F482419

General Info

Members Datasets Scaffolds Average Seq Length
825 328 1650 62

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100113613|Ga0070706_1001136134
Length 71
Sequence MAPWKKCYLEAMEKPKLKEHDGMVCRSCGNEERASEGYPCADCGTFICLICTFRGVTRCKACEQKAQSNKA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
191 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
192 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
293 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
294 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
295 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
296 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
297 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
298 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
299 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
300 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
301 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
306 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.91
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 18.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100113613 3300005467 Bacteria 2522
2 CNAas_1002750 3300000532 Unclassified 1215
3 Ga0065712_10455648 3300005290 Bacteria 682
4 Ga0065715_10103934 3300005293 Bacteria 2997
5 Ga0070658_10849995 3300005327 Bacteria 793
6 Ga0070676_10166556 3300005328 Unclassified 1422
7 Ga0070683_100075287 3300005329 Bacteria 3154
8 Ga0070683_100429050 3300005329 Bacteria 1261
9 Ga0070683_101128756 3300005329 Unclassified 753
10 Ga0070690_100100402 3300005330 Bacteria 1918
11 Ga0070677_10049625 3300005333 Unclassified 1691
12 Ga0068869_100094681 3300005334 Bacteria 2252
13 Ga0070666_10957925 3300005335 Unclassified 634
14 Ga0070680_100003363 3300005336 Bacteria 11935
15 Ga0070680_100021656 3300005336 Bacteria 5111
16 Ga0070680_100055087 3300005336 Bacteria 3249
17 Ga0070680_100119131 3300005336 Bacteria 2202
18 Ga0070680_101792620 3300005336 Unclassified 532
19 Ga0070682_100630331 3300005337 Bacteria 851
20 Ga0070660_100262983 3300005339 Unclassified 1409
21 Ga0070660_100431535 3300005339 Unclassified 1092
22 Ga0070689_100289260 3300005340 Bacteria 1361
23 Ga0070691_10077606 3300005341 Bacteria 1621
24 Ga0070691_10221303 3300005341 Bacteria 1003
25 Ga0070691_10328797 3300005341 Unclassified 843
26 Ga0070687_100014007 3300005343 Bacteria 3591
27 Ga0070661_100585813 3300005344 Unclassified 901
28 Ga0070661_100829453 3300005344 Unclassified 760
29 Ga0070692_10035505 3300005345 Bacteria 2524
30 Ga0070692_10376816 3300005345 Bacteria 889
31 Ga0070692_10635068 3300005345 Bacteria 711
32 Ga0070668_100025764 3300005347 Bacteria 4460
33 Ga0070668_100403279 3300005347 Bacteria 1168
34 Ga0070669_100231649 3300005353 Bacteria 1464
35 Ga0070669_100320550 3300005353 Bacteria 1251
36 Ga0070669_100782836 3300005353 Bacteria 810
37 Ga0070669_100946602 3300005353 Unclassified 737
38 Ga0070675_100321829 3300005354 Bacteria 1366
39 Ga0070675_100716710 3300005354 Unclassified 912
40 Ga0070675_101412245 3300005354 Unclassified 642
41 Ga0070671_100010826 3300005355 Bacteria 7319
42 Ga0070674_100402181 3300005356 Unclassified 1119
43 Ga0070674_100440864 3300005356 Unclassified 1073
44 Ga0070673_100008660 3300005364 Bacteria 6780
45 Ga0070673_100165407 3300005364 Bacteria 1884
46 Ga0070673_101238311 3300005364 Unclassified 700
47 Ga0070659_100335077 3300005366 Bacteria 1267
48 Ga0070659_102088271 3300005366 Unclassified 509
49 Ga0070667_100516508 3300005367 Bacteria 1096
50 Ga0070667_100905810 3300005367 Bacteria 821
51 Ga0070667_102079310 3300005367 Unclassified 535
52 Ga0070703_10007838 3300005406 Bacteria 3004
53 Ga0070703_10014634 3300005406 Bacteria 2236
54 Ga0070703_10042819 3300005406 Bacteria 1417
55 Ga0070703_10057329 3300005406 Bacteria 1264
56 Ga0070703_10061064 3300005406 Bacteria 1233
57 Ga0070709_10000756 3300005434 Bacteria 18271
58 Ga0070709_10001089 3300005434 Bacteria 15003
59 Ga0070713_101052054 3300005436 Unclassified 786
60 Ga0070710_10366988 3300005437 Bacteria 957
61 Ga0070711_100000587 3300005439 Bacteria 18990
62 Ga0070711_100400439 3300005439 Bacteria 1114
63 Ga0070711_101035327 3300005439 Unclassified 705
64 Ga0070705_100016368 3300005440 Bacteria 3852
65 Ga0070705_100033313 3300005440 Unclassified 2871
66 Ga0070705_100037012 3300005440 Bacteria 2749
67 Ga0070705_100051470 3300005440 Bacteria 2402
68 Ga0070705_100112805 3300005440 Bacteria 1740
69 Ga0070705_100255112 3300005440 Bacteria 1233
70 Ga0070705_100671787 3300005440 Bacteria 810
71 Ga0070705_101214855 3300005440 Unclassified 622
72 Ga0070705_101768965 3300005440 Bacteria 524
73 Ga0070700_100517596 3300005441 Unclassified 921
74 Ga0070700_101124770 3300005441 Bacteria 652
75 Ga0070700_101265985 3300005441 Unclassified 618
76 Ga0070694_100000374 3300005444 Bacteria 24071
77 Ga0070694_100009909 3300005444 Bacteria 5855
78 Ga0070694_100011765 3300005444 Bacteria 5425
79 Ga0070694_100049476 3300005444 Unclassified 2831
80 Ga0070694_100052718 3300005444 Bacteria 2751
81 Ga0070694_100056569 3300005444 Bacteria 2664
82 Ga0070694_100141881 3300005444 Bacteria 1746
83 Ga0070694_100206487 3300005444 Bacteria 1467
84 Ga0070694_100236817 3300005444 Bacteria 1375
85 Ga0070694_100358786 3300005444 Bacteria 1131
86 Ga0070694_101347276 3300005444 Bacteria 601
87 Ga0070694_101391362 3300005444 Bacteria 592
88 Ga0070708_100012323 3300005445 Bacteria 6973
89 Ga0070708_100021439 3300005445 Bacteria 5463
90 Ga0070708_100025627 3300005445 Bacteria 5043
91 Ga0070708_100057250 3300005445 Bacteria 3470
92 Ga0070708_100063598 3300005445 Bacteria 3304
93 Ga0070708_100079521 3300005445 Bacteria 2966
94 Ga0070708_100097486 3300005445 Bacteria 2688
95 Ga0070708_100176360 3300005445 Unclassified 1997
96 Ga0070708_100292227 3300005445 Unclassified 1534
97 Ga0070708_101137364 3300005445 Bacteria 731
98 Ga0070708_101488635 3300005445 Unclassified 631
99 Ga0070678_101342728 3300005456 Bacteria 666
100 Ga0070662_100928229 3300005457 Bacteria 743
101 Ga0070662_101282534 3300005457 Bacteria 630
102 Ga0070662_101808689 3300005457 Unclassified 528
103 Ga0070681_10113112 3300005458 Bacteria 2654
104 Ga0068867_100045576 3300005459 Bacteria 3217
105 Ga0068867_100613809 3300005459 Bacteria 950
106 Ga0070706_100013002 3300005467 Bacteria 7702
107 Ga0070706_100022495 3300005467 Bacteria 5802
108 Ga0070706_100149294 3300005467 Bacteria 2182
109 Ga0070706_100214138 3300005467 Bacteria 1798
110 Ga0070706_100353172 3300005467 Unclassified 1370
111 Ga0070706_100797641 3300005467 Bacteria 874
112 Ga0070706_100963648 3300005467 Bacteria 787
113 Ga0070707_100049000 3300005468 Bacteria 4048
114 Ga0070707_100060864 3300005468 Bacteria 3621
115 Ga0070707_100073895 3300005468 Bacteria 3287
116 Ga0070707_100666959 3300005468 Bacteria 1003
117 Ga0070707_100976892 3300005468 Bacteria 812
118 Ga0070707_101234883 3300005468 Bacteria 713
119 Ga0070707_101237676 3300005468 Bacteria 713
120 Ga0070698_100021638 3300005471 Bacteria 6734
121 Ga0070698_100278761 3300005471 Unclassified 1603
122 Ga0070699_100009657 3300005518 Bacteria 8353
123 Ga0070699_100015867 3300005518 Bacteria 6466
124 Ga0070699_100019610 3300005518 Bacteria 5826
125 Ga0070699_100041914 3300005518 Bacteria 3961
126 Ga0070699_100097486 3300005518 Bacteria 2575
127 Ga0070699_100180515 3300005518 Bacteria 1873
128 Ga0070699_100243215 3300005518 Bacteria 1607
129 Ga0070699_100475314 3300005518 Bacteria 1134
130 Ga0070699_100951485 3300005518 Bacteria 787
131 Ga0070699_101399483 3300005518 Bacteria 641
132 Ga0070679_100035645 3300005530 Bacteria 4936
133 Ga0070679_100036498 3300005530 Bacteria 4877
134 Ga0070679_100843366 3300005530 Unclassified 860
135 Ga0070679_100968684 3300005530 Bacteria 794
136 Ga0070684_100305473 3300005535 Bacteria 1460
137 Ga0070684_100489346 3300005535 Unclassified 1139
138 Ga0070684_101774869 3300005535 Bacteria 582
