025297 | Bacteria | 230054 |
| 306 | Ga0209758_1000233 | 3300025297 | Bacteria | 116640 |
| 307 | Ga0209050_1000165 | 3300025298 | Bacteria | 152109 |
| 308 | Ga0209050_1003454 | 3300025298 | Bacteria | 11619 |
| 309 | Ga0209050_1005020 | 3300025298 | Bacteria | 8594 |
| 310 | Ga0209050_1005104 | 3300025298 | Bacteria | 8455 |
| 311 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 312 | Ga0209256_1000213 | 3300025299 | Bacteria | 108298 |
| 313 | Ga0209256_1019763 | 3300025299 | Bacteria | 2130 |
| 314 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 315 | Ga0209051_1003799 | 3300025303 | Bacteria | 9660 |
| 316 | Ga0209051_1017492 | 3300025303 | Bacteria | 3202 |
| 317 | Ga0209051_1050987 | 3300025303 | Bacteria | 1381 |
| 318 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 319 | Ga0209257_1000079 | 3300025304 | Bacteria | 316420 |
| 320 | Ga0209257_1004314 | 3300025304 | Bacteria | 11173 |
| 321 | Ga0209257_1005076 | 3300025304 | Bacteria | 9557 |
| 322 | Ga0209257_1015488 | 3300025304 | Bacteria | 3169 |
| 323 | Ga0207697_10035759 | 3300025315 | Bacteria | 2034 |
| 324 | Ga0207697_10146054 | 3300025315 | Bacteria | 1027 |
| 325 | Ga0207656_10035874 | 3300025321 | Bacteria | 2079 |
| 326 | Ga0207682_10007137 | 3300025893 | Bacteria | 4468 |
| 327 | Ga0207682_10027910 | 3300025893 | Bacteria | 2249 |
| 328 | Ga0207642_10038964 | 3300025899 | Bacteria | 2061 |
| 329 | Ga0207710_10104713 | 3300025900 | Bacteria | 1338 |
| 330 | Ga0207688_10038739 | 3300025901 | Bacteria | 2646 |
| 331 | Ga0207688_10149739 | 3300025901 | Bacteria | 1378 |
| 332 | Ga0207680_10029456 | 3300025903 | Bacteria | 3084 |
| 333 | Ga0207680_10051294 | 3300025903 | Bacteria | 2467 |
| 334 | Ga0207647_10080814 | 3300025904 | Bacteria | 1949 |
| 335 | Ga0207645_10004234 | 3300025907 | Bacteria | 10652 |
| 336 | Ga0207645_10012569 | 3300025907 | Bacteria | 5741 |
| 337 | Ga0207645_10029621 | 3300025907 | Bacteria | 3528 |
| 338 | Ga0207645_10102360 | 3300025907 | Bacteria | 1848 |
| 339 | Ga0207705_10290717 | 3300025909 | Bacteria | 1252 |
| 340 | Ga0207707_10174785 | 3300025912 | Bacteria | 1876 |
| 341 | Ga0207695_10008032 | 3300025913 | Bacteria | 13283 |
| 342 | Ga0207695_10274765 | 3300025913 | Bacteria | 1580 |
| 343 | Ga0207671_10001963 | 3300025914 | Bacteria | 22689 |
| 344 | Ga0207671_10357467 | 3300025914 | Bacteria | 1159 |
| 345 | Ga0207660_10020015 | 3300025917 | Bacteria | 4484 |
| 346 | Ga0207657_10014336 | 3300025919 | Bacteria | 7740 |
| 347 | Ga0207657_10144514 | 3300025919 | Bacteria | 1941 |
| 348 | Ga0207649_10008710 | 3300025920 | Bacteria | 5539 |
| 349 | Ga0207681_10016288 | 3300025923 | Bacteria | 4648 |
| 350 | Ga0207681_10047471 | 3300025923 | Bacteria | 2893 |
| 351 | Ga0207681_10321680 | 3300025923 | Bacteria | 1230 |
| 352 | Ga0207681_10419031 | 3300025923 | Bacteria | 1084 |
| 353 | Ga0207694_10024236 | 3300025924 | Bacteria | 4607 |
| 354 | Ga0207694_10143980 | 3300025924 | Bacteria | 1918 |
| 355 | Ga0207650_10000348 | 3300025925 | Bacteria | 44624 |
| 356 | Ga0207650_10008918 | 3300025925 | Bacteria | 6854 |
| 357 | Ga0207650_10061253 | 3300025925 | Bacteria | 2809 |
| 358 | Ga0207650_10122449 | 3300025925 | Bacteria | 2027 |
| 359 | Ga0207650_10194507 | 3300025925 | Bacteria | 1622 |
| 360 | Ga0207650_10198936 | 3300025925 | Bacteria | 1604 |
| 361 | Ga0207650_10245846 | 3300025925 | Bacteria | 1447 |
| 362 | Ga0207650_10360059 | 3300025925 | Bacteria | 1198 |
| 363 | Ga0207659_10000583 | 3300025926 | Bacteria | 21821 |
| 364 | Ga0207659_10002553 | 3300025926 | Bacteria | 10833 |
| 365 | Ga0207659_10014174 | 3300025926 | Bacteria | 5132 |
| 366 | Ga0207687_10169937 | 3300025927 | Bacteria | 1681 |
| 367 | Ga0207687_10340736 | 3300025927 | Bacteria | 1219 |
| 368 | Ga0207644_10000492 | 3300025931 | Bacteria | 25386 |
| 369 | Ga0207644_10010547 | 3300025931 | Bacteria | 6091 |
| 370 | Ga0207644_10023599 | 3300025931 | Bacteria | 4216 |
| 371 | Ga0207644_10034408 | 3300025931 | Bacteria | 3545 |
| 372 | Ga0207644_10058968 | 3300025931 | Bacteria | 2775 |
| 373 | Ga0207644_10105696 | 3300025931 | Bacteria | 2121 |
| 374 | Ga0207644_10199678 | 3300025931 | Bacteria | 1577 |
| 375 | Ga0207644_10249044 | 3300025931 | Bacteria | 1417 |
| 376 | Ga0207690_10020627 | 3300025932 | Bacteria | 4076 |
| 377 | Ga0207690_10044370 | 3300025932 | Bacteria | 2930 |
| 378 | Ga0207690_10125427 | 3300025932 | Bacteria | 1871 |
| 379 | Ga0207690_10261190 | 3300025932 | Bacteria | 1342 |
| 380 | Ga0207706_10015888 | 3300025933 | Bacteria | 6805 |
| 381 | Ga0207706_10022266 | 3300025933 | Bacteria | 5687 |
| 382 | Ga0207706_10025041 | 3300025933 | Bacteria | 5350 |
| 383 | Ga0207706_10133552 | 3300025933 | Bacteria | 2183 |
| 384 | Ga0207686_10043061 | 3300025934 | Bacteria | 2764 |
| 385 | Ga0207686_10184100 | 3300025934 | Bacteria | 1483 |
| 386 | Ga0207709_10004530 | 3300025935 | Bacteria | 8016 |
| 387 | Ga0207709_10080541 | 3300025935 | Bacteria | 2097 |
| 388 | Ga0207709_10095073 | 3300025935 | Bacteria | 1957 |
| 389 | Ga0207709_10127319 | 3300025935 | Bacteria | 1730 |
| 390 | Ga0207670_10009907 | 3300025936 | Bacteria | 5459 |
| 391 | Ga0207670_10075551 | 3300025936 | Bacteria | 2342 |
| 392 | Ga0207669_10003686 | 3300025937 | Bacteria | 6659 |
| 393 | Ga0207669_10006877 | 3300025937 | Bacteria | 5230 |
| 394 | Ga0207669_10018316 | 3300025937 | Bacteria | 3617 |
| 395 | Ga0207669_10103966 | 3300025937 | Bacteria | 1885 |
| 396 | Ga0207704_10009288 | 3300025938 | Bacteria | 4734 |
| 397 | Ga0207704_10039296 | 3300025938 | Bacteria | 2754 |
| 398 | Ga0207704_10042130 | 3300025938 | Bacteria | 2684 |
| 399 | Ga0207691_10007412 | 3300025940 | Bacteria | 10562 |
| 400 | Ga0207691_10020182 | 3300025940 | Bacteria | 6303 |
| 401 | Ga0207691_10025082 | 3300025940 | Bacteria | 5600 |
| 402 | Ga0207691_10036069 | 3300025940 | Bacteria | 4583 |
| 403 | Ga0207691_10165140 | 3300025940 | Bacteria | 1941 |
| 404 | Ga0207691_10220038 | 3300025940 | Bacteria | 1647 |
| 405 | Ga0207711_10014620 | 3300025941 | Bacteria | 6523 |
| 406 | Ga0207689_10010704 | 3300025942 | Bacteria | 7891 |
| 407 | Ga0207661_10011795 | 3300025944 | Bacteria | 6345 |
| 408 | Ga0207679_10000351 | 3300025945 | Bacteria | 33566 |
| 409 | Ga0207679_10022902 | 3300025945 | Bacteria | 4261 |
| 410 | Ga0207679_10071459 | 3300025945 | Bacteria | 2618 |
| 411 | Ga0207679_10100490 | 3300025945 | Bacteria | 2260 |
| 412 | Ga0207679_10125660 | 3300025945 | Bacteria | 2049 |
| 413 | Ga0207679_10151534 | 3300025945 | Bacteria | 1888 |
| 414 | Ga0207667_10119729 | 3300025949 | Bacteria | 2713 |
| 415 | Ga0207651_10008816 | 3300025960 | Bacteria | 5473 |
| 416 | Ga0207651_10010527 | 3300025960 | Bacteria | 5130 |
| 417 | Ga0207712_10059781 | 3300025961 | Bacteria | 2699 |
| 418 | Ga0207712_10130523 | 3300025961 | Bacteria | 1914 |
| 419 | Ga0207668_10033023 | 3300025972 | Bacteria | 3426 |
| 420 | Ga0207668_10040810 | 3300025972 | Bacteria | 3133 |
| 421 | Ga0207668_10197810 | 3300025972 | Bacteria | 1598 |
| 422 | Ga0207668_10614715 | 3300025972 | Bacteria | 948 |
| 423 | Ga0207640_10258091 | 3300025981 | Bacteria | 1356 |
| 424 | Ga0207658_10008172 | 3300025986 | Bacteria | 7125 |
| 425 | Ga0207658_10016467 | 3300025986 | Bacteria | 5084 |
| 426 | Ga0207658_10086291 | 3300025986 | Bacteria | 2420 |
| 427 | Ga0207658_10126476 | 3300025986 | Bacteria | 2046 |
| 428 | Ga0207677_10006793 | 3300026023 | Bacteria | 6282 |
| 429 | Ga0207677_10008408 | 3300026023 | Bacteria | 5760 |
| 430 | Ga0207677_10011753 | 3300026023 | Bacteria | 5004 |
| 431 | Ga0207677_10039580 | 3300026023 | Bacteria | 3101 |
| 432 | Ga0207677_10067627 | 3300026023 | Bacteria | 2504 |
| 433 | Ga0207677_10071978 | 3300026023 | Bacteria | 2442 |
| 434 | Ga0207703_10006182 | 3300026035 | Bacteria | 9582 |
| 435 | Ga0207703_10042180 | 3300026035 | Bacteria | 3659 |
| 436 | Ga0207703_10043436 | 3300026035 | Bacteria | 3607 |
| 437 | Ga0207703_10172459 | 3300026035 | Bacteria | 1904 |
| 438 | Ga0207639_10138046 | 3300026041 | Bacteria | 2028 |
| 439 | Ga0207639_10303529 | 3300026041 | Bacteria | 1412 |
| 440 | Ga0207678_10019654 | 3300026067 | Bacteria | 5940 |
| 441 | Ga0207678_10051289 | 3300026067 | Bacteria | 3562 |
| 442 | Ga0207678_10132803 | 3300026067 | Bacteria | 2124 |
| 443 | Ga0207678_10448492 | 3300026067 | Bacteria | 1121 |
| 444 | Ga0207678_10494600 | 3300026067 | Bacteria | 1066 |
| 445 | Ga0207708_10013481 | 3300026075 | Bacteria | 6112 |
| 446 | Ga0207702_10080509 | 3300026078 | Bacteria | 2826 |
| 447 | Ga0207702_10122704 | 3300026078 | Bacteria | 2327 |
| 448 | Ga0207702_10289979 | 3300026078 | Bacteria | 1550 |
| 449 | Ga0207702_10387151 | 3300026078 | Bacteria | 1346 |
| 450 | Ga0207641_10015872 | 3300026088 | Bacteria | 6167 |
| 451 | Ga0207641_10153653 | 3300026088 | Bacteria | 2086 |
| 452 | Ga0207648_10006696 | 3300026089 | Bacteria | 11428 |
| 453 | Ga0207648_10006922 | 3300026089 | Bacteria | 11237 |
| 454 | Ga0207648_10006965 | 3300026089 | Bacteria | 11188 |
| 455 | Ga0207648_10013294 | 3300026089 | Bacteria | 7667 |
| 456 | Ga0207648_10085172 | 3300026089 | Bacteria | 2757 |
| 457 | Ga0207648_10094768 | 3300026089 | Bacteria | 2610 |
| 458 | Ga0207648_10104408 | 3300026089 | Bacteria | 2485 |
| 459 | Ga0207648_10149415 | 3300026089 | Bacteria | 2061 |
| 460 | Ga0207648_10344551 | 3300026089 | Bacteria | 1342 |
| 461 | Ga0207676_10001822 | 3300026095 | Bacteria | 15609 |
| 462 | Ga0207676_10011015 | 3300026095 | Bacteria | 6455 |
| 463 | Ga0207676_10019239 | 3300026095 | Bacteria | 4978 |
| 464 | Ga0207676_10104531 | 3300026095 | Bacteria | 2356 |
| 465 | Ga0207676_10489259 | 3300026095 | Bacteria | 1166 |
| 466 | Ga0207674_10038138 | 3300026116 | Bacteria | 4992 |
| 467 | Ga0207675_100004540 | 3300026118 | Bacteria | 13390 |
| 468 | Ga0207675_100004707 | 3300026118 | Bacteria | 13136 |
| 469 | Ga0207675_100014213 | 3300026118 | Bacteria | 7423 |
| 470 | Ga0207675_100101496 | 3300026118 | Bacteria | 2711 |
| 471 | Ga0207683_10020842 | 3300026121 | Bacteria | 5608 |
| 472 | Ga0207683_10034755 | 3300026121 | Bacteria | 4382 |
| 473 | Ga0207683_10056782 | 3300026121 | Bacteria | 3435 |
| 474 | Ga0207683_10143025 | 3300026121 | Bacteria | 2156 |
| 475 | Ga0207683_10147666 | 3300026121 | Bacteria | 2121 |
| 476 | Ga0207683_10212812 | 3300026121 | Bacteria | 1760 |
| 477 | Ga0207698_10030706 | 3300026142 | Bacteria | 3869 |
| 478 | Ga0207698_10063072 | 3300026142 | Bacteria | 2898 |
| 479 | Ga0207698_10081370 | 3300026142 | Bacteria | 2614 |
| 480 | Ga0207698_10082403 | 3300026142 | Bacteria | 2600 |
| 481 | Ga0207698_10084701 | 3300026142 | Bacteria | 2571 |
| 482 | Ga0207698_10113956 | 3300026142 | Bacteria | 2273 |
| 483 | Ga0207698_10164030 | 3300026142 | Bacteria | 1947 |
| 484 | Ga0207698_10256973 | 3300026142 | Bacteria | 1602 |
| 485 | Ga0207698_10426131 | 3300026142 | Bacteria | 1274 |
| 486 | Ga0209281_1000042 | 3300027111 | Bacteria | 344748 |
| 487 | Ga0209969_1004201 | 3300027360 | Bacteria | 2018 |
| 488 | Ga0209968_1000176 | 3300027526 | Bacteria | 11068 |
| 489 | Ga0209966_1000006 | 3300027695 | Bacteria | 102095 |
| 490 | Ga0209998_10009287 | 3300027717 | Bacteria | 2042 |
| 491 | Ga0209974_10016459 | 3300027876 | Bacteria | 2456 |
| 492 | Ga0268266_10300460 | 3300028379 | Bacteria | 1497 |
| 493 | Ga0268265_10008394 | 3300028380 | Bacteria | 6975 |
| 494 | Ga0268265_10031149 | 3300028380 | Bacteria | 3850 |
| 495 | Ga0268265_10167719 | 3300028380 | Bacteria | 1873 |
| 496 | Ga0268265_10553428 | 3300028380 | Bacteria | 1092 |
| 497 | Ga0268264_10005037 | 3300028381 | Bacteria | 11180 |
| 498 | Ga0268264_10072163 | 3300028381 | Bacteria | 2927 |
| 499 | Ga0268264_10208985 | 3300028381 | Bacteria | 1790 |
| 500 | Ga0268264_10272318 | 3300028381 | Bacteria | 1582 |
| 501 | Ga0268264_10320382 | 3300028381 | Bacteria | 1466 |
| 502 | Ga0307517_10004982 | 3300028786 | Bacteria | 20222 |
| 503 | Ga0307517_10087446 | 3300028786 | Bacteria | 2589 |
| 504 | Ga0307517_10152281 | 3300028786 | Bacteria | 1582 |
| 505 | Ga0307517_10185718 | 3300028786 | Bacteria | 1331 |
| 506 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 507 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 508 | Ga0307515_10001622 | 3300028794 | Bacteria | 50061 |
| 509 | Ga0307515_10015131 | 3300028794 | Bacteria | 14230 |
| 510 | Ga0307515_10015416 | 3300028794 | Bacteria | 14081 |
| 511 | Ga0307515_10016824 | 3300028794 | Bacteria | 13369 |
| 512 | Ga0307515_10086229 | 3300028794 | Bacteria | 4005 |
| 513 | Ga0307515_10164487 | 3300028794 | Bacteria | 2244 |
| 514 | Ga0307515_10239809 | 3300028794 | Bacteria | 1587 |
| 515 | Ga0307512_10063200 | 3300030522 | Bacteria | 2832 |
| 516 | Ga0307513_10002553 | 3300031456 | Bacteria | 25147 |
| 517 | Ga0307513_10039012 | 3300031456 | Bacteria | 5269 |
| 518 | Ga0307513_10040644 | 3300031456 | Bacteria | 5141 |
| 519 | Ga0307513_10044803 | 3300031456 | Bacteria | 4842 |
| 520 | Ga0307513_10229244 | 3300031456 | Bacteria | 1671 |
| 521 | Ga0307513_10280163 | 3300031456 | Bacteria | 1445 |
| 522 | Ga0307509_10005169 | 3300031507 | Bacteria | 18309 |
| 523 | Ga0307509_10023117 | 3300031507 | Bacteria | 6989 |
| 524 | Ga0307509_10039152 | 3300031507 | Bacteria | 5166 |
| 525 | Ga0307509_10052887 | 3300031507 | Bacteria | 4334 |
| 526 | Ga0307509_10150861 | 3300031507 | Bacteria | 2240 |
| 527 | Ga0307509_10206828 | 3300031507 | Bacteria | 1792 |
| 528 | Ga0307509_10301794 | 3300031507 | Bacteria | 1349 |
| 529 | Ga0307408_100000038 | 3300031548 | Bacteria | 183170 |
| 530 | Ga0307408_100023553 | 3300031548 | Bacteria | 4196 |
| 531 | Ga0307408_100096268 | 3300031548 | Bacteria | 2245 |
| 532 | Ga0307408_100430525 | 3300031548 | Bacteria | 1140 |
| 533 | Ga0307408_100515310 | 3300031548 | Bacteria | 1049 |
| 534 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 535 | Ga0307508_10000738 | 3300031616 | Bacteria | 38723 |
| 536 | Ga0307508_10042723 | 3300031616 | Bacteria | 4064 |
| 537 | Ga0307508_10134438 | 3300031616 | Bacteria | 2076 |
| 538 | Ga0307514_10014340 | 3300031649 | Bacteria | 6562 |
| 539 | Ga0307516_10003350 | 3300031730 | Bacteria | 20726 |
| 540 | Ga0307516_10005683 | 3300031730 | Bacteria | 14791 |
| 541 | Ga0307516_10007148 | 3300031730 | Bacteria | 12888 |
| 542 | Ga0307516_10012873 | 3300031730 | Bacteria | 8976 |
| 543 | Ga0307516_10047797 | 3300031730 | Bacteria | 4213 |
| 544 | Ga0307516_10055228 | 3300031730 | Bacteria | 3878 |
| 545 | Ga0307405_10037541 | 3300031731 | Bacteria | 2912 |
| 546 | Ga0307413_10004001 | 3300031824 | Bacteria | 6333 |
| 547 | Ga0307410_10013145 | 3300031852 | Bacteria | 4818 |
| 548 | Ga0307406_10007866 | 3300031901 | Bacteria | 5934 |
| 549 | Ga0307406_10070873 | 3300031901 | Bacteria | 2283 |
| 550 | Ga0307407_10038907 | 3300031903 | Bacteria | 2640 |
| 551 | Ga0307407_10097516 | 3300031903 | Bacteria | 1817 |
| 552 | Ga0307412_10007008 | 3300031911 | Bacteria | 6397 |
| 553 | Ga0307412_10499754 | 3300031911 | Bacteria | 1012 |
| 554 | Ga0307409_100000998 | 3300031995 | Bacteria | 13235 |
| 555 | Ga0307409_100024853 | 3300031995 | Bacteria | 4188 |
| 556 | Ga0307409_100232311 | 3300031995 | Bacteria | 1673 |
| 557 | Ga0307416_100010514 | 3300032002 | Bacteria | 6117 |
| 558 | Ga0307416_100114686 | 3300032002 | Bacteria | 2384 |
| 559 | Ga0307414_10050194 | 3300032004 | Bacteria | 2889 |
| 560 | Ga0307414_10208028 | 3300032004 | Bacteria | 1597 |
| 561 | Ga0307411_10000979 | 3300032005 | Bacteria | 10978 |
| 562 | Ga0307411_10019052 | 3300032005 | Bacteria | 3953 |
| 563 | Ga0307411_10285897 | 3300032005 | Bacteria | 1315 |
| 564 | Ga0307415_100031801 | 3300032126 | Bacteria | 3405 |
| 565 | Ga0307415_100051892 | 3300032126 | Bacteria | 2786 |
| 566 | Ga0307507_10032760 | 3300033179 | Bacteria | 5415 |
| 567 | Ga0307507_10119882 | 3300033179 | Bacteria | 2109 |
| 568 | Ga0307510_10027873 | 3300033180 | Bacteria | 6461 |
| 569 | Ga0307510_10036903 | 3300033180 | Bacteria | 5433 |
| 570 | Ga0307510_10075055 | 3300033180 | Bacteria | 3336 |
| 571 | Ga0307510_10213471 | 3300033180 | Bacteria | 1449 |
| 572 | Ga0373936_0113328 | 3300035113 | Bacteria | 1153 |
| 573 | Ga0373939_0000473 | 3300035114 | Bacteria | 10147 |
| 574 | Ga0373945_0044197 | 3300035116 | Bacteria | 1619 |
| 575 | Ga0373954_0056738 | 3300035118 | Bacteria | 1844 |
| 576 | Ga0373943_0172921 | 3300035170 | Bacteria | 1183 |
| 577 | Ga0373946_0055697 | 3300035171 | Bacteria | 1668 |
| 578 | Ga0373955_0033098 | 3300035172 | Bacteria | 2720 |
| 579 | Ga0373962_0093956 | 3300035242 | Bacteria | 927 |
| 580 | Ga0373931_0000592 | 3300035691 | Bacteria | 14947 |
| 581 | Ga0373931_0003802 | 3300035691 | Bacteria | 6830 |
| 582 | Ga0373931_0014685 | 3300035691 | Bacteria | 3833 |
| 583 | Ga0373927_0220710 | 3300035695 | Bacteria | 1245 |
| 584 | Ga0373937_0027070 | 3300036401 | Bacteria | 5183 |
| 585 | Ga0373937_0068865 | 3300036401 | Bacteria | 3262 |
| 586 | Ga0373925_0182142 | 3300037068 | Bacteria | 1663 |
| 587 | Ga0395900_0000378 | 3300037418 | Bacteria | 64374 |
| 588 | Ga0395898_0001418 | 3300037466 | Bacteria | 34116 |
| 589 | Ga0395905_0000140 | 3300037471 | Bacteria | 120221 |
| 590 | Ga0395905_0010601 | 3300037471 | Bacteria | 8946 |
| 591 | Ga0395905_0046174 | 3300037471 | Bacteria | 4084 |
| 592 | Ga0395905_0071504 | 3300037471 | Bacteria | 3252 |
| 593 | Ga0436361_0176167 | 3300039447 | Bacteria | 2834 |
| 594 | Ga0436361_0376061 | 3300039447 | Bacteria | 200571 |
| 595 | Ga0436361_0661219 | 3300039447 | Bacteria | 16120 |
| 596 | Ga0436361_0850318 | 3300039447 | Bacteria | 4805 |
| 597 | Ga0436361_1188656 | 3300039447 | Bacteria | 7770 |
| 598 | Ga0439465_0040569 | 3300041413 | Bacteria | 1505 |
| 599 | Ga0451795_1472563 | 3300041456 | Bacteria | 1594 |
| 600 | Ga0451800_1509975 | 3300041459 | Bacteria | 1169 |
| 601 | Ga0451802_0268620 | 3300041460 | Bacteria | 2271 |
| 602 | Ga0451802_1769615 | 3300041460 | Bacteria | 1304 |
| 603 | Ga0451807_0320661 | 3300041486 | Bacteria | 1563 |
| 604 | Ga0439437_000875 | 3300042000 | Bacteria | 3132 |
| 605 | Ga0439437_004926 | 3300042000 | Bacteria | 1464 |
| 606 | Ga0439449_0018927 | 3300042007 | Bacteria | 2582 |
| 607 | Ga0439450_006794 | 3300042008 | Bacteria | 2072 |
| 608 | Ga0439454_014139 | 3300042011 | Bacteria | 1103 |
| 609 | Ga0450917_000152 | 3300042120 | Bacteria | 4594 |
| 610 | Ga0450890_000380 | 3300042127 | Bacteria | 6485 |
| 611 | Ga0450890_001531 | 3300042127 | Bacteria | 3322 |
| 612 | Ga0450891_000009 | 3300042129 | Bacteria | 14978 |
| 613 | Ga0450892_001075 | 3300042130 | Bacteria | 2858 |
| 614 | Ga0450898_024535 | 3300042134 | Bacteria | 1078 |
| 615 | Ga0450899_001706 | 3300042135 | Bacteria | 2431 |
| 616 | Ga0450889_000322 | 3300042144 | Bacteria | 5345 |
| 617 | Ga0439446_0012141 | 3300042156 | Bacteria | 2350 |
| 618 | Ga0439459_0001206 | 3300042438 | Bacteria | 3774 |
| 619 | Ga0450916_011857 | 3300042530 | Bacteria | 1106 |
| 620 | Ga0450918_000032 | 3300042531 | Bacteria | 28506 |
| 621 | Ga0450893_0007029 | 3300042532 | Bacteria | 1824 |
| 622 | Ga0451577_0016311 | 3300042876 | Bacteria | 6882 |
| 623 | Ga0451577_0016490 | 3300042876 | Bacteria | 6840 |
| 624 | Ga0451577_0018894 | 3300042876 | Bacteria | 6344 |
| 625 | Ga0451577_0111724 | 3300042876 | Bacteria | 2445 |
| 626 | Ga0466969_0000595 | 3300044656 | Bacteria | 19624 |
| 627 | Ga0466969_0031112 | 3300044656 | Bacteria | 2717 |
| 628 | Ga0466972_0004708 | 3300044658 | Bacteria | 6833 |
| 629 | Ga0466972_0023937 | 3300044658 | Bacteria | 3034 |
| 630 | Ga0466972_0092783 | 3300044658 | Bacteria | 1431 |
| 631 | Ga0466965_0079289 | 3300044683 | Bacteria | 1658 |
| 632 | Ga0466965_0163086 | 3300044683 | Bacteria | 1169 |
| 633 | Ga0466966_0020813 | 3300044684 | Bacteria | 4312 |
| 634 | Ga0466966_0072535 | 3300044684 | Bacteria | 2155 |
| 635 | Ga0466961_0010868 | 3300044693 | Bacteria | 5814 |
| 636 | Ga0466961_0022304 | 3300044693 | Bacteria | 4073 |
| 637 | Ga0466963_0087157 | 3300044694 | Bacteria | 2122 |
| 638 | Ga0466963_0191646 | 3300044694 | Bacteria | 1428 |
| 639 | Ga0466964_0013194 | 3300044706 | Bacteria | 3132 |
| 640 | Ga0453684_0052450 | 3300044712 | Bacteria | 5332 |
| 641 | Ga0453684_0144500 | 3300044712 | Bacteria | 2836 |
| 642 | Ga0453684_0162760 | 3300044712 | Bacteria | 2637 |
| 643 | Ga0453684_0270026 | 3300044712 | Bacteria | 1944 |
| 644 | Ga0453684_0284315 | 3300044712 | Bacteria | 1885 |
| 645 | Ga0466970_0054937 | 3300044765 | Bacteria | 2126 |
| 646 | Ga0466970_0063142 | 3300044765 | Bacteria | 1986 |
| 647 | Ga0466957_0176607 | 3300044842 | Bacteria | 1393 |
| 648 | Ga0466957_0198590 | 3300044842 | Bacteria | 1316 |
| 649 | Ga0466960_0054584 | 3300044901 | Bacteria | 1940 |
| 650 | Ga0466959_0016680 | 3300045049 | Bacteria | 5371 |
| 651 | Ga0451576_0031221 | 3300045051 | Bacteria | 5682 |
| 652 | Ga0451576_0057090 | 3300045051 | Bacteria | 4081 |
| 653 | Ga0451576_0273449 | 3300045051 | Bacteria | 1766 |
| 654 | Ga0451576_0339540 | 3300045051 | Bacteria | 1572 |
| 655 | Ga0466967_0073560 | 3300045976 | Bacteria | 3066 |
| 656 | Ga0495592_0015031 | 3300046454 | Bacteria | 5877 |
| 657 | Ga0495629_0132975 | 3300046459 | Bacteria | 1733 |
| 658 | Ga0495638_0059719 | 3300046460 | Bacteria | 2360 |
| 659 | Ga0495650_0009265 | 3300046471 | Bacteria | 5622 |
| 660 | Ga0495580_0038552 | 3300046472 | Bacteria | 3422 |
| 661 | Ga0495580_0128718 | 3300046472 | Bacteria | 1757 |
| 662 | Ga0495605_0068331 | 3300046474 | Bacteria | 1684 |
| 663 | Ga0495664_0047649 | 3300046477 | Bacteria | 2544 |
| 664 | Ga0495610_0058151 | 3300046512 | Bacteria | 1851 |
| 665 | Ga0495620_0030046 | 3300046515 | Bacteria | 2507 |
| 666 | Ga0495631_0086079 | 3300046518 | Bacteria | 1354 |
| 667 | Ga0495632_0010505 | 3300046519 | Bacteria | 5474 |
| 668 | Ga0495632_0012778 | 3300046519 | Bacteria | 4820 |
| 669 | Ga0495632_0018008 | 3300046519 | Bacteria | 3884 |
| 670 | Ga0495632_0042105 | 3300046519 | Bacteria | 2291 |
| 671 | Ga0495643_0015622 | 3300046522 | Bacteria | 4481 |
| 672 | Ga0495648_0065053 | 3300046524 | Bacteria | 2146 |
| 673 | Ga0495648_0192729 | 3300046524 | Bacteria | 1027 |
| 674 | Ga0495642_0063505 | 3300046528 | Bacteria | 1535 |
| 675 | Ga0495586_0191238 | 3300046535 | Bacteria | 1159 |
| 676 | Ga0495598_0035924 | 3300046537 | Bacteria | 1421 |
| 677 | Ga0495621_0004199 | 3300046539 | Bacteria | 4024 |
| 678 | Ga0495597_0108654 | 3300046542 | Bacteria | 1164 |
| 679 | Ga0495645_0056885 | 3300046543 | Bacteria | 2840 |
| 680 | Ga0495645_0131680 | 3300046543 | Bacteria | 1752 |
| 681 | Ga0495622_0018138 | 3300046557 | Bacteria | 3278 |
| 682 | Ga0495667_0198994 | 3300046559 | Bacteria | 1283 |
| 683 | Ga0495611_0111293 | 3300046648 | Bacteria | 1275 |
| 684 | Ga0495625_0056756 | 3300046660 | Bacteria | 2786 |
| 685 | Ga0495635_0215317 | 3300046663 | Bacteria | 1300 |
| 686 | Ga0495647_0009330 | 3300046681 | Bacteria | 3321 |
| 687 | Ga0495658_0184818 | 3300046683 | Bacteria | 1294 |
| 688 | Ga0495624_0064038 | 3300046690 | Bacteria | 2298 |
| 689 | Ga0495670_0166774 | 3300046691 | Bacteria | 1159 |