139 Ga0070697_100003822 3300005536 Bacteria 11564
140 Ga0070697_100003996 3300005536 Bacteria 11314
141 Ga0070697_100041551 3300005536 Bacteria 3722
142 Ga0070697_100050640 3300005536 Bacteria 3372
143 Ga0070697_100102016 3300005536 Bacteria 2384
144 Ga0070697_100192088 3300005536 Bacteria 1733
145 Ga0070697_100201849 3300005536 Unclassified 1690
146 Ga0070697_100248780 3300005536 Bacteria 1520
147 Ga0070697_100318781 3300005536 Unclassified 1338
148 Ga0070697_100358154 3300005536 Bacteria 1261
149 Ga0070697_100566772 3300005536 Bacteria 996
150 Ga0070697_100617483 3300005536 Bacteria 953
151 Ga0070697_100679178 3300005536 Bacteria 908
152 Ga0070697_101412675 3300005536 Bacteria 621
153 Ga0070697_101688081 3300005536 Unclassified 566
154 Ga0068853_100331931 3300005539 Bacteria 1411
155 Ga0070672_100066526 3300005543 Unclassified 2854
156 Ga0070672_100226269 3300005543 Bacteria 1570
157 Ga0070672_100507506 3300005543 Bacteria 1044
158 Ga0070672_100956484 3300005543 Bacteria 758
159 Ga0070686_100077128 3300005544 Bacteria 2196
160 Ga0070686_101130040 3300005544 Bacteria 648
161 Ga0070695_100006531 3300005545 Bacteria 6892
162 Ga0070695_100006633 3300005545 Bacteria 6843
163 Ga0070695_100013795 3300005545 Bacteria 4860
164 Ga0070695_100029648 3300005545 Bacteria 3400
165 Ga0070695_100039569 3300005545 Unclassified 2981
166 Ga0070695_100042029 3300005545 Unclassified 2900
167 Ga0070695_100191597 3300005545 Bacteria 1455
168 Ga0070695_100194634 3300005545 Bacteria 1445
169 Ga0070695_100208085 3300005545 Unclassified 1402
170 Ga0070695_100251128 3300005545 Bacteria 1287
171 Ga0070695_100505877 3300005545 Bacteria 935
172 Ga0070695_100655473 3300005545 Bacteria 829
173 Ga0070696_100004070 3300005546 Bacteria 9752
174 Ga0070696_100007899 3300005546 Bacteria 7101
175 Ga0070696_100011984 3300005546 Bacteria 5810
176 Ga0070696_100015433 3300005546 Bacteria 5129
177 Ga0070696_100042186 3300005546 Bacteria 3154
178 Ga0070696_100048219 3300005546 Bacteria 2956
179 Ga0070696_100088860 3300005546 Bacteria 2197
180 Ga0070696_100286419 3300005546 Bacteria 1257
181 Ga0070696_100486468 3300005546 Bacteria 979
182 Ga0070696_100496805 3300005546 Bacteria 970
183 Ga0070696_101867829 3300005546 Unclassified 520
184 Ga0070693_100138707 3300005547 Bacteria 1528
185 Ga0070693_100145530 3300005547 Bacteria 1496
186 Ga0070665_100318706 3300005548 Bacteria 1559
187 Ga0070665_102166572 3300005548 Bacteria 560
188 Ga0070704_100002886 3300005549 Bacteria 9753
189 Ga0070704_100004974 3300005549 Bacteria 7721
190 Ga0070704_100006942 3300005549 Bacteria 6712
191 Ga0070704_100062587 3300005549 Unclassified 2668
192 Ga0070704_100069789 3300005549 Bacteria 2547
193 Ga0070704_100184481 3300005549 Bacteria 1672
194 Ga0070704_100793301 3300005549 Bacteria 846
195 Ga0068855_100277218 3300005563 Bacteria 1863
196 Ga0068855_100368574 3300005563 Bacteria 1579
197 Ga0068855_100577295 3300005563 Unclassified 1215
198 Ga0068855_100939577 3300005563 Bacteria 911
199 Ga0070664_100014141 3300005564 Bacteria 6511
200 Ga0070664_100017396 3300005564 Bacteria 5902
201 Ga0070664_100800012 3300005564 Unclassified 881
202 Ga0070664_100822242 3300005564 Bacteria 869
203 Ga0070664_101775347 3300005564 Unclassified 585
204 Ga0070664_101895837 3300005564 Unclassified 565
205 Ga0070664_102131535 3300005564 Unclassified 532
206 Ga0068857_101014542 3300005577 Unclassified 799
207 Ga0068857_101342769 3300005577 Unclassified 695
208 Ga0068856_101144963 3300005614 Bacteria 795
209 Ga0068852_102111895 3300005616 Unclassified 585
210 Ga0068859_100127177 3300005617 Bacteria 2618
211 Ga0068859_100588376 3300005617 Bacteria 1206
212 Ga0068859_100649380 3300005617 Bacteria 1147
213 Ga0068864_100278379 3300005618 Bacteria 1561
214 Ga0068861_100138095 3300005719 Unclassified 1986
215 Ga0068870_10265994 3300005840 Bacteria 1069
216 Ga0068870_10325454 3300005840 Bacteria 978
217 Ga0068860_100511243 3300005843 Bacteria 1200
218 Ga0068860_102174628 3300005843 Bacteria 576
219 Ga0068862_100499642 3300005844 Unclassified 1154
220 Ga0068862_100888464 3300005844 Bacteria 875
221 Ga0068862_101406602 3300005844 Bacteria 701
222 Ga0081538_10045689 3300005981 Bacteria 2711
223 Ga0075432_10367852 3300006058 Bacteria 613
224 Ga0070715_10478279 3300006163 Bacteria 709
225 Ga0070716_100031552 3300006173 Bacteria 2882
226 Ga0070716_101055347 3300006173 Bacteria 645
227 Ga0070716_101220275 3300006173 Bacteria 605
228 Ga0070712_100705936 3300006175 Bacteria 860
229 Ga0097621_101606754 3300006237 Bacteria 618
230 Ga0075428_100060813 3300006844 Bacteria 4137
231 Ga0075428_100365546 3300006844 Unclassified 1547
232 Ga0075428_100458416 3300006844 Unclassified 1365
233 Ga0075428_100472435 3300006844 Bacteria 1342
234 Ga0075428_100731342 3300006844 Bacteria 1053
235 Ga0075430_100256360 3300006846 Bacteria 1449
236 Ga0075430_100340824 3300006846 Unclassified 1238
237 Ga0075430_100441689 3300006846 Unclassified 1074
238 Ga0075430_100459877 3300006846 Bacteria 1050
239 Ga0075430_100580531 3300006846 Unclassified 925
240 Ga0075430_100848747 3300006846 Bacteria 752
241 Ga0075431_100075739 3300006847 Bacteria 3472
242 Ga0075431_100124247 3300006847 Unclassified 2663
243 Ga0075431_100185671 3300006847 Bacteria 2132
244 Ga0075431_101141650 3300006847 Bacteria 743
245 Ga0075433_10001942 3300006852 Bacteria 15545
246 Ga0075433_10006932 3300006852 Bacteria 8978
247 Ga0075433_10032263 3300006852 Unclassified 4486
248 Ga0075433_10045748 3300006852 Bacteria 3806
249 Ga0075433_10174043 3300006852 Bacteria 1915
250 Ga0075433_10335080 3300006852 Bacteria 1337
251 Ga0075433_11776126 3300006852 Unclassified 530
252 Ga0075434_100012684 3300006871 Bacteria 7993
253 Ga0075434_100016827 3300006871 Bacteria 7036
254 Ga0075434_100019562 3300006871 Bacteria 6555
255 Ga0075434_100031953 3300006871 Bacteria 5190
256 Ga0075434_100032321 3300006871 Bacteria 5160
257 Ga0075434_100035549 3300006871 Bacteria 4925
258 Ga0075434_100061882 3300006871 Bacteria 3725
259 Ga0075434_100069880 3300006871 Bacteria 3501
260 Ga0075434_100076870 3300006871 Bacteria 3333
261 Ga0075434_100463681 3300006871 Bacteria 1288
262 Ga0075434_100468823 3300006871 Bacteria 1280
263 Ga0075429_100025311 3300006880 Bacteria 5151
264 Ga0075429_101214935 3300006880 Unclassified 658
265 Ga0075429_101586857 3300006880 Unclassified 569
266 Ga0068865_100729414 3300006881 Bacteria 849
267 Ga0075436_100024262 3300006914 Bacteria 4168
268 Ga0075436_100028318 3300006914 Bacteria 3854
269 Ga0075436_100059565 3300006914 Bacteria 2637
270 Ga0075436_100130593 3300006914 Bacteria 1761
271 Ga0075436_100136141 3300006914 Bacteria 1724
272 Ga0075436_100345096 3300006914 Bacteria 1072
273 Ga0075436_100427871 3300006914 Bacteria 962
274 Ga0075436_100737722 3300006914 Bacteria 731
275 Ga0075436_100858896 3300006914 Bacteria 677
276 Ga0075436_101240985 3300006914 Bacteria 563
277 Ga0097620_100127178 3300006931 Bacteria 2618
278 Ga0097620_100588342 3300006931 Bacteria 1206
279 Ga0097620_100649448 3300006931 Bacteria 1147
280 Ga0075435_100017192 3300007076 Bacteria 5467
281 Ga0075435_100043446 3300007076 Bacteria 3597
282 Ga0075435_100050941 3300007076 Bacteria 3333
283 Ga0075435_100065653 3300007076 Bacteria 2951
284 Ga0075435_100079165 3300007076 Bacteria 2696
285 Ga0075435_101037893 3300007076 Bacteria 716
286 Ga0075435_101483785 3300007076 Bacteria 594
287 Ga0099794_10000020 3300007265 Bacteria 72580
288 Ga0099794_10000514 3300007265 Bacteria 12966
289 Ga0099794_10056915 3300007265 Bacteria 1893
290 Ga0099794_10067493 3300007265 Bacteria 1747
291 Ga0099794_10227144 3300007265 Unclassified 960
292 Ga0099794_10260760 3300007265 Bacteria 895
293 Ga0099794_10419593 3300007265 Unclassified 700
294 Ga0099795_10137463 3300007788 Unclassified 991
295 Ga0105240_11436399 3300009093 Bacteria 724
296 Ga0111539_10067073 3300009094 Unclassified 4238
297 Ga0111539_10155180 3300009094 Bacteria 2679