| 690 | Ga0495649_0003169 | 3300046694 | Bacteria | 11245 |
| 691 | Ga0495649_0259629 | 3300046694 | Bacteria | 891 |
| 692 | Ga0495600_0219065 | 3300046809 | Bacteria | 1218 |
| 693 | Ga0495660_0026700 | 3300046810 | Bacteria | 3271 |
| 694 | Ga0495687_008688 | 3300047443 | Bacteria | 5779 |
| 695 | Ga0495684_0099654 | 3300047471 | Bacteria | 2197 |
| 696 | Ga0495686_0019240 | 3300047472 | Bacteria | 4566 |
| 697 | Ga0495686_0159652 | 3300047472 | Bacteria | 1318 |
| 698 | Ga0495593_0021198 | 3300047673 | Bacteria | 3633 |
| 699 | Ga0495602_0436431 | 3300048088 | Bacteria | 927 |
| 700 | Ga0496102_0019412 | 3300048905 | Bacteria | 5988 |
| 701 | Ga0496102_0019732 | 3300048905 | Bacteria | 5942 |
| 702 | Ga0496104_0031558 | 3300048907 | Bacteria | 4928 |
| 703 | Ga0496104_0042098 | 3300048907 | Bacteria | 4285 |
| 704 | Ga0496104_0063012 | 3300048907 | Bacteria | 3516 |
| 705 | Ga0496105_0232127 | 3300048908 | Bacteria | 1499 |
| 706 | Ga0496106_0036433 | 3300048909 | Bacteria | 3680 |
| 707 | Ga0496107_0020662 | 3300048910 | Bacteria | 4652 |
| 708 | Ga0496108_0054149 | 3300048911 | Bacteria | 3367 |
| 709 | Ga0496108_0059750 | 3300048911 | Bacteria | 3206 |
| 710 | Ga0496108_0074503 | 3300048911 | Bacteria | 2866 |
| 711 | Ga0496108_0396000 | 3300048911 | Bacteria | 1206 |
| 712 | Ga0496109_0048691 | 3300048912 | Bacteria | 3856 |
| 713 | Ga0496109_0158807 | 3300048912 | Bacteria | 2118 |
| 714 | Ga0496110_0107019 | 3300048913 | Bacteria | 2510 |
| 715 | Ga0496110_0221703 | 3300048913 | Bacteria | 1720 |
| 716 | Ga0496111_0066936 | 3300048914 | Bacteria | 2609 |
| 717 | Ga0496112_0138311 | 3300048915 | Bacteria | 2405 |
| 718 | Ga0496113_0064832 | 3300048916 | Bacteria | 2763 |
| 719 | Ga0496114_0020018 | 3300048917 | Bacteria | 5428 |
| 720 | Ga0496114_0153338 | 3300048917 | Bacteria | 1999 |
| 721 | Ga0496115_0020021 | 3300048918 | Bacteria | 5155 |
| 722 | Ga0496121_0016606 | 3300048924 | Bacteria | 7587 |
| 723 | Ga0496124_0000161 | 3300048927 | Bacteria | 136651 |
| 724 | Ga0496125_0017717 | 3300048928 | Bacteria | 6780 |
| 725 | Ga0501309_010734 | 3300049129 | Bacteria | 1185 |
| 726 | Ga0501310_002501 | 3300049130 | Bacteria | 1751 |
| 727 | Ga0501292_001467 | 3300049515 | Bacteria | 2907 |
| 728 | Ga0501034_0116252 | 3300049571 | Bacteria | 2663 |
| 729 | Ga0501039_0355635 | 3300049575 | Bacteria | 1151 |
| 730 | Ga0501043_0013188 | 3300049579 | Bacteria | 6464 |
| 731 | Ga0501046_0000049 | 3300049580 | Bacteria | 135088 |
| 732 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 733 | Ga0501048_0015557 | 3300049582 | Bacteria | 5619 |
| 734 | Ga0501198_000166 | 3300049649 | Bacteria | 8715 |
| 735 | Ga0501206_011526 | 3300049653 | Bacteria | 1194 |
| 736 | Ga0501211_000398 | 3300049658 | Bacteria | 4143 |
| 737 | Ga0501222_000256 | 3300049662 | Bacteria | 8961 |
| 738 | Ga0501222_003094 | 3300049662 | Bacteria | 2285 |
| 739 | Ga0501252_001271 | 3300049682 | Bacteria | 2281 |
| 740 | Ga0501253_007103 | 3300049683 | Bacteria | 1550 |
| 741 | Ga0501255_009784 | 3300049684 | Bacteria | 1071 |
| 742 | Ga0501257_028200 | 3300049686 | Bacteria | 1346 |
| 743 | Ga0501258_000887 | 3300049687 | Bacteria | 2249 |
| 744 | Ga0501221_007219 | 3300049704 | Bacteria | 1899 |
| 745 | Ga0501225_0020353 | 3300049705 | Bacteria | 1834 |
| 746 | Ga0501267_001944 | 3300049764 | Bacteria | 1823 |
| 747 | Ga0501035_0143246 | 3300049822 | Bacteria | 2077 |
| 748 | Ga0501035_0332354 | 3300049822 | Bacteria | 1275 |
| 749 | Ga0501044_0278747 | 3300049823 | Bacteria | 1606 |
| 750 | Ga0501045_0024117 | 3300049824 | Bacteria | 4366 |
| 751 | nmdc:mga03683_129445_c1 | 3300050489 | Bacteria | 1128 |
| 752 | nmdc:mga03683_44576_c1 | 3300050489 | Bacteria | 1833 |
| 753 | nmdc:mga03n38_74311_c1 | 3300050490 | Bacteria | 1581 |
| 754 | nmdc:mga0k408_102377_c1 | 3300050493 | Bacteria | 1689 |
| 755 | nmdc:mga0k408_10775_c2 | 3300050493 | Bacteria | 2658 |
| 756 | nmdc:mga0k408_1102_c1 | 3300050493 | Bacteria | 14783 |
| 757 | nmdc:mga0k408_121448_c1 | 3300050493 | Bacteria | 1547 |
| 758 | nmdc:mga0k408_14563_c1 | 3300050493 | Bacteria | 4337 |
| 759 | nmdc:mga0k408_183701_c1 | 3300050493 | Bacteria | 1247 |
| 760 | nmdc:mga0k408_220299_c1 | 3300050493 | Bacteria | 1133 |
| 761 | nmdc:mga0k408_3182_c1 | 3300050493 | Bacteria | 8694 |
| 762 | nmdc:mga0k408_3241_c1 | 3300050493 | Bacteria | 8614 |
| 763 | nmdc:mga0k408_3706_c1 | 3300050493 | Bacteria | 8095 |
| 764 | nmdc:mga0k408_4690_c1 | 3300050493 | Bacteria | 7247 |
| 765 | nmdc:mga0k408_4692_c1 | 3300050493 | Bacteria | 7245 |
| 766 | nmdc:mga0k408_55825_c1 | 3300050493 | Bacteria | 2290 |
| 767 | nmdc:mga0k408_66978_c1 | 3300050493 | Bacteria | 2092 |
| 768 | nmdc:mga0k408_67756_c1 | 3300050493 | Bacteria | 2081 |
| 769 | nmdc:mga0k408_69545_c1 | 3300050493 | Bacteria | 2055 |
| 770 | nmdc:mga06z11_214880_c1 | 3300050494 | Bacteria | 1122 |
| 771 | nmdc:mga06z11_22764_c1 | 3300050494 | Bacteria | 2932 |
| 772 | nmdc:mga06z11_6551_c1 | 3300050494 | Bacteria | 4748 |
| 773 | nmdc:mga04h51_10773_c1 | 3300050495 | Bacteria | 2521 |
| 774 | nmdc:mga07m45_11905_c1 | 3300050496 | Bacteria | 4583 |
| 775 | nmdc:mga07m45_2726_c1 | 3300050496 | Bacteria | 8326 |
| 776 | nmdc:mga07m45_29645_c1 | 3300050496 | Bacteria | 3028 |
| 777 | nmdc:mga07m45_44795_c1 | 3300050496 | Bacteria | 2483 |
| 778 | nmdc:mga07m45_521_c1 | 3300050496 | Bacteria | 16326 |
| 779 | nmdc:mga07m45_6176_c1 | 3300050496 | Bacteria | 6041 |
| 780 | nmdc:mga05p37_219315_c1 | 3300050507 | Bacteria | 2296 |
| 781 | nmdc:mga09592_28321_c1 | 3300050508 | Bacteria | 4654 |
| 782 | nmdc:mga08y16_210159_c1 | 3300050511 | Bacteria | 2015 |
| 783 | nmdc:mga0sz30_3842_c1 | 3300050516 | Bacteria | 5416 |
| 784 | Ga0495601_0261976 | 3300053077 | Bacteria | 1128 |
| 785 | Ga0500578_0000007 | 3300053086 | Bacteria | 229642 |
| 786 | Ga0500644_0007389 | 3300053088 | Bacteria | 2860 |
| 787 | Ga0500644_0020243 | 3300053088 | Bacteria | 1975 |
| 788 | Ga0500644_0048148 | 3300053088 | Bacteria | 1449 |
| 789 | Ga0500646_0014730 | 3300053090 | Bacteria | 2031 |
| 790 | Ga0500651_0028496 | 3300053093 | Bacteria | 3511 |
| 791 | Ga0500651_0094844 | 3300053093 | Bacteria | 1834 |
| 792 | Ga0500556_0066206 | 3300053104 | Bacteria | 1341 |
| 793 | Ga0500569_026989 | 3300053109 | Bacteria | 1579 |
| 794 | Ga0500593_004305 | 3300053117 | Bacteria | 5501 |
| 795 | Ga0500628_005054 | 3300053129 | Bacteria | 2191 |
| 796 | Ga0500652_001774 | 3300053131 | Bacteria | 6541 |
| 797 | Ga0500655_008958 | 3300053133 | Bacteria | 1800 |
| 798 | Ga0500658_0009620 | 3300053134 | Bacteria | 3564 |
| 799 | Ga0500658_0011046 | 3300053134 | Bacteria | 3329 |
| 800 | Ga0500559_0000262 | 3300053136 | Bacteria | 41173 |
| 801 | Ga0500568_0013553 | 3300053139 | Bacteria | 3713 |
| 802 | Ga0500568_0045798 | 3300053139 | Bacteria | 1739 |
| 803 | Ga0500568_0062489 | 3300053139 | Bacteria | 1438 |
| 804 | Ga0500577_0019925 | 3300053142 | Bacteria | 2184 |
| 805 | Ga0500590_006823 | 3300053148 | Bacteria | 5588 |
| 806 | Ga0500619_000525 | 3300053154 | Bacteria | 6630 |
| 807 | Ga0500622_0000359 | 3300053156 | Bacteria | 44261 |
| 808 | Ga0500622_0003431 | 3300053156 | Bacteria | 10597 |
| 809 | Ga0500645_004369 | 3300053730 | Bacteria | 5435 |
| 810 | Ga0500587_001082 | 3300053739 | Bacteria | 3732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2928519762 | 2928520313 | 273 |
| 2 | 3300031730 | Ga0307516_10007148 | Ga0307516_100071483 | 280 |
| 3 | 3300035242 | Ga0373962_0093956 | Ga0373962_0093956_60_908 | 282 |
| 4 | 3300035695 | Ga0373927_0220710 | Ga0373927_0220710_202_1116 | 282 |
| 5 | 3300046694 | Ga0495649_0259629 | Ga0495649_0259629_18_866 | 282 |
| 6 | 3300048088 | Ga0495602_0436431 | Ga0495602_0436431_29_877 | 282 |
| 7 | 3300005295 | Ga0065707_10084028 | Ga0065707_100840283 | 284 |
| 8 | 3300005842 | Ga0068858_100439715 | Ga0068858_1004397151 | 284 |
| 9 | 3300046477 | Ga0495664_0047649 | Ga0495664_0047649_734_1615 | 284 |
| 10 | 3300046472 | Ga0495580_0128718 | Ga0495580_0128718_541_1401 | 286 |
| 11 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005366 | 288 |
| 12 | 3300028794 | Ga0307515_10086229 | Ga0307515_100862293 | 289 |
| 13 | 3300053139 | Ga0500568_0013553 | Ga0500568_0013553_2191_3063 | 289 |
| 14 | 3300005355 | Ga0070671_100005645 | Ga0070671_1000056454 | 290 |
| 15 | 3300005618 | Ga0068864_100019407 | Ga0068864_1000194073 | 290 |
| 16 | 3300009177 | Ga0105248_10000644 | Ga0105248_1000064419 | 290 |
| 17 | 3300025941 | Ga0207711_10014620 | Ga0207711_100146204 | 290 |
| 18 | 3300026095 | Ga0207676_10104531 | Ga0207676_101045311 | 290 |
| 19 | 3300028794 | Ga0307515_10239809 | Ga0307515_102398092 | 290 |
| 20 | 3300048907 | Ga0496104_0042098 | Ga0496104_0042098_916_1791 | 290 |
| 21 | 3300048908 | Ga0496105_0232127 | Ga0496105_0232127_361_1236 | 290 |
| 22 | 3300048911 | Ga0496108_0074503 | Ga0496108_0074503_649_1524 | 290 |
| 23 | 3300048915 | Ga0496112_0138311 | Ga0496112_0138311_710_1585 | 290 |
| 24 | iso_pu_bacteria | 2585428057 | 2587728244 | 290 |
| 25 | iso_pu_bacteria | 2585428058 | 2587734550 | 290 |
| 26 | iso_pu_bacteria | 2585428062 | 2587755467 | 290 |
| 27 | iso_pu_bacteria | 2588253510 | 2588295702 | 290 |
| 28 | iso_pu_bacteria | 2643221592 | 2643971114 | 290 |
| 29 | iso_pu_bacteria | 2643221625 | 2644142119 | 290 |
| 30 | iso_pu_bacteria | 2643221644 | 2644246044 | 290 |
| 31 | iso_pu_bacteria | 2643221648 | 2644275371 | 290 |
| 32 | iso_pu_bacteria | 2643221654 | 2644304095 | 290 |
| 33 | iso_pu_bacteria | 2643221660 | 2644337335 | 290 |
| 34 | 3300009147 | Ga0114129_10172375 | Ga0114129_101723752 | 291 |
| 35 | 3300021361 | Ga0213872_10000804 | Ga0213872_1000080416 | 291 |
| 36 | 3300039447 | Ga0436361_0176167 | Ga0436361_0176167_16_891 | 291 |
| 37 | 3300039447 | Ga0436361_0661219 | Ga0436361_0661219_4614_5507 | 291 |
| 38 | 3300050507 | nmdc:mga05p37_219315_c1 | nmdc:mga05p37_219315_c1_651_1529 | 291 |
| 39 | iso_pu_bacteria | 2643221544 | 2643746796 | 291 |
| 40 | iso_pu_bacteria | 2643221585 | 2643935663 | 291 |
| 41 | iso_pu_bacteria | 2643221639 | 2644221134 | 291 |
| 42 | iso_pu_bacteria | 2643221646 | 2644259976 | 291 |
| 43 | iso_pu_bacteria | 2643221656 | 2644317446 | 291 |
| 44 | iso_pu_bacteria | 2738541337 | 2739057628 | 291 |
| 45 | iso_pu_bacteria | 2831864461 | 2831866675 | 291 |
| 46 | 3300005366 | Ga0070659_100393377 | Ga0070659_1003933771 | 292 |
| 47 | 3300005456 | Ga0070678_100136783 | Ga0070678_1001367832 | 292 |
| 48 | 3300009093 | Ga0105240_10015269 | Ga0105240_100152699 | 292 |
| 49 | 3300009545 | Ga0105237_10001569 | Ga0105237_1000156916 | 292 |
| 50 | 3300009551 | Ga0105238_10015851 | Ga0105238_100158513 | 292 |
| 51 | 3300010375 | Ga0105239_10000486 | Ga0105239_1000048622 | 292 |
| 52 | 3300014326 | Ga0157380_10715303 | Ga0157380_107153032 | 292 |
| 53 | 3300021361 | Ga0213872_10000036 | Ga0213872_1000003678 | 292 |
| 54 | 3300021361 | Ga0213872_10005088 | Ga0213872_100050884 | 292 |
| 55 | 3300025913 | Ga0207695_10008032 | Ga0207695_1000803211 | 292 |
| 56 | 3300025914 | Ga0207671_10001963 | Ga0207671_1000196319 | 292 |
| 57 | 3300025924 | Ga0207694_10024236 | Ga0207694_100242363 | 292 |
| 58 | 3300025932 | Ga0207690_10261190 | Ga0207690_102611902 | 292 |
| 59 | 3300026041 | Ga0207639_10303529 | Ga0207639_103035292 | 292 |
| 60 | 3300026121 | Ga0207683_10147666 | Ga0207683_101476662 | 292 |
| 61 | 3300026142 | Ga0207698_10084701 | Ga0207698_100847012 | 292 |
| 62 | 3300028794 | Ga0307515_10016824 | Ga0307515_100168249 | 292 |
| 63 | 3300031730 | Ga0307516_10005683 | Ga0307516_1000568310 | 292 |
| 64 | 3300037471 | Ga0395905_0000140 | Ga0395905_0000140_100974_101855 | 292 |
| 65 | 3300039447 | Ga0436361_0850318 | Ga0436361_0850318_2397_3278 | 292 |
| 66 | 3300039447 | Ga0436361_1188656 | Ga0436361_1188656_3857_4735 | 292 |
| 67 | 3300041460 | Ga0451802_1769615 | Ga0451802_1769615_230_1111 | 292 |
| 68 | 3300042876 | Ga0451577_0016311 | Ga0451577_0016311_1581_2468 | 292 |
| 69 | 3300042876 | Ga0451577_0111724 | Ga0451577_0111724_672_1550 | 292 |
| 70 | 3300044656 | Ga0466969_0000595 | Ga0466969_0000595_2983_3861 | 292 |
| 71 | 3300044658 | Ga0466972_0023937 | Ga0466972_0023937_396_1277 | 292 |
| 72 | 3300044684 | Ga0466966_0072535 | Ga0466966_0072535_1167_2045 | 292 |
| 73 | 3300044693 | Ga0466961_0022304 | Ga0466961_0022304_836_1714 | 292 |
| 74 | 3300044712 | Ga0453684_0284315 | Ga0453684_0284315_765_1643 | 292 |
| 75 | 3300006195 | Ga0075366_10080298 | Ga0075366_100802982 | 293 |
| 76 | 3300006880 | Ga0075429_100014052 | Ga0075429_1000140524 | 293 |
| 77 | 3300021361 | Ga0213872_10000016 | Ga0213872_10000016129 | 293 |
| 78 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051270 | 293 |
| 79 | 3300025949 | Ga0207667_10119729 | Ga0207667_101197292 | 293 |
| 80 | 3300031456 | Ga0307513_10002553 | Ga0307513_100025537 | 293 |
| 81 | 3300031730 | Ga0307516_10047797 | Ga0307516_100477975 | 293 |
| 82 | 3300039447 | Ga0436361_0376061 | Ga0436361_0376061_156892_157785 | 293 |
| 83 | 3300041413 | Ga0439465_0040569 | Ga0439465_0040569_415_1299 | 293 |
| 84 | 3300042134 | Ga0450898_024535 | Ga0450898_024535_164_1048 | 293 |
| 85 | 3300042876 | Ga0451577_0018894 | Ga0451577_0018894_2841_3725 | 293 |
| 86 | 3300044712 | Ga0453684_0144500 | Ga0453684_0144500_403_1287 | 293 |
| 87 | 3300044712 | Ga0453684_0162760 | Ga0453684_0162760_374_1279 | 293 |
| 88 | 3300045051 | Ga0451576_0339540 | Ga0451576_0339540_327_1211 | 293 |
| 89 | 3300046471 | Ga0495650_0009265 | Ga0495650_0009265_2238_3122 | 293 |
| 90 | 3300047472 | Ga0495686_0019240 | Ga0495686_0019240_855_1739 | 293 |
| 91 | 3300049571 | Ga0501034_0116252 | Ga0501034_0116252_20_904 | 293 |
| 92 | 3300050493 | nmdc:mga0k408_121448_c1 | nmdc:mga0k408_121448_c1_503_1393 | 293 |
| 93 | 3300050508 | nmdc:mga09592_28321_c1 | nmdc:mga09592_28321_c1_1495_2376 | 293 |
| 94 | 3300003215 | JGI25153J46596_10003961 | JGI25153J46596_100039615 | 294 |
| 95 | 3300003316 | rootH1_10027020 | rootH1_100270203 | 294 |
| 96 | 3300003322 | rootL2_10001380 | rootL2_100013804 | 294 |
| 97 | 3300003347 | JGI26128J50194_1000258 | JGI26128J50194_10002582 | 294 |
| 98 | 3300003775 | Ga0055524_1000102 | Ga0055524_100010299 | 294 |
| 99 | 3300003791 | Ga0055530_10006141 | Ga0055530_100061412 | 294 |
| 100 | 3300003791 | Ga0055530_10014378 | Ga0055530_100143783 | 294 |
| 101 | 3300003792 | Ga0055540_1000002 | Ga0055540_100000298 | 294 |
| 102 | 3300003794 | Ga0055531_10001967 | Ga0055531_1000196711 | 294 |
| 103 | 3300003794 | Ga0055531_10003060 | Ga0055531_100030607 | 294 |
| 104 | 3300005262 | Ga0065165_1001184 | Ga0065165_10011842 | 294 |
| 105 | 3300005327 | Ga0070658_10029927 | Ga0070658_100299274 | 294 |
| 106 | 3300005327 | Ga0070658_10105786 | Ga0070658_101057862 | 294 |
| 107 | 3300005327 | Ga0070658_10121654 | Ga0070658_101216542 | 294 |
| 108 | 3300005327 | Ga0070658_10179881 | Ga0070658_101798812 | 294 |
| 109 | 3300005327 | Ga0070658_10244441 | Ga0070658_102444412 | 294 |
| 110 | 3300005328 | Ga0070676_10004596 | Ga0070676_100045964 | 294 |
| 111 | 3300005328 | Ga0070676_10010958 | Ga0070676_100109582 | 294 |
| 112 | 3300005328 | Ga0070676_10093856 | Ga0070676_100938562 | 294 |
| 113 | 3300005328 | Ga0070676_10280031 | Ga0070676_102800312 | 294 |
| 114 | 3300005329 | Ga0070683_100092942 | Ga0070683_1000929422 | 294 |
| 115 | 3300005330 | Ga0070690_100011621 | Ga0070690_1000116213 | 294 |
| 116 | 3300005330 | Ga0070690_100071956 | Ga0070690_1000719562 | 294 |
| 117 | 3300005331 | Ga0070670_100002048 | Ga0070670_10000204811 | 294 |
| 118 | 3300005331 | Ga0070670_100008361 | Ga0070670_1000083615 | 294 |
| 119 | 3300005331 | Ga0070670_100021861 | Ga0070670_1000218614 | 294 |
| 120 | 3300005331 | Ga0070670_100025406 | Ga0070670_1000254064 | 294 |
| 121 | 3300005331 | Ga0070670_100093319 | Ga0070670_1000933191 | 294 |
| 122 | 3300005331 | Ga0070670_100121872 | Ga0070670_1001218722 | 294 |
| 123 | 3300005331 | Ga0070670_100133015 | Ga0070670_1001330152 | 294 |
| 124 | 3300005331 | Ga0070670_100158433 | Ga0070670_1001584332 | 294 |
| 125 | 3300005333 | Ga0070677_10008624 | Ga0070677_100086244 | 294 |
| 126 | 3300005334 | Ga0068869_100019801 | Ga0068869_1000198012 | 294 |
| 127 | 3300005334 | Ga0068869_100020284 | Ga0068869_1000202844 | 294 |
| 128 | 3300005334 | Ga0068869_100103271 | Ga0068869_1001032712 | 294 |
| 129 | 3300005334 | Ga0068869_100170879 | Ga0068869_1001708792 | 294 |
| 130 | 3300005335 | Ga0070666_10020859 | Ga0070666_100208594 | 294 |
| 131 | 3300005335 | Ga0070666_10033849 | Ga0070666_100338492 | 294 |
| 132 | 3300005335 | Ga0070666_10253599 | Ga0070666_102535991 | 294 |
| 133 | 3300005336 | Ga0070680_100037136 | Ga0070680_1000371362 | 294 |
| 134 | 3300005338 | Ga0068868_100013349 | Ga0068868_1000133492 | 294 |
| 135 | 3300005338 | Ga0068868_100021229 | Ga0068868_1000212292 | 294 |
| 136 | 3300005338 | Ga0068868_100024067 | Ga0068868_1000240673 | 294 |
| 137 | 3300005338 | Ga0068868_100029737 | Ga0068868_1000297371 | 294 |
| 138 | 3300005339 | Ga0070660_100009492 | Ga0070660_1000094922 | 294 |
| 139 | 3300005339 | Ga0070660_100037209 | Ga0070660_1000372092 | 294 |
| 140 | 3300005339 | Ga0070660_100046031 | Ga0070660_1000460312 | 294 |
| 141 | 3300005344 | Ga0070661_100010860 | Ga0070661_1000108603 | 294 |
| 142 | 3300005344 | Ga0070661_100025314 | Ga0070661_1000253142 | 294 |
| 143 | 3300005344 | Ga0070661_100067906 | Ga0070661_1000679062 | 294 |
| 144 | 3300005344 | Ga0070661_100169216 | Ga0070661_1001692161 | 294 |
| 145 | 3300005347 | Ga0070668_100016454 | Ga0070668_1000164543 | 294 |
| 146 | 3300005347 | Ga0070668_100047777 | Ga0070668_1000477772 | 294 |
| 147 | 3300005353 | Ga0070669_100030988 | Ga0070669_1000309883 | 294 |
| 148 | 3300005353 | Ga0070669_100041356 | Ga0070669_1000413562 | 294 |
| 149 | 3300005353 | Ga0070669_100055512 | Ga0070669_1000555122 | 294 |
| 150 | 3300005353 | Ga0070669_100058881 | Ga0070669_1000588812 | 294 |
| 151 | 3300005353 | Ga0070669_100441712 | Ga0070669_1004417121 | 294 |
| 152 | 3300005354 | Ga0070675_100006469 | Ga0070675_1000064695 | 294 |
| 153 | 3300005354 | Ga0070675_100008748 | Ga0070675_1000087485 | 294 |
| 154 | 3300005354 | Ga0070675_100044056 | Ga0070675_1000440563 | 294 |
| 155 | 3300005354 | Ga0070675_100046192 | Ga0070675_1000461922 | 294 |
| 156 | 3300005354 | Ga0070675_100078021 | Ga0070675_1000780212 | 294 |
| 157 | 3300005354 | Ga0070675_100094373 | Ga0070675_1000943732 | 294 |
| 158 | 3300005354 | Ga0070675_100160606 | Ga0070675_1001606062 | 294 |
| 159 | 3300005355 | Ga0070671_100008532 | Ga0070671_1000085324 | 294 |
| 160 | 3300005355 | Ga0070671_100013751 | Ga0070671_1000137514 | 294 |
| 161 | 3300005355 | Ga0070671_100022683 | Ga0070671_1000226834 | 294 |
| 162 | 3300005355 | Ga0070671_100045805 | Ga0070671_1000458052 | 294 |
| 163 | 3300005355 | Ga0070671_100067597 | Ga0070671_1000675972 | 294 |
| 164 | 3300005355 | Ga0070671_100095140 | Ga0070671_1000951402 | 294 |
| 165 | 3300005355 | Ga0070671_100181333 | Ga0070671_1001813331 | 294 |
| 166 | 3300005355 | Ga0070671_100193312 | Ga0070671_1001933122 | 294 |
| 167 | 3300005356 | Ga0070674_100012126 | Ga0070674_1000121262 | 294 |
| 168 | 3300005356 | Ga0070674_100025563 | Ga0070674_1000255632 | 294 |
| 169 | 3300005356 | Ga0070674_100071600 | Ga0070674_1000716002 | 294 |
| 170 | 3300005356 | Ga0070674_100079278 | Ga0070674_1000792782 | 294 |
| 171 | 3300005356 | Ga0070674_100132244 | Ga0070674_1001322442 | 294 |
| 172 | 3300005356 | Ga0070674_100167505 | Ga0070674_1001675052 | 294 |
| 173 | 3300005364 | Ga0070673_100009255 | Ga0070673_1000092554 | 294 |
| 174 | 3300005364 | Ga0070673_100023993 | Ga0070673_1000239932 | 294 |
| 175 | 3300005364 | Ga0070673_100216347 | Ga0070673_1002163472 | 294 |
| 176 | 3300005366 | Ga0070659_100059640 | Ga0070659_1000596402 | 294 |
| 177 | 3300005367 | Ga0070667_100011064 | Ga0070667_1000110643 | 294 |
| 178 | 3300005367 | Ga0070667_100023847 | Ga0070667_1000238473 | 294 |
| 179 | 3300005367 | Ga0070667_100025961 | Ga0070667_1000259614 | 294 |
| 180 | 3300005367 | Ga0070667_100586785 | Ga0070667_1005867851 | 294 |
| 181 | 3300005441 | Ga0070700_100008788 | Ga0070700_1000087883 | 294 |
| 182 | 3300005455 | Ga0070663_100007158 | Ga0070663_1000071582 | 294 |
| 183 | 3300005455 | Ga0070663_100020351 | Ga0070663_1000203512 | 294 |
| 184 | 3300005455 | Ga0070663_100110921 | Ga0070663_1001109212 | 294 |
| 185 | 3300005456 | Ga0070678_100201819 | Ga0070678_1002018192 | 294 |
| 186 | 3300005456 | Ga0070678_100227375 | Ga0070678_1002273752 | 294 |
| 187 | 3300005457 | Ga0070662_100004772 | Ga0070662_1000047725 | 294 |
| 188 | 3300005457 | Ga0070662_100020745 | Ga0070662_1000207452 | 294 |
| 189 | 3300005457 | Ga0070662_100022096 | Ga0070662_1000220963 | 294 |
| 190 | 3300005457 | Ga0070662_100052621 | Ga0070662_1000526212 | 294 |
| 191 | 3300005457 | Ga0070662_100099349 | Ga0070662_1000993492 | 294 |
| 192 | 3300005457 | Ga0070662_100205977 | Ga0070662_1002059772 | 294 |
| 193 | 3300005459 | Ga0068867_100000642 | Ga0068867_10000064218 | 294 |
| 194 | 3300005459 | Ga0068867_100004124 | Ga0068867_1000041246 | 294 |
| 195 | 3300005459 | Ga0068867_100005865 | Ga0068867_1000058653 | 294 |
| 196 | 3300005459 | Ga0068867_100015749 | Ga0068867_1000157493 | 294 |
| 197 | 3300005459 | Ga0068867_100050133 | Ga0068867_1000501332 | 294 |
| 198 | 3300005459 | Ga0068867_100205067 | Ga0068867_1002050671 | 294 |
| 199 | 3300005459 | Ga0068867_100434613 | Ga0068867_1004346131 | 294 |
| 200 | 3300005466 | Ga0070685_10116127 | Ga0070685_101161272 | 294 |
| 201 | 3300005467 | Ga0070706_100002793 | Ga0070706_1000027933 | 294 |
| 202 | 3300005468 | Ga0070707_100105284 | Ga0070707_1001052842 | 294 |
| 203 | 3300005530 | Ga0070679_100328672 | Ga0070679_1003286722 | 294 |
| 204 | 3300005539 | Ga0068853_100021319 | Ga0068853_1000213192 | 294 |
| 205 | 3300005539 | Ga0068853_100026405 | Ga0068853_1000264052 | 294 |
| 206 | 3300005543 | Ga0070672_100004613 | Ga0070672_1000046135 | 294 |
| 207 | 3300005543 | Ga0070672_100011208 | Ga0070672_1000112082 | 294 |
| 208 | 3300005543 | Ga0070672_100015698 | Ga0070672_1000156983 | 294 |
| 209 | 3300005543 | Ga0070672_100023554 | Ga0070672_1000235543 | 294 |
| 210 | 3300005543 | Ga0070672_100034805 | Ga0070672_1000348052 | 294 |
| 211 | 3300005543 | Ga0070672_100083301 | Ga0070672_1000833013 | 294 |
| 212 | 3300005543 | Ga0070672_100408634 | Ga0070672_1004086342 | 294 |
| 213 | 3300005543 | Ga0070672_100420968 | Ga0070672_1004209682 | 294 |
| 214 | 3300005548 | Ga0070665_100016656 | Ga0070665_1000166566 | 294 |
| 215 | 3300005563 | Ga0068855_100032561 | Ga0068855_1000325613 | 294 |
| 216 | 3300005563 | Ga0068855_100382622 | Ga0068855_1003826222 | 294 |
| 217 | 3300005564 | Ga0070664_100006429 | Ga0070664_1000064295 | 294 |
| 218 | 3300005564 | Ga0070664_100040387 | Ga0070664_1000403874 | 294 |
| 219 | 3300005564 | Ga0070664_100072443 | Ga0070664_1000724433 | 294 |
| 220 | 3300005564 | Ga0070664_100154891 | Ga0070664_1001548912 | 294 |
| 221 | 3300005564 | Ga0070664_100194418 | Ga0070664_1001944182 | 294 |