298 Ga0111539_10216787 3300009094 Bacteria 2229
299 Ga0111539_11149989 3300009094 Unclassified 902
300 Ga0105245_11948058 3300009098 Unclassified 641
301 Ga0114129_10006231 3300009147 Bacteria 16909
302 Ga0114129_10046785 3300009147 Bacteria 6079
303 Ga0114129_10076182 3300009147 Unclassified 4670
304 Ga0114129_10622299 3300009147 Bacteria 1396
305 Ga0114129_10634967 3300009147 Bacteria 1380
306 Ga0114129_10667367 3300009147 Bacteria 1340
307 Ga0114129_11911611 3300009147 Bacteria 719
308 Ga0114129_12469503 3300009147 Bacteria 622
309 Ga0105241_10187470 3300009174 Bacteria 1720
310 Ga0105241_10337330 3300009174 Unclassified 1305
311 Ga0105241_10622428 3300009174 Bacteria 977
312 Ga0105242_12499909 3300009176 Unclassified 565
313 Ga0105248_10007125 3300009177 Bacteria 12255
314 Ga0105248_10118128 3300009177 Bacteria 2991
315 Ga0105248_11173605 3300009177 Bacteria 868
316 Ga0105237_10321801 3300009545 Bacteria 1550
317 Ga0105238_10120362 3300009551 Bacteria 2605
318 Ga0099796_10287218 3300010159 Unclassified 693
319 Ga0105239_12904112 3300010375 Bacteria 559
320 Ga0157373_10117891 3300013100 Bacteria 1866
321 Ga0157370_11179733 3300013104 Bacteria 691
322 Ga0157370_11592657 3300013104 Unclassified 587
323 Ga0157370_11767513 3300013104 Bacteria 555
324 Ga0157369_10074857 3300013105 Bacteria 3631
325 Ga0157369_10260757 3300013105 Bacteria 1807
326 Ga0157369_12691757 3300013105 Unclassified 501
327 Ga0157378_10038947 3300013297 Bacteria 4215
328 Ga0157372_10028625 3300013307 Bacteria 6083
329 Ga0157372_10902420 3300013307 Bacteria 1025
330 Ga0157372_10950679 3300013307 Bacteria 996
331 Ga0157372_12008785 3300013307 Bacteria 664
332 Ga0157375_10679721 3300013308 Bacteria 1184
333 Ga0157375_10798743 3300013308 Unclassified 1092
334 Ga0157380_10509888 3300014326 Bacteria 1170
335 Ga0157380_10769334 3300014326 Bacteria 976
336 Ga0157380_13038627 3300014326 Bacteria 535
337 Ga0157379_10797714 3300014968 Unclassified 891
338 Ga0157379_11364458 3300014968 Bacteria 686
339 Ga0157376_10407175 3300014969 Bacteria 1317
340 Ga0157376_11719177 3300014969 Bacteria 663
341 Ga0157376_12161317 3300014969 Unclassified 595
342 Ga0163161_10740282 3300017792 Bacteria 822
343 Ga0206356_10060205 3300020070 Bacteria 1548
344 Ga0206354_11236316 3300020081 Bacteria 1396
345 Ga0206353_11783127 3300020082 Bacteria 2478
346 Ga0207697_10231381 3300025315 Unclassified 816
347 Ga0207653_10000048 3300025885 Bacteria 90730
348 Ga0207653_10002567 3300025885 Bacteria 5773
349 Ga0207653_10031054 3300025885 Bacteria 1725
350 Ga0207653_10056107 3300025885 Bacteria 1320
351 Ga0207653_10078659 3300025885 Bacteria 1138
352 Ga0207682_10202902 3300025893 Bacteria 912
353 Ga0207692_10808031 3300025898 Bacteria 613
354 Ga0207680_10825301 3300025903 Unclassified 665
355 Ga0207685_10390610 3300025905 Bacteria 711
356 Ga0207699_10003770 3300025906 Bacteria 7237
357 Ga0207699_10042133 3300025906 Bacteria 2642
358 Ga0207645_10134260 3300025907 Bacteria 1611
359 Ga0207645_10473400 3300025907 Unclassified 847
360 Ga0207643_10224233 3300025908 Bacteria 1151
361 Ga0207643_10263860 3300025908 Bacteria 1064
362 Ga0207684_10016138 3300025910 Bacteria 6416
363 Ga0207684_10022695 3300025910 Bacteria 5357
364 Ga0207684_10028164 3300025910 Unclassified 4786
365 Ga0207684_10074905 3300025910 Unclassified 2876
366 Ga0207684_10079023 3300025910 Bacteria 2798
367 Ga0207684_10096983 3300025910 Bacteria 2517
368 Ga0207684_10337409 3300025910 Bacteria 1298
369 Ga0207684_10827772 3300025910 Bacteria 781
370 Ga0207684_11041027 3300025910 Unclassified 683
371 Ga0207654_10170512 3300025911 Bacteria 1413
372 Ga0207654_10738839 3300025911 Bacteria 708
373 Ga0207707_10014760 3300025912 Bacteria 6806
374 Ga0207695_10001308 3300025913 Bacteria 42247
375 Ga0207695_10065149 3300025913 Bacteria 3747
376 Ga0207695_10292591 3300025913 Bacteria 1521
377 Ga0207695_10294553 3300025913 Bacteria 1515
378 Ga0207671_10029457 3300025914 Bacteria 4099
379 Ga0207693_10506577 3300025915 Bacteria 942
380 Ga0207663_10004006 3300025916 Bacteria 7296
381 Ga0207663_10254312 3300025916 Bacteria 1294
382 Ga0207660_10006646 3300025917 Bacteria 7499
383 Ga0207660_10006991 3300025917 Bacteria 7307
384 Ga0207660_10026173 3300025917 Bacteria 3970
385 Ga0207660_10299332 3300025917 Bacteria 1280
386 Ga0207660_10306000 3300025917 Bacteria 1266
387 Ga0207662_10103273 3300025918 Bacteria 1768
388 Ga0207662_10551375 3300025918 Unclassified 798
389 Ga0207657_10042665 3300025919 Bacteria 4001
390 Ga0207649_10956571 3300025920 Unclassified 673
391 Ga0207652_10018755 3300025921 Bacteria 5678
392 Ga0207652_10490579 3300025921 Bacteria 1106
393 Ga0207652_11321110 3300025921 Bacteria 624
394 Ga0207646_10001595 3300025922 Bacteria 27689
395 Ga0207646_10001606 3300025922 Bacteria 27590
396 Ga0207646_10035861 3300025922 Bacteria 4478
397 Ga0207646_10136553 3300025922 Bacteria 2208
398 Ga0207646_10150963 3300025922 Bacteria 2095
399 Ga0207646_10163930 3300025922 Bacteria 2006
400 Ga0207646_10976423 3300025922 Bacteria 749
401 Ga0207681_10310387 3300025923 Bacteria 1251
402 Ga0207681_10454010 3300025923 Bacteria 1043
403 Ga0207681_10468812 3300025923 Bacteria 1027
404 Ga0207681_10503187 3300025923 Bacteria 992
405 Ga0207694_10594639 3300025924 Bacteria 930
406 Ga0207659_10330522 3300025926 Unclassified 1260
407 Ga0207659_11022254 3300025926 Bacteria 711
408 Ga0207664_10063099 3300025929 Bacteria 2961
409 Ga0207644_10006110 3300025931 Bacteria 7852
410 Ga0207690_10142199 3300025932 Bacteria 1769
411 Ga0207690_10953882 3300025932 Bacteria 713
412 Ga0207706_10487587 3300025933 Bacteria 1065
413 Ga0207670_10705149 3300025936 Bacteria 836
414 Ga0207669_10306994 3300025937 Unclassified 1208
415 Ga0207665_10001439 3300025939 Bacteria 16015
416 Ga0207665_10124360 3300025939 Bacteria 1825
417 Ga0207691_10170838 3300025940 Bacteria 1904
418 Ga0207691_10475602 3300025940 Unclassified 1062
419 Ga0207691_10553745 3300025940 Bacteria 975
420 Ga0207711_10088716 3300025941 Bacteria 2716
421 Ga0207711_10095281 3300025941 Bacteria 2625
422 Ga0207689_10799375 3300025942 Unclassified 796
423 Ga0207661_10050067 3300025944 Bacteria 3327
424 Ga0207661_10251258 3300025944 Bacteria 1572
425 Ga0207661_10341497 3300025944 Bacteria 1349
426 Ga0207661_10694385 3300025944 Bacteria 936
427 Ga0207679_10113335 3300025945 Bacteria 2145
428 Ga0207679_10119113 3300025945 Bacteria 2098
429 Ga0207679_10206604 3300025945 Unclassified 1644
430 Ga0207679_11122623 3300025945 Bacteria 721
431 Ga0207667_10204681 3300025949 Bacteria 2024
432 Ga0207667_12065741 3300025949 Bacteria 529
433 Ga0207651_10058044 3300025960 Bacteria 2673
434 Ga0207651_10060315 3300025960 Bacteria 2633
435 Ga0207651_11400736 3300025960 Unclassified 629
436 Ga0207668_10059020 3300025972 Unclassified 2685
437 Ga0207658_10220669 3300025986 Bacteria 1595
438 Ga0207639_10381075 3300026041 Bacteria 1266
439 Ga0207708_10030823 3300026075 Bacteria 4068
440 Ga0207708_11886415 3300026075 Bacteria 524
441 Ga0207702_10256298 3300026078 Bacteria 1645
442 Ga0207702_11501234 3300026078 Bacteria 667
443 Ga0207702_12484082 3300026078 Unclassified 505
444 Ga0207648_10084372 3300026089 Unclassified 2771
445 Ga0207648_10733417 3300026089 Bacteria 917
446 Ga0207648_11986283 3300026089 Unclassified 543
447 Ga0207674_10337953 3300026116 Bacteria 1456
448 Ga0207674_10583146 3300026116 Unclassified 1080
449 Ga0207674_10962523 3300026116 Unclassified 822
450 Ga0207675_100127483 3300026118 Bacteria 2411
451 Ga0207675_100217556 3300026118 Unclassified 1840
452 Ga0207675_102401063 3300026118 Bacteria 539
453 Ga0207683_10375144 3300026121 Bacteria 1307
454 Ga0209967_1034263 3300027364 Bacteria 764
455 Ga0209588_1000760 3300027671 Bacteria 8177
456 Ga0209588_1001980 3300027671 Bacteria 5498
457 Ga0209588_1094060 3300027671 Bacteria 965
458 Ga0209974_10334275 3300027876 Unclassified 585
459 Ga0268266_10863000 3300028379 Unclassified 875
460 Ga0268265_10522718 3300028380 Unclassified 1122
461 Ga0268264_10228199 3300028381 Bacteria 1718
462 Ga0268264_12115404 3300028381 Bacteria 571
463 Ga0307408_100168569 3300031548 Bacteria 1746
464 Ga0307408_100313535 3300031548 Unclassified 1319
465 Ga0307405_10017572 3300031731 Bacteria 3928
466 Ga0307405_10749066 3300031731 Bacteria 814
467 Ga0307413_10000395 3300031824 Bacteria 13959
468 Ga0307413_10003235 3300031824 Bacteria 6822
469 Ga0307413_10006010 3300031824 Bacteria 5495
470 Ga0307413_10010080 3300031824 Bacteria 4560
471 Ga0307413_10113015 3300031824 Bacteria 1822
472 Ga0307413_10204590 3300031824 Bacteria 1428
473 Ga0307410_10003941 3300031852 Bacteria 7558
474 Ga0307410_10015487 3300031852 Bacteria 4525
475 Ga0307410_10018096 3300031852 Bacteria 4250
476 Ga0307410_10026290 3300031852 Bacteria 3663
477 Ga0307410_10029876 3300031852 Bacteria 3476
478 Ga0307410_10036361 3300031852 Bacteria 3206
479 Ga0307410_10074776 3300031852 Bacteria 2360
480 Ga0307406_10009486 3300031901 Bacteria 5460
481 Ga0307406_10013226 3300031901 Bacteria 4723
482 Ga0307406_10020568 3300031901 Bacteria 3889
483 Ga0307406_10114015 3300031901 Bacteria 1866
484 Ga0307406_10404380 3300031901 Bacteria 1083
485 Ga0307407_10040178 3300031903 Bacteria 2606
486 Ga0307407_10057919 3300031903 Bacteria 2250
487 Ga0307407_10088864 3300031903 Bacteria 1888
488 Ga0307407_10140751 3300031903 Bacteria 1556
489 Ga0307407_10280182 3300031903 Bacteria 1154
490 Ga0307407_11558416 3300031903 Bacteria 523
491 Ga0307412_10066833 3300031911 Bacteria 2438
492 Ga0307412_10365578 3300031911 Bacteria 1163
493 Ga0307409_100000311 3300031995 Bacteria 19889
494 Ga0307409_100269756 3300031995 Bacteria 1566
495 Ga0307409_100529728 3300031995 Bacteria 1152
496 Ga0307416_100002453 3300032002 Bacteria 10652
497 Ga0307416_100011376 3300032002 Bacteria 5928
498 Ga0307416_100013045 3300032002 Bacteria 5631
499 Ga0307416_100029166 3300032002 Bacteria 4117
500 Ga0307416_100103846 3300032002 Bacteria 2482
501 Ga0307416_100226366 3300032002 Bacteria 1799
502 Ga0307416_100279026 3300032002 Bacteria 1646
503 Ga0307416_102214136 3300032002 Bacteria 651
504 Ga0307414_10051219 3300032004 Bacteria 2865
505 Ga0307414_10066667 3300032004 Bacteria 2575
506 Ga0307414_10073144 3300032004 Bacteria 2478
507 Ga0307414_10204531 3300032004 Bacteria 1609
508 Ga0307411_10007769 3300032005 Bacteria 5498
509 Ga0307411_10017042 3300032005 Bacteria 4127
510 Ga0307411_10023723 3300032005 Bacteria 3640
511 Ga0307411_10040831 3300032005 Bacteria 2946
512 Ga0307411_10314911 3300032005 Bacteria 1261
513 Ga0307415_100001413 3300032126 Bacteria 11472
514 Ga0307415_100019078 3300032126 Bacteria 4156
515 Ga0307415_100094742 3300032126 Bacteria 2171
516 Ga0307415_101991245 3300032126 Bacteria 565
517 Ga0373926_0256992 3300035083 Unclassified 678
518 Ga0373934_0222889 3300035086 Bacteria 778
519 Ga0373957_0058336 3300035120 Bacteria 1491
520 Ga0373955_0788383 3300035172 Bacteria 584
521 Ga0373931_0171115 3300035691 Bacteria 1280
522 Ga0373935_0951464 3300035692 Unclassified 637
523 Ga0373927_0515177 3300035695 Bacteria 790
524 Ga0373933_0459849 3300035724 Bacteria 833
525 Ga0373937_0080482 3300036401 Bacteria 3013
526 Ga0373937_0096633 3300036401 Bacteria 2740
527 Ga0373937_0512312 3300036401 Bacteria 1140
528 Ga0439439_0009132 3300041406 Bacteria 2353
529 Ga0439439_0085214 3300041406 Bacteria 858
530 Ga0439465_0387881 3300041413 Unclassified 531
531 Ga0439433_0155633 3300041999 Unclassified 590
532 Ga0439448_0002243 3300042005 Bacteria 5220
533 Ga0439449_0123938 3300042007 Bacteria 960
534 Ga0439457_054359 3300042014 Bacteria 902
535 Ga0439462_0026506 3300042015 Bacteria 1528
536 Ga0450894_037652 3300042131 Unclassified 689
537 Ga0450898_019178 3300042134 Bacteria 1190
538 Ga0450898_022396 3300042134 Bacteria 1118
539 Ga0450910_030708 3300042147 Unclassified 843
540 Ga0439444_0093510 3300042437 Bacteria 673
541 Ga0439464_0110373 3300042439 Bacteria 842
542 Ga0451577_0006635 3300042876 Bacteria 11495
543 Ga0451577_0245693 3300042876 Bacteria 1620
544 Ga0451577_0622266 3300042876 Bacteria 979
545 Ga0453683_0075339 3300044673 Unclassified 2113
546 Ga0453683_0081311 3300044673 Bacteria 2029
547 Ga0453683_0094721 3300044673 Unclassified 1873
548 Ga0453683_0116411 3300044673 Bacteria 1682
549 Ga0453683_0434694 3300044673 Unclassified 848
550 Ga0453683_0784974 3300044673 Bacteria 627
551 Ga0453683_0955786 3300044673 Bacteria 568
552 Ga0453683_0993751 3300044673 Unclassified 557
553 Ga0466961_0854049 3300044693 Bacteria 543
554 Ga0451576_0003514 3300045051 Bacteria 21417
555 Ga0451576_0016436 3300045051 Bacteria 8168
556 Ga0451576_0018380 3300045051 Bacteria 7664
557 Ga0451576_0033227 3300045051 Bacteria 5484
558 Ga0451576_0040981 3300045051 Bacteria 4896
559 Ga0451576_0505205 3300045051 Unclassified 1270
560 Ga0451576_0673685 3300045051 Bacteria 1087
561 Ga0451576_2167015 3300045051 Bacteria 571
562 Ga0466967_1648047 3300045976 Unclassified 639
563 Ga0495592_0226121 3300046454 Bacteria 1248
564 Ga0495592_0476349 3300046454 Bacteria 778
565 Ga0495592_0811034 3300046454 Unclassified 555
566 Ga0495603_0284475 3300046455 Unclassified 950
567 Ga0495603_0543274 3300046455 Bacteria 665
568 Ga0495641_0009016 3300046461 Bacteria 5990
569 Ga0495651_0021884 3300046462 Bacteria 4971
570 Ga0495651_0036851 3300046462 Bacteria 3808
571 Ga0495653_0030456 3300046463 Bacteria 4299
572 Ga0495580_0192878 3300046472 Bacteria 1405
573 Ga0495580_0427396 3300046472 Bacteria 890
574 Ga0495582_0021300 3300046473 Bacteria 3548
575 Ga0495639_0009206 3300046475 Bacteria 4233
576 Ga0495639_0058147 3300046475 Unclassified 1768
577 Ga0495662_0058019 3300046476 Bacteria 1870
578 Ga0495662_0195711 3300046476 Bacteria 996
579 Ga0495664_0011225 3300046477 Bacteria 5046
580 Ga0495664_0411816 3300046477 Bacteria 811
581 Ga0495585_0459769 3300046492 Bacteria 608
582 Ga0495594_0002354 3300046499 Bacteria 9838
583 Ga0495608_0155559 3300046511 Bacteria 1455
584 Ga0495618_0010773 3300046514 Bacteria 5537
585 Ga0495618_0081279 3300046514 Bacteria 2069
586 Ga0495628_0070927 3300046516 Bacteria 2716
587 Ga0495628_0142192 3300046516 Bacteria 1831
588 Ga0495630_0003371 3300046517 Bacteria 11122
589 Ga0495630_0894258 3300046517 Unclassified 676
590 Ga0495663_0025983 3300046525 Bacteria 1712
591 Ga0495663_0359023 3300046525 Unclassified 531
592 Ga0495666_0003208 3300046526 Bacteria 8236
593 Ga0495642_0309084 3300046528 Bacteria 693
594 Ga0495652_0118261 3300046529 Bacteria 2118
595 Ga0495665_0041028 3300046531 Bacteria 2464
596 Ga0495665_0459584 3300046531 Bacteria 643
597 Ga0495640_0002922 3300046533 Bacteria 13754
598 Ga0495640_0004600 3300046533 Bacteria 11008
599 Ga0495586_0002778 3300046535 Bacteria 9458
600 Ga0495586_0199627 3300046535 Bacteria 1134
601 Ga0495587_0042553 3300046536 Bacteria 2709
602 Ga0495587_0052897 3300046536 Bacteria 2395
603 Ga0495609_0036496 3300046538 Bacteria 2219
604 Ga0495621_0017723 3300046539 Bacteria 2306
605 Ga0495621_0030548 3300046539 Bacteria 1843
606 Ga0495645_0328103 3300046543 Bacteria 992
607 Ga0495622_0438737 3300046557 Bacteria 560
608 Ga0495633_0327137 3300046558 Unclassified 695
609 Ga0495667_0049907 3300046559 Bacteria 2762
610 Ga0495634_0023639 3300046642 Bacteria 4317
611 Ga0495634_0144176 3300046642 Bacteria 1510
612 Ga0495635_0024065 3300046663 Bacteria 4244
613 Ga0495635_0514424 3300046663 Bacteria 787
614 Ga0495659_0064512 3300046664 Bacteria 1360
615 Ga0495659_0268803 3300046664 Unclassified 714
616 Ga0495588_0153283 3300046674 Bacteria 1218
617 Ga0495599_0007708 3300046678 Bacteria 6537
618 Ga0495646_0034195 3300046680 Bacteria 3158
619 Ga0495647_0032796 3300046681 Unclassified 1938
620 Ga0495658_0146282 3300046683 Bacteria 1448
621 Ga0495658_0247733 3300046683 Bacteria 1120
622 Ga0495658_0881984 3300046683 Unclassified 572
623 Ga0495669_0064059 3300046684 Bacteria 1668