| 222 | 3300005578 | Ga0068854_100037510 | Ga0068854_1000375104 | 294 |
| 223 | 3300005578 | Ga0068854_100224210 | Ga0068854_1002242102 | 294 |
| 224 | 3300005614 | Ga0068856_100006124 | Ga0068856_1000061242 | 294 |
| 225 | 3300005614 | Ga0068856_100123364 | Ga0068856_1001233642 | 294 |
| 226 | 3300005616 | Ga0068852_100023193 | Ga0068852_1000231932 | 294 |
| 227 | 3300005616 | Ga0068852_100027990 | Ga0068852_1000279904 | 294 |
| 228 | 3300005616 | Ga0068852_100039338 | Ga0068852_1000393382 | 294 |
| 229 | 3300005616 | Ga0068852_100109473 | Ga0068852_1001094731 | 294 |
| 230 | 3300005616 | Ga0068852_100166749 | Ga0068852_1001667492 | 294 |
| 231 | 3300005616 | Ga0068852_100248668 | Ga0068852_1002486682 | 294 |
| 232 | 3300005616 | Ga0068852_100328211 | Ga0068852_1003282112 | 294 |
| 233 | 3300005616 | Ga0068852_100447148 | Ga0068852_1004471482 | 294 |
| 234 | 3300005616 | Ga0068852_100483701 | Ga0068852_1004837012 | 294 |
| 235 | 3300005616 | Ga0068852_100585957 | Ga0068852_1005859572 | 294 |
| 236 | 3300005618 | Ga0068864_100007037 | Ga0068864_1000070373 | 294 |
| 237 | 3300005618 | Ga0068864_100015754 | Ga0068864_1000157544 | 294 |
| 238 | 3300005618 | Ga0068864_100023608 | Ga0068864_1000236084 | 294 |
| 239 | 3300005718 | Ga0068866_10213288 | Ga0068866_102132881 | 294 |
| 240 | 3300005719 | Ga0068861_100006036 | Ga0068861_1000060366 | 294 |
| 241 | 3300005719 | Ga0068861_100011309 | Ga0068861_1000113094 | 294 |
| 242 | 3300005719 | Ga0068861_100014671 | Ga0068861_1000146712 | 294 |
| 243 | 3300005719 | Ga0068861_100031192 | Ga0068861_1000311923 | 294 |
| 244 | 3300005834 | Ga0068851_10002716 | Ga0068851_100027163 | 294 |
| 245 | 3300005834 | Ga0068851_10008035 | Ga0068851_100080354 | 294 |
| 246 | 3300005834 | Ga0068851_10089775 | Ga0068851_100897752 | 294 |
| 247 | 3300005840 | Ga0068870_10169441 | Ga0068870_101694412 | 294 |
| 248 | 3300005841 | Ga0068863_100038795 | Ga0068863_1000387954 | 294 |
| 249 | 3300005841 | Ga0068863_100051820 | Ga0068863_1000518202 | 294 |
| 250 | 3300005841 | Ga0068863_100162094 | Ga0068863_1001620942 | 294 |
| 251 | 3300005841 | Ga0068863_100511226 | Ga0068863_1005112262 | 294 |
| 252 | 3300005842 | Ga0068858_100002454 | Ga0068858_10000245417 | 294 |
| 253 | 3300005842 | Ga0068858_100031054 | Ga0068858_1000310543 | 294 |
| 254 | 3300005842 | Ga0068858_100035742 | Ga0068858_1000357422 | 294 |
| 255 | 3300005842 | Ga0068858_100249447 | Ga0068858_1002494472 | 294 |
| 256 | 3300005843 | Ga0068860_100001400 | Ga0068860_1000014003 | 294 |
| 257 | 3300005843 | Ga0068860_100022638 | Ga0068860_1000226384 | 294 |
| 258 | 3300005843 | Ga0068860_100044197 | Ga0068860_1000441972 | 294 |
| 259 | 3300005844 | Ga0068862_100036687 | Ga0068862_1000366872 | 294 |
| 260 | 3300005844 | Ga0068862_100087461 | Ga0068862_1000874612 | 294 |
| 261 | 3300006038 | Ga0075365_10015096 | Ga0075365_100150962 | 294 |
| 262 | 3300006042 | Ga0075368_10004264 | Ga0075368_100042642 | 294 |
| 263 | 3300006042 | Ga0075368_10083443 | Ga0075368_100834431 | 294 |
| 264 | 3300006048 | Ga0075363_100038499 | Ga0075363_1000384992 | 294 |
| 265 | 3300006048 | Ga0075363_100104865 | Ga0075363_1001048652 | 294 |
| 266 | 3300006051 | Ga0075364_10010325 | Ga0075364_100103254 | 294 |
| 267 | 3300006177 | Ga0075362_10003880 | Ga0075362_100038803 | 294 |
| 268 | 3300006177 | Ga0075362_10006506 | Ga0075362_100065062 | 294 |
| 269 | 3300006177 | Ga0075362_10015691 | Ga0075362_100156912 | 294 |
| 270 | 3300006177 | Ga0075362_10055107 | Ga0075362_100551072 | 294 |
| 271 | 3300006178 | Ga0075367_10005372 | Ga0075367_100053723 | 294 |
| 272 | 3300006178 | Ga0075367_10007232 | Ga0075367_100072323 | 294 |
| 273 | 3300006178 | Ga0075367_10055276 | Ga0075367_100552762 | 294 |
| 274 | 3300006186 | Ga0075369_10012194 | Ga0075369_100121942 | 294 |
| 275 | 3300006195 | Ga0075366_10003606 | Ga0075366_100036065 | 294 |
| 276 | 3300006195 | Ga0075366_10005541 | Ga0075366_100055413 | 294 |
| 277 | 3300006195 | Ga0075366_10005863 | Ga0075366_100058633 | 294 |
| 278 | 3300006195 | Ga0075366_10007743 | Ga0075366_100077434 | 294 |
| 279 | 3300006195 | Ga0075366_10008443 | Ga0075366_100084435 | 294 |
| 280 | 3300006195 | Ga0075366_10012804 | Ga0075366_100128042 | 294 |
| 281 | 3300006195 | Ga0075366_10026411 | Ga0075366_100264113 | 294 |
| 282 | 3300006195 | Ga0075366_10036785 | Ga0075366_100367852 | 294 |
| 283 | 3300006195 | Ga0075366_10051997 | Ga0075366_100519971 | 294 |
| 284 | 3300006195 | Ga0075366_10059162 | Ga0075366_100591622 | 294 |
| 285 | 3300006195 | Ga0075366_10159899 | Ga0075366_101598992 | 294 |
| 286 | 3300006195 | Ga0075366_10214028 | Ga0075366_102140281 | 294 |
| 287 | 3300006237 | Ga0097621_100035033 | Ga0097621_1000350332 | 294 |
| 288 | 3300006237 | Ga0097621_100060516 | Ga0097621_1000605162 | 294 |
| 289 | 3300006237 | Ga0097621_100133673 | Ga0097621_1001336732 | 294 |
| 290 | 3300006237 | Ga0097621_100312173 | Ga0097621_1003121732 | 294 |
| 291 | 3300006353 | Ga0075370_10004685 | Ga0075370_100046852 | 294 |
| 292 | 3300006353 | Ga0075370_10008432 | Ga0075370_100084323 | 294 |
| 293 | 3300006353 | Ga0075370_10008717 | Ga0075370_100087173 | 294 |
| 294 | 3300006353 | Ga0075370_10014080 | Ga0075370_100140802 | 294 |
| 295 | 3300006353 | Ga0075370_10014150 | Ga0075370_100141504 | 294 |
| 296 | 3300006353 | Ga0075370_10019838 | Ga0075370_100198384 | 294 |
| 297 | 3300006353 | Ga0075370_10056044 | Ga0075370_100560442 | 294 |
| 298 | 3300006353 | Ga0075370_10117372 | Ga0075370_101173722 | 294 |
| 299 | 3300006353 | Ga0075370_10250138 | Ga0075370_102501382 | 294 |
| 300 | 3300006358 | Ga0068871_100018527 | Ga0068871_1000185274 | 294 |
| 301 | 3300006358 | Ga0068871_100018943 | Ga0068871_1000189434 | 294 |
| 302 | 3300006358 | Ga0068871_100027282 | Ga0068871_1000272824 | 294 |
| 303 | 3300006358 | Ga0068871_100093142 | Ga0068871_1000931422 | 294 |
| 304 | 3300006358 | Ga0068871_100163356 | Ga0068871_1001633562 | 294 |
| 305 | 3300006881 | Ga0068865_100016820 | Ga0068865_1000168203 | 294 |
| 306 | 3300006881 | Ga0068865_100038534 | Ga0068865_1000385342 | 294 |
| 307 | 3300006881 | Ga0068865_100059102 | Ga0068865_1000591022 | 294 |
| 308 | 3300006944 | Ga0099823_1020572 | Ga0099823_10205723 | 294 |
| 309 | 3300006946 | Ga0079104_1000688 | Ga0079104_10006885 | 294 |
| 310 | 3300007076 | Ga0075435_100479101 | Ga0075435_1004791012 | 294 |
| 311 | 3300009093 | Ga0105240_10392070 | Ga0105240_103920702 | 294 |
| 312 | 3300009098 | Ga0105245_10029559 | Ga0105245_100295593 | 294 |
| 313 | 3300009098 | Ga0105245_10035827 | Ga0105245_100358274 | 294 |
| 314 | 3300009098 | Ga0105245_10175292 | Ga0105245_101752922 | 294 |
| 315 | 3300009098 | Ga0105245_10439222 | Ga0105245_104392222 | 294 |
| 316 | 3300009147 | Ga0114129_10689616 | Ga0114129_106896162 | 294 |
| 317 | 3300009148 | Ga0105243_10008061 | Ga0105243_100080614 | 294 |
| 318 | 3300009148 | Ga0105243_10008164 | Ga0105243_100081644 | 294 |
| 319 | 3300009148 | Ga0105243_10276144 | Ga0105243_102761442 | 294 |
| 320 | 3300009545 | Ga0105237_10060506 | Ga0105237_100605061 | 294 |
| 321 | 3300009545 | Ga0105237_10060893 | Ga0105237_100608934 | 294 |
| 322 | 3300009545 | Ga0105237_10161907 | Ga0105237_101619072 | 294 |
| 323 | 3300009551 | Ga0105238_10019682 | Ga0105238_100196824 | 294 |
| 324 | 3300009553 | Ga0105249_10140797 | Ga0105249_101407972 | 294 |
| 325 | 3300009553 | Ga0105249_10245605 | Ga0105249_102456052 | 294 |
| 326 | 3300009553 | Ga0105249_10267592 | Ga0105249_102675922 | 294 |
| 327 | 3300010375 | Ga0105239_10096543 | Ga0105239_100965432 | 294 |
| 328 | 3300012497 | Ga0157319_1000001 | Ga0157319_1000001121 | 294 |
| 329 | 3300013102 | Ga0157371_10079787 | Ga0157371_100797872 | 294 |
| 330 | 3300013105 | Ga0157369_10005235 | Ga0157369_100052352 | 294 |
| 331 | 3300013105 | Ga0157369_10441041 | Ga0157369_104410412 | 294 |
| 332 | 3300013296 | Ga0157374_10069109 | Ga0157374_100691092 | 294 |
| 333 | 3300013296 | Ga0157374_10106448 | Ga0157374_101064482 | 294 |
| 334 | 3300013296 | Ga0157374_10128359 | Ga0157374_101283592 | 294 |
| 335 | 3300013297 | Ga0157378_10020688 | Ga0157378_100206883 | 294 |
| 336 | 3300013297 | Ga0157378_10153560 | Ga0157378_101535602 | 294 |
| 337 | 3300013306 | Ga0163162_10003214 | Ga0163162_100032147 | 294 |
| 338 | 3300013306 | Ga0163162_10051816 | Ga0163162_100518162 | 294 |
| 339 | 3300013306 | Ga0163162_10073008 | Ga0163162_100730082 | 294 |
| 340 | 3300013306 | Ga0163162_10273416 | Ga0163162_102734162 | 294 |
| 341 | 3300013307 | Ga0157372_10014610 | Ga0157372_100146103 | 294 |
| 342 | 3300013307 | Ga0157372_10078250 | Ga0157372_100782504 | 294 |
| 343 | 3300013308 | Ga0157375_10037016 | Ga0157375_100370163 | 294 |
| 344 | 3300013308 | Ga0157375_10083876 | Ga0157375_100838763 | 294 |
| 345 | 3300013308 | Ga0157375_10149165 | Ga0157375_101491652 | 294 |
| 346 | 3300013308 | Ga0157375_10321526 | Ga0157375_103215262 | 294 |
| 347 | 3300014325 | Ga0163163_10063939 | Ga0163163_100639392 | 294 |
| 348 | 3300014325 | Ga0163163_10226094 | Ga0163163_102260942 | 294 |
| 349 | 3300014325 | Ga0163163_10259222 | Ga0163163_102592221 | 294 |
| 350 | 3300014326 | Ga0157380_10009160 | Ga0157380_100091603 | 294 |
| 351 | 3300014326 | Ga0157380_10015002 | Ga0157380_100150024 | 294 |
| 352 | 3300014745 | Ga0157377_10000052 | Ga0157377_100000527 | 294 |
| 353 | 3300014745 | Ga0157377_10001746 | Ga0157377_100017464 | 294 |
| 354 | 3300014968 | Ga0157379_10011097 | Ga0157379_100110974 | 294 |
| 355 | 3300014968 | Ga0157379_10015903 | Ga0157379_100159034 | 294 |
| 356 | 3300014968 | Ga0157379_10050583 | Ga0157379_100505833 | 294 |
| 357 | 3300014968 | Ga0157379_10179771 | Ga0157379_101797712 | 294 |
| 358 | 3300014969 | Ga0157376_10129080 | Ga0157376_101290802 | 294 |
| 359 | 3300017792 | Ga0163161_10014307 | Ga0163161_100143073 | 294 |
| 360 | 3300017792 | Ga0163161_10138152 | Ga0163161_101381522 | 294 |
| 361 | 3300025258 | Ga0209129_1015421 | Ga0209129_10154211 | 294 |
| 362 | 3300025273 | Ga0209673_1005911 | Ga0209673_10059112 | 294 |
| 363 | 3300025273 | Ga0209673_1009588 | Ga0209673_10095883 | 294 |
| 364 | 3300025297 | Ga0209758_1000099 | Ga0209758_1000099138 | 294 |
| 365 | 3300025298 | Ga0209050_1000165 | Ga0209050_100016571 | 294 |
| 366 | 3300025298 | Ga0209050_1003454 | Ga0209050_10034548 | 294 |
| 367 | 3300025298 | Ga0209050_1005104 | Ga0209050_10051047 | 294 |
| 368 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011780 | 294 |
| 369 | 3300025299 | Ga0209256_1000213 | Ga0209256_100021321 | 294 |
| 370 | 3300025303 | Ga0209051_1000024 | Ga0209051_100002499 | 294 |
| 371 | 3300025303 | Ga0209051_1003799 | Ga0209051_10037993 | 294 |
| 372 | 3300025303 | Ga0209051_1017492 | Ga0209051_10174923 | 294 |
| 373 | 3300025304 | Ga0209257_1000079 | Ga0209257_100007999 | 294 |
| 374 | 3300025304 | Ga0209257_1004314 | Ga0209257_10043146 | 294 |
| 375 | 3300025304 | Ga0209257_1005076 | Ga0209257_10050765 | 294 |
| 376 | 3300025315 | Ga0207697_10035759 | Ga0207697_100357592 | 294 |
| 377 | 3300025315 | Ga0207697_10146054 | Ga0207697_101460541 | 294 |
| 378 | 3300025321 | Ga0207656_10035874 | Ga0207656_100358742 | 294 |
| 379 | 3300025893 | Ga0207682_10007137 | Ga0207682_100071373 | 294 |
| 380 | 3300025893 | Ga0207682_10027910 | Ga0207682_100279102 | 294 |
| 381 | 3300025899 | Ga0207642_10038964 | Ga0207642_100389642 | 294 |
| 382 | 3300025900 | Ga0207710_10104713 | Ga0207710_101047132 | 294 |
| 383 | 3300025901 | Ga0207688_10038739 | Ga0207688_100387392 | 294 |
| 384 | 3300025901 | Ga0207688_10149739 | Ga0207688_101497392 | 294 |
| 385 | 3300025903 | Ga0207680_10029456 | Ga0207680_100294562 | 294 |