624 Ga0495613_0132127 3300046689 Bacteria 1787
625 Ga0495613_0219423 3300046689 Bacteria 1335
626 Ga0495624_0035815 3300046690 Bacteria 3203
627 Ga0495624_0055767 3300046690 Bacteria 2488
628 Ga0495670_0432601 3300046691 Unclassified 712
629 Ga0495600_0505285 3300046809 Bacteria 742
630 Ga0495604_0158689 3300047317 Bacteria 1600
631 Ga0495636_0228142 3300047318 Unclassified 856
632 Ga0495636_0269637 3300047318 Bacteria 791
633 Ga0495674_0006916 3300047319 Bacteria 10848
634 Ga0495674_0029322 3300047319 Bacteria 5012
635 Ga0495676_0046159 3300047321 Bacteria 3539
636 Ga0495680_0007138 3300047322 Bacteria 10290
637 Ga0495680_0332890 3300047322 Bacteria 1060
638 Ga0495675_0101722 3300047444 Bacteria 1798
639 Ga0495675_0451359 3300047444 Bacteria 744
640 Ga0495677_0170100 3300047445 Bacteria 843
641 Ga0495684_0020270 3300047471 Bacteria 5123
642 Ga0495684_0191808 3300047471 Bacteria 1510
643 Ga0495593_0185353 3300047673 Bacteria 1048
644 Ga0495602_0272933 3300048088 Bacteria 1249
645 Ga0495614_0108607 3300048089 Bacteria 1217
646 Ga0496100_0010018 3300048903 Bacteria 5353
647 Ga0496100_1236979 3300048903 Unclassified 589
648 Ga0496101_0055151 3300048904 Bacteria 2870
649 Ga0496101_0120991 3300048904 Bacteria 1979
650 Ga0496102_0086415 3300048905 Bacteria 2896
651 Ga0496102_0490837 3300048905 Bacteria 1150
652 Ga0496102_0800053 3300048905 Bacteria 865
653 Ga0496103_0006303 3300048906 Bacteria 7090
654 Ga0496104_0023440 3300048907 Bacteria 5674
655 Ga0496105_0262208 3300048908 Bacteria 1397
656 Ga0496106_0016439 3300048909 Bacteria 5474
657 Ga0496106_1411438 3300048909 Bacteria 538
658 Ga0496107_0049155 3300048910 Bacteria 3039
659 Ga0496108_0030800 3300048911 Bacteria 4445
660 Ga0496108_0443913 3300048911 Bacteria 1133
661 Ga0496108_1453374 3300048911 Unclassified 572
662 Ga0496109_0042162 3300048912 Bacteria 4133
663 Ga0496109_0264377 3300048912 Bacteria 1621
664 Ga0496110_0008866 3300048913 Bacteria 8108
665 Ga0496111_0168613 3300048914 Bacteria 1626
666 Ga0496112_0285975 3300048915 Bacteria 1595
667 Ga0496113_0022055 3300048916 Bacteria 4498
668 Ga0496115_0001686 3300048918 Bacteria 15873
669 Ga0496115_0046891 3300048918 Bacteria 3456
670 Ga0501303_064593 3300049526 Unclassified 507
671 Ga0501031_0076645 3300049568 Bacteria 2178
672 Ga0501031_0458421 3300049568 Bacteria 823
673 Ga0501032_0098476 3300049569 Bacteria 1938
674 Ga0501033_0072913 3300049570 Bacteria 2521
675 Ga0501033_0564898 3300049570 Bacteria 783
676 Ga0501036_0016908 3300049572 Bacteria 6093
677 Ga0501036_1457834 3300049572 Unclassified 554
678 Ga0501037_0279762 3300049573 Bacteria 1163
679 Ga0501037_0548015 3300049573 Bacteria 781
680 Ga0501038_0028389 3300049574 Bacteria 4972
681 Ga0501039_0019204 3300049575 Bacteria 5244
682 Ga0501040_0037887 3300049576 Bacteria 3278
683 Ga0501040_0807945 3300049576 Bacteria 679
684 Ga0501040_1015047 3300049576 Bacteria 601
685 Ga0501041_0117997 3300049577 Bacteria 1648
686 Ga0501041_0124086 3300049577 Bacteria 1606
687 Ga0501041_0282758 3300049577 Bacteria 1044
688 Ga0501041_1083761 3300049577 Bacteria 516
689 Ga0501042_0025459 3300049578 Bacteria 4157
690 Ga0501042_0695524 3300049578 Bacteria 739
691 Ga0501046_0177008 3300049580 Bacteria 1597
692 Ga0501046_0344057 3300049580 Bacteria 1083
693 Ga0501046_0579510 3300049580 Bacteria 798
694 Ga0501048_0013524 3300049582 Bacteria 6056
695 Ga0501067_0235142 3300049583 Bacteria 1020
696 Ga0501068_0539271 3300049584 Bacteria 758
697 Ga0501069_0480172 3300049585 Bacteria 740
698 Ga0501070_0631261 3300049586 Bacteria 852
699 Ga0501070_1520096 3300049586 Unclassified 506
700 Ga0501071_0007684 3300049587 Bacteria 7105
701 Ga0501071_0667557 3300049587 Bacteria 800
702 Ga0501071_1044167 3300049587 Bacteria 631
703 Ga0501071_1483035 3300049587 Unclassified 524
704 Ga0501072_0002702 3300049588 Bacteria 13305
705 Ga0501072_0972036 3300049588 Unclassified 662
706 Ga0501072_0972872 3300049588 Bacteria 662
707 Ga0501074_0035759 3300049590 Bacteria 3599
708 Ga0501074_0661526 3300049590 Bacteria 738
709 Ga0501074_0695216 3300049590 Bacteria 718
710 Ga0501075_0005807 3300049591 Bacteria 8444
711 Ga0501075_0308410 3300049591 Bacteria 1206
712 Ga0501075_0447449 3300049591 Bacteria 985
713 Ga0501076_0469768 3300049592 Bacteria 1036
714 Ga0501076_0552870 3300049592 Bacteria 949
715 Ga0501076_0738496 3300049592 Bacteria 812
716 Ga0501076_1044600 3300049592 Bacteria 673
717 Ga0501077_0235197 3300049593 Bacteria 1165
718 Ga0501202_002175 3300049652 Bacteria 3266
719 Ga0501209_072150 3300049656 Unclassified 983
720 Ga0501216_065468 3300049660 Unclassified 741
721 Ga0501223_046411 3300049663 Unclassified 843
722 Ga0501233_006140 3300049668 Bacteria 2249
723 Ga0501235_006079 3300049669 Bacteria 2626
724 Ga0501235_049941 3300049669 Unclassified 968
725 Ga0501240_121312 3300049673 Unclassified 516
726 Ga0501256_007460 3300049685 Bacteria 1004
727 Ga0501221_002518 3300049704 Bacteria 3021
728 Ga0501225_0006450 3300049705 Bacteria 3425
729 Ga0501079_0087232 3300049741 Bacteria 2416
730 Ga0501079_0103228 3300049741 Bacteria 2211
731 Ga0501079_0472471 3300049741 Bacteria 985
732 Ga0501079_1501538 3300049741 Unclassified 530
733 Ga0501081_0013398 3300049743 Bacteria 5393
734 Ga0501081_0058497 3300049743 Bacteria 2667
735 Ga0501083_0215061 3300049744 Bacteria 1253
736 Ga0501268_001307 3300049765 Bacteria 3081
737 Ga0501268_179222 3300049765 Bacteria 504
738 Ga0501273_000125 3300049770 Bacteria 5077
739 Ga0501035_0083682 3300049822 Bacteria 2815
740 Ga0501035_1517989 3300049822 Unclassified 510
741 Ga0501044_0447983 3300049823 Bacteria 1198
742 Ga0501044_1552388 3300049823 Unclassified 527
743 Ga0501045_0080988 3300049824 Bacteria 2394
744 Ga0501045_0477377 3300049824 Bacteria 926
745 nmdc:mga05p37_108140_c1 3300050507 Bacteria 3421
746 nmdc:mga05p37_1676964_c1 3300050507 Bacteria 621
747 nmdc:mga05p37_42142_c1 3300050507 Bacteria 5608
748 nmdc:mga05p37_494037_c1 3300050507 Bacteria 1406
749 nmdc:mga05p37_7108_c1 3300050507 Bacteria 13194
750 nmdc:mga05p37_868_c1 3300050507 Bacteria 34033
751 nmdc:mga09592_133132_c1 3300050508 Bacteria 2140
752 nmdc:mga09592_161345_c1 3300050508 Bacteria 1937
753 nmdc:mga0qj67_189459_c1 3300050509 Bacteria 1671
754 nmdc:mga0qj67_562651_c1 3300050509 Bacteria 914
755 nmdc:mga0qj67_621235_c1 3300050509 Unclassified 863
756 nmdc:mga06r32_1022355_c1 3300050510 Bacteria 778
757 nmdc:mga06r32_1230757_c1 3300050510 Unclassified 694
758 nmdc:mga06r32_173699_c1 3300050510 Bacteria 2139
759 nmdc:mga06r32_1819397_c1 3300050510 Bacteria 544
760 nmdc:mga06r32_21623_c1 3300050510 Bacteria 5940
761 nmdc:mga06r32_553264_c1 3300050510 Bacteria 1124
762 nmdc:mga08y16_154193_c1 3300050511 Bacteria 2387
763 nmdc:mga08y16_505411_c1 3300050511 Bacteria 1227
764 nmdc:mga08y16_881975_c1 3300050511 Bacteria 882
765 nmdc:mga08y16_990443_c1 3300050511 Unclassified 821
766 nmdc:mga0n895_113211_c1 3300050512 Bacteria 2731
767 nmdc:mga0n895_130370_c1 3300050512 Unclassified 2539
768 nmdc:mga0n895_144509_c1 3300050512 Bacteria 2408
769 nmdc:mga0n895_187814_c1 3300050512 Bacteria 2098
770 nmdc:mga0n895_205390_c1 3300050512 Bacteria 2001
771 nmdc:mga0n895_236778_c1 3300050512 Bacteria 1853
772 nmdc:mga0n895_248398_c1 3300050512 Bacteria 1806
773 nmdc:mga0n895_30831_c1 3300050512 Bacteria 5129
774 nmdc:mga0n895_364171_c1 3300050512 Bacteria 1464
775 nmdc:mga0n895_39602_c1 3300050512 Bacteria 4574
776 nmdc:mga0n895_41648_c1 3300050512 Unclassified 4466
777 nmdc:mga0rr50_101701_c1 3300050513 Bacteria 2260
778 nmdc:mga0rr50_1158305_c1 3300050513 Unclassified 657
779 nmdc:mga0rr50_1795028_c1 3300050513 Unclassified 516
780 nmdc:mga0rr50_22322_c1 3300050513 Bacteria 4342
781 nmdc:mga0rr50_272594_c1 3300050513 Bacteria 1411
782 nmdc:mga0rr50_6273_c1 3300050513 Bacteria 7217
783 nmdc:mga0rr50_949963_c1 3300050513 Bacteria 733
784 nmdc:mga0rr50_98765_c1 3300050513 Bacteria 2289
785 nmdc:mga08x19_1135_c1 3300050514 Bacteria 16615
786 nmdc:mga08x19_13688_c1 3300050514 Bacteria 4909
787 nmdc:mga08x19_15219_c1 3300050514 Bacteria 4678
788 nmdc:mga08x19_2225_c1 3300050514 Bacteria 11841
789 nmdc:mga08x19_24862_c1 3300050514 Bacteria 3727
790 nmdc:mga08x19_438173_c1 3300050514 Bacteria 919
791 nmdc:mga08x19_707470_c1 3300050514 Bacteria 715
792 nmdc:mga08x19_7548_c1 3300050514 Bacteria 6461
793 nmdc:mga08x19_773839_c1 3300050514 Bacteria 682
794 nmdc:mga08x19_84859_c1 3300050514 Bacteria 2084
795 nmdc:mga08x19_988241_c1 3300050514 Bacteria 598
796 nmdc:mga08x19_99073_c1 3300050514 Bacteria 1932
797 nmdc:mga0a205_10780_c1 3300050515 Bacteria 8405
798 nmdc:mga0a205_246781_c1 3300050515 Bacteria 1666
799 nmdc:mga0a205_304288_c1 3300050515 Bacteria 1467
800 nmdc:mga0a205_378386_c1 3300050515 Bacteria 1281
801 nmdc:mga0a205_50682_c1 3300050515 Unclassified 4008
802 nmdc:mga0a205_56256_c1 3300050515 Bacteria 2475
803 nmdc:mga0a205_56973_c1 3300050515 Bacteria 3773
804 nmdc:mga0a205_73627_c1 3300050515 Unclassified 3300
805 nmdc:mga0a205_765760_c1 3300050515 Unclassified 814
806 Ga0495601_0396614 3300053077 Bacteria 895
807 Ga0495612_0562046 3300053078 Unclassified 526
808 Ga0495619_0140621 3300053085 Bacteria 1662
809 Ga0495619_0284345 3300053085 Bacteria 1146
810 Ga0501084_0040613 3300054114 Bacteria 3892
811 Ga0501084_0123389 3300054114 Bacteria 2179
812 Ga0590071_006613 3300059421 Bacteria 2755
813 Ga0590071_007605 3300059421 Bacteria 2562
814 Ga0590071_028754 3300059421 Bacteria 1321
815 Ga0590071_161028 3300059421 Unclassified 584
816 Ga0590074_004443 3300059423 Bacteria 2318
817 Ga0590074_038936 3300059423 Unclassified 853
818 Ga0590075_016182 3300059424 Bacteria 1834
819 Ga0590075_111079 3300059424 Unclassified 716
820 Ga0590077_011249 3300059426 Bacteria 1846
821 Ga0501082_0060944 3300060353 Bacteria 3248
822 Ga0501082_0300951 3300060353 Bacteria 1397
823 Ga0501082_1166540 3300060353 Bacteria 673
824 Ga0530510_0051459 3300061734 Unclassified 2976
825 Ga0530510_0484578 3300061734 Bacteria 937
826 Ga0070706_100113613
827 CNAas_1002750
828 Ga0065712_10455648
829 Ga0065715_10103934
830 Ga0070658_10849995
831 Ga0070676_10166556
832 Ga0070683_100075287
833 Ga0070683_100429050
834 Ga0070683_101128756
835 Ga0070690_100100402
836 Ga0070677_10049625
837 Ga0068869_100094681
838 Ga0070666_10957925
839 Ga0070680_100003363
840 Ga0070680_100021656
841 Ga0070680_100055087
842 Ga0070680_100119131
843 Ga0070680_101792620
844 Ga0070682_100630331
845 Ga0070660_100262983
846 Ga0070660_100431535
847 Ga0070689_100289260
848 Ga0070691_10077606
849 Ga0070691_10221303
850 Ga0070691_10328797
851 Ga0070687_100014007
852 Ga0070661_100585813
853 Ga0070661_100829453
854 Ga0070692_10035505
855 Ga0070692_10376816
856 Ga0070692_10635068
857 Ga0070668_100025764
858 Ga0070668_100403279
859 Ga0070669_100231649
860 Ga0070669_100320550
861 Ga0070669_100782836
862 Ga0070669_100946602
863 Ga0070675_100321829
864 Ga0070675_100716710
865 Ga0070675_101412245
866 Ga0070671_100010826
867 Ga0070674_100402181
868 Ga0070674_100440864
869 Ga0070673_100008660
870 Ga0070673_100165407
871 Ga0070673_101238311
872 Ga0070659_100335077
873 Ga0070659_102088271
874 Ga0070667_100516508
875 Ga0070667_100905810
876 Ga0070667_102079310
877 Ga0070703_10007838
878 Ga0070703_10014634
879 Ga0070703_10042819
880 Ga0070703_10057329
881 Ga0070703_10061064
882 Ga0070709_10000756
883 Ga0070709_10001089
884 Ga0070713_101052054
885 Ga0070710_10366988
886 Ga0070711_100000587
887 Ga0070711_100400439
888 Ga0070711_101035327
889 Ga0070705_100016368
890 Ga0070705_100033313
891 Ga0070705_100037012
892 Ga0070705_100051470
893 Ga0070705_100112805
894 Ga0070705_100255112
895 Ga0070705_100671787
896 Ga0070705_101214855
897 Ga0070705_101768965
898 Ga0070700_100517596
899 Ga0070700_101124770
900 Ga0070700_101265985
901 Ga0070694_100000374
902 Ga0070694_100009909
903 Ga0070694_100011765
904 Ga0070694_100049476
905 Ga0070694_100052718
906 Ga0070694_100056569
907 Ga0070694_100141881
908 Ga0070694_100206487
909 Ga0070694_100236817
910 Ga0070694_100358786
911 Ga0070694_101347276
912 Ga0070694_101391362
913 Ga0070708_100012323
914 Ga0070708_100021439
915 Ga0070708_100025627
916 Ga0070708_100057250
917 Ga0070708_100063598
918 Ga0070708_100079521
919 Ga0070708_100097486
920 Ga0070708_100176360
921 Ga0070708_100292227
922 Ga0070708_101137364
923 Ga0070708_101488635
924 Ga0070678_101342728
925 Ga0070662_100928229
926 Ga0070662_101282534
927 Ga0070662_101808689
928 Ga0070681_10113112
929 Ga0068867_100045576
930 Ga0068867_100613809
931 Ga0070706_100013002
932 Ga0070706_100022495
933 Ga0070706_100149294
934 Ga0070706_100214138
935 Ga0070706_100353172
936 Ga0070706_100797641
937 Ga0070706_100963648
938 Ga0070707_100049000
939 Ga0070707_100060864
940 Ga0070707_100073895
941 Ga0070707_100666959
942 Ga0070707_100976892
943 Ga0070707_101234883
944 Ga0070707_101237676
945 Ga0070698_100021638
946 Ga0070698_100278761
947 Ga0070699_100009657
948 Ga0070699_100015867
949 Ga0070699_100019610
950 Ga0070699_100041914
951 Ga0070699_100097486
952 Ga0070699_100180515
953 Ga0070699_100243215
954 Ga0070699_100475314
955 Ga0070699_100951485
956 Ga0070699_101399483
957 Ga0070679_100035645
958 Ga0070679_100036498
959 Ga0070679_100843366
960 Ga0070679_100968684
961 Ga0070684_100305473
962 Ga0070684_100489346
963 Ga0070684_101774869
964 Ga0070697_100003822
965 Ga0070697_100003996
966 Ga0070697_100041551
967 Ga0070697_100050640
968 Ga0070697_100102016
969 Ga0070697_100192088
970 Ga0070697_100201849
971 Ga0070697_100248780
972 Ga0070697_100318781
973 Ga0070697_100358154
974 Ga0070697_100566772
975 Ga0070697_100617483
976 Ga0070697_100679178
977 Ga0070697_101412675
978 Ga0070697_101688081
979 Ga0068853_100331931
980 Ga0070672_100066526
981 Ga0070672_100226269
982 Ga0070672_100507506
983 Ga0070672_100956484
984 Ga0070686_100077128
985 Ga0070686_101130040
986 Ga0070695_100006531
987 Ga0070695_100006633
988 Ga0070695_100013795
989 Ga0070695_100029648
990 Ga0070695_100039569
991 Ga0070695_100042029
992 Ga0070695_100191597
993 Ga0070695_100194634
994 Ga0070695_100208085
995 Ga0070695_100251128
996 Ga0070695_100505877
997 Ga0070695_100655473
998 Ga0070696_100004070
999 Ga0070696_100007899
1000 Ga0070696_100011984
1001 Ga0070696_100015433
1002 Ga0070696_100042186
1003 Ga0070696_100048219
1004 Ga0070696_100088860
1005 Ga0070696_100286419
1006 Ga0070696_100486468
1007 Ga0070696_100496805
1008 Ga0070696_101867829
1009 Ga0070693_100138707
1010 Ga0070693_100145530
1011 Ga0070665_100318706
1012 Ga0070665_102166572
1013 Ga0070704_100002886
1014 Ga0070704_100004974
1015 Ga0070704_100006942
1016 Ga0070704_100062587
1017 Ga0070704_100069789
1018 Ga0070704_100184481
1019 Ga0070704_100793301
1020 Ga0068855_100277218
1021 Ga0068855_100368574
1022 Ga0068855_100577295
1023 Ga0068855_100939577
1024 Ga0070664_100014141
1025 Ga0070664_100017396
1026 Ga0070664_100800012
1027 Ga0070664_100822242
1028 Ga0070664_101775347
1029 Ga0070664_101895837
1030 Ga0070664_102131535
1031 Ga0068857_101014542
1032 Ga0068857_101342769
1033 Ga0068856_101144963
1034 Ga0068852_102111895
1035 Ga0068859_100127177
1036 Ga0068859_100588376
1037 Ga0068859_100649380
1038 Ga0068864_100278379
1039 Ga0068861_100138095
1040 Ga0068870_10265994
1041 Ga0068870_10325454
1042 Ga0068860_100511243
1043 Ga0068860_102174628
1044 Ga0068862_100499642
1045 Ga0068862_100888464
1046 Ga0068862_101406602
1047 Ga0081538_10045689
1048 Ga0075432_10367852
1049 Ga0070715_10478279
1050 Ga0070716_100031552
1051 Ga0070716_101055347
1052 Ga0070716_101220275
1053 Ga0070712_100705936
1054 Ga0097621_101606754
1055 Ga0075428_100060813
1056 Ga0075428_100365546
1057 Ga0075428_100458416
1058 Ga0075428_100472435
1059 Ga0075428_100731342
1060 Ga0075430_100256360
1061 Ga0075430_100340824
1062 Ga0075430_100441689
1063 Ga0075430_100459877
1064 Ga0075430_100580531
1065 Ga0075430_100848747