| 386 | 3300025903 | Ga0207680_10051294 | Ga0207680_100512942 | 294 |
| 387 | 3300025904 | Ga0207647_10080814 | Ga0207647_100808142 | 294 |
| 388 | 3300025907 | Ga0207645_10004234 | Ga0207645_100042343 | 294 |
| 389 | 3300025907 | Ga0207645_10012569 | Ga0207645_100125692 | 294 |
| 390 | 3300025907 | Ga0207645_10029621 | Ga0207645_100296213 | 294 |
| 391 | 3300025907 | Ga0207645_10102360 | Ga0207645_101023602 | 294 |
| 392 | 3300025909 | Ga0207705_10290717 | Ga0207705_102907172 | 294 |
| 393 | 3300025912 | Ga0207707_10174785 | Ga0207707_101747852 | 294 |
| 394 | 3300025913 | Ga0207695_10274765 | Ga0207695_102747653 | 294 |
| 395 | 3300025914 | Ga0207671_10357467 | Ga0207671_103574672 | 294 |
| 396 | 3300025917 | Ga0207660_10020015 | Ga0207660_100200153 | 294 |
| 397 | 3300025919 | Ga0207657_10014336 | Ga0207657_100143363 | 294 |
| 398 | 3300025919 | Ga0207657_10144514 | Ga0207657_101445142 | 294 |
| 399 | 3300025920 | Ga0207649_10008710 | Ga0207649_100087102 | 294 |
| 400 | 3300025923 | Ga0207681_10016288 | Ga0207681_100162882 | 294 |
| 401 | 3300025923 | Ga0207681_10047471 | Ga0207681_100474712 | 294 |
| 402 | 3300025923 | Ga0207681_10321680 | Ga0207681_103216802 | 294 |
| 403 | 3300025923 | Ga0207681_10419031 | Ga0207681_104190312 | 294 |
| 404 | 3300025924 | Ga0207694_10143980 | Ga0207694_101439802 | 294 |
| 405 | 3300025925 | Ga0207650_10000348 | Ga0207650_100003488 | 294 |
| 406 | 3300025925 | Ga0207650_10008918 | Ga0207650_100089184 | 294 |
| 407 | 3300025925 | Ga0207650_10061253 | Ga0207650_100612532 | 294 |
| 408 | 3300025925 | Ga0207650_10122449 | Ga0207650_101224492 | 294 |
| 409 | 3300025925 | Ga0207650_10194507 | Ga0207650_101945072 | 294 |
| 410 | 3300025925 | Ga0207650_10198936 | Ga0207650_101989362 | 294 |
| 411 | 3300025925 | Ga0207650_10245846 | Ga0207650_102458462 | 294 |
| 412 | 3300025925 | Ga0207650_10360059 | Ga0207650_103600592 | 294 |
| 413 | 3300025926 | Ga0207659_10000583 | Ga0207659_100005835 | 294 |
| 414 | 3300025926 | Ga0207659_10002553 | Ga0207659_100025533 | 294 |
| 415 | 3300025926 | Ga0207659_10014174 | Ga0207659_100141742 | 294 |
| 416 | 3300025927 | Ga0207687_10169937 | Ga0207687_101699371 | 294 |
| 417 | 3300025927 | Ga0207687_10340736 | Ga0207687_103407362 | 294 |
| 418 | 3300025931 | Ga0207644_10000492 | Ga0207644_1000049215 | 294 |
| 419 | 3300025931 | Ga0207644_10010547 | Ga0207644_100105474 | 294 |
| 420 | 3300025931 | Ga0207644_10023599 | Ga0207644_100235994 | 294 |
| 421 | 3300025931 | Ga0207644_10034408 | Ga0207644_100344082 | 294 |
| 422 | 3300025931 | Ga0207644_10058968 | Ga0207644_100589682 | 294 |
| 423 | 3300025931 | Ga0207644_10105696 | Ga0207644_101056962 | 294 |
| 424 | 3300025931 | Ga0207644_10199678 | Ga0207644_101996781 | 294 |
| 425 | 3300025931 | Ga0207644_10249044 | Ga0207644_102490442 | 294 |
| 426 | 3300025932 | Ga0207690_10020627 | Ga0207690_100206272 | 294 |
| 427 | 3300025932 | Ga0207690_10044370 | Ga0207690_100443703 | 294 |
| 428 | 3300025932 | Ga0207690_10125427 | Ga0207690_101254272 | 294 |
| 429 | 3300025933 | Ga0207706_10015888 | Ga0207706_100158883 | 294 |
| 430 | 3300025933 | Ga0207706_10022266 | Ga0207706_100222663 | 294 |
| 431 | 3300025933 | Ga0207706_10025041 | Ga0207706_100250412 | 294 |
| 432 | 3300025933 | Ga0207706_10133552 | Ga0207706_101335522 | 294 |
| 433 | 3300025934 | Ga0207686_10043061 | Ga0207686_100430612 | 294 |
| 434 | 3300025934 | Ga0207686_10184100 | Ga0207686_101841002 | 294 |
| 435 | 3300025935 | Ga0207709_10004530 | Ga0207709_100045303 | 294 |
| 436 | 3300025935 | Ga0207709_10080541 | Ga0207709_100805412 | 294 |
| 437 | 3300025935 | Ga0207709_10095073 | Ga0207709_100950732 | 294 |
| 438 | 3300025936 | Ga0207670_10009907 | Ga0207670_100099074 | 294 |
| 439 | 3300025936 | Ga0207670_10075551 | Ga0207670_100755512 | 294 |
| 440 | 3300025937 | Ga0207669_10003686 | Ga0207669_100036863 | 294 |
| 441 | 3300025937 | Ga0207669_10006877 | Ga0207669_100068773 | 294 |
| 442 | 3300025937 | Ga0207669_10018316 | Ga0207669_100183162 | 294 |
| 443 | 3300025937 | Ga0207669_10103966 | Ga0207669_101039662 | 294 |
| 444 | 3300025938 | Ga0207704_10009288 | Ga0207704_100092882 | 294 |
| 445 | 3300025938 | Ga0207704_10039296 | Ga0207704_100392963 | 294 |
| 446 | 3300025938 | Ga0207704_10042130 | Ga0207704_100421302 | 294 |
| 447 | 3300025940 | Ga0207691_10007412 | Ga0207691_100074123 | 294 |
| 448 | 3300025940 | Ga0207691_10020182 | Ga0207691_100201822 | 294 |
| 449 | 3300025940 | Ga0207691_10025082 | Ga0207691_100250822 | 294 |
| 450 | 3300025940 | Ga0207691_10036069 | Ga0207691_100360693 | 294 |
| 451 | 3300025940 | Ga0207691_10165140 | Ga0207691_101651402 | 294 |
| 452 | 3300025940 | Ga0207691_10220038 | Ga0207691_102200382 | 294 |
| 453 | 3300025942 | Ga0207689_10010704 | Ga0207689_100107043 | 294 |
| 454 | 3300025944 | Ga0207661_10011795 | Ga0207661_100117952 | 294 |
| 455 | 3300025945 | Ga0207679_10000351 | Ga0207679_1000035128 | 294 |
| 456 | 3300025945 | Ga0207679_10022902 | Ga0207679_100229022 | 294 |
| 457 | 3300025945 | Ga0207679_10071459 | Ga0207679_100714591 | 294 |
| 458 | 3300025945 | Ga0207679_10100490 | Ga0207679_101004902 | 294 |
| 459 | 3300025945 | Ga0207679_10125660 | Ga0207679_101256602 | 294 |
| 460 | 3300025945 | Ga0207679_10151534 | Ga0207679_101515342 | 294 |
| 461 | 3300025960 | Ga0207651_10008816 | Ga0207651_100088164 | 294 |
| 462 | 3300025960 | Ga0207651_10010527 | Ga0207651_100105271 | 294 |
| 463 | 3300025961 | Ga0207712_10059781 | Ga0207712_100597812 | 294 |
| 464 | 3300025961 | Ga0207712_10130523 | Ga0207712_101305232 | 294 |
| 465 | 3300025972 | Ga0207668_10033023 | Ga0207668_100330232 | 294 |
| 466 | 3300025972 | Ga0207668_10040810 | Ga0207668_100408102 | 294 |
| 467 | 3300025972 | Ga0207668_10197810 | Ga0207668_101978102 | 294 |
| 468 | 3300025972 | Ga0207668_10614715 | Ga0207668_106147151 | 294 |
| 469 | 3300025981 | Ga0207640_10258091 | Ga0207640_102580912 | 294 |
| 470 | 3300025986 | Ga0207658_10008172 | Ga0207658_100081722 | 294 |
| 471 | 3300025986 | Ga0207658_10016467 | Ga0207658_100164672 | 294 |
| 472 | 3300025986 | Ga0207658_10086291 | Ga0207658_100862912 | 294 |
| 473 | 3300025986 | Ga0207658_10126476 | Ga0207658_101264762 | 294 |
| 474 | 3300026023 | Ga0207677_10006793 | Ga0207677_100067933 | 294 |
| 475 | 3300026023 | Ga0207677_10008408 | Ga0207677_100084082 | 294 |
| 476 | 3300026023 | Ga0207677_10011753 | Ga0207677_100117532 | 294 |
| 477 | 3300026023 | Ga0207677_10039580 | Ga0207677_100395803 | 294 |
| 478 | 3300026023 | Ga0207677_10067627 | Ga0207677_100676272 | 294 |
| 479 | 3300026023 | Ga0207677_10071978 | Ga0207677_100719781 | 294 |
| 480 | 3300026035 | Ga0207703_10006182 | Ga0207703_100061823 | 294 |
| 481 | 3300026035 | Ga0207703_10042180 | Ga0207703_100421803 | 294 |
| 482 | 3300026035 | Ga0207703_10043436 | Ga0207703_100434363 | 294 |
| 483 | 3300026035 | Ga0207703_10172459 | Ga0207703_101724592 | 294 |
| 484 | 3300026041 | Ga0207639_10138046 | Ga0207639_101380462 | 294 |
| 485 | 3300026067 | Ga0207678_10019654 | Ga0207678_100196541 | 294 |
| 486 | 3300026067 | Ga0207678_10051289 | Ga0207678_100512894 | 294 |
| 487 | 3300026067 | Ga0207678_10132803 | Ga0207678_101328032 | 294 |
| 488 | 3300026067 | Ga0207678_10448492 | Ga0207678_104484922 | 294 |
| 489 | 3300026067 | Ga0207678_10494600 | Ga0207678_104946001 | 294 |
| 490 | 3300026075 | Ga0207708_10013481 | Ga0207708_100134813 | 294 |
| 491 | 3300026078 | Ga0207702_10080509 | Ga0207702_100805093 | 294 |
| 492 | 3300026078 | Ga0207702_10122704 | Ga0207702_101227042 | 294 |
| 493 | 3300026078 | Ga0207702_10289979 | Ga0207702_102899792 | 294 |
| 494 | 3300026078 | Ga0207702_10387151 | Ga0207702_103871512 | 294 |
| 495 | 3300026088 | Ga0207641_10015872 | Ga0207641_100158724 | 294 |
| 496 | 3300026088 | Ga0207641_10153653 | Ga0207641_101536532 | 294 |
| 497 | 3300026089 | Ga0207648_10006696 | Ga0207648_100066967 | 294 |
| 498 | 3300026089 | Ga0207648_10006922 | Ga0207648_100069223 | 294 |
| 499 | 3300026089 | Ga0207648_10006965 | Ga0207648_100069653 | 294 |
| 500 | 3300026089 | Ga0207648_10013294 | Ga0207648_100132943 | 294 |
| 501 | 3300026089 | Ga0207648_10085172 | Ga0207648_100851722 | 294 |
| 502 | 3300026089 | Ga0207648_10094768 | Ga0207648_100947682 | 294 |
| 503 | 3300026089 | Ga0207648_10104408 | Ga0207648_101044082 | 294 |
| 504 | 3300026089 | Ga0207648_10149415 | Ga0207648_101494152 | 294 |
| 505 | 3300026089 | Ga0207648_10344551 | Ga0207648_103445512 | 294 |
| 506 | 3300026095 | Ga0207676_10001822 | Ga0207676_1000182213 | 294 |
| 507 | 3300026095 | Ga0207676_10011015 | Ga0207676_100110152 | 294 |
| 508 | 3300026095 | Ga0207676_10019239 | Ga0207676_100192394 | 294 |
| 509 | 3300026095 | Ga0207676_10489259 | Ga0207676_104892592 | 294 |
| 510 | 3300026116 | Ga0207674_10038138 | Ga0207674_100381382 | 294 |
| 511 | 3300026118 | Ga0207675_100004540 | Ga0207675_1000045406 | 294 |
| 512 | 3300026118 | Ga0207675_100004707 | Ga0207675_10000470710 | 294 |
| 513 | 3300026118 | Ga0207675_100014213 | Ga0207675_1000142133 | 294 |
| 514 | 3300026118 | Ga0207675_100101496 | Ga0207675_1001014962 | 294 |
| 515 | 3300026121 | Ga0207683_10020842 | Ga0207683_100208423 | 294 |
| 516 | 3300026121 | Ga0207683_10034755 | Ga0207683_100347552 | 294 |
| 517 | 3300026121 | Ga0207683_10056782 | Ga0207683_100567823 | 294 |
| 518 | 3300026121 | Ga0207683_10143025 | Ga0207683_101430252 | 294 |
| 519 | 3300026121 | Ga0207683_10212812 | Ga0207683_102128122 | 294 |
| 520 | 3300026142 | Ga0207698_10030706 | Ga0207698_100307062 | 294 |
| 521 | 3300026142 | Ga0207698_10063072 | Ga0207698_100630722 | 294 |
| 522 | 3300026142 | Ga0207698_10081370 | Ga0207698_100813702 | 294 |
| 523 | 3300026142 | Ga0207698_10082403 | Ga0207698_100824032 | 294 |
| 524 | 3300026142 | Ga0207698_10113956 | Ga0207698_101139562 | 294 |
| 525 | 3300026142 | Ga0207698_10164030 | Ga0207698_101640302 | 294 |
| 526 | 3300026142 | Ga0207698_10256973 | Ga0207698_102569732 | 294 |
| 527 | 3300026142 | Ga0207698_10426131 | Ga0207698_104261312 | 294 |
| 528 | 3300027111 | Ga0209281_1000042 | Ga0209281_10000425 | 294 |
| 529 | 3300027360 | Ga0209969_1004201 | Ga0209969_10042012 | 294 |
| 530 | 3300027526 | Ga0209968_1000176 | Ga0209968_10001763 | 294 |
| 531 | 3300027695 | Ga0209966_1000006 | Ga0209966_100000661 | 294 |
| 532 | 3300027717 | Ga0209998_10009287 | Ga0209998_100092872 | 294 |
| 533 | 3300027876 | Ga0209974_10016459 | Ga0209974_100164592 | 294 |
| 534 | 3300028379 | Ga0268266_10300460 | Ga0268266_103004602 | 294 |
| 535 | 3300028380 | Ga0268265_10008394 | Ga0268265_100083943 | 294 |
| 536 | 3300028380 | Ga0268265_10031149 | Ga0268265_100311493 | 294 |
| 537 | 3300028380 | Ga0268265_10167719 | Ga0268265_101677191 | 294 |
| 538 | 3300028380 | Ga0268265_10553428 | Ga0268265_105534281 | 294 |
| 539 | 3300028381 | Ga0268264_10005037 | Ga0268264_100050373 | 294 |
| 540 | 3300028381 | Ga0268264_10072163 | Ga0268264_100721633 | 294 |
| 541 | 3300028381 | Ga0268264_10208985 | Ga0268264_102089852 | 294 |
| 542 | 3300028381 | Ga0268264_10272318 | Ga0268264_102723182 | 294 |
| 543 | 3300028381 | Ga0268264_10320382 | Ga0268264_103203821 | 294 |
| 544 | 3300028786 | Ga0307517_10004982 | Ga0307517_100049824 | 294 |
| 545 | 3300028786 | Ga0307517_10087446 | Ga0307517_100874462 | 294 |
| 546 | 3300028786 | Ga0307517_10152281 | Ga0307517_101522812 | 294 |
| 547 | 3300028786 | Ga0307517_10185718 | Ga0307517_101857182 | 294 |
| 548 | 3300028794 | Ga0307515_10000020 | Ga0307515_1000002070 | 294 |
| 549 | 3300028794 | Ga0307515_10000525 | Ga0307515_100005257 | 294 |