1066 Ga0075431_100075739
1067 Ga0075431_100124247
1068 Ga0075431_100185671
1069 Ga0075431_101141650
1070 Ga0075433_10001942
1071 Ga0075433_10006932
1072 Ga0075433_10032263
1073 Ga0075433_10045748
1074 Ga0075433_10174043
1075 Ga0075433_10335080
1076 Ga0075433_11776126
1077 Ga0075434_100012684
1078 Ga0075434_100016827
1079 Ga0075434_100019562
1080 Ga0075434_100031953
1081 Ga0075434_100032321
1082 Ga0075434_100035549
1083 Ga0075434_100061882
1084 Ga0075434_100069880
1085 Ga0075434_100076870
1086 Ga0075434_100463681
1087 Ga0075434_100468823
1088 Ga0075429_100025311
1089 Ga0075429_101214935
1090 Ga0075429_101586857
1091 Ga0068865_100729414
1092 Ga0075436_100024262
1093 Ga0075436_100028318
1094 Ga0075436_100059565
1095 Ga0075436_100130593
1096 Ga0075436_100136141
1097 Ga0075436_100345096
1098 Ga0075436_100427871
1099 Ga0075436_100737722
1100 Ga0075436_100858896
1101 Ga0075436_101240985
1102 Ga0097620_100127178
1103 Ga0097620_100588342
1104 Ga0097620_100649448
1105 Ga0075435_100017192
1106 Ga0075435_100043446
1107 Ga0075435_100050941
1108 Ga0075435_100065653
1109 Ga0075435_100079165
1110 Ga0075435_101037893
1111 Ga0075435_101483785
1112 Ga0099794_10000020
1113 Ga0099794_10000514
1114 Ga0099794_10056915
1115 Ga0099794_10067493
1116 Ga0099794_10227144
1117 Ga0099794_10260760
1118 Ga0099794_10419593
1119 Ga0099795_10137463
1120 Ga0105240_11436399
1121 Ga0111539_10067073
1122 Ga0111539_10155180
1123 Ga0111539_10216787
1124 Ga0111539_11149989
1125 Ga0105245_11948058
1126 Ga0114129_10006231
1127 Ga0114129_10046785
1128 Ga0114129_10076182
1129 Ga0114129_10622299
1130 Ga0114129_10634967
1131 Ga0114129_10667367
1132 Ga0114129_11911611
1133 Ga0114129_12469503
1134 Ga0105241_10187470
1135 Ga0105241_10337330
1136 Ga0105241_10622428
1137 Ga0105242_12499909
1138 Ga0105248_10007125
1139 Ga0105248_10118128
1140 Ga0105248_11173605
1141 Ga0105237_10321801
1142 Ga0105238_10120362
1143 Ga0099796_10287218
1144 Ga0105239_12904112
1145 Ga0157373_10117891
1146 Ga0157370_11179733
1147 Ga0157370_11592657
1148 Ga0157370_11767513
1149 Ga0157369_10074857
1150 Ga0157369_10260757
1151 Ga0157369_12691757
1152 Ga0157378_10038947
1153 Ga0157372_10028625
1154 Ga0157372_10902420
1155 Ga0157372_10950679
1156 Ga0157372_12008785
1157 Ga0157375_10679721
1158 Ga0157375_10798743
1159 Ga0157380_10509888
1160 Ga0157380_10769334
1161 Ga0157380_13038627
1162 Ga0157379_10797714
1163 Ga0157379_11364458
1164 Ga0157376_10407175
1165 Ga0157376_11719177
1166 Ga0157376_12161317
1167 Ga0163161_10740282
1168 Ga0206356_10060205
1169 Ga0206354_11236316
1170 Ga0206353_11783127
1171 Ga0207697_10231381
1172 Ga0207653_10000048
1173 Ga0207653_10002567
1174 Ga0207653_10031054
1175 Ga0207653_10056107
1176 Ga0207653_10078659
1177 Ga0207682_10202902
1178 Ga0207692_10808031
1179 Ga0207680_10825301
1180 Ga0207685_10390610
1181 Ga0207699_10003770
1182 Ga0207699_10042133
1183 Ga0207645_10134260
1184 Ga0207645_10473400
1185 Ga0207643_10224233
1186 Ga0207643_10263860
1187 Ga0207684_10016138
1188 Ga0207684_10022695
1189 Ga0207684_10028164
1190 Ga0207684_10074905
1191 Ga0207684_10079023
1192 Ga0207684_10096983
1193 Ga0207684_10337409
1194 Ga0207684_10827772
1195 Ga0207684_11041027
1196 Ga0207654_10170512
1197 Ga0207654_10738839
1198 Ga0207707_10014760
1199 Ga0207695_10001308
1200 Ga0207695_10065149
1201 Ga0207695_10292591
1202 Ga0207695_10294553
1203 Ga0207671_10029457
1204 Ga0207693_10506577
1205 Ga0207663_10004006
1206 Ga0207663_10254312
1207 Ga0207660_10006646
1208 Ga0207660_10006991
1209 Ga0207660_10026173
1210 Ga0207660_10299332
1211 Ga0207660_10306000
1212 Ga0207662_10103273
1213 Ga0207662_10551375
1214 Ga0207657_10042665
1215 Ga0207649_10956571
1216 Ga0207652_10018755
1217 Ga0207652_10490579
1218 Ga0207652_11321110
1219 Ga0207646_10001595
1220 Ga0207646_10001606
1221 Ga0207646_10035861
1222 Ga0207646_10136553
1223 Ga0207646_10150963
1224 Ga0207646_10163930
1225 Ga0207646_10976423
1226 Ga0207681_10310387
1227 Ga0207681_10454010
1228 Ga0207681_10468812
1229 Ga0207681_10503187
1230 Ga0207694_10594639
1231 Ga0207659_10330522
1232 Ga0207659_11022254
1233 Ga0207664_10063099
1234 Ga0207644_10006110
1235 Ga0207690_10142199
1236 Ga0207690_10953882
1237 Ga0207706_10487587
1238 Ga0207670_10705149
1239 Ga0207669_10306994
1240 Ga0207665_10001439
1241 Ga0207665_10124360
1242 Ga0207691_10170838
1243 Ga0207691_10475602
1244 Ga0207691_10553745
1245 Ga0207711_10088716
1246 Ga0207711_10095281
1247 Ga0207689_10799375
1248 Ga0207661_10050067
1249 Ga0207661_10251258
1250 Ga0207661_10341497
1251 Ga0207661_10694385
1252 Ga0207679_10113335
1253 Ga0207679_10119113
1254 Ga0207679_10206604
1255 Ga0207679_11122623
1256 Ga0207667_10204681
1257 Ga0207667_12065741
1258 Ga0207651_10058044
1259 Ga0207651_10060315
1260 Ga0207651_11400736
1261 Ga0207668_10059020
1262 Ga0207658_10220669
1263 Ga0207639_10381075
1264 Ga0207708_10030823
1265 Ga0207708_11886415
1266 Ga0207702_10256298
1267 Ga0207702_11501234
1268 Ga0207702_12484082
1269 Ga0207648_10084372
1270 Ga0207648_10733417
1271 Ga0207648_11986283
1272 Ga0207674_10337953
1273 Ga0207674_10583146
1274 Ga0207674_10962523
1275 Ga0207675_100127483
1276 Ga0207675_100217556
1277 Ga0207675_102401063
1278 Ga0207683_10375144
1279 Ga0209967_1034263
1280 Ga0209588_1000760
1281 Ga0209588_1001980
1282 Ga0209588_1094060
1283 Ga0209974_10334275
1284 Ga0268266_10863000
1285 Ga0268265_10522718
1286 Ga0268264_10228199
1287 Ga0268264_12115404
1288 Ga0307408_100168569
1289 Ga0307408_100313535
1290 Ga0307405_10017572
1291 Ga0307405_10749066
1292 Ga0307413_10000395
1293 Ga0307413_10003235
1294 Ga0307413_10006010
1295 Ga0307413_10010080
1296 Ga0307413_10113015
1297 Ga0307413_10204590
1298 Ga0307410_10003941
1299 Ga0307410_10015487
1300 Ga0307410_10018096
1301 Ga0307410_10026290
1302 Ga0307410_10029876
1303 Ga0307410_10036361
1304 Ga0307410_10074776
1305 Ga0307406_10009486
1306 Ga0307406_10013226
1307 Ga0307406_10020568
1308 Ga0307406_10114015
1309 Ga0307406_10404380
1310 Ga0307407_10040178
1311 Ga0307407_10057919
1312 Ga0307407_10088864
1313 Ga0307407_10140751
1314 Ga0307407_10280182
1315 Ga0307407_11558416
1316 Ga0307412_10066833
1317 Ga0307412_10365578
1318 Ga0307409_100000311
1319 Ga0307409_100269756
1320 Ga0307409_100529728
1321 Ga0307416_100002453
1322 Ga0307416_100011376
1323 Ga0307416_100013045
1324 Ga0307416_100029166
1325 Ga0307416_100103846
1326 Ga0307416_100226366
1327 Ga0307416_100279026
1328 Ga0307416_102214136
1329 Ga0307414_10051219
1330 Ga0307414_10066667
1331 Ga0307414_10073144
1332 Ga0307414_10204531
1333 Ga0307411_10007769
1334 Ga0307411_10017042
1335 Ga0307411_10023723
1336 Ga0307411_10040831
1337 Ga0307411_10314911
1338 Ga0307415_100001413
1339 Ga0307415_100019078
1340 Ga0307415_100094742
1341 Ga0307415_101991245
1342 Ga0373926_0256992
1343 Ga0373934_0222889
1344 Ga0373957_0058336
1345 Ga0373955_0788383
1346 Ga0373931_0171115
1347 Ga0373935_0951464
1348 Ga0373927_0515177
1349 Ga0373933_0459849
1350 Ga0373937_0080482
1351 Ga0373937_0096633
1352 Ga0373937_0512312
1353 Ga0439439_0009132
1354 Ga0439439_0085214
1355 Ga0439465_0387881
1356 Ga0439433_0155633
1357 Ga0439448_0002243
1358 Ga0439449_0123938
1359 Ga0439457_054359
1360 Ga0439462_0026506
1361 Ga0450894_037652
1362 Ga0450898_019178
1363 Ga0450898_022396
1364 Ga0450910_030708
1365 Ga0439444_0093510
1366 Ga0439464_0110373
1367 Ga0451577_0006635
1368 Ga0451577_0245693
1369 Ga0451577_0622266
1370 Ga0453683_0075339
1371 Ga0453683_0081311
1372 Ga0453683_0094721
1373 Ga0453683_0116411
1374 Ga0453683_0434694
1375 Ga0453683_0784974
1376 Ga0453683_0955786
1377 Ga0453683_0993751
1378 Ga0466961_0854049
1379 Ga0451576_0003514
1380 Ga0451576_0016436
1381 Ga0451576_0018380
1382 Ga0451576_0033227
1383 Ga0451576_0040981
1384 Ga0451576_0505205
1385 Ga0451576_0673685
1386 Ga0451576_2167015
1387 Ga0466967_1648047
1388 Ga0495592_0226121
1389 Ga0495592_0476349
1390 Ga0495592_0811034
1391 Ga0495603_0284475
1392 Ga0495603_0543274