| 550 | 3300028794 | Ga0307515_10001622 | Ga0307515_1000162221 | 294 |
| 551 | 3300028794 | Ga0307515_10015131 | Ga0307515_100151318 | 294 |
| 552 | 3300028794 | Ga0307515_10015416 | Ga0307515_1001541612 | 294 |
| 553 | 3300028794 | Ga0307515_10164487 | Ga0307515_101644872 | 294 |
| 554 | 3300030522 | Ga0307512_10063200 | Ga0307512_100632002 | 294 |
| 555 | 3300031456 | Ga0307513_10039012 | Ga0307513_100390123 | 294 |
| 556 | 3300031456 | Ga0307513_10040644 | Ga0307513_100406442 | 294 |
| 557 | 3300031456 | Ga0307513_10044803 | Ga0307513_100448034 | 294 |
| 558 | 3300031456 | Ga0307513_10229244 | Ga0307513_102292442 | 294 |
| 559 | 3300031456 | Ga0307513_10280163 | Ga0307513_102801631 | 294 |
| 560 | 3300031507 | Ga0307509_10005169 | Ga0307509_100051693 | 294 |
| 561 | 3300031507 | Ga0307509_10023117 | Ga0307509_100231172 | 294 |
| 562 | 3300031507 | Ga0307509_10039152 | Ga0307509_100391524 | 294 |
| 563 | 3300031507 | Ga0307509_10052887 | Ga0307509_100528871 | 294 |
| 564 | 3300031507 | Ga0307509_10150861 | Ga0307509_101508612 | 294 |
| 565 | 3300031507 | Ga0307509_10206828 | Ga0307509_102068282 | 294 |
| 566 | 3300031507 | Ga0307509_10301794 | Ga0307509_103017942 | 294 |
| 567 | 3300031548 | Ga0307408_100023553 | Ga0307408_1000235532 | 294 |
| 568 | 3300031548 | Ga0307408_100096268 | Ga0307408_1000962682 | 294 |
| 569 | 3300031548 | Ga0307408_100430525 | Ga0307408_1004305252 | 294 |
| 570 | 3300031616 | Ga0307508_10000007 | Ga0307508_10000007148 | 294 |
| 571 | 3300031616 | Ga0307508_10000738 | Ga0307508_100007383 | 294 |
| 572 | 3300031616 | Ga0307508_10042723 | Ga0307508_100427231 | 294 |
| 573 | 3300031616 | Ga0307508_10134438 | Ga0307508_101344382 | 294 |
| 574 | 3300031649 | Ga0307514_10014340 | Ga0307514_100143403 | 294 |
| 575 | 3300031730 | Ga0307516_10003350 | Ga0307516_1000335015 | 294 |
| 576 | 3300031730 | Ga0307516_10012873 | Ga0307516_100128734 | 294 |
| 577 | 3300031730 | Ga0307516_10055228 | Ga0307516_100552282 | 294 |
| 578 | 3300031731 | Ga0307405_10037541 | Ga0307405_100375413 | 294 |
| 579 | 3300031824 | Ga0307413_10004001 | Ga0307413_100040014 | 294 |
| 580 | 3300031852 | Ga0307410_10013145 | Ga0307410_100131452 | 294 |
| 581 | 3300031901 | Ga0307406_10007866 | Ga0307406_100078664 | 294 |
| 582 | 3300031901 | Ga0307406_10070873 | Ga0307406_100708732 | 294 |
| 583 | 3300031903 | Ga0307407_10038907 | Ga0307407_100389073 | 294 |
| 584 | 3300031903 | Ga0307407_10097516 | Ga0307407_100975162 | 294 |
| 585 | 3300031911 | Ga0307412_10007008 | Ga0307412_100070082 | 294 |
| 586 | 3300031911 | Ga0307412_10499754 | Ga0307412_104997541 | 294 |
| 587 | 3300031995 | Ga0307409_100000998 | Ga0307409_1000009982 | 294 |
| 588 | 3300031995 | Ga0307409_100024853 | Ga0307409_1000248533 | 294 |
| 589 | 3300031995 | Ga0307409_100232311 | Ga0307409_1002323112 | 294 |
| 590 | 3300032002 | Ga0307416_100010514 | Ga0307416_1000105142 | 294 |
| 591 | 3300032002 | Ga0307416_100114686 | Ga0307416_1001146862 | 294 |
| 592 | 3300032004 | Ga0307414_10050194 | Ga0307414_100501942 | 294 |
| 593 | 3300032004 | Ga0307414_10208028 | Ga0307414_102080282 | 294 |
| 594 | 3300032005 | Ga0307411_10019052 | Ga0307411_100190522 | 294 |
| 595 | 3300032005 | Ga0307411_10285897 | Ga0307411_102858972 | 294 |
| 596 | 3300032126 | Ga0307415_100031801 | Ga0307415_1000318013 | 294 |
| 597 | 3300032126 | Ga0307415_100051892 | Ga0307415_1000518922 | 294 |
| 598 | 3300033179 | Ga0307507_10032760 | Ga0307507_100327604 | 294 |
| 599 | 3300033179 | Ga0307507_10119882 | Ga0307507_101198822 | 294 |
| 600 | 3300033180 | Ga0307510_10027873 | Ga0307510_100278734 | 294 |
| 601 | 3300033180 | Ga0307510_10036903 | Ga0307510_100369032 | 294 |
| 602 | 3300033180 | Ga0307510_10075055 | Ga0307510_100750552 | 294 |
| 603 | 3300033180 | Ga0307510_10213471 | Ga0307510_102134712 | 294 |
| 604 | 3300035113 | Ga0373936_0113328 | Ga0373936_0113328_18_902 | 294 |
| 605 | 3300035116 | Ga0373945_0044197 | Ga0373945_0044197_347_1231 | 294 |
| 606 | 3300035118 | Ga0373954_0056738 | Ga0373954_0056738_817_1701 | 294 |
| 607 | 3300035170 | Ga0373943_0172921 | Ga0373943_0172921_206_1090 | 294 |
| 608 | 3300035171 | Ga0373946_0055697 | Ga0373946_0055697_333_1217 | 294 |
| 609 | 3300035172 | Ga0373955_0033098 | Ga0373955_0033098_546_1430 | 294 |
| 610 | 3300035691 | Ga0373931_0003802 | Ga0373931_0003802_4528_5412 | 294 |
| 611 | 3300035691 | Ga0373931_0014685 | Ga0373931_0014685_594_1478 | 294 |
| 612 | 3300036401 | Ga0373937_0027070 | Ga0373937_0027070_739_1623 | 294 |
| 613 | 3300036401 | Ga0373937_0068865 | Ga0373937_0068865_1373_2257 | 294 |
| 614 | 3300037068 | Ga0373925_0182142 | Ga0373925_0182142_433_1317 | 294 |
| 615 | 3300037418 | Ga0395900_0000378 | Ga0395900_0000378_50764_51648 | 294 |
| 616 | 3300037466 | Ga0395898_0001418 | Ga0395898_0001418_27226_28110 | 294 |
| 617 | 3300037471 | Ga0395905_0010601 | Ga0395905_0010601_861_1745 | 294 |
| 618 | 3300037471 | Ga0395905_0046174 | Ga0395905_0046174_2210_3094 | 294 |
| 619 | 3300037471 | Ga0395905_0071504 | Ga0395905_0071504_1442_2332 | 294 |
| 620 | 3300041456 | Ga0451795_1472563 | Ga0451795_1472563_525_1409 | 294 |
| 621 | 3300041459 | Ga0451800_1509975 | Ga0451800_1509975_234_1118 | 294 |
| 622 | 3300041460 | Ga0451802_0268620 | Ga0451802_0268620_50_934 | 294 |
| 623 | 3300041486 | Ga0451807_0320661 | Ga0451807_0320661_236_1120 | 294 |
| 624 | 3300042000 | Ga0439437_004926 | Ga0439437_004926_86_970 | 294 |
| 625 | 3300042007 | Ga0439449_0018927 | Ga0439449_0018927_956_1840 | 294 |
| 626 | 3300042008 | Ga0439450_006794 | Ga0439450_006794_381_1265 | 294 |
| 627 | 3300042011 | Ga0439454_014139 | Ga0439454_014139_182_1072 | 294 |
| 628 | 3300042127 | Ga0450890_001531 | Ga0450890_001531_1152_2042 | 294 |
| 629 | 3300042135 | Ga0450899_001706 | Ga0450899_001706_664_1548 | 294 |
| 630 | 3300042156 | Ga0439446_0012141 | Ga0439446_0012141_182_1075 | 294 |
| 631 | 3300042438 | Ga0439459_0001206 | Ga0439459_0001206_1630_2520 | 294 |
| 632 | 3300042531 | Ga0450918_000032 | Ga0450918_000032_24724_25608 | 294 |
| 633 | 3300042876 | Ga0451577_0016490 | Ga0451577_0016490_3506_4399 | 294 |
| 634 | 3300044656 | Ga0466969_0031112 | Ga0466969_0031112_1166_2050 | 294 |
| 635 | 3300044658 | Ga0466972_0004708 | Ga0466972_0004708_2999_3883 | 294 |
| 636 | 3300044658 | Ga0466972_0092783 | Ga0466972_0092783_157_1044 | 294 |
| 637 | 3300044683 | Ga0466965_0079289 | Ga0466965_0079289_607_1494 | 294 |
| 638 | 3300044683 | Ga0466965_0163086 | Ga0466965_0163086_259_1143 | 294 |
| 639 | 3300044684 | Ga0466966_0020813 | Ga0466966_0020813_2004_2888 | 294 |
| 640 | 3300044693 | Ga0466961_0010868 | Ga0466961_0010868_743_1627 | 294 |
| 641 | 3300044694 | Ga0466963_0087157 | Ga0466963_0087157_211_1095 | 294 |
| 642 | 3300044694 | Ga0466963_0191646 | Ga0466963_0191646_372_1259 | 294 |
| 643 | 3300044706 | Ga0466964_0013194 | Ga0466964_0013194_1207_2091 | 294 |
| 644 | 3300044712 | Ga0453684_0052450 | Ga0453684_0052450_1920_2804 | 294 |
| 645 | 3300044712 | Ga0453684_0270026 | Ga0453684_0270026_556_1443 | 294 |
| 646 | 3300044765 | Ga0466970_0054937 | Ga0466970_0054937_620_1504 | 294 |
| 647 | 3300044765 | Ga0466970_0063142 | Ga0466970_0063142_451_1335 | 294 |
| 648 | 3300044842 | Ga0466957_0176607 | Ga0466957_0176607_430_1314 | 294 |
| 649 | 3300044842 | Ga0466957_0198590 | Ga0466957_0198590_36_920 | 294 |
| 650 | 3300044901 | Ga0466960_0054584 | Ga0466960_0054584_315_1202 | 294 |
| 651 | 3300045049 | Ga0466959_0016680 | Ga0466959_0016680_2981_3865 | 294 |
| 652 | 3300045051 | Ga0451576_0031221 | Ga0451576_0031221_1942_2829 | 294 |
| 653 | 3300045051 | Ga0451576_0273449 | Ga0451576_0273449_783_1667 | 294 |
| 654 | 3300045976 | Ga0466967_0073560 | Ga0466967_0073560_538_1422 | 294 |
| 655 | 3300046454 | Ga0495592_0015031 | Ga0495592_0015031_2804_3688 | 294 |
| 656 | 3300046459 | Ga0495629_0132975 | Ga0495629_0132975_621_1505 | 294 |
| 657 | 3300046460 | Ga0495638_0059719 | Ga0495638_0059719_624_1508 | 294 |
| 658 | 3300046472 | Ga0495580_0038552 | Ga0495580_0038552_2299_3183 | 294 |
| 659 | 3300046474 | Ga0495605_0068331 | Ga0495605_0068331_410_1294 | 294 |
| 660 | 3300046512 | Ga0495610_0058151 | Ga0495610_0058151_580_1464 | 294 |
| 661 | 3300046515 | Ga0495620_0030046 | Ga0495620_0030046_1332_2216 | 294 |
| 662 | 3300046518 | Ga0495631_0086079 | Ga0495631_0086079_271_1155 | 294 |
| 663 | 3300046519 | Ga0495632_0010505 | Ga0495632_0010505_742_1626 | 294 |
| 664 | 3300046519 | Ga0495632_0012778 | Ga0495632_0012778_502_1386 | 294 |
| 665 | 3300046519 | Ga0495632_0018008 | Ga0495632_0018008_2758_3642 | 294 |
| 666 | 3300046519 | Ga0495632_0042105 | Ga0495632_0042105_1266_2150 | 294 |
| 667 | 3300046522 | Ga0495643_0015622 | Ga0495643_0015622_3047_3931 | 294 |
| 668 | 3300046524 | Ga0495648_0065053 | Ga0495648_0065053_443_1327 | 294 |
| 669 | 3300046524 | Ga0495648_0192729 | Ga0495648_0192729_15_899 | 294 |
| 670 | 3300046528 | Ga0495642_0063505 | Ga0495642_0063505_318_1202 | 294 |
| 671 | 3300046535 | Ga0495586_0191238 | Ga0495586_0191238_201_1085 | 294 |
| 672 | 3300046537 | Ga0495598_0035924 | Ga0495598_0035924_278_1162 | 294 |
| 673 | 3300046539 | Ga0495621_0004199 | Ga0495621_0004199_284_1168 | 294 |
| 674 | 3300046542 | Ga0495597_0108654 | Ga0495597_0108654_126_1010 | 294 |
| 675 | 3300046543 | Ga0495645_0056885 | Ga0495645_0056885_1905_2789 | 294 |
| 676 | 3300046543 | Ga0495645_0131680 | Ga0495645_0131680_236_1120 | 294 |
| 677 | 3300046557 | Ga0495622_0018138 | Ga0495622_0018138_1882_2766 | 294 |
| 678 | 3300046559 | Ga0495667_0198994 | Ga0495667_0198994_245_1129 | 294 |
| 679 | 3300046648 | Ga0495611_0111293 | Ga0495611_0111293_229_1113 | 294 |
| 680 | 3300046660 | Ga0495625_0056756 | Ga0495625_0056756_429_1313 | 294 |
| 681 | 3300046663 | Ga0495635_0215317 | Ga0495635_0215317_399_1283 | 294 |
| 682 | 3300046681 | Ga0495647_0009330 | Ga0495647_0009330_935_1819 | 294 |
| 683 | 3300046683 | Ga0495658_0184818 | Ga0495658_0184818_210_1094 | 294 |
| 684 | 3300046690 | Ga0495624_0064038 | Ga0495624_0064038_935_1819 | 294 |
| 685 | 3300046691 | Ga0495670_0166774 | Ga0495670_0166774_226_1110 | 294 |
| 686 | 3300046694 | Ga0495649_0003169 | Ga0495649_0003169_3151_4035 | 294 |
| 687 | 3300046809 | Ga0495600_0219065 | Ga0495600_0219065_68_952 | 294 |
| 688 | 3300046810 | Ga0495660_0026700 | Ga0495660_0026700_372_1256 | 294 |
| 689 | 3300047443 | Ga0495687_008688 | Ga0495687_008688_2367_3251 | 294 |
| 690 | 3300047471 | Ga0495684_0099654 | Ga0495684_0099654_747_1631 | 294 |
| 691 | 3300047472 | Ga0495686_0159652 | Ga0495686_0159652_80_964 | 294 |
| 692 | 3300047673 | Ga0495593_0021198 | Ga0495593_0021198_624_1508 | 294 |
| 693 | 3300048905 | Ga0496102_0019412 | Ga0496102_0019412_2369_3256 | 294 |
| 694 | 3300048905 | Ga0496102_0019732 | Ga0496102_0019732_2719_3603 | 294 |
| 695 | 3300048907 | Ga0496104_0031558 | Ga0496104_0031558_3496_4380 | 294 |
| 696 | 3300048907 | Ga0496104_0063012 | Ga0496104_0063012_284_1168 | 294 |
| 697 | 3300048909 | Ga0496106_0036433 | Ga0496106_0036433_278_1162 | 294 |
| 698 | 3300048910 | Ga0496107_0020662 | Ga0496107_0020662_1286_2170 | 294 |
| 699 | 3300048911 | Ga0496108_0054149 | Ga0496108_0054149_374_1258 | 294 |
| 700 | 3300048911 | Ga0496108_0059750 | Ga0496108_0059750_58_942 | 294 |
| 701 | 3300048911 | Ga0496108_0396000 | Ga0496108_0396000_67_951 | 294 |
| 702 | 3300048912 | Ga0496109_0048691 | Ga0496109_0048691_802_1686 | 294 |
| 703 | 3300048912 | Ga0496109_0158807 | Ga0496109_0158807_448_1332 | 294 |
| 704 | 3300048913 | Ga0496110_0107019 | Ga0496110_0107019_1423_2307 | 294 |