1393 Ga0495641_0009016
1394 Ga0495651_0021884
1395 Ga0495651_0036851
1396 Ga0495653_0030456
1397 Ga0495580_0192878
1398 Ga0495580_0427396
1399 Ga0495582_0021300
1400 Ga0495639_0009206
1401 Ga0495639_0058147
1402 Ga0495662_0058019
1403 Ga0495662_0195711
1404 Ga0495664_0011225
1405 Ga0495664_0411816
1406 Ga0495585_0459769
1407 Ga0495594_0002354
1408 Ga0495608_0155559
1409 Ga0495618_0010773
1410 Ga0495618_0081279
1411 Ga0495628_0070927
1412 Ga0495628_0142192
1413 Ga0495630_0003371
1414 Ga0495630_0894258
1415 Ga0495663_0025983
1416 Ga0495663_0359023
1417 Ga0495666_0003208
1418 Ga0495642_0309084
1419 Ga0495652_0118261
1420 Ga0495665_0041028
1421 Ga0495665_0459584
1422 Ga0495640_0002922
1423 Ga0495640_0004600
1424 Ga0495586_0002778
1425 Ga0495586_0199627
1426 Ga0495587_0042553
1427 Ga0495587_0052897
1428 Ga0495609_0036496
1429 Ga0495621_0017723
1430 Ga0495621_0030548
1431 Ga0495645_0328103
1432 Ga0495622_0438737
1433 Ga0495633_0327137
1434 Ga0495667_0049907
1435 Ga0495634_0023639
1436 Ga0495634_0144176
1437 Ga0495635_0024065
1438 Ga0495635_0514424
1439 Ga0495659_0064512
1440 Ga0495659_0268803
1441 Ga0495588_0153283
1442 Ga0495599_0007708
1443 Ga0495646_0034195
1444 Ga0495647_0032796
1445 Ga0495658_0146282
1446 Ga0495658_0247733
1447 Ga0495658_0881984
1448 Ga0495669_0064059
1449 Ga0495613_0132127
1450 Ga0495613_0219423
1451 Ga0495624_0035815
1452 Ga0495624_0055767
1453 Ga0495670_0432601
1454 Ga0495600_0505285
1455 Ga0495604_0158689
1456 Ga0495636_0228142
1457 Ga0495636_0269637
1458 Ga0495674_0006916
1459 Ga0495674_0029322
1460 Ga0495676_0046159
1461 Ga0495680_0007138
1462 Ga0495680_0332890
1463 Ga0495675_0101722
1464 Ga0495675_0451359
1465 Ga0495677_0170100
1466 Ga0495684_0020270
1467 Ga0495684_0191808
1468 Ga0495593_0185353
1469 Ga0495602_0272933
1470 Ga0495614_0108607
1471 Ga0496100_0010018
1472 Ga0496100_1236979
1473 Ga0496101_0055151
1474 Ga0496101_0120991
1475 Ga0496102_0086415
1476 Ga0496102_0490837
1477 Ga0496102_0800053
1478 Ga0496103_0006303
1479 Ga0496104_0023440
1480 Ga0496105_0262208
1481 Ga0496106_0016439
1482 Ga0496106_1411438
1483 Ga0496107_0049155
1484 Ga0496108_0030800
1485 Ga0496108_0443913
1486 Ga0496108_1453374
1487 Ga0496109_0042162
1488 Ga0496109_0264377
1489 Ga0496110_0008866
1490 Ga0496111_0168613
1491 Ga0496112_0285975
1492 Ga0496113_0022055
1493 Ga0496115_0001686
1494 Ga0496115_0046891
1495 Ga0501303_064593
1496 Ga0501031_0076645
1497 Ga0501031_0458421
1498 Ga0501032_0098476
1499 Ga0501033_0072913
1500 Ga0501033_0564898
1501 Ga0501036_0016908
1502 Ga0501036_1457834
1503 Ga0501037_0279762
1504 Ga0501037_0548015
1505 Ga0501038_0028389
1506 Ga0501039_0019204
1507 Ga0501040_0037887
1508 Ga0501040_0807945
1509 Ga0501040_1015047
1510 Ga0501041_0117997
1511 Ga0501041_0124086
1512 Ga0501041_0282758
1513 Ga0501041_1083761
1514 Ga0501042_0025459
1515 Ga0501042_0695524
1516 Ga0501046_0177008
1517 Ga0501046_0344057
1518 Ga0501046_0579510
1519 Ga0501048_0013524
1520 Ga0501067_0235142
1521 Ga0501068_0539271
1522 Ga0501069_0480172
1523 Ga0501070_0631261
1524 Ga0501070_1520096
1525 Ga0501071_0007684
1526 Ga0501071_0667557
1527 Ga0501071_1044167
1528 Ga0501071_1483035
1529 Ga0501072_0002702
1530 Ga0501072_0972036
1531 Ga0501072_0972872
1532 Ga0501074_0035759
1533 Ga0501074_0661526
1534 Ga0501074_0695216
1535 Ga0501075_0005807
1536 Ga0501075_0308410
1537 Ga0501075_0447449
1538 Ga0501076_0469768
1539 Ga0501076_0552870
1540 Ga0501076_0738496
1541 Ga0501076_1044600
1542 Ga0501077_0235197
1543 Ga0501202_002175
1544 Ga0501209_072150
1545 Ga0501216_065468
1546 Ga0501223_046411
1547 Ga0501233_006140
1548 Ga0501235_006079
1549 Ga0501235_049941
1550 Ga0501240_121312
1551 Ga0501256_007460
1552 Ga0501221_002518
1553 Ga0501225_0006450
1554 Ga0501079_0087232
1555 Ga0501079_0103228
1556 Ga0501079_0472471
1557 Ga0501079_1501538
1558 Ga0501081_0013398
1559 Ga0501081_0058497
1560 Ga0501083_0215061
1561 Ga0501268_001307
1562 Ga0501268_179222
1563 Ga0501273_000125
1564 Ga0501035_0083682
1565 Ga0501035_1517989
1566 Ga0501044_0447983
1567 Ga0501044_1552388
1568 Ga0501045_0080988
1569 Ga0501045_0477377
1570 nmdc:mga05p37_108140_c1
1571 nmdc:mga05p37_1676964_c1
1572 nmdc:mga05p37_42142_c1
1573 nmdc:mga05p37_494037_c1
1574 nmdc:mga05p37_7108_c1
1575 nmdc:mga05p37_868_c1
1576 nmdc:mga09592_133132_c1
1577 nmdc:mga09592_161345_c1
1578 nmdc:mga0qj67_189459_c1
1579 nmdc:mga0qj67_562651_c1
1580 nmdc:mga0qj67_621235_c1
1581 nmdc:mga06r32_1022355_c1
1582 nmdc:mga06r32_1230757_c1
1583 nmdc:mga06r32_173699_c1
1584 nmdc:mga06r32_1819397_c1
1585 nmdc:mga06r32_21623_c1
1586 nmdc:mga06r32_553264_c1
1587 nmdc:mga08y16_154193_c1
1588 nmdc:mga08y16_505411_c1
1589 nmdc:mga08y16_881975_c1
1590 nmdc:mga08y16_990443_c1
1591 nmdc:mga0n895_113211_c1
1592 nmdc:mga0n895_130370_c1
1593 nmdc:mga0n895_144509_c1
1594 nmdc:mga0n895_187814_c1
1595 nmdc:mga0n895_205390_c1
1596 nmdc:mga0n895_236778_c1
1597 nmdc:mga0n895_248398_c1
1598 nmdc:mga0n895_30831_c1
1599 nmdc:mga0n895_364171_c1
1600 nmdc:mga0n895_39602_c1
1601 nmdc:mga0n895_41648_c1
1602 nmdc:mga0rr50_101701_c1
1603 nmdc:mga0rr50_1158305_c1
1604 nmdc:mga0rr50_1795028_c1
1605 nmdc:mga0rr50_22322_c1
1606 nmdc:mga0rr50_272594_c1
1607 nmdc:mga0rr50_6273_c1
1608 nmdc:mga0rr50_949963_c1
1609 nmdc:mga0rr50_98765_c1
1610 nmdc:mga08x19_1135_c1
1611 nmdc:mga08x19_13688_c1
1612 nmdc:mga08x19_15219_c1
1613 nmdc:mga08x19_2225_c1
1614 nmdc:mga08x19_24862_c1
1615 nmdc:mga08x19_438173_c1
1616 nmdc:mga08x19_707470_c1
1617 nmdc:mga08x19_7548_c1
1618 nmdc:mga08x19_773839_c1
1619 nmdc:mga08x19_84859_c1
1620 nmdc:mga08x19_988241_c1
1621 nmdc:mga08x19_99073_c1
1622 nmdc:mga0a205_10780_c1
1623 nmdc:mga0a205_246781_c1
1624 nmdc:mga0a205_304288_c1
1625 nmdc:mga0a205_378386_c1
1626 nmdc:mga0a205_50682_c1
1627 nmdc:mga0a205_56256_c1
1628 nmdc:mga0a205_56973_c1
1629 nmdc:mga0a205_73627_c1
1630 nmdc:mga0a205_765760_c1
1631 Ga0495601_0396614
1632 Ga0495612_0562046
1633 Ga0495619_0140621
1634 Ga0495619_0284345
1635 Ga0501084_0040613
1636 Ga0501084_0123389
1637 Ga0590071_006613
1638 Ga0590071_007605
1639 Ga0590071_028754
1640 Ga0590071_161028
1641 Ga0590074_004443
1642 Ga0590074_038936
1643 Ga0590075_016182
1644 Ga0590075_111079
1645 Ga0590077_011249
1646 Ga0501082_0060944
1647 Ga0501082_0300951
1648 Ga0501082_1166540
1649 Ga0530510_0051459
1650 Ga0530510_0484578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v8f-assembly1.cif.gz_B crystal structure of ube2l3 bound to hoip ring1 domain. 0.7766 11 40
2gvi-assembly1.cif.gz_A crystal structure of a putative formylmethanofuran dehydrogenase subunit e (ta1109) from thermoplasma acidophilum at 1.87 a resolution 0.7705 7 42
6tda-assembly1.cif.gz_L structure of swi/snf chromatin remodeler rsc bound to a nucleosome 0.77 11 44
6az3-assembly1.cif.gz_m cryo-em structure of of the large subunit of leishmania ribosome bound to paromomycin 0.739 25 38
6psq-assembly1.cif.gz_N escherichia coli rna polymerase closed complex (trpc) with trar and rpst p2 promoter 0.7268 25 60
ID Description Score Start End Superfamily
2gviA03 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.7866 8 42 3.30.60.20
af_Q84RQ9_108_204_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7602 8 40 3.30.40.10
2gviA03 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.7547 8 42 3.30.60.20
af_Q9N3Z0_154_205_3.30.60.90 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Zinc finger, ZZ-type 0.7434 13 45 3.30.60.90
af_Q96EP0_695_787_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7427 11 40 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A1Q7Q753-F1-model_v4 B box-type domain-containing protein 0.9913 3 55
AF-A0A838P835-F1-model_v4 DUF1610 domain-containing protein 0.9878 5 51
AF-A0A1G0LRV6-F1-model_v4 B box-type domain-containing protein 0.9875 8 56
AF-A0A7W1KK42-F1-model_v4 B box-type domain-containing protein 0.9778 6 55
AF-A0A0S8B8Y7-F1-model_v4 B box-type domain-containing protein 0.9662 7 61

Map