| 705 | 3300048913 | Ga0496110_0221703 | Ga0496110_0221703_577_1461 | 294 |
| 706 | 3300048914 | Ga0496111_0066936 | Ga0496111_0066936_522_1406 | 294 |
| 707 | 3300048916 | Ga0496113_0064832 | Ga0496113_0064832_351_1235 | 294 |
| 708 | 3300048917 | Ga0496114_0020018 | Ga0496114_0020018_1519_2403 | 294 |
| 709 | 3300048917 | Ga0496114_0153338 | Ga0496114_0153338_435_1319 | 294 |
| 710 | 3300048918 | Ga0496115_0020021 | Ga0496115_0020021_1655_2539 | 294 |
| 711 | 3300048924 | Ga0496121_0016606 | Ga0496121_0016606_3982_4869 | 294 |
| 712 | 3300048927 | Ga0496124_0000161 | Ga0496124_0000161_104565_105452 | 294 |
| 713 | 3300048928 | Ga0496125_0017717 | Ga0496125_0017717_2765_3652 | 294 |
| 714 | 3300049515 | Ga0501292_001467 | Ga0501292_001467_685_1569 | 294 |
| 715 | 3300049575 | Ga0501039_0355635 | Ga0501039_0355635_156_1040 | 294 |
| 716 | 3300049579 | Ga0501043_0013188 | Ga0501043_0013188_3235_4122 | 294 |
| 717 | 3300049580 | Ga0501046_0000049 | Ga0501046_0000049_131897_132784 | 294 |
| 718 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_55089_55976 | 294 |
| 719 | 3300049582 | Ga0501048_0015557 | Ga0501048_0015557_2581_3468 | 294 |
| 720 | 3300049649 | Ga0501198_000166 | Ga0501198_000166_2906_3790 | 294 |
| 721 | 3300049662 | Ga0501222_000256 | Ga0501222_000256_4939_5823 | 294 |
| 722 | 3300049682 | Ga0501252_001271 | Ga0501252_001271_799_1683 | 294 |
| 723 | 3300049683 | Ga0501253_007103 | Ga0501253_007103_622_1506 | 294 |
| 724 | 3300049686 | Ga0501257_028200 | Ga0501257_028200_251_1135 | 294 |
| 725 | 3300049822 | Ga0501035_0332354 | Ga0501035_0332354_29_913 | 294 |
| 726 | 3300049823 | Ga0501044_0278747 | Ga0501044_0278747_252_1139 | 294 |
| 727 | 3300049824 | Ga0501045_0024117 | Ga0501045_0024117_494_1381 | 294 |
| 728 | 3300050489 | nmdc:mga03683_129445_c1 | nmdc:mga03683_129445_c1_149_1033 | 294 |
| 729 | 3300050489 | nmdc:mga03683_44576_c1 | nmdc:mga03683_44576_c1_645_1529 | 294 |
| 730 | 3300050490 | nmdc:mga03n38_74311_c1 | nmdc:mga03n38_74311_c1_667_1551 | 294 |
| 731 | 3300050493 | nmdc:mga0k408_102377_c1 | nmdc:mga0k408_102377_c1_317_1201 | 294 |
| 732 | 3300050493 | nmdc:mga0k408_10775_c2 | nmdc:mga0k408_10775_c2_39_923 | 294 |
| 733 | 3300050493 | nmdc:mga0k408_1102_c1 | nmdc:mga0k408_1102_c1_1074_1958 | 294 |
| 734 | 3300050493 | nmdc:mga0k408_14563_c1 | nmdc:mga0k408_14563_c1_642_1526 | 294 |
| 735 | 3300050493 | nmdc:mga0k408_220299_c1 | nmdc:mga0k408_220299_c1_77_961 | 294 |
| 736 | 3300050493 | nmdc:mga0k408_3182_c1 | nmdc:mga0k408_3182_c1_2907_3791 | 294 |
| 737 | 3300050493 | nmdc:mga0k408_3241_c1 | nmdc:mga0k408_3241_c1_7687_8571 | 294 |
| 738 | 3300050493 | nmdc:mga0k408_3706_c1 | nmdc:mga0k408_3706_c1_4827_5711 | 294 |
| 739 | 3300050493 | nmdc:mga0k408_4690_c1 | nmdc:mga0k408_4690_c1_3725_4609 | 294 |
| 740 | 3300050493 | nmdc:mga0k408_4692_c1 | nmdc:mga0k408_4692_c1_3580_4467 | 294 |
| 741 | 3300050493 | nmdc:mga0k408_55825_c1 | nmdc:mga0k408_55825_c1_168_1058 | 294 |
| 742 | 3300050493 | nmdc:mga0k408_66978_c1 | nmdc:mga0k408_66978_c1_674_1558 | 294 |
| 743 | 3300050493 | nmdc:mga0k408_67756_c1 | nmdc:mga0k408_67756_c1_919_1803 | 294 |
| 744 | 3300050493 | nmdc:mga0k408_69545_c1 | nmdc:mga0k408_69545_c1_918_1802 | 294 |
| 745 | 3300050494 | nmdc:mga06z11_214880_c1 | nmdc:mga06z11_214880_c1_68_952 | 294 |
| 746 | 3300050494 | nmdc:mga06z11_22764_c1 | nmdc:mga06z11_22764_c1_1831_2715 | 294 |
| 747 | 3300050494 | nmdc:mga06z11_6551_c1 | nmdc:mga06z11_6551_c1_1606_2490 | 294 |
| 748 | 3300050495 | nmdc:mga04h51_10773_c1 | nmdc:mga04h51_10773_c1_501_1385 | 294 |
| 749 | 3300050496 | nmdc:mga07m45_11905_c1 | nmdc:mga07m45_11905_c1_2703_3593 | 294 |
| 750 | 3300050496 | nmdc:mga07m45_2726_c1 | nmdc:mga07m45_2726_c1_4015_4899 | 294 |
| 751 | 3300050496 | nmdc:mga07m45_29645_c1 | nmdc:mga07m45_29645_c1_2002_2886 | 294 |
| 752 | 3300050496 | nmdc:mga07m45_44795_c1 | nmdc:mga07m45_44795_c1_626_1510 | 294 |
| 753 | 3300050496 | nmdc:mga07m45_521_c1 | nmdc:mga07m45_521_c1_2346_3230 | 294 |
| 754 | 3300050496 | nmdc:mga07m45_6176_c1 | nmdc:mga07m45_6176_c1_276_1160 | 294 |
| 755 | 3300050511 | nmdc:mga08y16_210159_c1 | nmdc:mga08y16_210159_c1_371_1255 | 294 |
| 756 | 3300050516 | nmdc:mga0sz30_3842_c1 | nmdc:mga0sz30_3842_c1_405_1289 | 294 |
| 757 | 3300053077 | Ga0495601_0261976 | Ga0495601_0261976_143_1027 | 294 |
| 758 | 3300053086 | Ga0500578_0000007 | Ga0500578_0000007_201142_202026 | 294 |
| 759 | 3300053088 | Ga0500644_0007389 | Ga0500644_0007389_653_1537 | 294 |
| 760 | 3300053088 | Ga0500644_0020243 | Ga0500644_0020243_113_997 | 294 |
| 761 | 3300053088 | Ga0500644_0048148 | Ga0500644_0048148_298_1182 | 294 |
| 762 | 3300053090 | Ga0500646_0014730 | Ga0500646_0014730_1016_1900 | 294 |
| 763 | 3300053093 | Ga0500651_0028496 | Ga0500651_0028496_2523_3407 | 294 |
| 764 | 3300053093 | Ga0500651_0094844 | Ga0500651_0094844_640_1524 | 294 |
| 765 | 3300053109 | Ga0500569_026989 | Ga0500569_026989_173_1057 | 294 |
| 766 | 3300053117 | Ga0500593_004305 | Ga0500593_004305_2509_3396 | 294 |
| 767 | 3300053129 | Ga0500628_005054 | Ga0500628_005054_1243_2127 | 294 |
| 768 | 3300053131 | Ga0500652_001774 | Ga0500652_001774_3042_3926 | 294 |
| 769 | 3300053133 | Ga0500655_008958 | Ga0500655_008958_660_1544 | 294 |
| 770 | 3300053134 | Ga0500658_0009620 | Ga0500658_0009620_127_1011 | 294 |
| 771 | 3300053134 | Ga0500658_0011046 | Ga0500658_0011046_334_1218 | 294 |
| 772 | 3300053136 | Ga0500559_0000262 | Ga0500559_0000262_11640_12524 | 294 |
| 773 | 3300053139 | Ga0500568_0045798 | Ga0500568_0045798_205_1089 | 294 |
| 774 | 3300053139 | Ga0500568_0062489 | Ga0500568_0062489_294_1178 | 294 |
| 775 | 3300053142 | Ga0500577_0019925 | Ga0500577_0019925_1025_1909 | 294 |
| 776 | 3300053148 | Ga0500590_006823 | Ga0500590_006823_1497_2381 | 294 |
| 777 | 3300053154 | Ga0500619_000525 | Ga0500619_000525_3134_4021 | 294 |
| 778 | 3300053156 | Ga0500622_0000359 | Ga0500622_0000359_2545_3429 | 294 |
| 779 | 3300053156 | Ga0500622_0003431 | Ga0500622_0003431_8195_9079 | 294 |
| 780 | 3300053730 | Ga0500645_004369 | Ga0500645_004369_2343_3227 | 294 |
| 781 | 3300053739 | Ga0500587_001082 | Ga0500587_001082_565_1449 | 294 |
| 782 | 3300002773 | JGI25152J39213_1001351 | JGI25152J39213_10013512 | 295 |
| 783 | 3300002774 | JGI25150J39212_1010495 | JGI25150J39212_10104952 | 295 |
| 784 | 3300003215 | JGI25153J46596_10013555 | JGI25153J46596_100135553 | 295 |
| 785 | 3300003322 | rootL2_10022824 | rootL2_100228243 | 295 |
| 786 | 3300003323 | rootH1_10158640 | rootH1_101586405 | 295 |
| 787 | 3300003771 | Ga0055526_1008178 | Ga0055526_10081785 | 295 |
| 788 | 3300003794 | Ga0055531_10000107 | Ga0055531_1000010783 | 295 |
| 789 | 3300006353 | Ga0075370_10068742 | Ga0075370_100687422 | 295 |
| 790 | 3300009148 | Ga0105243_10214660 | Ga0105243_102146602 | 295 |
| 791 | 3300025245 | Ga0207425_1001369 | Ga0207425_10013695 | 295 |
| 792 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012403 | 295 |
| 793 | 3300025273 | Ga0209673_1012584 | Ga0209673_10125843 | 295 |
| 794 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022111 | 295 |
| 795 | 3300025297 | Ga0209758_1000233 | Ga0209758_1000233110 | 295 |
| 796 | 3300025298 | Ga0209050_1005020 | Ga0209050_10050202 | 295 |
| 797 | 3300025299 | Ga0209256_1019763 | Ga0209256_10197632 | 295 |
| 798 | 3300025303 | Ga0209051_1050987 | Ga0209051_10509872 | 295 |
| 799 | 3300025304 | Ga0209257_1000032 | Ga0209257_10000322 | 295 |
| 800 | 3300025304 | Ga0209257_1015488 | Ga0209257_10154882 | 295 |
| 801 | 3300025935 | Ga0207709_10127319 | Ga0207709_101273192 | 295 |
| 802 | 3300031548 | Ga0307408_100000038 | Ga0307408_10000003829 | 295 |
| 803 | 3300031548 | Ga0307408_100515310 | Ga0307408_1005153101 | 295 |
| 804 | 3300032005 | Ga0307411_10000979 | Ga0307411_100009794 | 295 |
| 805 | 3300035114 | Ga0373939_0000473 | Ga0373939_0000473_2552_3448 | 295 |
| 806 | 3300035691 | Ga0373931_0000592 | Ga0373931_0000592_13704_14600 | 295 |
| 807 | 3300042000 | Ga0439437_000875 | Ga0439437_000875_1307_2203 | 295 |
| 808 | 3300042120 | Ga0450917_000152 | Ga0450917_000152_2735_3631 | 295 |
| 809 | 3300042127 | Ga0450890_000380 | Ga0450890_000380_1918_2814 | 295 |
| 810 | 3300042129 | Ga0450891_000009 | Ga0450891_000009_12564_13460 | 295 |
| 811 | 3300042130 | Ga0450892_001075 | Ga0450892_001075_218_1114 | 295 |
| 812 | 3300042144 | Ga0450889_000322 | Ga0450889_000322_934_1830 | 295 |
| 813 | 3300042530 | Ga0450916_011857 | Ga0450916_011857_42_938 | 295 |
| 814 | 3300042532 | Ga0450893_0007029 | Ga0450893_0007029_785_1681 | 295 |
| 815 | 3300045051 | Ga0451576_0057090 | Ga0451576_0057090_963_1862 | 295 |
| 816 | 3300049129 | Ga0501309_010734 | Ga0501309_010734_29_925 | 295 |
| 817 | 3300049130 | Ga0501310_002501 | Ga0501310_002501_106_1002 | 295 |
| 818 | 3300049653 | Ga0501206_011526 | Ga0501206_011526_210_1106 | 295 |
| 819 | 3300049658 | Ga0501211_000398 | Ga0501211_000398_27_923 | 295 |
| 820 | 3300049662 | Ga0501222_003094 | Ga0501222_003094_370_1266 | 295 |
| 821 | 3300049684 | Ga0501255_009784 | Ga0501255_009784_67_963 | 295 |
| 822 | 3300049687 | Ga0501258_000887 | Ga0501258_000887_921_1817 | 295 |
| 823 | 3300049704 | Ga0501221_007219 | Ga0501221_007219_367_1263 | 295 |
| 824 | 3300049705 | Ga0501225_0020353 | Ga0501225_0020353_572_1468 | 295 |
| 825 | 3300049764 | Ga0501267_001944 | Ga0501267_001944_235_1131 | 295 |
| 826 | 3300049822 | Ga0501035_0143246 | Ga0501035_0143246_653_1546 | 295 |
| 827 | 3300050493 | nmdc:mga0k408_183701_c1 | nmdc:mga0k408_183701_c1_312_1208 | 295 |
| 828 | 3300053104 | Ga0500556_0066206 | Ga0500556_0066206_293_1183 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wji-assembly1.cif.gz_A-2 | crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine | 0.9298 | 2 | 280 |
| 2g5c-assembly1.cif.gz_A | crystal structure of prephenate dehydrogenase from aquifex aeolicus | 0.9144 | 1 | 280 |
| 2g5c-assembly1.cif.gz_A | crystal structure of prephenate dehydrogenase from aquifex aeolicus | 0.9019 | 1 | 280 |
| 3ggp-assembly2.cif.gz_D | crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ | 0.8992 | 1 | 280 |
| 3dzb-assembly1.cif.gz_A | crystal structure of prephenate dehydrogenase from streptococcus thermophilus | 0.8979 | 3 | 281 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1kD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9412 | 4 | 174 | 3.40.50.720 |
| 2f1kD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9302 | 4 | 174 | 3.40.50.720 |
| 2g5cD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9178 | 3 | 171 | 3.40.50.720 |
| af_O69721_5_180_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8991 | 2 | 177 | 3.40.50.720 |
| 2g5cD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.897 | 3 | 171 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519I2I5-F1-model_v4 | Prephenate dehydrogenase/arogenate dehydrogenase family protein | 1 | 1 | 93 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A519I2I5-F1-model_v4 | Prephenate dehydrogenase/arogenate dehydrogenase family protein | 0.9897 | 1 | 93 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A0F9J666-F1-model_v4 | Prephenate/arogenate dehydrogenase domain-containing protein | 0.9828 | 1 | 180 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A3D1CP08-F1-model_v4 | Prephenate dehydrogenase/arogenate dehydrogenase family protein | 0.9757 | 1 | 126 |
GO:0004665
GO:0006571 GO:0008977 GO:0070403 |
| AF-A0A432J8H5-F1-model_v4 | deleted | 0.9704 | 1 | 110 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar