F482301
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 822 | 429 | 777 | 444 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10012640|Ga0105241_100126404 |
| Length | 451 |
| Sequence | MSTTTTVNFQPQLDKLRNQISELVQQYAEIAHSPKPFVPGQSAVPVSGKVIGAKELQLMVDASLDGWLTTGRFNAMFEERLAKFLGVKYLITVNSGSSANLVAFSTLTSPKLGDRAIKQGDEVIGVAAGFPTTVNPIIQFGAVPVFVDVDLATHNIDASKIEAAITPKTKAIMLAHSLGNPFNLDVVTALCKKYNLWLVEDCCDALGATYNGQMVGTFGDIATLSFYPAHHITMGEGGAVFTNNAELKLIAESFRDWGRDCYCPPGKDNTCDKRFCWTKKDLGGDLPDGYDHKYTYSHLGYNLKISDMQAACALGQMDRLEEFIAKRRANFSYLKNRLASCADFLHLPEATPNSEPSWFGFPLILKESSGVKRTDLINYLEENKIGTRLLFAGNLTKQPYMANRNFRVSGELTNTDVVMNQTFWLGTFPGLGQEQLDYIAGKLEEFFGVGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 2 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 3 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 4 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 5 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 6 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 7 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 8 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 9 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 10 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 11 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 12 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 13 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 14 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 15 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 16 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 17 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 18 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 19 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 20 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 21 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 22 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 23 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 24 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 25 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 26 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 27 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 28 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 29 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 30 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 31 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 32 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 33 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 34 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 35 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 36 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 37 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 38 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 39 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 40 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 41 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 42 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 43 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 47 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 48 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 49 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 50 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 51 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 61 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 89 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 163 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 272 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 273 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 277 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 278 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 279 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 280 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 281 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 282 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 283 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 284 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 287 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 297 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 371 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 372 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 373 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 374 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 375 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 376 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 377 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 378 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 380 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 385 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 387 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 403 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 405 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 406 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 407 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 408 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 410 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 411 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 412 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 414 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 419 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 421 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 422 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 423 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 424 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 425 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 426 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 427 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 428 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 429 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.53 |
| Metatranscriptomes | 0.12 |
| Isolates | 5.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.53 |
| Nodule | 1.58 |
| Rhizoplane | 2.8 |
| Rhizosphere | 74.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1009690 | 3300001904 | Bacteria | 1583 |
| 2 | JGI24741J21665_1008137 | 3300001915 | Bacteria | 1993 |
| 3 | JGI24739J22299_10000336 | 3300001989 | Bacteria | 15990 |
| 4 | JGI24735J21928_10001316 | 3300002067 | Bacteria | 8772 |
| 5 | JGI24735J21928_10002016 | 3300002067 | Bacteria | 7144 |
| 6 | JGI25156J39149_1000313 | 3300002705 | Bacteria | 32091 |
| 7 | JGI25162J39368_1000120 | 3300002737 | Bacteria | 86031 |
| 8 | JGI25154J39366_1000711 | 3300002738 | Bacteria | 15124 |
| 9 | JGI25158J39367_1000009 | 3300002739 | Bacteria | 53723 |
| 10 | JGI25159J45721_1000778 | 3300002987 | Bacteria | 13861 |
| 11 | JGI25159J45721_1002167 | 3300002987 | Bacteria | 7649 |
| 12 | JGI25151J46595_10001656 | 3300003187 | Bacteria | 14617 |
| 13 | rootH1_10023399 | 3300003316 | Bacteria | 14787 |
| 14 | rootH1_10023399 | 3300003323 | Bacteria | 18842 |
| 15 | rootH2_10019449 | 3300003320 | Bacteria | 18026 |
| 16 | rootL2_10002855 | 3300003322 | Bacteria | 17523 |
| 17 | rootL2_10017982 | 3300003322 | Bacteria | 5916 |
| 18 | rootL2_10215171 | 3300003322 | Bacteria | 5311 |
| 19 | JGI25161J50226_1000115 | 3300003374 | Bacteria | 62500 |
| 20 | Ga0006562J51391_1008496 | 3300003578 | Bacteria | 16204 |
| 21 | Ga0055529_1000274 | 3300003763 | Bacteria | 61422 |
| 22 | Ga0055526_1000085 | 3300003771 | Bacteria | 86760 |
| 23 | Ga0055537_1000295 | 3300003773 | Bacteria | 35299 |
| 24 | Ga0055524_1000437 | 3300003775 | Bacteria | 34910 |
| 25 | Ga0055524_1004778 | 3300003775 | Bacteria | 6184 |
| 26 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 27 | Ga0055534_1000047 | 3300003784 | Bacteria | 94932 |
| 28 | Ga0055528_1000049 | 3300003790 | Bacteria | 94814 |
| 29 | Ga0055530_10002636 | 3300003791 | Bacteria | 11240 |
| 30 | Ga0055543_1000094 | 3300004625 | Bacteria | 78040 |
| 31 | Ga0055543_1001560 | 3300004625 | Bacteria | 8872 |
| 32 | Ga0065165_1000059 | 3300005262 | Bacteria | 182314 |
| 33 | Ga0065165_1000167 | 3300005262 | Bacteria | 115630 |
| 34 | Ga0065165_1000434 | 3300005262 | Bacteria | 65848 |
| 35 | Ga0065165_1005158 | 3300005262 | Bacteria | 7555 |
| 36 | Ga0065165_1014879 | 3300005262 | Bacteria | 2998 |
| 37 | Ga0065165_1019668 | 3300005262 | Bacteria | 2401 |
| 38 | Ga0065165_1019848 | 3300005262 | Bacteria | 2385 |
| 39 | Ga0065714_10068111 | 3300005288 | Bacteria | 4953 |
| 40 | Ga0065704_10075142 | 3300005289 | Bacteria | 5769 |
| 41 | Ga0070658_10000596 | 3300005327 | Bacteria | 31295 |
| 42 | Ga0070658_10001501 | 3300005327 | Bacteria | 19811 |
| 43 | Ga0070683_100018434 | 3300005329 | Bacteria | 6183 |
| 44 | Ga0070690_100020398 | 3300005330 | Bacteria | 4037 |
| 45 | Ga0070670_100047220 | 3300005331 | Bacteria | 3704 |
| 46 | Ga0070677_10066497 | 3300005333 | Bacteria | 1503 |
| 47 | Ga0070666_10006119 | 3300005335 | Bacteria | 7397 |
| 48 | Ga0070680_100038229 | 3300005336 | Bacteria | 3881 |
| 49 | Ga0068868_100028844 | 3300005338 | Bacteria | 4247 |
| 50 | Ga0068868_100032871 | 3300005338 | Bacteria | 3993 |
| 51 | Ga0070660_100000537 | 3300005339 | Bacteria | 25342 |
| 52 | Ga0070660_100003070 | 3300005339 | Bacteria | 11480 |
| 53 | Ga0070687_100013667 | 3300005343 | Bacteria | 3624 |
| 54 | Ga0070661_100130914 | 3300005344 | Bacteria | 1884 |
| 55 | Ga0070668_100000850 | 3300005347 | Bacteria | 21166 |
| 56 | Ga0070668_100002351 | 3300005347 | Bacteria | 13898 |
| 57 | Ga0070668_100035103 | 3300005347 | Bacteria | 3822 |
| 58 | Ga0070669_100000372 | 3300005353 | Bacteria | 34677 |
| 59 | Ga0070669_100000973 | 3300005353 | Bacteria | 20930 |
| 60 | Ga0070669_100001543 | 3300005353 | Bacteria | 16655 |
| 61 | Ga0070669_100006723 | 3300005353 | Bacteria | 8280 |
| 62 | Ga0070675_100031164 | 3300005354 | Bacteria | 4309 |
| 63 | Ga0070675_100234542 | 3300005354 | Bacteria | 1602 |
| 64 | Ga0070671_100000287 | 3300005355 | Bacteria | 34334 |
| 65 | Ga0070671_100001504 | 3300005355 | Bacteria | 17449 |
| 66 | Ga0070674_100061175 | 3300005356 | Bacteria | 2627 |
| 67 | Ga0070673_100067301 | 3300005364 | Bacteria | 2864 |
| 68 | Ga0070673_100164007 | 3300005364 | Bacteria | 1892 |
| 69 | Ga0070659_100002095 | 3300005366 | Bacteria | 14218 |
| 70 | Ga0070659_100008373 | 3300005366 | Bacteria | 7554 |
| 71 | Ga0070659_100008464 | 3300005366 | Bacteria | 7518 |
| 72 | Ga0070667_100000298 | 3300005367 | Bacteria | 55786 |
| 73 | Ga0070667_100027529 | 3300005367 | Bacteria | 4730 |
| 74 | Ga0070701_10014086 | 3300005438 | Bacteria | 3657 |
| 75 | Ga0070700_100001055 | 3300005441 | Bacteria | 13639 |
| 76 | Ga0070700_100041253 | 3300005441 | Bacteria | 2829 |
| 77 | Ga0070694_100040557 | 3300005444 | Bacteria | 3103 |
| 78 | Ga0070694_100072341 | 3300005444 | Bacteria | 2378 |
| 79 | Ga0070663_100000402 | 3300005455 | Bacteria | 22670 |
| 80 | Ga0070663_100073949 | 3300005455 | Bacteria | 2487 |
| 81 | Ga0070662_100010169 | 3300005457 | Bacteria | 6167 |
| 82 | Ga0070662_100023027 | 3300005457 | Bacteria | 4274 |
| 83 | Ga0070662_100075240 | 3300005457 | Bacteria | 2500 |
| 84 | Ga0070662_100084037 | 3300005457 | Bacteria | 2377 |
| 85 | Ga0070681_10204068 | 3300005458 | Bacteria | 1894 |
| 86 | Ga0068867_100000453 | 3300005459 | Bacteria | 27171 |
| 87 | Ga0068867_100025227 | 3300005459 | Bacteria | 4264 |
| 88 | Ga0068867_100127973 | 3300005459 | Bacteria | 1970 |
| 89 | Ga0070685_10020109 | 3300005466 | Bacteria | 3611 |
| 90 | Ga0070679_100029494 | 3300005530 | Bacteria | 5413 |
| 91 | Ga0070684_100019423 | 3300005535 | Bacteria | 5621 |
| 92 | Ga0068853_100026442 | 3300005539 | Bacteria | 4872 |
| 93 | Ga0068853_100100685 | 3300005539 | Bacteria | 2555 |
| 94 | Ga0070672_100008613 | 3300005543 | Bacteria | 6988 |
| 95 | Ga0070672_100082270 | 3300005543 | Bacteria | 2583 |
| 96 | Ga0070686_100013387 | 3300005544 | Bacteria | 4695 |
| 97 | Ga0070665_100000152 | 3300005548 | Bacteria | 126430 |
| 98 | Ga0070665_100114759 | 3300005548 | Bacteria | 2696 |
| 99 | Ga0070704_100029675 | 3300005549 | Bacteria | 3655 |
| 100 | Ga0068855_100001138 | 3300005563 | Bacteria | 32970 |
| 101 | Ga0068855_100001663 | 3300005563 | Bacteria | 27798 |
| 102 | Ga0068855_100003503 | 3300005563 | Bacteria | 19223 |
| 103 | Ga0068855_100009842 | 3300005563 | Bacteria | 11534 |
| 104 | Ga0068855_100034874 | 3300005563 | Bacteria | 5996 |
| 105 | Ga0070664_100014244 | 3300005564 | Bacteria | 6486 |
| 106 | Ga0070664_100032833 | 3300005564 | Bacteria | 4343 |
| 107 | Ga0068857_100130081 | 3300005577 | Bacteria | 2270 |
| 108 | Ga0068854_100001405 | 3300005578 | Bacteria | 14525 |
| 109 | Ga0068854_100004322 | 3300005578 | Bacteria | 8956 |
| 110 | Ga0068854_100038590 | 3300005578 | Bacteria | 3360 |
| 111 | Ga0068854_100107715 | 3300005578 | Bacteria | 2098 |
| 112 | Ga0068856_100023697 | 3300005614 | Bacteria | 5968 |
| 113 | Ga0068852_100005716 | 3300005616 | Bacteria | 8921 |
| 114 | Ga0068852_100049228 | 3300005616 | Bacteria | 3604 |
| 115 | Ga0068852_100065216 | 3300005616 | Bacteria | 3176 |
| 116 | Ga0068859_100005526 | 3300005617 | Bacteria | 12872 |
| 117 | Ga0068859_100042590 | 3300005617 | Bacteria | 4561 |
| 118 | Ga0068864_100070993 | 3300005618 | Bacteria | 3031 |
| 119 | Ga0068866_10004108 | 3300005718 | Bacteria | 5972 |
| 120 | Ga0068861_100045828 | 3300005719 | Bacteria | 3295 |
| 121 | Ga0068851_10091645 | 3300005834 | Bacteria | 1600 |
| 122 | Ga0068863_100003486 | 3300005841 | Bacteria | 15521 |
| 123 | Ga0068863_100007924 | 3300005841 | Bacteria | 10383 |
| 124 | Ga0068858_100022919 | 3300005842 | Bacteria | 5824 |
| 125 | Ga0068858_100033556 | 3300005842 | Bacteria | 4761 |
| 126 | Ga0068860_100000412 | 3300005843 | Bacteria | 55786 |
| 127 | Ga0068860_100001988 | 3300005843 | Bacteria | 21589 |
| 128 | Ga0068860_100009213 | 3300005843 | Bacteria | 9812 |
| 129 | Ga0068860_100016090 | 3300005843 | Bacteria | 7297 |
| 130 | Ga0068860_100054861 | 3300005843 | Bacteria | 3788 |
| 131 | Ga0068860_100101217 | 3300005843 | Bacteria | 2749 |
| 132 | Ga0075363_100015353 | 3300006048 | Bacteria | 3763 |
| 133 | Ga0075362_10000999 | 3300006177 | Bacteria | 8674 |
| 134 | Ga0075362_10023250 | 3300006177 | Bacteria | 2620 |
| 135 | Ga0075367_10003220 | 3300006178 | Bacteria | 7716 |
| 136 | Ga0075367_10057980 | 3300006178 | Bacteria | 2303 |
| 137 | Ga0075369_10000158 | 3300006186 | Bacteria | 19172 |
| 138 | Ga0075366_10000031 | 3300006195 | Bacteria | 49332 |
| 139 | Ga0075366_10014126 | 3300006195 | Bacteria | 4556 |
| 140 | Ga0075366_10019499 | 3300006195 | Bacteria | 3925 |
| 141 | Ga0075366_10028312 | 3300006195 | Bacteria | 3289 |
| 142 | Ga0097621_100015998 | 3300006237 | Bacteria | 5656 |
| 143 | Ga0075370_10003436 | 3300006353 | Bacteria | 7540 |
| 144 | Ga0075370_10020179 | 3300006353 | Bacteria | 3639 |
| 145 | Ga0075370_10022825 | 3300006353 | Bacteria | 3441 |
| 146 | Ga0068871_100060164 | 3300006358 | Bacteria | 3098 |
| 147 | Ga0075430_100000001 | 3300006846 | Bacteria | 185803 |
| 148 | Ga0075433_10046330 | 3300006852 | Bacteria | 3781 |
| 149 | Ga0068865_100001312 | 3300006881 | Bacteria | 14481 |
| 150 | Ga0097620_100005526 | 3300006931 | Bacteria | 12872 |
| 151 | Ga0097620_100016879 | 3300006931 | Bacteria | 7328 |
| 152 | Ga0097620_100027286 | 3300006931 | Bacteria | 5728 |
| 153 | Ga0097620_100042591 | 3300006931 | Bacteria | 4561 |
| 154 | Ga0099823_1000804 | 3300006944 | Bacteria | 23356 |
| 155 | Ga0079104_1000280 | 3300006946 | Bacteria | 65859 |
| 156 | Ga0099826_10000048 | 3300006948 | Bacteria | 74895 |
| 157 | Ga0105251_10001577 | 3300009011 | Bacteria | 19514 |
| 158 | Ga0105251_10001908 | 3300009011 | Bacteria | 17107 |
| 159 | Ga0105244_10000783 | 3300009036 | Bacteria | 27093 |
| 160 | Ga0105250_10002832 | 3300009092 | Bacteria | 8498 |
| 161 | Ga0105240_10016734 | 3300009093 | Bacteria | 9919 |
| 162 | Ga0105240_10016756 | 3300009093 | Bacteria | 9911 |
| 163 | Ga0105240_10024586 | 3300009093 | Bacteria | 7935 |
| 164 | Ga0111539_10204092 | 3300009094 | Bacteria | 2304 |
| 165 | Ga0111539_10230499 | 3300009094 | Bacteria | 2156 |
| 166 | Ga0105245_10011442 | 3300009098 | Bacteria | 7727 |
| 167 | Ga0105247_10016494 | 3300009101 | Bacteria | 4428 |
| 168 | Ga0105243_10005228 | 3300009148 | Bacteria | 10156 |
| 169 | Ga0105241_10012640 | 3300009174 | Bacteria | 6196 |
| 170 | Ga0105241_10030818 | 3300009174 | Bacteria | 4011 |
| 171 | Ga0105241_10071856 | 3300009174 | Bacteria | 2687 |
| 172 | Ga0105241_10167234 | 3300009174 | Bacteria | 1813 |
| 173 | Ga0105242_10002227 | 3300009176 | Bacteria | 15303 |
| 174 | Ga0105242_10010849 | 3300009176 | Bacteria | 6998 |
| 175 | Ga0105242_10024994 | 3300009176 | Bacteria | 4721 |
| 176 | Ga0105248_10005696 | 3300009177 | Bacteria | 13689 |
| 177 | Ga0105248_10016734 | 3300009177 | Bacteria | 8074 |
| 178 | Ga0105248_10019448 | 3300009177 | Bacteria | 7514 |
| 179 | Ga0105248_10048890 | 3300009177 | Bacteria | 4744 |
| 180 | Ga0105248_10050405 | 3300009177 | Bacteria | 4669 |
| 181 | Ga0105237_10001258 | 3300009545 | Bacteria | 33852 |
| 182 | Ga0105237_10001432 | 3300009545 | Bacteria | 31551 |
| 183 | Ga0105237_10001646 | 3300009545 | Bacteria | 28976 |
| 184 | Ga0105237_10046422 | 3300009545 | Bacteria | 4369 |
| 185 | Ga0105237_10075539 | 3300009545 | Bacteria | 3361 |
| 186 | Ga0105237_10105578 | 3300009545 | Bacteria | 2808 |
| 187 | Ga0105237_10157673 | 3300009545 | Bacteria | 2267 |
| 188 | Ga0105237_10220082 | 3300009545 | Bacteria | 1899 |
| 189 | Ga0105238_10007176 | 3300009551 | Bacteria | 11145 |
| 190 | Ga0105238_10019406 | 3300009551 | Bacteria | 6924 |
| 191 | Ga0105238_10027418 | 3300009551 | Bacteria | 5804 |
| 192 | Ga0105238_10034683 | 3300009551 | Bacteria | 5133 |
| 193 | Ga0105249_10028434 | 3300009553 | Bacteria | 5045 |
| 194 | Ga0099796_10009326 | 3300010159 | Bacteria | 2653 |
| 195 | Ga0105239_10000421 | 3300010375 | Bacteria | 61717 |
| 196 | Ga0105239_10001138 | 3300010375 | Bacteria | 36690 |
| 197 | Ga0105239_10001525 | 3300010375 | Bacteria | 30758 |
| 198 | Ga0105239_10008218 | 3300010375 | Bacteria | 11904 |
| 199 | Ga0105239_10008956 | 3300010375 | Bacteria | 11325 |
| 200 | Ga0105239_10037413 | 3300010375 | Bacteria | 5320 |
| 201 | Ga0105246_10000244 | 3300011119 | Bacteria | 27958 |
| 202 | Ga0105246_10000490 | 3300011119 | Bacteria | 21442 |
| 203 | Ga0105246_10003540 | 3300011119 | Bacteria | 9453 |
| 204 | Ga0157373_10000047 | 3300013100 | Bacteria | 110376 |
| 205 | Ga0157373_10017878 | 3300013100 | Bacteria | 5162 |
| 206 | Ga0157373_10025559 | 3300013100 | Bacteria | 4270 |
| 207 | Ga0157371_10002039 | 3300013102 | Bacteria | 19908 |
| 208 | Ga0157371_10003453 | 3300013102 | Bacteria | 14329 |
| 209 | Ga0157371_10004164 | 3300013102 | Bacteria | 12745 |
| 210 | Ga0157370_10000485 | 3300013104 | Bacteria | 49509 |
| 211 | Ga0157370_10000508 | 3300013104 | Bacteria | 48558 |
| 212 | Ga0157370_10001430 | 3300013104 | Bacteria | 29613 |
| 213 | Ga0157370_10002664 | 3300013104 | Bacteria | 21422 |
| 214 | Ga0157370_10004233 | 3300013104 | Bacteria | 16607 |
| 215 | Ga0157370_10023559 | 3300013104 | Bacteria | 6110 |
| 216 | Ga0157370_10033974 | 3300013104 | Bacteria | 4969 |
| 217 | Ga0157370_10038265 | 3300013104 | Bacteria | 4641 |
| 218 | Ga0157369_10000572 | 3300013105 | Bacteria | 48524 |
| 219 | Ga0157369_10000594 | 3300013105 | Bacteria | 47098 |
| 220 | Ga0157374_10088966 | 3300013296 | Bacteria | 2942 |
| 221 | Ga0157374_10259788 | 3300013296 | Bacteria | 1710 |
| 222 | Ga0157378_10003913 | 3300013297 | Bacteria | 13198 |
| 223 | Ga0163162_10001713 | 3300013306 | Bacteria | 20541 |
| 224 | Ga0163162_10053712 | 3300013306 | Bacteria | 4050 |
| 225 | Ga0163162_10066203 | 3300013306 | Bacteria | 3661 |
| 226 | Ga0163162_10119697 | 3300013306 | Bacteria | 2736 |
| 227 | Ga0157372_10031659 | 3300013307 | Bacteria | 5791 |
| 228 | Ga0157372_10034561 | 3300013307 | Bacteria | 5558 |
| 229 | Ga0157372_10048158 | 3300013307 | Bacteria | 4738 |
| 230 | Ga0157372_10289308 | 3300013307 | Bacteria | 1906 |
| 231 | Ga0157375_10000055 | 3300013308 | Bacteria | 126704 |
| 232 | Ga0157375_10000629 | 3300013308 | Bacteria | 31341 |
| 233 | Ga0157375_10013502 | 3300013308 | Bacteria | 7272 |
| 234 | Ga0157375_10073477 | 3300013308 | Bacteria | 3439 |
| 235 | Ga0163163_10067469 | 3300014325 | Bacteria | 3557 |
| 236 | Ga0157380_10000325 | 3300014326 | Bacteria | 28843 |
| 237 | Ga0182008_10000118 | 3300014497 | Bacteria | 59429 |
| 238 | Ga0182008_10002412 | 3300014497 | Bacteria | 11737 |
| 239 | Ga0182008_10013366 | 3300014497 | Bacteria | 4316 |
| 240 | Ga0157377_10000088 | 3300014745 | Bacteria | 67719 |
| 241 | Ga0157379_10040916 | 3300014968 | Bacteria | 4137 |
| 242 | Ga0157379_10063383 | 3300014968 | Bacteria | 3305 |
| 243 | Ga0157376_10052227 | 3300014969 | Bacteria | 3398 |
| 244 | Ga0182006_1000010 | 3300015261 | Bacteria | 413414 |
| 245 | Ga0182006_1000366 | 3300015261 | Bacteria | 37493 |
| 246 | Ga0182007_10000021 | 3300015262 | Bacteria | 193408 |
| 247 | Ga0182007_10000024 | 3300015262 | Bacteria | 181761 |
| 248 | Ga0182007_10001040 | 3300015262 | Bacteria | 15203 |
| 249 | Ga0182005_1000579 | 3300015265 | Bacteria | 18027 |
| 250 | Ga0182005_1001431 | 3300015265 | Bacteria | 9604 |
| 251 | Ga0163161_10007796 | 3300017792 | Bacteria | 7406 |
| 252 | Ga0163161_10013775 | 3300017792 | Bacteria | 5634 |
| 253 | Ga0213872_10000136 | 3300021361 | Bacteria | 66682 |
| 254 | Ga0213872_10000546 | 3300021361 | Bacteria | 29266 |
| 255 | Ga0213872_10005357 | 3300021361 | Bacteria | 6621 |
| 256 | Ga0213872_10010598 | 3300021361 | Bacteria | 4381 |
| 257 | Ga0209436_100042 | 3300025208 | Bacteria | 73600 |
| 258 | Ga0209672_100532 | 3300025228 | Bacteria | 20804 |
| 259 | Ga0209437_100143 | 3300025233 | Bacteria | 164970 |
| 260 | Ga0209437_106660 | 3300025233 | Bacteria | 1913 |
| 261 | Ga0209646_1000169 | 3300025246 | Bacteria | 86319 |
| 262 | Ga0209026_1005102 | 3300025250 | Bacteria | 3636 |
| 263 | Ga0209148_1000237 | 3300025254 | Bacteria | 88748 |
| 264 | Ga0209759_1000562 | 3300025256 | Bacteria | 37533 |
| 265 | Ga0209759_1000574 | 3300025256 | Bacteria | 36692 |
| 266 | Ga0209759_1012361 | 3300025256 | Bacteria | 2369 |
| 267 | Ga0209129_1000329 | 3300025258 | Bacteria | 41319 |
| 268 | Ga0209233_1001868 | 3300025261 | Bacteria | 8090 |
| 269 | Ga0209455_1000253 | 3300025272 | Bacteria | 62650 |
| 270 | Ga0209673_1004452 | 3300025273 | Bacteria | 7498 |
| 271 | Ga0209673_1018432 | 3300025273 | Bacteria | 2538 |
| 272 | Ga0209130_1000016 | 3300025284 | Bacteria | 395540 |
| 273 | Ga0209130_1000227 | 3300025284 | Bacteria | 73760 |
| 274 | Ga0209130_1004602 | 3300025284 | Bacteria | 5157 |
| 275 | Ga0209675_1000546 | 3300025291 | Bacteria | 27468 |
| 276 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 277 | Ga0209025_1000039 | 3300025294 | Bacteria | 377396 |
| 278 | Ga0209025_1001164 | 3300025294 | Bacteria | 37261 |
| 279 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 280 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 281 | Ga0209050_1004070 | 3300025298 | Bacteria | 10233 |
| 282 | Ga0209256_1000424 | 3300025299 | Bacteria | 66333 |
| 283 | Ga0207426_1004366 | 3300025302 | Bacteria | 6941 |
| 284 | Ga0207426_1031442 | 3300025302 | Bacteria | 1732 |
| 285 | Ga0209051_1000469 | 3300025303 | Bacteria | 52936 |
| 286 | Ga0207697_10038625 | 3300025315 | Bacteria | 1957 |
| 287 | Ga0207656_10009379 | 3300025321 | Bacteria | 3635 |
| 288 | Ga0207656_10027777 | 3300025321 | Bacteria | 2317 |
| 289 | Ga0207696_1017168 | 3300025711 | Bacteria | 2403 |
| 290 | Ga0207655_1001036 | 3300025728 | Bacteria | 28029 |
| 291 | Ga0207713_1001686 | 3300025735 | Bacteria | 17087 |
| 292 | Ga0207713_1006601 | 3300025735 | Bacteria | 7042 |
| 293 | Ga0207710_10055557 | 3300025900 | Bacteria | 1785 |
| 294 | Ga0207680_10003093 | 3300025903 | Bacteria | 7817 |
| 295 | Ga0207680_10024889 | 3300025903 | Bacteria | 3293 |
| 296 | Ga0207647_10003721 | 3300025904 | Bacteria | 11402 |
| 297 | Ga0207647_10059443 | 3300025904 | Bacteria | 2339 |
| 298 | Ga0207645_10004012 | 3300025907 | Bacteria | 10978 |
| 299 | Ga0207705_10000344 | 3300025909 | Bacteria | 41940 |
| 300 | Ga0207705_10093407 | 3300025909 | Bacteria | 2205 |
| 301 | Ga0207654_10001203 | 3300025911 | Bacteria | 13874 |
| 302 | Ga0207654_10037169 | 3300025911 | Bacteria | 2724 |
| 303 | Ga0207695_10011856 | 3300025913 | Bacteria | 10512 |
| 304 | Ga0207695_10048140 | 3300025913 | Bacteria | 4505 |
| 305 | Ga0207695_10087928 | 3300025913 | Bacteria | 3129 |
| 306 | Ga0207671_10000987 | 3300025914 | Bacteria | 35078 |
| 307 | Ga0207671_10001650 | 3300025914 | Bacteria | 25405 |
| 308 | Ga0207671_10004477 | 3300025914 | Bacteria | 13327 |
| 309 | Ga0207671_10035500 | 3300025914 | Bacteria | 3699 |
| 310 | Ga0207671_10098803 | 3300025914 | Bacteria | 2208 |
| 311 | Ga0207671_10116881 | 3300025914 | Bacteria | 2035 |
| 312 | Ga0207660_10017143 | 3300025917 | Bacteria | 4807 |
| 313 | Ga0207662_10003922 | 3300025918 | Bacteria | 7753 |
| 314 | Ga0207662_10022336 | 3300025918 | Bacteria | 3627 |
| 315 | Ga0207657_10001327 | 3300025919 | Bacteria | 26265 |
| 316 | Ga0207657_10001827 | 3300025919 | Bacteria | 22959 |
| 317 | Ga0207657_10036177 | 3300025919 | Bacteria | 4421 |
| 318 | Ga0207649_10077687 | 3300025920 | Bacteria | 2140 |
| 319 | Ga0207649_10093041 | 3300025920 | Bacteria | 1977 |
| 320 | Ga0207652_10038392 | 3300025921 | Bacteria | 4059 |
| 321 | Ga0207652_10171132 | 3300025921 | Bacteria | 1949 |
| 322 | Ga0207681_10000269 | 3300025923 | Bacteria | 39376 |
| 323 | Ga0207681_10000703 | 3300025923 | Bacteria | 21982 |
| 324 | Ga0207681_10003185 | 3300025923 | Bacteria | 10298 |
| 325 | Ga0207694_10026822 | 3300025924 | Bacteria | 4386 |
| 326 | Ga0207694_10028497 | 3300025924 | Bacteria | 4258 |
| 327 | Ga0207650_10022834 | 3300025925 | Bacteria | 4433 |
| 328 | Ga0207650_10029108 | 3300025925 | Bacteria | 3967 |
| 329 | Ga0207659_10016916 | 3300025926 | Bacteria | 4756 |
| 330 | Ga0207687_10077399 | 3300025927 | Bacteria | 2392 |
| 331 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 332 | Ga0207644_10000163 | 3300025931 | Bacteria | 48264 |
| 333 | Ga0207644_10001973 | 3300025931 | Bacteria | 13264 |
| 334 | Ga0207644_10011155 | 3300025931 | Bacteria | 5938 |
| 335 | Ga0207690_10000615 | 3300025932 | Bacteria | 23019 |
| 336 | Ga0207690_10009413 | 3300025932 | Bacteria | 5803 |
| 337 | Ga0207690_10207911 | 3300025932 | Bacteria | 1490 |
| 338 | Ga0207706_10016727 | 3300025933 | Bacteria | 6620 |
| 339 | Ga0207706_10024393 | 3300025933 | Bacteria | 5422 |
| 340 | Ga0207706_10028266 | 3300025933 | Bacteria | 5009 |
| 341 | Ga0207706_10050704 | 3300025933 | Bacteria | 3667 |
| 342 | Ga0207706_10105166 | 3300025933 | Bacteria | 2484 |
| 343 | Ga0207706_10232030 | 3300025933 | Bacteria | 1614 |
| 344 | Ga0207686_10021148 | 3300025934 | Bacteria | 3729 |
| 345 | Ga0207686_10025577 | 3300025934 | Bacteria | 3435 |
| 346 | Ga0207686_10071820 | 3300025934 | Bacteria | 2229 |
| 347 | Ga0207669_10001655 | 3300025937 | Bacteria | 9475 |
| 348 | Ga0207704_10019891 | 3300025938 | Bacteria | 3538 |
| 349 | Ga0207691_10000575 | 3300025940 | Bacteria | 36701 |
| 350 | Ga0207691_10067823 | 3300025940 | Bacteria | 3225 |
| 351 | Ga0207691_10097206 | 3300025940 | Bacteria | 2632 |
| 352 | Ga0207711_10001635 | 3300025941 | Bacteria | 20665 |
| 353 | Ga0207711_10001666 | 3300025941 | Bacteria | 20482 |
| 354 | Ga0207711_10025493 | 3300025941 | Bacteria | 4960 |
| 355 | Ga0207711_10029581 | 3300025941 | Bacteria | 4622 |
| 356 | Ga0207711_10030848 | 3300025941 | Bacteria | 4523 |
| 357 | Ga0207711_10058424 | 3300025941 | Bacteria | 3319 |
| 358 | Ga0207689_10007647 | 3300025942 | Bacteria | 9462 |
| 359 | Ga0207661_10033723 | 3300025944 | Bacteria | 3976 |
| 360 | Ga0207679_10033488 | 3300025945 | Bacteria | 3616 |
| 361 | Ga0207667_10000427 | 3300025949 | Bacteria | 56780 |
| 362 | Ga0207667_10003296 | 3300025949 | Bacteria | 19914 |
| 363 | Ga0207667_10012152 | 3300025949 | Bacteria | 9944 |
| 364 | Ga0207667_10028397 | 3300025949 | Bacteria | 6077 |
| 365 | Ga0207667_10050793 | 3300025949 | Bacteria | 4374 |
| 366 | Ga0207667_10100602 | 3300025949 | Bacteria | 2982 |
| 367 | Ga0207651_10020608 | 3300025960 | Bacteria | 3984 |
| 368 | Ga0207651_10064481 | 3300025960 | Bacteria | 2564 |
| 369 | Ga0207651_10135283 | 3300025960 | Bacteria | 1894 |
| 370 | Ga0207668_10047914 | 3300025972 | Bacteria | 2929 |
| 371 | Ga0207640_10006957 | 3300025981 | Bacteria | 6223 |
| 372 | Ga0207640_10043044 | 3300025981 | Bacteria | 2883 |
| 373 | Ga0207658_10000254 | 3300025986 | Bacteria | 55800 |
| 374 | Ga0207658_10009815 | 3300025986 | Bacteria | 6499 |
| 375 | Ga0207658_10021424 | 3300025986 | Bacteria | 4487 |
| 376 | Ga0207703_10010118 | 3300026035 | Bacteria | 7392 |
| 377 | Ga0207703_10031138 | 3300026035 | Bacteria | 4216 |
| 378 | Ga0207703_10045351 | 3300026035 | Bacteria | 3536 |
| 379 | Ga0207639_10020960 | 3300026041 | Bacteria | 4688 |
| 380 | Ga0207639_10030083 | 3300026041 | Bacteria | 3981 |
| 381 | Ga0207639_10074104 | 3300026041 | Bacteria | 2672 |
| 382 | Ga0207678_10006529 | 3300026067 | Bacteria | 10340 |
| 383 | Ga0207678_10100277 | 3300026067 | Bacteria | 2474 |
| 384 | Ga0207708_10002545 | 3300026075 | Bacteria | 13408 |
| 385 | Ga0207708_10024712 | 3300026075 | Bacteria | 4545 |
| 386 | Ga0207641_10002044 | 3300026088 | Bacteria | 19204 |
| 387 | Ga0207641_10010838 | 3300026088 | Bacteria | 7469 |
| 388 | Ga0207641_10043315 | 3300026088 | Bacteria | 3780 |
| 389 | Ga0207641_10060520 | 3300026088 | Bacteria | 3228 |
| 390 | Ga0207648_10000019 | 3300026089 | Bacteria | 144209 |
| 391 | Ga0207648_10013847 | 3300026089 | Bacteria | 7481 |
| 392 | Ga0207648_10015132 | 3300026089 | Bacteria | 7100 |
| 393 | Ga0207648_10172059 | 3300026089 | Bacteria | 1915 |
| 394 | Ga0207676_10067600 | 3300026095 | Bacteria | 2855 |
| 395 | Ga0207676_10121735 | 3300026095 | Bacteria | 2202 |
| 396 | Ga0207676_10139058 | 3300026095 | Bacteria | 2076 |
| 397 | Ga0207674_10009959 | 3300026116 | Bacteria | 10816 |
| 398 | Ga0207674_10012951 | 3300026116 | Bacteria | 9302 |
| 399 | Ga0207674_10014731 | 3300026116 | Bacteria | 8625 |
| 400 | Ga0207674_10046818 | 3300026116 | Bacteria | 4438 |
| 401 | Ga0207674_10130394 | 3300026116 | Bacteria | 2478 |
| 402 | Ga0207675_100057789 | 3300026118 | Bacteria | 3620 |
| 403 | Ga0207683_10021454 | 3300026121 | Bacteria | 5529 |
| 404 | Ga0207698_10039959 | 3300026142 | Bacteria | 3480 |
| 405 | Ga0207698_10047883 | 3300026142 | Bacteria | 3242 |
| 406 | Ga0207698_10059704 | 3300026142 | Bacteria | 2962 |
| 407 | Ga0209281_1000337 | 3300027111 | Bacteria | 79938 |
| 408 | Ga0209389_1000523 | 3300027296 | Bacteria | 23302 |
| 409 | Ga0209282_1000066 | 3300027666 | Bacteria | 87072 |
| 410 | Ga0209974_10022224 | 3300027876 | Bacteria | 2101 |
| 411 | Ga0268266_10000125 | 3300028379 | Bacteria | 151647 |
| 412 | Ga0268265_10023251 | 3300028380 | Bacteria | 4368 |
| 413 | Ga0268265_10027571 | 3300028380 | Bacteria | 4055 |
| 414 | Ga0268264_10000083 | 3300028381 | Bacteria | 245366 |
| 415 | Ga0268264_10001036 | 3300028381 | Bacteria | 27932 |
| 416 | Ga0268264_10005274 | 3300028381 | Bacteria | 10945 |
| 417 | Ga0268264_10014029 | 3300028381 | Bacteria | 6587 |
| 418 | Ga0268264_10064467 | 3300028381 | Bacteria | 3084 |
| 419 | Ga0307515_10002251 | 3300028794 | Bacteria | 42303 |
| 420 | Ga0307515_10004349 | 3300028794 | Bacteria | 29393 |
| 421 | Ga0307515_10006229 | 3300028794 | Bacteria | 23956 |
| 422 | Ga0307515_10034203 | 3300028794 | Bacteria | 8333 |
| 423 | Ga0265324_10000090 | 3300029957 | Bacteria | 70577 |
| 424 | Ga0265324_10000630 | 3300029957 | Bacteria | 24053 |
| 425 | Ga0265331_10005821 | 3300031250 | Bacteria | 7387 |
| 426 | Ga0307513_10152001 | 3300031456 | Bacteria | 2222 |
| 427 | Ga0307509_10000904 | 3300031507 | Bacteria | 50711 |
| 428 | Ga0307509_10160307 | 3300031507 | Bacteria | 2149 |
| 429 | Ga0307408_100000364 | 3300031548 | Bacteria | 41737 |
| 430 | Ga0307408_100010473 | 3300031548 | Bacteria | 6114 |
| 431 | Ga0307408_100018733 | 3300031548 | Bacteria | 4651 |
| 432 | Ga0307408_100066259 | 3300031548 | Bacteria | 2652 |
| 433 | Ga0307514_10018767 | 3300031649 | Bacteria | 5666 |
| 434 | Ga0307514_10055238 | 3300031649 | Bacteria | 3054 |
| 435 | Ga0265314_10034537 | 3300031711 | Bacteria | 3696 |
| 436 | Ga0307405_10000496 | 3300031731 | Bacteria | 14786 |
| 437 | Ga0307405_10038843 | 3300031731 | Bacteria | 2873 |
| 438 | Ga0307410_10002639 | 3300031852 | Bacteria | 8737 |
| 439 | Ga0307406_10060951 | 3300031901 | Bacteria | 2435 |
| 440 | Ga0307412_10002152 | 3300031911 | Bacteria | 10926 |
| 441 | Ga0307409_100028312 | 3300031995 | Bacteria | 3989 |
| 442 | Ga0307409_100083619 | 3300031995 | Bacteria | 2589 |
| 443 | Ga0307416_100002543 | 3300032002 | Bacteria | 10506 |
| 444 | Ga0307416_100023247 | 3300032002 | Bacteria | 4494 |
| 445 | Ga0307414_10000198 | 3300032004 | Bacteria | 40555 |
| 446 | Ga0307414_10000538 | 3300032004 | Bacteria | 19753 |
| 447 | Ga0307411_10000004 | 3300032005 | Bacteria | 460327 |
| 448 | Ga0307415_100031436 | 3300032126 | Bacteria | 3420 |
| 449 | Ga0307415_100194317 | 3300032126 | Bacteria | 1604 |
| 450 | Ga0307510_10002154 | 3300033180 | Bacteria | 22232 |
| 451 | Ga0307510_10003569 | 3300033180 | Bacteria | 18167 |
| 452 | Ga0373953_0003515 | 3300035117 | Bacteria | 4893 |
| 453 | Ga0373954_0010399 | 3300035118 | Bacteria | 4106 |
| 454 | Ga0373955_0003319 | 3300035172 | Bacteria | 7066 |
| 455 | Ga0373931_0060165 | 3300035691 | Bacteria | 2044 |
| 456 | Ga0373925_0049088 | 3300037068 | Bacteria | 3146 |
| 457 | Ga0395899_0000209 | 3300037312 | Bacteria | 85489 |
| 458 | Ga0395899_0000281 | 3300037312 | Bacteria | 66519 |
| 459 | Ga0395899_0021800 | 3300037312 | Bacteria | 4859 |
| 460 | Ga0395899_0034707 | 3300037312 | Bacteria | 3788 |
| 461 | Ga0395899_0076856 | 3300037312 | Bacteria | 2437 |
| 462 | Ga0395900_0072758 | 3300037418 | Bacteria | 3534 |
| 463 | Ga0395900_0106887 | 3300037418 | Bacteria | 2875 |
| 464 | Ga0395900_0155648 | 3300037418 | Bacteria | 2334 |
| 465 | Ga0395898_0047831 | 3300037466 | Bacteria | 4195 |
| 466 | Ga0395898_0053628 | 3300037466 | Bacteria | 3938 |
| 467 | Ga0395898_0063068 | 3300037466 | Bacteria | 3597 |
| 468 | Ga0395898_0185317 | 3300037466 | Bacteria | 1989 |
| 469 | Ga0395905_0004026 | 3300037471 | Bacteria | 15424 |
| 470 | Ga0395905_0038690 | 3300037471 | Bacteria | 4474 |
| 471 | Ga0395905_0073982 | 3300037471 | Bacteria | 3193 |
| 472 | Ga0395901_0018161 | 3300038443 | Bacteria | 7179 |
| 473 | Ga0395901_0100568 | 3300038443 | Bacteria | 3033 |
| 474 | Ga0395901_0122037 | 3300038443 | Bacteria | 2739 |
| 475 | Ga0400483_277560 | 3300039062 | Unclassified | 1748 |
| 476 | Ga0436361_0141619 | 3300039447 | Bacteria | 5339 |
| 477 | Ga0436361_0151105 | 3300039447 | Bacteria | 6131 |
| 478 | Ga0436361_0399468 | 3300039447 | Bacteria | 9484 |
| 479 | Ga0436361_0658458 | 3300039447 | Bacteria | 21346 |
| 480 | Ga0436361_0954756 | 3300039447 | Bacteria | 64588 |
| 481 | Ga0439438_000623 | 3300041405 | Bacteria | 15968 |
| 482 | Ga0439447_000592 | 3300041407 | Bacteria | 13542 |
| 483 | Ga0439466_0000429 | 3300041411 | Bacteria | 16007 |
| 484 | Ga0439448_0001384 | 3300042005 | Bacteria | 6240 |
| 485 | Ga0439432_000177 | 3300042006 | Bacteria | 22560 |
| 486 | Ga0439451_000069 | 3300042009 | Bacteria | 18787 |
| 487 | Ga0439452_000517 | 3300042010 | Bacteria | 20821 |
| 488 | Ga0439455_0005912 | 3300042012 | Bacteria | 2511 |
| 489 | Ga0439456_001562 | 3300042013 | Bacteria | 4617 |
| 490 | Ga0439463_000134 | 3300042016 | Bacteria | 18645 |
| 491 | Ga0450911_000195 | 3300042115 | Bacteria | 23925 |
| 492 | Ga0439458_0002354 | 3300042157 | Bacteria | 4635 |
| 493 | Ga0439459_0001902 | 3300042438 | Bacteria | 3164 |
| 494 | Ga0450893_0003082 | 3300042532 | Bacteria | 2620 |
| 495 | Ga0451577_0031747 | 3300042876 | Bacteria | 4765 |
| 496 | Ga0451577_0133079 | 3300042876 | Bacteria | 2232 |
| 497 | Ga0466972_0010263 | 3300044658 | Bacteria | 4704 |
| 498 | Ga0466972_0022034 | 3300044658 | Bacteria | 3173 |
| 499 | Ga0453683_0041045 | 3300044673 | Bacteria | 2906 |
| 500 | Ga0466965_0004523 | 3300044683 | Bacteria | 6189 |
| 501 | Ga0466966_0000556 | 3300044684 | Bacteria | 23802 |
| 502 | Ga0466961_0000561 | 3300044693 | Bacteria | 23621 |
| 503 | Ga0466961_0002510 | 3300044693 | Bacteria | 11390 |
| 504 | Ga0466961_0065813 | 3300044693 | Bacteria | 2303 |
| 505 | Ga0466964_0000063 | 3300044706 | Bacteria | 23331 |
| 506 | Ga0466970_0011421 | 3300044765 | Bacteria | 4527 |
| 507 | Ga0466957_0014405 | 3300044842 | Bacteria | 4605 |
| 508 | Ga0466957_0017135 | 3300044842 | Bacteria | 4240 |
| 509 | Ga0466959_0000447 | 3300045049 | Bacteria | 24046 |
| 510 | Ga0466959_0039624 | 3300045049 | Bacteria | 3482 |
| 511 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 512 | Ga0451576_0038238 | 3300045051 | Bacteria | 5078 |
| 513 | Ga0466958_0000259 | 3300045836 | Bacteria | 20492 |
| 514 | Ga0466958_0001672 | 3300045836 | Bacteria | 10697 |
| 515 | Ga0495617_002792 | 3300046452 | Bacteria | 6737 |
| 516 | Ga0495627_005535 | 3300046453 | Bacteria | 5069 |
| 517 | Ga0495590_0000056 | 3300046457 | Bacteria | 96913 |
| 518 | Ga0495590_0008633 | 3300046457 | Bacteria | 3883 |
| 519 | Ga0495590_0010545 | 3300046457 | Bacteria | 3470 |
| 520 | Ga0495591_001291 | 3300046458 | Bacteria | 15945 |
| 521 | Ga0495638_0000602 | 3300046460 | Bacteria | 40434 |
| 522 | Ga0495638_0003410 | 3300046460 | Bacteria | 12526 |
| 523 | Ga0495638_0121630 | 3300046460 | Bacteria | 1542 |
| 524 | Ga0495651_0000872 | 3300046462 | Bacteria | 23438 |
| 525 | Ga0495651_0057554 | 3300046462 | Bacteria | 2984 |
| 526 | Ga0495650_0000284 | 3300046471 | Bacteria | 96068 |
| 527 | Ga0495650_0000454 | 3300046471 | Bacteria | 64731 |
| 528 | Ga0495650_0001444 | 3300046471 | Bacteria | 22917 |
| 529 | Ga0495650_0021959 | 3300046471 | Bacteria | 3069 |
| 530 | Ga0495605_0000102 | 3300046474 | Bacteria | 107430 |
| 531 | Ga0495605_0000214 | 3300046474 | Bacteria | 71480 |
| 532 | Ga0495605_0007367 | 3300046474 | Bacteria | 6248 |
| 533 | Ga0495605_0023388 | 3300046474 | Bacteria | 3251 |
| 534 | Ga0495605_0027315 | 3300046474 | Bacteria | 2958 |
| 535 | Ga0495605_0032850 | 3300046474 | Bacteria | 2639 |
| 536 | Ga0495605_0065753 | 3300046474 | Bacteria | 1724 |
| 537 | Ga0495639_0004282 | 3300046475 | Bacteria | 6121 |
| 538 | Ga0495662_0091516 | 3300046476 | Bacteria | 1483 |
| 539 | Ga0495664_0006100 | 3300046477 | Bacteria | 6652 |
| 540 | Ga0495584_0000210 | 3300046491 | Bacteria | 42003 |
| 541 | Ga0495584_0002120 | 3300046491 | Bacteria | 11355 |
| 542 | Ga0495584_0003854 | 3300046491 | Bacteria | 8138 |
| 543 | Ga0495584_0008952 | 3300046491 | Bacteria | 5175 |
| 544 | Ga0495584_0093572 | 3300046491 | Bacteria | 1517 |
| 545 | Ga0495585_0001382 | 3300046492 | Bacteria | 19177 |
| 546 | Ga0495585_0001745 | 3300046492 | Bacteria | 16560 |
| 547 | Ga0495585_0002217 | 3300046492 | Bacteria | 14070 |
| 548 | Ga0495596_0001107 | 3300046500 | Bacteria | 15956 |
| 549 | Ga0495607_0000962 | 3300046501 | Bacteria | 26634 |
| 550 | Ga0495607_0005543 | 3300046501 | Bacteria | 9007 |
| 551 | Ga0495607_0024387 | 3300046501 | Bacteria | 3771 |
| 552 | Ga0495583_0000553 | 3300046506 | Bacteria | 52333 |
| 553 | Ga0495583_0002085 | 3300046506 | Bacteria | 18033 |
| 554 | Ga0495606_0000149 | 3300046507 | Bacteria | 120165 |
| 555 | Ga0495606_0000771 | 3300046507 | Bacteria | 49120 |
| 556 | Ga0495606_0001996 | 3300046507 | Bacteria | 25148 |
| 557 | Ga0495606_0002350 | 3300046507 | Bacteria | 22219 |
| 558 | Ga0495606_0004293 | 3300046507 | Bacteria | 14365 |
| 559 | Ga0495606_0032269 | 3300046507 | Bacteria | 3630 |
| 560 | Ga0495608_0020491 | 3300046511 | Bacteria | 4545 |
| 561 | Ga0495608_0129179 | 3300046511 | Bacteria | 1618 |
| 562 | Ga0495610_0000371 | 3300046512 | Bacteria | 46658 |
| 563 | Ga0495610_0000505 | 3300046512 | Bacteria | 39813 |
| 564 | Ga0495610_0000805 | 3300046512 | Bacteria | 29394 |
| 565 | Ga0495610_0017787 | 3300046512 | Bacteria | 4042 |
| 566 | Ga0495610_0022295 | 3300046512 | Bacteria | 3467 |
| 567 | Ga0495616_0000178 | 3300046513 | Bacteria | 54382 |
| 568 | Ga0495616_0069273 | 3300046513 | Bacteria | 1711 |
| 569 | Ga0495618_0048852 | 3300046514 | Bacteria | 2672 |
| 570 | Ga0495620_0000266 | 3300046515 | Bacteria | 38388 |
| 571 | Ga0495628_0003452 | 3300046516 | Bacteria | 14151 |
| 572 | Ga0495631_0000234 | 3300046518 | Bacteria | 38074 |
| 573 | Ga0495631_0000838 | 3300046518 | Bacteria | 19541 |
| 574 | Ga0495631_0012128 | 3300046518 | Bacteria | 4220 |
| 575 | Ga0495631_0016761 | 3300046518 | Bacteria | 3483 |
| 576 | Ga0495632_0000110 | 3300046519 | Bacteria | 84473 |
| 577 | Ga0495632_0000393 | 3300046519 | Bacteria | 41065 |
| 578 | Ga0495632_0033510 | 3300046519 | Bacteria | 2636 |
| 579 | Ga0495637_0000169 | 3300046520 | Bacteria | 50531 |
| 580 | Ga0495637_0000487 | 3300046520 | Bacteria | 28799 |
| 581 | Ga0495637_0005579 | 3300046520 | Bacteria | 6386 |
| 582 | Ga0495643_0002037 | 3300046522 | Bacteria | 16800 |
| 583 | Ga0495643_0004493 | 3300046522 | Bacteria | 9728 |
| 584 | Ga0495643_0017980 | 3300046522 | Bacteria | 4118 |
| 585 | Ga0495644_0001354 | 3300046523 | Bacteria | 10008 |
| 586 | Ga0495648_0000119 | 3300046524 | Bacteria | 95682 |
| 587 | Ga0495648_0000848 | 3300046524 | Bacteria | 32268 |
| 588 | Ga0495648_0004260 | 3300046524 | Bacteria | 12274 |
| 589 | Ga0495648_0020734 | 3300046524 | Bacteria | 4574 |
| 590 | Ga0495642_0000742 | 3300046528 | Bacteria | 16176 |
| 591 | Ga0495642_0001112 | 3300046528 | Bacteria | 12402 |
| 592 | Ga0495642_0004309 | 3300046528 | Bacteria | 5528 |
| 593 | Ga0495652_0038050 | 3300046529 | Bacteria | 4170 |
| 594 | Ga0495652_0093643 | 3300046529 | Bacteria | 2452 |
| 595 | Ga0495654_0000349 | 3300046530 | Bacteria | 39806 |
| 596 | Ga0495654_0057004 | 3300046530 | Bacteria | 1888 |
| 597 | Ga0495640_0015795 | 3300046533 | Bacteria | 5666 |
| 598 | Ga0495587_0031513 | 3300046536 | Bacteria | 3210 |
| 599 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 600 | Ga0495609_0008264 | 3300046538 | Bacteria | 5107 |
| 601 | Ga0495609_0012385 | 3300046538 | Bacteria | 4045 |
| 602 | Ga0495597_0000450 | 3300046542 | Bacteria | 35268 |
| 603 | Ga0495622_0000574 | 3300046557 | Bacteria | 22031 |
| 604 | Ga0495633_0000003 | 3300046558 | Bacteria | 472476 |
| 605 | Ga0495633_0000088 | 3300046558 | Bacteria | 124193 |
| 606 | Ga0495633_0017087 | 3300046558 | Bacteria | 3720 |
| 607 | Ga0495656_0009942 | 3300046615 | Bacteria | 3441 |
| 608 | Ga0495656_0046292 | 3300046615 | Bacteria | 1840 |
| 609 | Ga0495668_0000188 | 3300046616 | Bacteria | 92177 |
| 610 | Ga0495668_0000673 | 3300046616 | Bacteria | 41193 |
| 611 | Ga0495668_0000801 | 3300046616 | Bacteria | 36223 |
| 612 | Ga0495668_0001028 | 3300046616 | Bacteria | 29571 |
| 613 | Ga0495668_0003760 | 3300046616 | Bacteria | 11133 |
| 614 | Ga0495668_0005007 | 3300046616 | Bacteria | 9149 |
| 615 | Ga0495634_0001931 | 3300046642 | Bacteria | 17735 |
| 616 | Ga0495625_0000929 | 3300046660 | Bacteria | 39380 |
| 617 | Ga0495625_0001607 | 3300046660 | Bacteria | 26676 |
| 618 | Ga0495635_0118510 | 3300046663 | Bacteria | 1806 |
| 619 | Ga0495661_0000207 | 3300046665 | Bacteria | 67846 |
| 620 | Ga0495661_0000258 | 3300046665 | Bacteria | 60916 |
| 621 | Ga0495661_0000649 | 3300046665 | Bacteria | 35207 |
| 622 | Ga0495661_0000723 | 3300046665 | Bacteria | 32427 |
| 623 | Ga0495661_0001310 | 3300046665 | Bacteria | 21143 |
| 624 | Ga0495661_0002383 | 3300046665 | Bacteria | 14513 |
| 625 | Ga0495661_0004690 | 3300046665 | Bacteria | 9817 |
| 626 | Ga0495613_0111214 | 3300046689 | Bacteria | 1974 |
| 627 | Ga0495670_0007862 | 3300046691 | Bacteria | 5245 |
| 628 | Ga0495649_0000133 | 3300046694 | Bacteria | 65433 |
| 629 | Ga0495649_0000350 | 3300046694 | Bacteria | 39632 |
| 630 | Ga0495649_0018844 | 3300046694 | Bacteria | 3877 |
| 631 | Ga0495589_0000009 | 3300046794 | Bacteria | 256265 |
| 632 | Ga0495589_0000834 | 3300046794 | Bacteria | 19363 |
| 633 | Ga0495660_0000042 | 3300046810 | Bacteria | 167048 |
| 634 | Ga0495660_0000938 | 3300046810 | Bacteria | 21368 |
| 635 | Ga0495674_0004286 | 3300047319 | Bacteria | 13728 |
| 636 | Ga0495672_0000125 | 3300047320 | Bacteria | 118271 |
| 637 | Ga0495672_0001479 | 3300047320 | Bacteria | 23049 |
| 638 | Ga0495672_0055104 | 3300047320 | Bacteria | 2321 |
| 639 | Ga0495676_0000567 | 3300047321 | Bacteria | 30353 |
| 640 | Ga0495683_0022084 | 3300047323 | Bacteria | 3274 |
| 641 | Ga0495687_000013 | 3300047443 | Bacteria | 371058 |
| 642 | Ga0495687_000811 | 3300047443 | Bacteria | 33635 |
| 643 | Ga0495687_000988 | 3300047443 | Bacteria | 28638 |
| 644 | Ga0495675_0005404 | 3300047444 | Bacteria | 7786 |
| 645 | Ga0495677_0000024 | 3300047445 | Bacteria | 99215 |
| 646 | Ga0495677_0011379 | 3300047445 | Bacteria | 3256 |
| 647 | Ga0495679_000373 | 3300047446 | Bacteria | 34281 |
| 648 | Ga0495679_000766 | 3300047446 | Bacteria | 20467 |
| 649 | Ga0495679_001063 | 3300047446 | Bacteria | 16662 |
| 650 | Ga0495673_0000146 | 3300047469 | Bacteria | 127378 |
| 651 | Ga0495681_0000196 | 3300047470 | Bacteria | 50863 |
| 652 | Ga0495681_0062794 | 3300047470 | Bacteria | 1706 |
| 653 | Ga0495684_0072504 | 3300047471 | Bacteria | 2616 |
| 654 | Ga0495686_0000332 | 3300047472 | Bacteria | 77832 |
| 655 | Ga0495686_0000779 | 3300047472 | Bacteria | 41840 |
| 656 | Ga0495686_0001970 | 3300047472 | Bacteria | 20400 |
| 657 | Ga0495686_0002414 | 3300047472 | Bacteria | 17718 |
| 658 | Ga0495686_0003633 | 3300047472 | Bacteria | 13228 |
| 659 | Ga0495686_0096275 | 3300047472 | Bacteria | 1792 |
| 660 | Ga0495602_0004979 | 3300048088 | Bacteria | 13922 |
| 661 | Ga0495626_0000151 | 3300048091 | Bacteria | 86296 |
| 662 | Ga0495626_0000311 | 3300048091 | Bacteria | 51548 |
| 663 | Ga0495626_0001120 | 3300048091 | Bacteria | 22506 |
| 664 | Ga0495626_0002177 | 3300048091 | Bacteria | 14101 |
| 665 | Ga0495626_0002471 | 3300048091 | Bacteria | 12790 |
| 666 | Ga0495626_0005839 | 3300048091 | Bacteria | 7100 |
| 667 | Ga0495626_0034500 | 3300048091 | Bacteria | 2419 |
| 668 | Ga0496101_0037710 | 3300048904 | Bacteria | 3430 |
| 669 | Ga0496102_0035649 | 3300048905 | Bacteria | 4478 |
| 670 | Ga0496102_0065520 | 3300048905 | Bacteria | 3330 |
| 671 | Ga0496104_0034953 | 3300048907 | Bacteria | 4689 |
| 672 | Ga0496106_0053938 | 3300048909 | Bacteria | 3037 |
| 673 | Ga0496107_0060349 | 3300048910 | Bacteria | 2745 |
| 674 | Ga0496109_0034494 | 3300048912 | Bacteria | 4557 |
| 675 | Ga0496109_0110437 | 3300048912 | Bacteria | 2556 |
| 676 | Ga0496110_0020145 | 3300048913 | Bacteria | 5627 |
| 677 | Ga0496112_0006013 | 3300048915 | Bacteria | 10592 |
| 678 | Ga0496112_0090760 | 3300048915 | Bacteria | 3024 |
| 679 | Ga0496116_0015775 | 3300048919 | Bacteria | 5952 |
| 680 | Ga0496116_0026819 | 3300048919 | Bacteria | 4203 |
| 681 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 682 | Ga0496117_0002526 | 3300048920 | Bacteria | 22920 |
| 683 | Ga0496117_0020607 | 3300048920 | Bacteria | 5369 |
| 684 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 685 | Ga0496118_0002734 | 3300048921 | Bacteria | 23211 |
| 686 | Ga0496118_0047473 | 3300048921 | Bacteria | 3327 |
| 687 | Ga0496118_0114805 | 3300048921 | Bacteria | 1775 |
| 688 | Ga0496119_0002272 | 3300048922 | Bacteria | 21341 |
| 689 | Ga0496121_0000087 | 3300048924 | Bacteria | 222451 |
| 690 | Ga0496121_0000518 | 3300048924 | Bacteria | 73428 |
| 691 | Ga0496121_0002120 | 3300048924 | Bacteria | 31168 |
| 692 | Ga0496121_0002258 | 3300048924 | Bacteria | 30031 |
| 693 | Ga0496121_0006329 | 3300048924 | Bacteria | 14764 |
| 694 | Ga0496121_0030743 | 3300048924 | Bacteria | 4926 |
| 695 | Ga0496122_0043622 | 3300048925 | Bacteria | 3511 |
| 696 | Ga0496123_0061352 | 3300048926 | Bacteria | 2416 |
| 697 | Ga0496124_0001999 | 3300048927 | Bacteria | 27784 |
| 698 | Ga0496124_0002832 | 3300048927 | Bacteria | 21955 |
| 699 | Ga0496124_0003913 | 3300048927 | Bacteria | 17798 |
| 700 | Ga0496124_0005236 | 3300048927 | Bacteria | 14712 |
| 701 | Ga0496124_0013995 | 3300048927 | Bacteria | 7786 |
| 702 | Ga0496124_0025815 | 3300048927 | Bacteria | 5311 |
| 703 | Ga0496124_0036082 | 3300048927 | Bacteria | 4318 |
| 704 | Ga0496125_0007187 | 3300048928 | Bacteria | 11871 |
| 705 | Ga0496125_0084766 | 3300048928 | Bacteria | 2405 |
| 706 | Ga0496125_0085069 | 3300048928 | Bacteria | 2398 |
| 707 | Ga0496126_0003931 | 3300048929 | Bacteria | 18201 |
| 708 | Ga0496126_0004264 | 3300048929 | Bacteria | 17195 |
| 709 | Ga0496126_0008917 | 3300048929 | Bacteria | 10741 |
| 710 | Ga0496126_0011383 | 3300048929 | Bacteria | 9218 |
| 711 | Ga0496126_0147391 | 3300048929 | Bacteria | 2020 |
| 712 | Ga0495678_002507 | 3300049459 | Bacteria | 12363 |
| 713 | Ga0495678_006851 | 3300049459 | Bacteria | 5989 |
| 714 | Ga0495678_007148 | 3300049459 | Bacteria | 5830 |
| 715 | Ga0501300_005324 | 3300049523 | Bacteria | 1899 |
| 716 | Ga0501034_0056451 | 3300049571 | Bacteria | 3951 |
| 717 | Ga0501038_0034733 | 3300049574 | Bacteria | 4432 |
| 718 | Ga0501047_0108738 | 3300049581 | Bacteria | 2655 |
| 719 | Ga0501070_0089955 | 3300049586 | Bacteria | 2541 |
| 720 | Ga0501211_001797 | 3300049658 | Bacteria | 2290 |
| 721 | Ga0501223_000330 | 3300049663 | Bacteria | 11742 |
| 722 | Ga0501249_000029 | 3300049679 | Bacteria | 86766 |
| 723 | Ga0501225_0009277 | 3300049705 | Bacteria | 2804 |
| 724 | Ga0501245_006383 | 3300049708 | Bacteria | 1647 |
| 725 | Ga0501035_0081534 | 3300049822 | Bacteria | 2855 |
| 726 | Ga0501044_0012728 | 3300049823 | Bacteria | 9111 |
| 727 | Ga0501044_0041388 | 3300049823 | Bacteria | 4796 |
| 728 | nmdc:mga0k408_16770_c1 | 3300050493 | Bacteria | 4070 |
| 729 | nmdc:mga0k408_5180_c1 | 3300050493 | Bacteria | 6914 |
| 730 | nmdc:mga0k408_8160_c1 | 3300050493 | Bacteria | 5610 |
| 731 | nmdc:mga0k408_85_c1 | 3300050493 | Bacteria | 43890 |
| 732 | nmdc:mga06z11_48728_c1 | 3300050494 | Bacteria | 2158 |
| 733 | nmdc:mga07m45_20565_c1 | 3300050496 | Bacteria | 3586 |
| 734 | nmdc:mga07m45_31057_c1 | 3300050496 | Bacteria | 2960 |
| 735 | nmdc:mga07m45_51972_c1 | 3300050496 | Bacteria | 2312 |
| 736 | nmdc:mga0qj67_5357_c1 | 3300050509 | Bacteria | 9364 |
| 737 | nmdc:mga0qj67_99486_c2 | 3300050509 | Bacteria | 1960 |
| 738 | nmdc:mga06r32_78583_c1 | 3300050510 | Bacteria | 3207 |
| 739 | nmdc:mga08y16_32878_c1 | 3300050511 | Bacteria | 5452 |
| 740 | nmdc:mga0a205_1975_c1 | 3300050515 | Bacteria | 17865 |
| 741 | nmdc:mga0a205_78965_c1 | 3300050515 | Bacteria | 3179 |
| 742 | nmdc:mga0sz30_67_c1 | 3300050516 | Bacteria | 40523 |
| 743 | Ga0500635_0000005 | 3300053080 | Bacteria | 187821 |
| 744 | Ga0495595_0004581 | 3300053084 | Bacteria | 5559 |
| 745 | Ga0495619_0022725 | 3300053085 | Bacteria | 4016 |
| 746 | Ga0500643_000416 | 3300053087 | Bacteria | 32407 |
| 747 | Ga0500562_000193 | 3300053108 | Bacteria | 16558 |
| 748 | Ga0500562_012855 | 3300053108 | Bacteria | 2131 |
| 749 | Ga0500592_000009 | 3300053116 | Bacteria | 87878 |
| 750 | Ga0500593_000185 | 3300053117 | Bacteria | 25193 |
| 751 | Ga0500594_0001222 | 3300053118 | Bacteria | 5552 |
| 752 | Ga0500607_000386 | 3300053121 | Bacteria | 42198 |
| 753 | Ga0500618_000774 | 3300053125 | Bacteria | 18011 |
| 754 | Ga0500628_000320 | 3300053129 | Bacteria | 9207 |
| 755 | Ga0500652_001105 | 3300053131 | Bacteria | 8693 |
| 756 | Ga0500655_000476 | 3300053133 | Bacteria | 8132 |
| 757 | Ga0500658_0001514 | 3300053134 | Bacteria | 9314 |
| 758 | Ga0500559_0000174 | 3300053136 | Bacteria | 50893 |
| 759 | Ga0500559_0000788 | 3300053136 | Bacteria | 20687 |
| 760 | Ga0500564_041249 | 3300053138 | Bacteria | 2124 |
| 761 | Ga0500604_0000190 | 3300053151 | Bacteria | 17544 |
| 762 | Ga0500604_0008413 | 3300053151 | Bacteria | 2737 |
| 763 | Ga0500616_0002312 | 3300053153 | Bacteria | 16122 |
| 764 | Ga0500619_000059 | 3300053154 | Bacteria | 33814 |
| 765 | Ga0500619_001478 | 3300053154 | Bacteria | 4174 |
| 766 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 767 | Ga0500622_0003702 | 3300053156 | Bacteria | 10023 |
| 768 | Ga0500622_0005025 | 3300053156 | Bacteria | 8060 |
| 769 | Ga0500622_0038554 | 3300053156 | Bacteria | 2492 |
| 770 | Ga0500622_0044722 | 3300053156 | Bacteria | 2295 |
| 771 | Ga0500622_0053841 | 3300053156 | Bacteria | 2065 |
| 772 | Ga0500627_0000114 | 3300053158 | Bacteria | 25849 |
| 773 | Ga0500627_0000992 | 3300053158 | Bacteria | 7711 |
| 774 | Ga0500634_0000104 | 3300053161 | Bacteria | 32418 |
| 775 | Ga0500570_000087 | 3300053724 | Bacteria | 25741 |
| 776 | Ga0500645_000535 | 3300053730 | Bacteria | 25399 |
| 777 | Ga0500587_000474 | 3300053739 | Bacteria | 4807 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047470 | Ga0495681_0062794 | Ga0495681_0062794_19_1188 | 377 |
| 2 | 3300013307 | Ga0157372_10289308 | Ga0157372_102893082 | 387 |
| 3 | 3300025933 | Ga0207706_10232030 | Ga0207706_102320302 | 387 |
| 4 | 3300053156 | Ga0500622_0005025 | Ga0500622_0005025_10_1179 | 387 |
| 5 | 3300048921 | Ga0496118_0114805 | Ga0496118_0114805_395_1609 | 399 |
| 6 | 3300046474 | Ga0495605_0023388 | Ga0495605_0023388_1973_3199 | 402 |
| 7 | 3300046694 | Ga0495649_0018844 | Ga0495649_0018844_2650_3867 | 403 |
| 8 | 3300003316 | rootH1_10023399 | rootH1_100233996 | 404 |
| 9 | 3300046453 | Ga0495627_005535 | Ga0495627_005535_3793_5028 | 405 |
| 10 | 3300046491 | Ga0495584_0003854 | Ga0495584_0003854_141_1454 | 408 |
| 11 | 3300046507 | Ga0495606_0001996 | Ga0495606_0001996_18549_19862 | 408 |
| 12 | 3300046542 | Ga0495597_0000450 | Ga0495597_0000450_20954_22267 | 408 |
| 13 | 3300046512 | Ga0495610_0000371 | Ga0495610_0000371_22713_24017 | 409 |
| 14 | 3300006946 | Ga0079104_1000280 | Ga0079104_100028053 | 413 |
| 15 | 3300027111 | Ga0209281_1000337 | Ga0209281_100033764 | 413 |
| 16 | 3300048091 | Ga0495626_0001120 | Ga0495626_0001120_15_1268 | 415 |
| 17 | 3300048091 | Ga0495626_0034500 | Ga0495626_0034500_15_1268 | 415 |
| 18 | 3300003322 | rootL2_10017982 | rootL2_100179822 | 419 |
| 19 | 3300003781 | Ga0055536_1000002 | Ga0055536_1000002521 | 419 |
| 20 | 3300003791 | Ga0055530_10002636 | Ga0055530_100026364 | 419 |
| 21 | 3300013104 | Ga0157370_10004233 | Ga0157370_100042336 | 419 |
| 22 | 3300013105 | Ga0157369_10000594 | Ga0157369_1000059421 | 419 |
| 23 | 3300015262 | Ga0182007_10000024 | Ga0182007_1000002420 | 419 |
| 24 | 3300025292 | Ga0209676_1000022 | Ga0209676_100002218 | 419 |
| 25 | 3300025298 | Ga0209050_1000020 | Ga0209050_1000020523 | 419 |
| 26 | 3300046558 | Ga0495633_0000003 | Ga0495633_0000003_386408_387673 | 419 |
| 27 | 3300013104 | Ga0157370_10001430 | Ga0157370_1000143015 | 422 |
| 28 | 3300049663 | Ga0501223_000330 | Ga0501223_000330_10456_11730 | 422 |
| 29 | 3300053156 | Ga0500622_0044722 | Ga0500622_0044722_247_1521 | 422 |
| 30 | 3300053730 | Ga0500645_000535 | Ga0500645_000535_5355_6629 | 422 |
| 31 | 3300005289 | Ga0065704_10075142 | Ga0065704_100751423 | 423 |
| 32 | 3300037312 | Ga0395899_0000209 | Ga0395899_0000209_80087_81364 | 423 |
| 33 | 3300042115 | Ga0450911_000195 | Ga0450911_000195_13709_15022 | 423 |
| 34 | 3300046491 | Ga0495584_0000210 | Ga0495584_0000210_17271_18584 | 423 |
| 35 | 3300046519 | Ga0495632_0033510 | Ga0495632_0033510_781_2094 | 423 |
| 36 | 3300046520 | Ga0495637_0000169 | Ga0495637_0000169_26904_28217 | 423 |
| 37 | 3300046665 | Ga0495661_0000258 | Ga0495661_0000258_23668_24981 | 423 |
| 38 | 3300053138 | Ga0500564_041249 | Ga0500564_041249_746_2023 | 423 |
| 39 | 3300005288 | Ga0065714_10068111 | Ga0065714_100681112 | 424 |
| 40 | 3300009011 | Ga0105251_10001908 | Ga0105251_100019085 | 424 |
| 41 | 3300015265 | Ga0182005_1000579 | Ga0182005_10005799 | 424 |
| 42 | 3300025735 | Ga0207713_1001686 | Ga0207713_100168615 | 424 |
| 43 | 3300041405 | Ga0439438_000623 | Ga0439438_000623_4042_5355 | 424 |
| 44 | 3300041411 | Ga0439466_0000429 | Ga0439466_0000429_4550_5863 | 424 |
| 45 | 3300042006 | Ga0439432_000177 | Ga0439432_000177_4525_5838 | 424 |
| 46 | 3300042009 | Ga0439451_000069 | Ga0439451_000069_14996_16309 | 424 |
| 47 | 3300042010 | Ga0439452_000517 | Ga0439452_000517_3854_5167 | 424 |
| 48 | 3300042013 | Ga0439456_001562 | Ga0439456_001562_2332_3645 | 424 |
| 49 | 3300046458 | Ga0495591_001291 | Ga0495591_001291_3783_5096 | 424 |
| 50 | 3300046460 | Ga0495638_0000602 | Ga0495638_0000602_25030_26343 | 424 |
| 51 | 3300046471 | Ga0495650_0000454 | Ga0495650_0000454_56663_57976 | 424 |
| 52 | 3300046471 | Ga0495650_0021959 | Ga0495650_0021959_985_2298 | 424 |
| 53 | 3300046474 | Ga0495605_0000214 | Ga0495605_0000214_34390_35703 | 424 |
| 54 | 3300046474 | Ga0495605_0027315 | Ga0495605_0027315_1181_2494 | 424 |
| 55 | 3300046501 | Ga0495607_0024387 | Ga0495607_0024387_1841_3154 | 424 |
| 56 | 3300046506 | Ga0495583_0000553 | Ga0495583_0000553_9442_10755 | 424 |
| 57 | 3300046506 | Ga0495583_0002085 | Ga0495583_0002085_1028_2341 | 424 |
| 58 | 3300046507 | Ga0495606_0000771 | Ga0495606_0000771_28113_29426 | 424 |
| 59 | 3300046512 | Ga0495610_0000805 | Ga0495610_0000805_11059_12372 | 424 |
| 60 | 3300046512 | Ga0495610_0017787 | Ga0495610_0017787_1733_3046 | 424 |
| 61 | 3300046515 | Ga0495620_0000266 | Ga0495620_0000266_28313_29626 | 424 |
| 62 | 3300046519 | Ga0495632_0000110 | Ga0495632_0000110_23300_24613 | 424 |
| 63 | 3300046519 | Ga0495632_0000393 | Ga0495632_0000393_24546_25859 | 424 |
| 64 | 3300046520 | Ga0495637_0005579 | Ga0495637_0005579_5040_6353 | 424 |
| 65 | 3300046524 | Ga0495648_0000848 | Ga0495648_0000848_5695_7008 | 424 |
| 66 | 3300046538 | Ga0495609_0008264 | Ga0495609_0008264_3533_4846 | 424 |
| 67 | 3300046665 | Ga0495661_0000649 | Ga0495661_0000649_8614_9927 | 424 |
| 68 | 3300046665 | Ga0495661_0004690 | Ga0495661_0004690_7074_8387 | 424 |
| 69 | 3300047321 | Ga0495676_0000567 | Ga0495676_0000567_16675_17988 | 424 |
| 70 | 3300047446 | Ga0495679_001063 | Ga0495679_001063_12500_13813 | 424 |
| 71 | 3300047470 | Ga0495681_0000196 | Ga0495681_0000196_16447_17760 | 424 |
| 72 | 3300048927 | Ga0496124_0001999 | Ga0496124_0001999_20037_21350 | 424 |
| 73 | 3300049459 | Ga0495678_007148 | Ga0495678_007148_803_2116 | 424 |
| 74 | iso_pu_bacteria | 2857627736 | 2857632398 | 426 |
| 75 | iso_pu_bacteria | 2945997725 | 2945998389 | 426 |
| 76 | 3300042016 | Ga0439463_000134 | Ga0439463_000134_4372_5694 | 427 |
| 77 | iso_pu_bacteria | 2585427687 | 2586209645 | 427 |
| 78 | iso_pu_bacteria | 2739367857 | 2740002883 | 427 |
| 79 | iso_pu_bacteria | 2739367858 | 2740007700 | 427 |
| 80 | iso_pu_bacteria | 2914759650 | 2914761990 | 427 |
| 81 | 3300003322 | rootL2_10215171 | rootL2_102151715 | 428 |
| 82 | 3300005455 | Ga0070663_100000402 | Ga0070663_10000040210 | 428 |
| 83 | 3300006195 | Ga0075366_10000031 | Ga0075366_1000003110 | 428 |
| 84 | 3300013102 | Ga0157371_10004164 | Ga0157371_100041648 | 428 |
| 85 | 3300013104 | Ga0157370_10038265 | Ga0157370_100382654 | 428 |
| 86 | 3300017792 | Ga0163161_10013775 | Ga0163161_100137752 | 428 |
| 87 | 3300032004 | Ga0307414_10000198 | Ga0307414_1000019820 | 428 |
| 88 | 3300032004 | Ga0307414_10000538 | Ga0307414_1000053812 | 428 |
| 89 | 3300032005 | Ga0307411_10000004 | Ga0307411_1000000450 | 428 |
| 90 | 3300046524 | Ga0495648_0004260 | Ga0495648_0004260_3991_5292 | 428 |
| 91 | 3300046538 | Ga0495609_0012385 | Ga0495609_0012385_219_1520 | 428 |
| 92 | 3300046616 | Ga0495668_0000673 | Ga0495668_0000673_16487_17788 | 428 |
| 93 | 3300050493 | nmdc:mga0k408_85_c1 | nmdc:mga0k408_85_c1_6356_7657 | 428 |
| 94 | 3300002737 | JGI25162J39368_1000120 | JGI25162J39368_100012059 | 429 |
| 95 | 3300003578 | Ga0006562J51391_1008496 | Ga0006562J51391_100849610 | 429 |
| 96 | 3300009545 | Ga0105237_10001258 | Ga0105237_1000125811 | 429 |
| 97 | 3300009545 | Ga0105237_10001646 | Ga0105237_100016468 | 429 |
| 98 | 3300009545 | Ga0105237_10075539 | Ga0105237_100755393 | 429 |
| 99 | 3300010375 | Ga0105239_10000421 | Ga0105239_1000042116 | 429 |
| 100 | 3300010375 | Ga0105239_10001138 | Ga0105239_1000113813 | 429 |
| 101 | 3300010375 | Ga0105239_10001525 | Ga0105239_1000152519 | 429 |
| 102 | 3300013100 | Ga0157373_10000047 | Ga0157373_1000004788 | 429 |
| 103 | 3300013102 | Ga0157371_10002039 | Ga0157371_1000203910 | 429 |
| 104 | 3300013104 | Ga0157370_10000508 | Ga0157370_100005082 | 429 |
| 105 | 3300013105 | Ga0157369_10000572 | Ga0157369_100005722 | 429 |
| 106 | 3300025233 | Ga0209437_100143 | Ga0209437_10014319 | 429 |
| 107 | 3300025261 | Ga0209233_1001868 | Ga0209233_10018686 | 429 |
| 108 | 3300025914 | Ga0207671_10000987 | Ga0207671_1000098718 | 429 |
| 109 | 3300025914 | Ga0207671_10001650 | Ga0207671_1000165016 | 429 |
| 110 | 3300041407 | Ga0439447_000592 | Ga0439447_000592_6050_7354 | 429 |
| 111 | 3300048927 | Ga0496124_0005236 | Ga0496124_0005236_10287_11591 | 429 |
| 112 | 3300049679 | Ga0501249_000029 | Ga0501249_000029_26150_27454 | 429 |
| 113 | 3300046518 | Ga0495631_0000838 | Ga0495631_0000838_11117_12418 | 430 |
| 114 | 3300047446 | Ga0495679_000373 | Ga0495679_000373_23606_24907 | 430 |
| 115 | 3300048920 | Ga0496117_0002526 | Ga0496117_0002526_4978_6279 | 430 |
| 116 | 3300048921 | Ga0496118_0002734 | Ga0496118_0002734_5252_6553 | 430 |
| 117 | iso_pu_bacteria | 2511231007 | 2511273015 | 430 |
| 118 | iso_pu_bacteria | 2513237082 | 2513555969 | 430 |
| 119 | iso_pu_bacteria | 2515154123 | 2515688494 | 430 |
| 120 | iso_pu_bacteria | 2599185160 | 2599353821 | 430 |
| 121 | iso_pu_bacteria | 2599185164 | 2599378929 | 430 |
| 122 | iso_pu_bacteria | 2599185165 | 2599386093 | 430 |
| 123 | iso_pu_bacteria | 2599185181 | 2599460655 | 430 |
| 124 | iso_pu_bacteria | 2599185186 | 2599489676 | 430 |
| 125 | iso_pu_bacteria | 2599185356 | 2600213268 | 430 |
| 126 | iso_pu_bacteria | 2600255313 | 2601773435 | 430 |
| 127 | iso_pu_bacteria | 2738541276 | 2738714005 | 430 |
| 128 | iso_pu_bacteria | 2834028612 | 2834029596 | 430 |
| 129 | iso_pu_bacteria | 2846033681 | 2846034742 | 430 |
| 130 | iso_pu_bacteria | 2932422444 | 2932426367 | 430 |
| 131 | iso_pu_bacteria | 637000220 | 637322431 | 430 |
| 132 | iso_pu_bacteria | 641736154 | 642416137 | 430 |
| 133 | iso_pu_bacteria | 8020945358 | 8020951649 | 430 |
| 134 | iso_pu_bacteria | 8055817908 | 8055819695 | 430 |
| 135 | 3300009094 | Ga0111539_10204092 | Ga0111539_102040922 | 431 |
| 136 | 3300046514 | Ga0495618_0048852 | Ga0495618_0048852_429_1811 | 431 |
| 137 | 3300046642 | Ga0495634_0001931 | Ga0495634_0001931_378_1760 | 431 |
| 138 | 3300047319 | Ga0495674_0004286 | Ga0495674_0004286_8352_9734 | 431 |
| 139 | 3300053153 | Ga0500616_0002312 | Ga0500616_0002312_3269_4612 | 431 |
| 140 | iso_pu_bacteria | 2919688452 | 2919688637 | 431 |
| 141 | iso_pu_bacteria | 2855730933 | 2855735463 | 433 |
| 142 | iso_pu_bacteria | 2855767633 | 2855771246 | 433 |
| 143 | iso_pu_bacteria | 2881412998 | 2881416889 | 433 |
| 144 | iso_pu_bacteria | 2921643360 | 2921644691 | 433 |
| 145 | 3300001915 | JGI24741J21665_1008137 | JGI24741J21665_10081372 | 434 |
| 146 | 3300002705 | JGI25156J39149_1000313 | JGI25156J39149_100031318 | 434 |
| 147 | 3300002987 | JGI25159J45721_1002167 | JGI25159J45721_10021673 | 434 |
| 148 | 3300005262 | Ga0065165_1000167 | Ga0065165_10001676 | 434 |
| 149 | 3300005339 | Ga0070660_100000537 | Ga0070660_1000005379 | 434 |
| 150 | 3300005366 | Ga0070659_100002095 | Ga0070659_1000020957 | 434 |
| 151 | 3300005563 | Ga0068855_100003503 | Ga0068855_10000350315 | 434 |
| 152 | 3300009036 | Ga0105244_10000783 | Ga0105244_1000078321 | 434 |
| 153 | 3300009092 | Ga0105250_10002832 | Ga0105250_100028324 | 434 |
| 154 | 3300009093 | Ga0105240_10024586 | Ga0105240_100245866 | 434 |
| 155 | 3300009545 | Ga0105237_10046422 | Ga0105237_100464222 | 434 |
| 156 | 3300009551 | Ga0105238_10027418 | Ga0105238_100274184 | 434 |
| 157 | 3300010375 | Ga0105239_10008956 | Ga0105239_100089564 | 434 |
| 158 | 3300011119 | Ga0105246_10000244 | Ga0105246_1000024424 | 434 |
| 159 | 3300011119 | Ga0105246_10000490 | Ga0105246_100004904 | 434 |
| 160 | 3300013100 | Ga0157373_10025559 | Ga0157373_100255592 | 434 |
| 161 | 3300013104 | Ga0157370_10002664 | Ga0157370_100026644 | 434 |
| 162 | 3300013104 | Ga0157370_10023559 | Ga0157370_100235592 | 434 |
| 163 | 3300013104 | Ga0157370_10033974 | Ga0157370_100339742 | 434 |
| 164 | 3300013296 | Ga0157374_10259788 | Ga0157374_102597881 | 434 |
| 165 | 3300013308 | Ga0157375_10000629 | Ga0157375_1000062910 | 434 |
| 166 | 3300014497 | Ga0182008_10000118 | Ga0182008_1000011846 | 434 |
| 167 | 3300014497 | Ga0182008_10013366 | Ga0182008_100133662 | 434 |
| 168 | 3300015261 | Ga0182006_1000366 | Ga0182006_100036622 | 434 |
| 169 | 3300015265 | Ga0182005_1001431 | Ga0182005_10014317 | 434 |
| 170 | 3300025228 | Ga0209672_100532 | Ga0209672_10053219 | 434 |
| 171 | 3300025256 | Ga0209759_1000562 | Ga0209759_100056217 | 434 |
| 172 | 3300025284 | Ga0209130_1000016 | Ga0209130_1000016263 | 434 |
| 173 | 3300025302 | Ga0207426_1004366 | Ga0207426_10043664 | 434 |
| 174 | 3300025711 | Ga0207696_1017168 | Ga0207696_10171682 | 434 |
| 175 | 3300025728 | Ga0207655_1001036 | Ga0207655_100103623 | 434 |
| 176 | 3300025904 | Ga0207647_10059443 | Ga0207647_100594432 | 434 |
| 177 | 3300025913 | Ga0207695_10011856 | Ga0207695_100118564 | 434 |
| 178 | 3300025914 | Ga0207671_10035500 | Ga0207671_100355003 | 434 |
| 179 | 3300025919 | Ga0207657_10001827 | Ga0207657_1000182717 | 434 |
| 180 | 3300025924 | Ga0207694_10026822 | Ga0207694_100268224 | 434 |
| 181 | 3300025932 | Ga0207690_10000615 | Ga0207690_1000061517 | 434 |
| 182 | 3300025949 | Ga0207667_10003296 | Ga0207667_1000329614 | 434 |
| 183 | 3300025949 | Ga0207667_10050793 | Ga0207667_100507934 | 434 |
| 184 | 3300026067 | Ga0207678_10006529 | Ga0207678_100065297 | 434 |
| 185 | 3300032002 | Ga0307416_100002543 | Ga0307416_1000025438 | 434 |
| 186 | 3300037471 | Ga0395905_0073982 | Ga0395905_0073982_625_1938 | 434 |
| 187 | 3300042876 | Ga0451577_0031747 | Ga0451577_0031747_1301_2617 | 434 |
| 188 | 3300042876 | Ga0451577_0133079 | Ga0451577_0133079_425_1741 | 434 |
| 189 | 3300044673 | Ga0453683_0041045 | Ga0453683_0041045_1440_2756 | 434 |
| 190 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_677317_678633 | 434 |
| 191 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_692682_693998 | 434 |
| 192 | 3300046530 | Ga0495654_0057004 | Ga0495654_0057004_272_1585 | 434 |
| 193 | 3300046616 | Ga0495668_0000188 | Ga0495668_0000188_9391_10704 | 434 |
| 194 | 3300046665 | Ga0495661_0000723 | Ga0495661_0000723_8527_9840 | 434 |
| 195 | 3300047472 | Ga0495686_0002414 | Ga0495686_0002414_6377_7690 | 434 |
| 196 | 3300048904 | Ga0496101_0037710 | Ga0496101_0037710_1550_2869 | 434 |
| 197 | 3300048907 | Ga0496104_0034953 | Ga0496104_0034953_3302_4621 | 434 |
| 198 | 3300048915 | Ga0496112_0090760 | Ga0496112_0090760_849_2168 | 434 |
| 199 | 3300048919 | Ga0496116_0015775 | Ga0496116_0015775_1711_3030 | 434 |
| 200 | 3300048924 | Ga0496121_0000518 | Ga0496121_0000518_65829_67142 | 434 |
| 201 | 3300048924 | Ga0496121_0002258 | Ga0496121_0002258_22234_23547 | 434 |
| 202 | 3300048924 | Ga0496121_0006329 | Ga0496121_0006329_2374_3693 | 434 |
| 203 | 3300048925 | Ga0496122_0043622 | Ga0496122_0043622_847_2166 | 434 |
| 204 | 3300048926 | Ga0496123_0061352 | Ga0496123_0061352_586_1905 | 434 |
| 205 | 3300048927 | Ga0496124_0036082 | Ga0496124_0036082_967_2286 | 434 |
| 206 | 3300048928 | Ga0496125_0007187 | Ga0496125_0007187_3540_4859 | 434 |
| 207 | 3300048928 | Ga0496125_0085069 | Ga0496125_0085069_952_2265 | 434 |
| 208 | 3300048929 | Ga0496126_0004264 | Ga0496126_0004264_1887_3200 | 434 |
| 209 | 3300048929 | Ga0496126_0011383 | Ga0496126_0011383_587_1900 | 434 |
| 210 | 3300050509 | nmdc:mga0qj67_99486_c2 | nmdc:mga0qj67_99486_c2_271_1599 | 434 |
| 211 | 3300050510 | nmdc:mga06r32_78583_c1 | nmdc:mga06r32_78583_c1_432_1760 | 434 |
| 212 | 3300053161 | Ga0500634_0000104 | Ga0500634_0000104_8556_9869 | 434 |
| 213 | iso_pu_bacteria | 2600255292 | 2601666666 | 434 |
| 214 | iso_pu_bacteria | 2600255292 | 2601667177 | 434 |
| 215 | iso_pu_bacteria | 2600255292 | 2601670720 | 434 |
| 216 | iso_pu_bacteria | 2600255292 | 2601671165 | 434 |
| 217 | iso_pu_bacteria | 2643221638 | 2644214911 | 434 |
| 218 | iso_pu_bacteria | 2857547612 | 2857548431 | 434 |
| 219 | iso_pu_bacteria | 2857558681 | 2857564182 | 434 |
| 220 | iso_pu_bacteria | 2885080285 | 2885084626 | 434 |
| 221 | 3300005335 | Ga0070666_10006119 | Ga0070666_100061192 | 435 |
| 222 | 3300005344 | Ga0070661_100130914 | Ga0070661_1001309142 | 435 |
| 223 | 3300005438 | Ga0070701_10014086 | Ga0070701_100140863 | 435 |
| 224 | 3300005444 | Ga0070694_100040557 | Ga0070694_1000405573 | 435 |
| 225 | 3300005444 | Ga0070694_100072341 | Ga0070694_1000723412 | 435 |
| 226 | 3300005457 | Ga0070662_100075240 | Ga0070662_1000752402 | 435 |
| 227 | 3300005466 | Ga0070685_10020109 | Ga0070685_100201091 | 435 |
| 228 | 3300005617 | Ga0068859_100042590 | Ga0068859_1000425902 | 435 |
| 229 | 3300006178 | Ga0075367_10057980 | Ga0075367_100579802 | 435 |
| 230 | 3300006186 | Ga0075369_10000158 | Ga0075369_100001587 | 435 |
| 231 | 3300006195 | Ga0075366_10028312 | Ga0075366_100283124 | 435 |
| 232 | 3300006353 | Ga0075370_10020179 | Ga0075370_100201792 | 435 |
| 233 | 3300006931 | Ga0097620_100042591 | Ga0097620_1000425912 | 435 |
| 234 | 3300009094 | Ga0111539_10230499 | Ga0111539_102304992 | 435 |
| 235 | 3300013308 | Ga0157375_10000055 | Ga0157375_10000055111 | 435 |
| 236 | 3300025903 | Ga0207680_10003093 | Ga0207680_100030934 | 435 |
| 237 | 3300025918 | Ga0207662_10003922 | Ga0207662_100039225 | 435 |
| 238 | 3300025920 | Ga0207649_10077687 | Ga0207649_100776872 | 435 |
| 239 | 3300025933 | Ga0207706_10024393 | Ga0207706_100243932 | 435 |
| 240 | 3300025940 | Ga0207691_10000575 | Ga0207691_1000057514 | 435 |
| 241 | 3300026095 | Ga0207676_10121735 | Ga0207676_101217352 | 435 |
| 242 | 3300026142 | Ga0207698_10039959 | Ga0207698_100399593 | 435 |
| 243 | 3300031548 | Ga0307408_100000364 | Ga0307408_10000036426 | 435 |
| 244 | 3300035117 | Ga0373953_0003515 | Ga0373953_0003515_584_1921 | 435 |
| 245 | 3300035118 | Ga0373954_0010399 | Ga0373954_0010399_318_1655 | 435 |
| 246 | 3300035172 | Ga0373955_0003319 | Ga0373955_0003319_2105_3442 | 435 |
| 247 | 3300037312 | Ga0395899_0034707 | Ga0395899_0034707_1248_2567 | 435 |
| 248 | 3300037466 | Ga0395898_0185317 | Ga0395898_0185317_539_1858 | 435 |
| 249 | 3300037471 | Ga0395905_0004026 | Ga0395905_0004026_4041_5357 | 435 |
| 250 | 3300044658 | Ga0466972_0010263 | Ga0466972_0010263_1794_3110 | 435 |
| 251 | 3300045051 | Ga0451576_0038238 | Ga0451576_0038238_26_1369 | 435 |
| 252 | 3300046462 | Ga0495651_0057554 | Ga0495651_0057554_617_1954 | 435 |
| 253 | 3300046511 | Ga0495608_0020491 | Ga0495608_0020491_1169_2506 | 435 |
| 254 | 3300046516 | Ga0495628_0003452 | Ga0495628_0003452_11449_12786 | 435 |
| 255 | 3300046529 | Ga0495652_0093643 | Ga0495652_0093643_227_1564 | 435 |
| 256 | 3300046536 | Ga0495587_0031513 | Ga0495587_0031513_883_2220 | 435 |
| 257 | 3300046689 | Ga0495613_0111214 | Ga0495613_0111214_556_1893 | 435 |
| 258 | 3300047444 | Ga0495675_0005404 | Ga0495675_0005404_502_1839 | 435 |
| 259 | 3300047472 | Ga0495686_0000332 | Ga0495686_0000332_13611_14930 | 435 |
| 260 | 3300050496 | nmdc:mga07m45_31057_c1 | nmdc:mga07m45_31057_c1_348_1667 | 435 |
| 261 | 3300050511 | nmdc:mga08y16_32878_c1 | nmdc:mga08y16_32878_c1_2396_3733 | 435 |
| 262 | 3300050516 | nmdc:mga0sz30_67_c1 | nmdc:mga0sz30_67_c1_28968_30287 | 435 |
| 263 | 3300053084 | Ga0495595_0004581 | Ga0495595_0004581_3499_4836 | 435 |
| 264 | 3300053085 | Ga0495619_0022725 | Ga0495619_0022725_765_2102 | 435 |
| 265 | 3300053156 | Ga0500622_0000001 | Ga0500622_0000001_132598_133914 | 435 |
| 266 | iso_pu_bacteria | 2838054893 | 2838054979 | 435 |
| 267 | iso_pu_bacteria | 8047673197 | 8047675764 | 435 |
| 268 | 3300005327 | Ga0070658_10000596 | Ga0070658_1000059623 | 436 |
| 269 | 3300005366 | Ga0070659_100008464 | Ga0070659_1000084645 | 436 |
| 270 | 3300005563 | Ga0068855_100001138 | Ga0068855_10000113812 | 436 |
| 271 | 3300005563 | Ga0068855_100001663 | Ga0068855_10000166317 | 436 |
| 272 | 3300013104 | Ga0157370_10000485 | Ga0157370_1000048530 | 436 |
| 273 | 3300025254 | Ga0209148_1000237 | Ga0209148_100023772 | 436 |
| 274 | 3300025909 | Ga0207705_10000344 | Ga0207705_1000034431 | 436 |
| 275 | 3300025932 | Ga0207690_10009413 | Ga0207690_100094134 | 436 |
| 276 | 3300025941 | Ga0207711_10029581 | Ga0207711_100295812 | 436 |
| 277 | 3300025949 | Ga0207667_10000427 | Ga0207667_1000042719 | 436 |
| 278 | 3300025949 | Ga0207667_10012152 | Ga0207667_100121525 | 436 |
| 279 | 3300037466 | Ga0395898_0053628 | Ga0395898_0053628_1404_2726 | 436 |
| 280 | 3300045049 | Ga0466959_0039624 | Ga0466959_0039624_1014_2336 | 436 |
| 281 | 3300045836 | Ga0466958_0000259 | Ga0466958_0000259_8356_9678 | 436 |
| 282 | 3300046476 | Ga0495662_0091516 | Ga0495662_0091516_14_1363 | 436 |
| 283 | 3300046477 | Ga0495664_0006100 | Ga0495664_0006100_1268_2617 | 436 |
| 284 | 3300046511 | Ga0495608_0129179 | Ga0495608_0129179_254_1603 | 436 |
| 285 | 3300046533 | Ga0495640_0015795 | Ga0495640_0015795_477_1826 | 436 |
| 286 | 3300046663 | Ga0495635_0118510 | Ga0495635_0118510_430_1779 | 436 |
| 287 | 3300046665 | Ga0495661_0002383 | Ga0495661_0002383_9415_10734 | 436 |
| 288 | 3300047471 | Ga0495684_0072504 | Ga0495684_0072504_523_1872 | 436 |
| 289 | 3300048928 | Ga0496125_0084766 | Ga0496125_0084766_349_1674 | 436 |
| 290 | 3300050493 | nmdc:mga0k408_8160_c1 | nmdc:mga0k408_8160_c1_1642_2991 | 436 |
| 291 | 3300053108 | Ga0500562_012855 | Ga0500562_012855_440_1789 | 436 |
| 292 | 3300053724 | Ga0500570_000087 | Ga0500570_000087_8244_9602 | 436 |
| 293 | iso_pu_bacteria | 2585428058 | 2587731156 | 436 |
| 294 | 3300002738 | JGI25154J39366_1000711 | JGI25154J39366_10007116 | 437 |
| 295 | 3300002739 | JGI25158J39367_1000009 | JGI25158J39367_100000920 | 437 |
| 296 | 3300002987 | JGI25159J45721_1000778 | JGI25159J45721_10007787 | 437 |
| 297 | 3300003187 | JGI25151J46595_10001656 | JGI25151J46595_100016568 | 437 |
| 298 | 3300003374 | JGI25161J50226_1000115 | JGI25161J50226_100011525 | 437 |
| 299 | 3300003763 | Ga0055529_1000274 | Ga0055529_100027431 | 437 |
| 300 | 3300003771 | Ga0055526_1000085 | Ga0055526_100008513 | 437 |
| 301 | 3300003773 | Ga0055537_1000295 | Ga0055537_100029510 | 437 |
| 302 | 3300003775 | Ga0055524_1004778 | Ga0055524_10047784 | 437 |
| 303 | 3300003784 | Ga0055534_1000047 | Ga0055534_100004759 | 437 |
| 304 | 3300003790 | Ga0055528_1000049 | Ga0055528_10000498 | 437 |
| 305 | 3300004625 | Ga0055543_1000094 | Ga0055543_100009419 | 437 |
| 306 | 3300005262 | Ga0065165_1000434 | Ga0065165_100043425 | 437 |
| 307 | 3300005262 | Ga0065165_1014879 | Ga0065165_10148791 | 437 |
| 308 | 3300005262 | Ga0065165_1019668 | Ga0065165_10196682 | 437 |
| 309 | 3300006846 | Ga0075430_100000001 | Ga0075430_10000000172 | 437 |
| 310 | 3300006948 | Ga0099826_10000048 | Ga0099826_1000004816 | 437 |
| 311 | 3300014497 | Ga0182008_10002412 | Ga0182008_100024122 | 437 |
| 312 | 3300015261 | Ga0182006_1000010 | Ga0182006_1000010241 | 437 |
| 313 | 3300015262 | Ga0182007_10000021 | Ga0182007_1000002130 | 437 |
| 314 | 3300015262 | Ga0182007_10001040 | Ga0182007_100010405 | 437 |
| 315 | 3300021361 | Ga0213872_10000136 | Ga0213872_1000013637 | 437 |
| 316 | 3300021361 | Ga0213872_10000546 | Ga0213872_100005469 | 437 |
| 317 | 3300021361 | Ga0213872_10005357 | Ga0213872_100053574 | 437 |
| 318 | 3300021361 | Ga0213872_10010598 | Ga0213872_100105983 | 437 |
| 319 | 3300025208 | Ga0209436_100042 | Ga0209436_10004229 | 437 |
| 320 | 3300025233 | Ga0209437_106660 | Ga0209437_1066602 | 437 |
| 321 | 3300025246 | Ga0209646_1000169 | Ga0209646_100016946 | 437 |
| 322 | 3300025250 | Ga0209026_1005102 | Ga0209026_10051023 | 437 |
| 323 | 3300025258 | Ga0209129_1000329 | Ga0209129_100032910 | 437 |
| 324 | 3300025272 | Ga0209455_1000253 | Ga0209455_100025331 | 437 |
| 325 | 3300025284 | Ga0209130_1000227 | Ga0209130_100022725 | 437 |
| 326 | 3300025284 | Ga0209130_1004602 | Ga0209130_10046022 | 437 |
| 327 | 3300025294 | Ga0209025_1000039 | Ga0209025_1000039122 | 437 |
| 328 | 3300025294 | Ga0209025_1001164 | Ga0209025_100116410 | 437 |
| 329 | 3300025295 | Ga0209564_1000010 | Ga0209564_1000010691 | 437 |
| 330 | 3300025302 | Ga0207426_1031442 | Ga0207426_10314422 | 437 |
| 331 | 3300025918 | Ga0207662_10022336 | Ga0207662_100223363 | 437 |
| 332 | 3300027666 | Ga0209282_1000066 | Ga0209282_100006665 | 437 |
| 333 | 3300031507 | Ga0307509_10160307 | Ga0307509_101603072 | 437 |
| 334 | 3300031711 | Ga0265314_10034537 | Ga0265314_100345373 | 437 |
| 335 | 3300037312 | Ga0395899_0000281 | Ga0395899_0000281_55981_57315 | 437 |
| 336 | 3300037418 | Ga0395900_0072758 | Ga0395900_0072758_2029_3360 | 437 |
| 337 | 3300038443 | Ga0395901_0100568 | Ga0395901_0100568_71_1402 | 437 |
| 338 | 3300039062 | Ga0400483_277560 | Ga0400483_277560_107_1429 | 437 |
| 339 | 3300039447 | Ga0436361_0141619 | Ga0436361_0141619_2825_4150 | 437 |
| 340 | 3300039447 | Ga0436361_0399468 | Ga0436361_0399468_1365_2690 | 437 |
| 341 | 3300039447 | Ga0436361_0658458 | Ga0436361_0658458_10101_11426 | 437 |
| 342 | 3300039447 | Ga0436361_0954756 | Ga0436361_0954756_12201_13526 | 437 |
| 343 | 3300046452 | Ga0495617_002792 | Ga0495617_002792_37_1362 | 437 |
| 344 | 3300046457 | Ga0495590_0000056 | Ga0495590_0000056_20274_21599 | 437 |
| 345 | 3300046457 | Ga0495590_0008633 | Ga0495590_0008633_2347_3669 | 437 |
| 346 | 3300046460 | Ga0495638_0003410 | Ga0495638_0003410_1856_3181 | 437 |
| 347 | 3300046471 | Ga0495650_0000284 | Ga0495650_0000284_34351_35676 | 437 |
| 348 | 3300046471 | Ga0495650_0001444 | Ga0495650_0001444_9308_10633 | 437 |
| 349 | 3300046474 | Ga0495605_0000102 | Ga0495605_0000102_90056_91381 | 437 |
| 350 | 3300046475 | Ga0495639_0004282 | Ga0495639_0004282_3377_4702 | 437 |
| 351 | 3300046491 | Ga0495584_0093572 | Ga0495584_0093572_162_1493 | 437 |
| 352 | 3300046492 | Ga0495585_0001745 | Ga0495585_0001745_3366_4694 | 437 |
| 353 | 3300046507 | Ga0495606_0000149 | Ga0495606_0000149_30405_31730 | 437 |
| 354 | 3300046507 | Ga0495606_0002350 | Ga0495606_0002350_6449_7774 | 437 |
| 355 | 3300046507 | Ga0495606_0032269 | Ga0495606_0032269_188_1513 | 437 |
| 356 | 3300046513 | Ga0495616_0069273 | Ga0495616_0069273_61_1395 | 437 |
| 357 | 3300046520 | Ga0495637_0000487 | Ga0495637_0000487_10723_12048 | 437 |
| 358 | 3300046522 | Ga0495643_0002037 | Ga0495643_0002037_6615_7949 | 437 |
| 359 | 3300046522 | Ga0495643_0004493 | Ga0495643_0004493_4149_5474 | 437 |
| 360 | 3300046524 | Ga0495648_0000119 | Ga0495648_0000119_13111_14436 | 437 |
| 361 | 3300046524 | Ga0495648_0020734 | Ga0495648_0020734_1418_2743 | 437 |
| 362 | 3300046528 | Ga0495642_0001112 | Ga0495642_0001112_7289_8614 | 437 |
| 363 | 3300046557 | Ga0495622_0000574 | Ga0495622_0000574_8654_9979 | 437 |
| 364 | 3300046558 | Ga0495633_0000088 | Ga0495633_0000088_112282_113607 | 437 |
| 365 | 3300046615 | Ga0495656_0009942 | Ga0495656_0009942_1412_2737 | 437 |
| 366 | 3300046616 | Ga0495668_0001028 | Ga0495668_0001028_20176_21501 | 437 |
| 367 | 3300046660 | Ga0495625_0001607 | Ga0495625_0001607_11367_12692 | 437 |
| 368 | 3300046665 | Ga0495661_0001310 | Ga0495661_0001310_16045_17370 | 437 |
| 369 | 3300046694 | Ga0495649_0000350 | Ga0495649_0000350_10854_12188 | 437 |
| 370 | 3300046794 | Ga0495589_0000834 | Ga0495589_0000834_14136_15461 | 437 |
| 371 | 3300046810 | Ga0495660_0000042 | Ga0495660_0000042_70549_71874 | 437 |
| 372 | 3300046810 | Ga0495660_0000938 | Ga0495660_0000938_1017_2342 | 437 |
| 373 | 3300047320 | Ga0495672_0000125 | Ga0495672_0000125_21492_22820 | 437 |
| 374 | 3300047320 | Ga0495672_0001479 | Ga0495672_0001479_19056_20381 | 437 |
| 375 | 3300047323 | Ga0495683_0022084 | Ga0495683_0022084_1809_3134 | 437 |
| 376 | 3300047443 | Ga0495687_000988 | Ga0495687_000988_15947_17272 | 437 |
| 377 | 3300047445 | Ga0495677_0011379 | Ga0495677_0011379_714_2039 | 437 |
| 378 | 3300047469 | Ga0495673_0000146 | Ga0495673_0000146_20338_21663 | 437 |
| 379 | 3300047469 | Ga0495673_0000146 | Ga0495673_0000146_26534_27859 | 437 |
| 380 | 3300047472 | Ga0495686_0003633 | Ga0495686_0003633_4490_5815 | 437 |
| 381 | 3300047472 | Ga0495686_0096275 | Ga0495686_0096275_406_1731 | 437 |
| 382 | 3300048091 | Ga0495626_0000311 | Ga0495626_0000311_33848_35173 | 437 |
| 383 | 3300048091 | Ga0495626_0002471 | Ga0495626_0002471_5999_7330 | 437 |
| 384 | 3300048920 | Ga0496117_0000010 | Ga0496117_0000010_444290_445615 | 437 |
| 385 | 3300048921 | Ga0496118_0000009 | Ga0496118_0000009_166340_167665 | 437 |
| 386 | 3300048924 | Ga0496121_0002120 | Ga0496121_0002120_23139_24464 | 437 |
| 387 | 3300048927 | Ga0496124_0003913 | Ga0496124_0003913_11293_12615 | 437 |
| 388 | 3300048927 | Ga0496124_0025815 | Ga0496124_0025815_2084_3409 | 437 |
| 389 | 3300049459 | Ga0495678_002507 | Ga0495678_002507_10214_11539 | 437 |
| 390 | 3300049459 | Ga0495678_006851 | Ga0495678_006851_635_1960 | 437 |
| 391 | 3300050515 | nmdc:mga0a205_78965_c1 | nmdc:mga0a205_78965_c1_1611_2963 | 437 |
| 392 | 3300053133 | Ga0500655_000476 | Ga0500655_000476_6308_7642 | 437 |
| 393 | 3300053136 | Ga0500559_0000788 | Ga0500559_0000788_2916_4274 | 437 |
| 394 | 3300053151 | Ga0500604_0000190 | Ga0500604_0000190_15707_17041 | 437 |
| 395 | 3300005333 | Ga0070677_10066497 | Ga0070677_100664971 | 438 |
| 396 | 3300005347 | Ga0070668_100035103 | Ga0070668_1000351033 | 438 |
| 397 | 3300005353 | Ga0070669_100006723 | Ga0070669_1000067234 | 438 |
| 398 | 3300005354 | Ga0070675_100031164 | Ga0070675_1000311642 | 438 |
| 399 | 3300005354 | Ga0070675_100234542 | Ga0070675_1002345422 | 438 |
| 400 | 3300005364 | Ga0070673_100164007 | Ga0070673_1001640072 | 438 |
| 401 | 3300005441 | Ga0070700_100041253 | Ga0070700_1000412532 | 438 |
| 402 | 3300005457 | Ga0070662_100010169 | Ga0070662_1000101692 | 438 |
| 403 | 3300005459 | Ga0068867_100127973 | Ga0068867_1001279732 | 438 |
| 404 | 3300005543 | Ga0070672_100008613 | Ga0070672_1000086132 | 438 |
| 405 | 3300005564 | Ga0070664_100032833 | Ga0070664_1000328333 | 438 |
| 406 | 3300005618 | Ga0068864_100070993 | Ga0068864_1000709933 | 438 |
| 407 | 3300005719 | Ga0068861_100045828 | Ga0068861_1000458283 | 438 |
| 408 | 3300005843 | Ga0068860_100054861 | Ga0068860_1000548612 | 438 |
| 409 | 3300009176 | Ga0105242_10002227 | Ga0105242_100022277 | 438 |
| 410 | 3300009177 | Ga0105248_10016734 | Ga0105248_100167344 | 438 |
| 411 | 3300013306 | Ga0163162_10066203 | Ga0163162_100662032 | 438 |
| 412 | 3300013307 | Ga0157372_10034561 | Ga0157372_100345612 | 438 |
| 413 | 3300013308 | Ga0157375_10073477 | Ga0157375_100734772 | 438 |
| 414 | 3300014325 | Ga0163163_10067469 | Ga0163163_100674692 | 438 |
| 415 | 3300017792 | Ga0163161_10007796 | Ga0163161_100077965 | 438 |
| 416 | 3300025291 | Ga0209675_1000546 | Ga0209675_100054610 | 438 |
| 417 | 3300025315 | Ga0207697_10038625 | Ga0207697_100386252 | 438 |
| 418 | 3300025923 | Ga0207681_10003185 | Ga0207681_100031857 | 438 |
| 419 | 3300025925 | Ga0207650_10029108 | Ga0207650_100291083 | 438 |
| 420 | 3300025926 | Ga0207659_10016916 | Ga0207659_100169163 | 438 |
| 421 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009286 | 438 |
| 422 | 3300025931 | Ga0207644_10011155 | Ga0207644_100111556 | 438 |
| 423 | 3300025933 | Ga0207706_10016727 | Ga0207706_100167273 | 438 |
| 424 | 3300025934 | Ga0207686_10025577 | Ga0207686_100255772 | 438 |
| 425 | 3300025940 | Ga0207691_10067823 | Ga0207691_100678232 | 438 |
| 426 | 3300025941 | Ga0207711_10058424 | Ga0207711_100584243 | 438 |
| 427 | 3300025945 | Ga0207679_10033488 | Ga0207679_100334883 | 438 |
| 428 | 3300025960 | Ga0207651_10135283 | Ga0207651_101352832 | 438 |
| 429 | 3300025972 | Ga0207668_10047914 | Ga0207668_100479142 | 438 |
| 430 | 3300026075 | Ga0207708_10024712 | Ga0207708_100247124 | 438 |
| 431 | 3300026088 | Ga0207641_10043315 | Ga0207641_100433153 | 438 |
| 432 | 3300026089 | Ga0207648_10172059 | Ga0207648_101720592 | 438 |
| 433 | 3300026095 | Ga0207676_10139058 | Ga0207676_101390582 | 438 |
| 434 | 3300026118 | Ga0207675_100057789 | Ga0207675_1000577893 | 438 |
| 435 | 3300028381 | Ga0268264_10064467 | Ga0268264_100644672 | 438 |
| 436 | 3300031456 | Ga0307513_10152001 | Ga0307513_101520012 | 438 |
| 437 | 3300046528 | Ga0495642_0000742 | Ga0495642_0000742_4711_6039 | 438 |
| 438 | 3300048929 | Ga0496126_0008917 | Ga0496126_0008917_6540_7913 | 438 |
| 439 | 3300049581 | Ga0501047_0108738 | Ga0501047_0108738_730_2067 | 438 |
| 440 | 3300049822 | Ga0501035_0081534 | Ga0501035_0081534_1209_2546 | 438 |
| 441 | 3300049823 | Ga0501044_0041388 | Ga0501044_0041388_1684_3021 | 438 |
| 442 | iso_pu_bacteria | 2585428057 | 2587728093 | 438 |
| 443 | iso_pu_bacteria | 8055225921 | 8055226157 | 438 |
| 444 | 3300003320 | rootH2_10019449 | rootH2_1001944917 | 439 |
| 445 | 3300003322 | rootL2_10002855 | rootL2_100028553 | 439 |
| 446 | 3300003775 | Ga0055524_1000437 | Ga0055524_100043729 | 439 |
| 447 | 3300004625 | Ga0055543_1001560 | Ga0055543_10015606 | 439 |
| 448 | 3300005262 | Ga0065165_1000059 | Ga0065165_100005973 | 439 |
| 449 | 3300005262 | Ga0065165_1005158 | Ga0065165_10051586 | 439 |
| 450 | 3300005343 | Ga0070687_100013667 | Ga0070687_1000136673 | 439 |
| 451 | 3300005347 | Ga0070668_100002351 | Ga0070668_1000023516 | 439 |
| 452 | 3300005353 | Ga0070669_100000973 | Ga0070669_1000009739 | 439 |
| 453 | 3300005356 | Ga0070674_100061175 | Ga0070674_1000611752 | 439 |
| 454 | 3300005441 | Ga0070700_100001055 | Ga0070700_10000105513 | 439 |
| 455 | 3300005459 | Ga0068867_100000453 | Ga0068867_10000045316 | 439 |
| 456 | 3300005544 | Ga0070686_100013387 | Ga0070686_1000133873 | 439 |
| 457 | 3300006195 | Ga0075366_10019499 | Ga0075366_100194993 | 439 |
| 458 | 3300006353 | Ga0075370_10022825 | Ga0075370_100228253 | 439 |
| 459 | 3300006881 | Ga0068865_100001312 | Ga0068865_10000131213 | 439 |
| 460 | 3300006944 | Ga0099823_1000804 | Ga0099823_100080416 | 439 |
| 461 | 3300009174 | Ga0105241_10012640 | Ga0105241_100126404 | 439 |
| 462 | 3300014745 | Ga0157377_10000088 | Ga0157377_1000008852 | 439 |
| 463 | 3300025273 | Ga0209673_1004452 | Ga0209673_10044525 | 439 |
| 464 | 3300025273 | Ga0209673_1018432 | Ga0209673_10184322 | 439 |
| 465 | 3300025298 | Ga0209050_1004070 | Ga0209050_10040704 | 439 |
| 466 | 3300025299 | Ga0209256_1000424 | Ga0209256_100042444 | 439 |
| 467 | 3300025303 | Ga0209051_1000469 | Ga0209051_100046922 | 439 |
| 468 | 3300025907 | Ga0207645_10004012 | Ga0207645_100040129 | 439 |
| 469 | 3300025911 | Ga0207654_10001203 | Ga0207654_100012034 | 439 |
| 470 | 3300025919 | Ga0207657_10036177 | Ga0207657_100361772 | 439 |
| 471 | 3300025923 | Ga0207681_10000703 | Ga0207681_100007039 | 439 |
| 472 | 3300025925 | Ga0207650_10022834 | Ga0207650_100228344 | 439 |
| 473 | 3300025933 | Ga0207706_10105166 | Ga0207706_101051663 | 439 |
| 474 | 3300025937 | Ga0207669_10001655 | Ga0207669_100016557 | 439 |
| 475 | 3300026075 | Ga0207708_10002545 | Ga0207708_1000254513 | 439 |
| 476 | 3300026089 | Ga0207648_10000019 | Ga0207648_1000001945 | 439 |
| 477 | 3300026089 | Ga0207648_10015132 | Ga0207648_100151325 | 439 |
| 478 | 3300027296 | Ga0209389_1000523 | Ga0209389_10005237 | 439 |
| 479 | 3300027876 | Ga0209974_10022224 | Ga0209974_100222242 | 439 |
| 480 | 3300028794 | Ga0307515_10006229 | Ga0307515_1000622912 | 439 |
| 481 | 3300028794 | Ga0307515_10034203 | Ga0307515_100342036 | 439 |
| 482 | 3300031548 | Ga0307408_100010473 | Ga0307408_1000104734 | 439 |
| 483 | 3300031548 | Ga0307408_100018733 | Ga0307408_1000187333 | 439 |
| 484 | 3300031649 | Ga0307514_10055238 | Ga0307514_100552382 | 439 |
| 485 | 3300031901 | Ga0307406_10060951 | Ga0307406_100609512 | 439 |
| 486 | 3300031995 | Ga0307409_100028312 | Ga0307409_1000283122 | 439 |
| 487 | 3300032002 | Ga0307416_100023247 | Ga0307416_1000232472 | 439 |
| 488 | 3300032126 | Ga0307415_100031436 | Ga0307415_1000314363 | 439 |
| 489 | 3300037312 | Ga0395899_0076856 | Ga0395899_0076856_870_2225 | 439 |
| 490 | 3300037418 | Ga0395900_0106887 | Ga0395900_0106887_1026_2381 | 439 |
| 491 | 3300042438 | Ga0439459_0001902 | Ga0439459_0001902_1229_2581 | 439 |
| 492 | 3300042532 | Ga0450893_0003082 | Ga0450893_0003082_657_2009 | 439 |
| 493 | 3300044683 | Ga0466965_0004523 | Ga0466965_0004523_4123_5478 | 439 |
| 494 | 3300044684 | Ga0466966_0000556 | Ga0466966_0000556_9596_10927 | 439 |
| 495 | 3300044693 | Ga0466961_0002510 | Ga0466961_0002510_8838_10169 | 439 |
| 496 | 3300044693 | Ga0466961_0065813 | Ga0466961_0065813_709_2064 | 439 |
| 497 | 3300044706 | Ga0466964_0000063 | Ga0466964_0000063_397_1752 | 439 |
| 498 | 3300045049 | Ga0466959_0000447 | Ga0466959_0000447_7251_8582 | 439 |
| 499 | 3300046457 | Ga0495590_0010545 | Ga0495590_0010545_1085_2437 | 439 |
| 500 | 3300046462 | Ga0495651_0000872 | Ga0495651_0000872_4403_5737 | 439 |
| 501 | 3300046474 | Ga0495605_0007367 | Ga0495605_0007367_1659_3014 | 439 |
| 502 | 3300046491 | Ga0495584_0002120 | Ga0495584_0002120_9806_11161 | 439 |
| 503 | 3300046501 | Ga0495607_0000962 | Ga0495607_0000962_11792_13147 | 439 |
| 504 | 3300046507 | Ga0495606_0004293 | Ga0495606_0004293_10749_12101 | 439 |
| 505 | 3300046513 | Ga0495616_0000178 | Ga0495616_0000178_28472_29827 | 439 |
| 506 | 3300046518 | Ga0495631_0000234 | Ga0495631_0000234_16826_18157 | 439 |
| 507 | 3300046518 | Ga0495631_0012128 | Ga0495631_0012128_1622_2974 | 439 |
| 508 | 3300046522 | Ga0495643_0017980 | Ga0495643_0017980_1908_3263 | 439 |
| 509 | 3300046528 | Ga0495642_0004309 | Ga0495642_0004309_3229_4581 | 439 |
| 510 | 3300046529 | Ga0495652_0038050 | Ga0495652_0038050_1569_2903 | 439 |
| 511 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_522450_523805 | 439 |
| 512 | 3300046558 | Ga0495633_0017087 | Ga0495633_0017087_1876_3228 | 439 |
| 513 | 3300046615 | Ga0495656_0046292 | Ga0495656_0046292_40_1395 | 439 |
| 514 | 3300046616 | Ga0495668_0005007 | Ga0495668_0005007_5428_6780 | 439 |
| 515 | 3300046665 | Ga0495661_0000207 | Ga0495661_0000207_41801_43156 | 439 |
| 516 | 3300046691 | Ga0495670_0007862 | Ga0495670_0007862_2481_3833 | 439 |
| 517 | 3300046794 | Ga0495589_0000009 | Ga0495589_0000009_213051_214406 | 439 |
| 518 | 3300047320 | Ga0495672_0055104 | Ga0495672_0055104_253_1608 | 439 |
| 519 | 3300047443 | Ga0495687_000013 | Ga0495687_000013_213051_214406 | 439 |
| 520 | 3300047443 | Ga0495687_000811 | Ga0495687_000811_13942_15294 | 439 |
| 521 | 3300047445 | Ga0495677_0000024 | Ga0495677_0000024_39867_41222 | 439 |
| 522 | 3300048088 | Ga0495602_0004979 | Ga0495602_0004979_8186_9520 | 439 |
| 523 | 3300048091 | Ga0495626_0000151 | Ga0495626_0000151_35453_36808 | 439 |
| 524 | 3300048091 | Ga0495626_0005839 | Ga0495626_0005839_644_1999 | 439 |
| 525 | 3300048905 | Ga0496102_0065520 | Ga0496102_0065520_103_1455 | 439 |
| 526 | 3300048927 | Ga0496124_0013995 | Ga0496124_0013995_2403_3755 | 439 |
| 527 | 3300048929 | Ga0496126_0003931 | Ga0496126_0003931_10800_12152 | 439 |
| 528 | 3300049523 | Ga0501300_005324 | Ga0501300_005324_491_1843 | 439 |
| 529 | 3300049571 | Ga0501034_0056451 | Ga0501034_0056451_257_1603 | 439 |
| 530 | 3300049574 | Ga0501038_0034733 | Ga0501038_0034733_2029_3375 | 439 |
| 531 | 3300049586 | Ga0501070_0089955 | Ga0501070_0089955_736_2082 | 439 |
| 532 | 3300049823 | Ga0501044_0012728 | Ga0501044_0012728_7177_8523 | 439 |
| 533 | 3300050493 | nmdc:mga0k408_16770_c1 | nmdc:mga0k408_16770_c1_1431_2783 | 439 |
| 534 | 3300050496 | nmdc:mga07m45_20565_c1 | nmdc:mga07m45_20565_c1_788_2140 | 439 |
| 535 | 3300053118 | Ga0500594_0001222 | Ga0500594_0001222_627_1964 | 439 |
| 536 | 3300053134 | Ga0500658_0001514 | Ga0500658_0001514_7712_9064 | 439 |
| 537 | 3300053154 | Ga0500619_001478 | Ga0500619_001478_2550_3884 | 439 |
| 538 | 3300053156 | Ga0500622_0038554 | Ga0500622_0038554_10_1362 | 439 |
| 539 | 3300053156 | Ga0500622_0053841 | Ga0500622_0053841_150_1502 | 439 |
| 540 | 3300005262 | Ga0065165_1019848 | Ga0065165_10198482 | 440 |
| 541 | 3300006048 | Ga0075363_100015353 | Ga0075363_1000153534 | 440 |
| 542 | 3300006177 | Ga0075362_10023250 | Ga0075362_100232502 | 440 |
| 543 | 3300006178 | Ga0075367_10003220 | Ga0075367_100032203 | 440 |
| 544 | 3300013307 | Ga0157372_10031659 | Ga0157372_100316592 | 440 |
| 545 | 3300025256 | Ga0209759_1000574 | Ga0209759_10005749 | 440 |
| 546 | 3300025256 | Ga0209759_1012361 | Ga0209759_10123612 | 440 |
| 547 | 3300025949 | Ga0207667_10100602 | Ga0207667_101006022 | 440 |
| 548 | 3300026116 | Ga0207674_10046818 | Ga0207674_100468184 | 440 |
| 549 | 3300029957 | Ga0265324_10000630 | Ga0265324_1000063021 | 440 |
| 550 | 3300031250 | Ga0265331_10005821 | Ga0265331_100058212 | 440 |
| 551 | 3300037312 | Ga0395899_0021800 | Ga0395899_0021800_2792_4147 | 440 |
| 552 | 3300037466 | Ga0395898_0047831 | Ga0395898_0047831_708_2063 | 440 |
| 553 | 3300037471 | Ga0395905_0038690 | Ga0395905_0038690_1805_3160 | 440 |
| 554 | 3300039447 | Ga0436361_0151105 | Ga0436361_0151105_3703_5052 | 440 |
| 555 | 3300044658 | Ga0466972_0022034 | Ga0466972_0022034_56_1390 | 440 |
| 556 | 3300044693 | Ga0466961_0000561 | Ga0466961_0000561_14042_15397 | 440 |
| 557 | 3300044765 | Ga0466970_0011421 | Ga0466970_0011421_1318_2673 | 440 |
| 558 | 3300044842 | Ga0466957_0014405 | Ga0466957_0014405_1247_2593 | 440 |
| 559 | 3300044842 | Ga0466957_0017135 | Ga0466957_0017135_518_1873 | 440 |
| 560 | 3300045836 | Ga0466958_0001672 | Ga0466958_0001672_7137_8492 | 440 |
| 561 | 3300046460 | Ga0495638_0121630 | Ga0495638_0121630_178_1524 | 440 |
| 562 | 3300046474 | Ga0495605_0032850 | Ga0495605_0032850_433_1776 | 440 |
| 563 | 3300046474 | Ga0495605_0065753 | Ga0495605_0065753_192_1535 | 440 |
| 564 | 3300046491 | Ga0495584_0008952 | Ga0495584_0008952_3330_4673 | 440 |
| 565 | 3300046492 | Ga0495585_0001382 | Ga0495585_0001382_3223_4566 | 440 |
| 566 | 3300046492 | Ga0495585_0002217 | Ga0495585_0002217_4824_6167 | 440 |
| 567 | 3300046500 | Ga0495596_0001107 | Ga0495596_0001107_3639_4982 | 440 |
| 568 | 3300046518 | Ga0495631_0016761 | Ga0495631_0016761_1916_3259 | 440 |
| 569 | 3300046523 | Ga0495644_0001354 | Ga0495644_0001354_2385_3728 | 440 |
| 570 | 3300046616 | Ga0495668_0003760 | Ga0495668_0003760_5693_7036 | 440 |
| 571 | 3300047446 | Ga0495679_000766 | Ga0495679_000766_7684_9027 | 440 |
| 572 | 3300047472 | Ga0495686_0001970 | Ga0495686_0001970_5188_6543 | 440 |
| 573 | 3300048091 | Ga0495626_0002177 | Ga0495626_0002177_12336_13679 | 440 |
| 574 | 3300048921 | Ga0496118_0047473 | Ga0496118_0047473_1162_2538 | 440 |
| 575 | 3300048922 | Ga0496119_0002272 | Ga0496119_0002272_18170_19546 | 440 |
| 576 | 3300050494 | nmdc:mga06z11_48728_c1 | nmdc:mga06z11_48728_c1_425_1762 | 440 |
| 577 | 3300053080 | Ga0500635_0000005 | Ga0500635_0000005_134276_135619 | 440 |
| 578 | 3300053129 | Ga0500628_000320 | Ga0500628_000320_1904_3268 | 440 |
| 579 | iso_pu_bacteria | 2839138175 | 2839140630 | 441 |
| 580 | 3300037068 | Ga0373925_0049088 | Ga0373925_0049088_683_2029 | 442 |
| 581 | 3300048905 | Ga0496102_0035649 | Ga0496102_0035649_2968_4317 | 442 |
| 582 | 3300053117 | Ga0500593_000185 | Ga0500593_000185_9379_10740 | 442 |
| 583 | 3300053154 | Ga0500619_000059 | Ga0500619_000059_12746_14092 | 442 |
| 584 | 3300005327 | Ga0070658_10001501 | Ga0070658_1000150111 | 443 |
| 585 | 3300005329 | Ga0070683_100018434 | Ga0070683_1000184344 | 443 |
| 586 | 3300005336 | Ga0070680_100038229 | Ga0070680_1000382294 | 443 |
| 587 | 3300005339 | Ga0070660_100003070 | Ga0070660_1000030706 | 443 |
| 588 | 3300005366 | Ga0070659_100008373 | Ga0070659_1000083735 | 443 |
| 589 | 3300005455 | Ga0070663_100073949 | Ga0070663_1000739492 | 443 |
| 590 | 3300005458 | Ga0070681_10204068 | Ga0070681_102040682 | 443 |
| 591 | 3300005530 | Ga0070679_100029494 | Ga0070679_1000294943 | 443 |
| 592 | 3300005535 | Ga0070684_100019423 | Ga0070684_1000194234 | 443 |
| 593 | 3300005549 | Ga0070704_100029675 | Ga0070704_1000296753 | 443 |
| 594 | 3300005564 | Ga0070664_100014244 | Ga0070664_1000142444 | 443 |
| 595 | 3300005578 | Ga0068854_100004322 | Ga0068854_1000043224 | 443 |
| 596 | 3300005616 | Ga0068852_100049228 | Ga0068852_1000492283 | 443 |
| 597 | 3300005834 | Ga0068851_10091645 | Ga0068851_100916451 | 443 |
| 598 | 3300009093 | Ga0105240_10016756 | Ga0105240_100167566 | 443 |
| 599 | 3300009174 | Ga0105241_10071856 | Ga0105241_100718562 | 443 |
| 600 | 3300009551 | Ga0105238_10034683 | Ga0105238_100346833 | 443 |
| 601 | 3300013100 | Ga0157373_10017878 | Ga0157373_100178782 | 443 |
| 602 | 3300013307 | Ga0157372_10048158 | Ga0157372_100481582 | 443 |
| 603 | 3300025913 | Ga0207695_10048140 | Ga0207695_100481403 | 443 |
| 604 | 3300025917 | Ga0207660_10017143 | Ga0207660_100171432 | 443 |
| 605 | 3300025919 | Ga0207657_10001327 | Ga0207657_1000132716 | 443 |
| 606 | 3300025920 | Ga0207649_10093041 | Ga0207649_100930412 | 443 |
| 607 | 3300025921 | Ga0207652_10038392 | Ga0207652_100383922 | 443 |
| 608 | 3300025924 | Ga0207694_10028497 | Ga0207694_100284972 | 443 |
| 609 | 3300025932 | Ga0207690_10207911 | Ga0207690_102079111 | 443 |
| 610 | 3300025944 | Ga0207661_10033723 | Ga0207661_100337234 | 443 |
| 611 | 3300025949 | Ga0207667_10028397 | Ga0207667_100283974 | 443 |
| 612 | 3300026041 | Ga0207639_10020960 | Ga0207639_100209603 | 443 |
| 613 | 3300026067 | Ga0207678_10100277 | Ga0207678_101002772 | 443 |
| 614 | 3300026116 | Ga0207674_10014731 | Ga0207674_100147314 | 443 |
| 615 | 3300026142 | Ga0207698_10047883 | Ga0207698_100478833 | 443 |
| 616 | 3300046501 | Ga0495607_0005543 | Ga0495607_0005543_2822_4168 | 443 |
| 617 | 3300046694 | Ga0495649_0000133 | Ga0495649_0000133_18243_19589 | 443 |
| 618 | 3300053125 | Ga0500618_000774 | Ga0500618_000774_3150_4496 | 443 |
| 619 | 3300006177 | Ga0075362_10000999 | Ga0075362_100009992 | 444 |
| 620 | 3300053108 | Ga0500562_000193 | Ga0500562_000193_1665_3017 | 444 |
| 621 | 3300053131 | Ga0500652_001105 | Ga0500652_001105_5488_6834 | 444 |
| 622 | iso_pu_bacteria | 2585428062 | 2587759337 | 444 |
| 623 | 3300006195 | Ga0075366_10014126 | Ga0075366_100141264 | 445 |
| 624 | 3300006353 | Ga0075370_10003436 | Ga0075370_100034367 | 445 |
| 625 | 3300009176 | Ga0105242_10010849 | Ga0105242_100108495 | 445 |
| 626 | 3300010159 | Ga0099796_10009326 | Ga0099796_100093262 | 445 |
| 627 | 3300025934 | Ga0207686_10071820 | Ga0207686_100718202 | 445 |
| 628 | 3300028794 | Ga0307515_10002251 | Ga0307515_1000225132 | 445 |
| 629 | 3300028794 | Ga0307515_10004349 | Ga0307515_1000434916 | 445 |
| 630 | 3300031507 | Ga0307509_10000904 | Ga0307509_1000090448 | 445 |
| 631 | 3300031649 | Ga0307514_10018767 | Ga0307514_100187672 | 445 |
| 632 | 3300033180 | Ga0307510_10002154 | Ga0307510_1000215420 | 445 |
| 633 | 3300033180 | Ga0307510_10003569 | Ga0307510_100035692 | 445 |
| 634 | 3300046512 | Ga0495610_0000505 | Ga0495610_0000505_17707_19059 | 445 |
| 635 | 3300046512 | Ga0495610_0022295 | Ga0495610_0022295_1435_2793 | 445 |
| 636 | 3300046530 | Ga0495654_0000349 | Ga0495654_0000349_20743_22095 | 445 |
| 637 | 3300046660 | Ga0495625_0000929 | Ga0495625_0000929_14689_16044 | 445 |
| 638 | 3300050493 | nmdc:mga0k408_5180_c1 | nmdc:mga0k408_5180_c1_303_1661 | 445 |
| 639 | 3300050496 | nmdc:mga07m45_51972_c1 | nmdc:mga07m45_51972_c1_693_2048 | 445 |
| 640 | 3300053739 | Ga0500587_000474 | Ga0500587_000474_2025_3383 | 445 |
| 641 | 3300029957 | Ga0265324_10000090 | Ga0265324_1000009029 | 446 |
| 642 | 3300005367 | Ga0070667_100000298 | Ga0070667_10000029833 | 447 |
| 643 | 3300005841 | Ga0068863_100003486 | Ga0068863_1000034866 | 447 |
| 644 | 3300005843 | Ga0068860_100000412 | Ga0068860_10000041234 | 447 |
| 645 | 3300006931 | Ga0097620_100027286 | Ga0097620_1000272863 | 447 |
| 646 | 3300025986 | Ga0207658_10000254 | Ga0207658_1000025433 | 447 |
| 647 | 3300026088 | Ga0207641_10002044 | Ga0207641_1000204414 | 447 |
| 648 | 3300028381 | Ga0268264_10000083 | Ga0268264_1000008333 | 447 |
| 649 | 3300031731 | Ga0307405_10038843 | Ga0307405_100388433 | 447 |
| 650 | 3300053121 | Ga0500607_000386 | Ga0500607_000386_13033_14400 | 447 |
| 651 | 3300005843 | Ga0068860_100016090 | Ga0068860_1000160904 | 448 |
| 652 | 3300025921 | Ga0207652_10171132 | Ga0207652_101711322 | 448 |
| 653 | 3300028381 | Ga0268264_10014029 | Ga0268264_100140294 | 448 |
| 654 | 3300037466 | Ga0395898_0063068 | Ga0395898_0063068_1069_2469 | 448 |
| 655 | 3300009545 | Ga0105237_10157673 | Ga0105237_101576732 | 449 |
| 656 | 3300025914 | Ga0207671_10098803 | Ga0207671_100988032 | 449 |
| 657 | 3300032126 | Ga0307415_100194317 | Ga0307415_1001943172 | 449 |
| 658 | 3300001989 | JGI24739J22299_10000336 | JGI24739J22299_100003365 | 450 |
| 659 | 3300002067 | JGI24735J21928_10002016 | JGI24735J21928_100020163 | 450 |
| 660 | 3300005330 | Ga0070690_100020398 | Ga0070690_1000203982 | 450 |
| 661 | 3300005331 | Ga0070670_100047220 | Ga0070670_1000472203 | 450 |
| 662 | 3300005338 | Ga0068868_100028844 | Ga0068868_1000288443 | 450 |
| 663 | 3300005338 | Ga0068868_100032871 | Ga0068868_1000328714 | 450 |
| 664 | 3300005347 | Ga0070668_100000850 | Ga0070668_10000085018 | 450 |
| 665 | 3300005353 | Ga0070669_100000372 | Ga0070669_10000037218 | 450 |
| 666 | 3300005353 | Ga0070669_100001543 | Ga0070669_1000015433 | 450 |
| 667 | 3300005355 | Ga0070671_100000287 | Ga0070671_10000028718 | 450 |
| 668 | 3300005355 | Ga0070671_100001504 | Ga0070671_1000015042 | 450 |
| 669 | 3300005364 | Ga0070673_100067301 | Ga0070673_1000673012 | 450 |
| 670 | 3300005367 | Ga0070667_100027529 | Ga0070667_1000275293 | 450 |
| 671 | 3300005457 | Ga0070662_100023027 | Ga0070662_1000230274 | 450 |
| 672 | 3300005457 | Ga0070662_100084037 | Ga0070662_1000840373 | 450 |
| 673 | 3300005459 | Ga0068867_100025227 | Ga0068867_1000252275 | 450 |
| 674 | 3300005539 | Ga0068853_100026442 | Ga0068853_1000264423 | 450 |
| 675 | 3300005543 | Ga0070672_100082270 | Ga0070672_1000822702 | 450 |
| 676 | 3300005548 | Ga0070665_100000152 | Ga0070665_10000015227 | 450 |
| 677 | 3300005548 | Ga0070665_100114759 | Ga0070665_1001147593 | 450 |
| 678 | 3300005563 | Ga0068855_100009842 | Ga0068855_1000098423 | 450 |
| 679 | 3300005577 | Ga0068857_100130081 | Ga0068857_1001300812 | 450 |
| 680 | 3300005578 | Ga0068854_100001405 | Ga0068854_1000014056 | 450 |
| 681 | 3300005578 | Ga0068854_100038590 | Ga0068854_1000385902 | 450 |
| 682 | 3300005578 | Ga0068854_100107715 | Ga0068854_1001077152 | 450 |
| 683 | 3300005616 | Ga0068852_100005716 | Ga0068852_1000057164 | 450 |
| 684 | 3300005617 | Ga0068859_100005526 | Ga0068859_10000552610 | 450 |
| 685 | 3300005718 | Ga0068866_10004108 | Ga0068866_100041086 | 450 |
| 686 | 3300005841 | Ga0068863_100007924 | Ga0068863_1000079242 | 450 |
| 687 | 3300005842 | Ga0068858_100022919 | Ga0068858_1000229195 | 450 |
| 688 | 3300005842 | Ga0068858_100033556 | Ga0068858_1000335565 | 450 |
| 689 | 3300005843 | Ga0068860_100001988 | Ga0068860_1000019884 | 450 |
| 690 | 3300005843 | Ga0068860_100009213 | Ga0068860_1000092136 | 450 |
| 691 | 3300005843 | Ga0068860_100101217 | Ga0068860_1001012171 | 450 |
| 692 | 3300006237 | Ga0097621_100015998 | Ga0097621_1000159984 | 450 |
| 693 | 3300006358 | Ga0068871_100060164 | Ga0068871_1000601642 | 450 |
| 694 | 3300006852 | Ga0075433_10046330 | Ga0075433_100463303 | 450 |
| 695 | 3300006931 | Ga0097620_100005526 | Ga0097620_10000552610 | 450 |
| 696 | 3300006931 | Ga0097620_100016879 | Ga0097620_1000168794 | 450 |
| 697 | 3300009011 | Ga0105251_10001577 | Ga0105251_100015777 | 450 |
| 698 | 3300009098 | Ga0105245_10011442 | Ga0105245_100114426 | 450 |
| 699 | 3300009101 | Ga0105247_10016494 | Ga0105247_100164942 | 450 |
| 700 | 3300009148 | Ga0105243_10005228 | Ga0105243_100052283 | 450 |
| 701 | 3300009174 | Ga0105241_10167234 | Ga0105241_101672342 | 450 |
| 702 | 3300009176 | Ga0105242_10024994 | Ga0105242_100249943 | 450 |
| 703 | 3300009177 | Ga0105248_10005696 | Ga0105248_1000569610 | 450 |
| 704 | 3300009177 | Ga0105248_10019448 | Ga0105248_100194484 | 450 |
| 705 | 3300009177 | Ga0105248_10048890 | Ga0105248_100488903 | 450 |
| 706 | 3300009177 | Ga0105248_10050405 | Ga0105248_100504053 | 450 |
| 707 | 3300009545 | Ga0105237_10001432 | Ga0105237_1000143215 | 450 |
| 708 | 3300009553 | Ga0105249_10028434 | Ga0105249_100284342 | 450 |
| 709 | 3300011119 | Ga0105246_10003540 | Ga0105246_100035406 | 450 |
| 710 | 3300013296 | Ga0157374_10088966 | Ga0157374_100889662 | 450 |
| 711 | 3300013306 | Ga0163162_10001713 | Ga0163162_1000171319 | 450 |
| 712 | 3300013306 | Ga0163162_10053712 | Ga0163162_100537123 | 450 |
| 713 | 3300013306 | Ga0163162_10119697 | Ga0163162_101196971 | 450 |
| 714 | 3300013308 | Ga0157375_10013502 | Ga0157375_100135023 | 450 |
| 715 | 3300014968 | Ga0157379_10040916 | Ga0157379_100409163 | 450 |
| 716 | 3300014968 | Ga0157379_10063383 | Ga0157379_100633833 | 450 |
| 717 | 3300014969 | Ga0157376_10052227 | Ga0157376_100522273 | 450 |
| 718 | 3300025321 | Ga0207656_10009379 | Ga0207656_100093794 | 450 |
| 719 | 3300025321 | Ga0207656_10027777 | Ga0207656_100277772 | 450 |
| 720 | 3300025735 | Ga0207713_1006601 | Ga0207713_10066014 | 450 |
| 721 | 3300025900 | Ga0207710_10055557 | Ga0207710_100555572 | 450 |
| 722 | 3300025903 | Ga0207680_10024889 | Ga0207680_100248892 | 450 |
| 723 | 3300025909 | Ga0207705_10093407 | Ga0207705_100934072 | 450 |
| 724 | 3300025914 | Ga0207671_10004477 | Ga0207671_100044772 | 450 |
| 725 | 3300025923 | Ga0207681_10000269 | Ga0207681_1000026911 | 450 |
| 726 | 3300025927 | Ga0207687_10077399 | Ga0207687_100773992 | 450 |
| 727 | 3300025931 | Ga0207644_10000163 | Ga0207644_1000016320 | 450 |
| 728 | 3300025931 | Ga0207644_10001973 | Ga0207644_100019732 | 450 |
| 729 | 3300025933 | Ga0207706_10028266 | Ga0207706_100282663 | 450 |
| 730 | 3300025933 | Ga0207706_10050704 | Ga0207706_100507043 | 450 |
| 731 | 3300025934 | Ga0207686_10021148 | Ga0207686_100211482 | 450 |
| 732 | 3300025938 | Ga0207704_10019891 | Ga0207704_100198913 | 450 |
| 733 | 3300025940 | Ga0207691_10097206 | Ga0207691_100972062 | 450 |
| 734 | 3300025941 | Ga0207711_10001635 | Ga0207711_1000163513 | 450 |
| 735 | 3300025941 | Ga0207711_10001666 | Ga0207711_1000166616 | 450 |
| 736 | 3300025941 | Ga0207711_10025493 | Ga0207711_100254932 | 450 |
| 737 | 3300025941 | Ga0207711_10030848 | Ga0207711_100308482 | 450 |
| 738 | 3300025942 | Ga0207689_10007647 | Ga0207689_100076474 | 450 |
| 739 | 3300025960 | Ga0207651_10020608 | Ga0207651_100206083 | 450 |
| 740 | 3300025960 | Ga0207651_10064481 | Ga0207651_100644813 | 450 |
| 741 | 3300025981 | Ga0207640_10006957 | Ga0207640_100069575 | 450 |
| 742 | 3300025981 | Ga0207640_10043044 | Ga0207640_100430442 | 450 |
| 743 | 3300025986 | Ga0207658_10009815 | Ga0207658_100098154 | 450 |
| 744 | 3300025986 | Ga0207658_10021424 | Ga0207658_100214243 | 450 |
| 745 | 3300026035 | Ga0207703_10010118 | Ga0207703_100101182 | 450 |
| 746 | 3300026035 | Ga0207703_10031138 | Ga0207703_100311382 | 450 |
| 747 | 3300026035 | Ga0207703_10045351 | Ga0207703_100453511 | 450 |
| 748 | 3300026041 | Ga0207639_10030083 | Ga0207639_100300832 | 450 |
| 749 | 3300026041 | Ga0207639_10074104 | Ga0207639_100741042 | 450 |
| 750 | 3300026088 | Ga0207641_10010838 | Ga0207641_100108386 | 450 |
| 751 | 3300026088 | Ga0207641_10060520 | Ga0207641_100605201 | 450 |
| 752 | 3300026089 | Ga0207648_10013847 | Ga0207648_100138473 | 450 |
| 753 | 3300026095 | Ga0207676_10067600 | Ga0207676_100676002 | 450 |
| 754 | 3300026116 | Ga0207674_10009959 | Ga0207674_100099598 | 450 |
| 755 | 3300026116 | Ga0207674_10130394 | Ga0207674_101303942 | 450 |
| 756 | 3300026121 | Ga0207683_10021454 | Ga0207683_100214543 | 450 |
| 757 | 3300026142 | Ga0207698_10059704 | Ga0207698_100597042 | 450 |
| 758 | 3300028379 | Ga0268266_10000125 | Ga0268266_1000012535 | 450 |
| 759 | 3300028380 | Ga0268265_10023251 | Ga0268265_100232514 | 450 |
| 760 | 3300028380 | Ga0268265_10027571 | Ga0268265_100275714 | 450 |
| 761 | 3300028381 | Ga0268264_10001036 | Ga0268264_1000103613 | 450 |
| 762 | 3300028381 | Ga0268264_10005274 | Ga0268264_100052748 | 450 |
| 763 | 3300031995 | Ga0307409_100083619 | Ga0307409_1000836192 | 450 |
| 764 | 3300035691 | Ga0373931_0060165 | Ga0373931_0060165_162_1517 | 450 |
| 765 | 3300037418 | Ga0395900_0155648 | Ga0395900_0155648_840_2195 | 450 |
| 766 | 3300038443 | Ga0395901_0018161 | Ga0395901_0018161_3902_5257 | 450 |
| 767 | 3300038443 | Ga0395901_0122037 | Ga0395901_0122037_1043_2401 | 450 |
| 768 | 3300042005 | Ga0439448_0001384 | Ga0439448_0001384_2206_3561 | 450 |
| 769 | 3300042012 | Ga0439455_0005912 | Ga0439455_0005912_130_1485 | 450 |
| 770 | 3300042157 | Ga0439458_0002354 | Ga0439458_0002354_3047_4402 | 450 |
| 771 | 3300047472 | Ga0495686_0000779 | Ga0495686_0000779_29233_30588 | 450 |
| 772 | 3300048909 | Ga0496106_0053938 | Ga0496106_0053938_623_1978 | 450 |
| 773 | 3300048910 | Ga0496107_0060349 | Ga0496107_0060349_540_1895 | 450 |
| 774 | 3300048912 | Ga0496109_0034494 | Ga0496109_0034494_814_2169 | 450 |
| 775 | 3300048912 | Ga0496109_0110437 | Ga0496109_0110437_582_1937 | 450 |
| 776 | 3300048913 | Ga0496110_0020145 | Ga0496110_0020145_2803_4158 | 450 |
| 777 | 3300048915 | Ga0496112_0006013 | Ga0496112_0006013_3540_4895 | 450 |
| 778 | 3300048919 | Ga0496116_0026819 | Ga0496116_0026819_1582_2979 | 450 |
| 779 | 3300048920 | Ga0496117_0020607 | Ga0496117_0020607_226_1587 | 450 |
| 780 | 3300048924 | Ga0496121_0000087 | Ga0496121_0000087_118037_119407 | 450 |
| 781 | 3300048924 | Ga0496121_0030743 | Ga0496121_0030743_2348_3745 | 450 |
| 782 | 3300048927 | Ga0496124_0002832 | Ga0496124_0002832_6316_7692 | 450 |
| 783 | 3300048929 | Ga0496126_0147391 | Ga0496126_0147391_235_1602 | 450 |
| 784 | 3300050509 | nmdc:mga0qj67_5357_c1 | nmdc:mga0qj67_5357_c1_3852_5216 | 450 |
| 785 | 3300050515 | nmdc:mga0a205_1975_c1 | nmdc:mga0a205_1975_c1_1478_2833 | 450 |
| 786 | 3300053087 | Ga0500643_000416 | Ga0500643_000416_27803_29167 | 450 |
| 787 | 3300053116 | Ga0500592_000009 | Ga0500592_000009_75720_77126 | 450 |
| 788 | 3300053136 | Ga0500559_0000174 | Ga0500559_0000174_37473_38840 | 450 |
| 789 | 3300053156 | Ga0500622_0003702 | Ga0500622_0003702_8604_9971 | 450 |
| 790 | 3300053158 | Ga0500627_0000114 | Ga0500627_0000114_14493_15899 | 450 |
| 791 | 3300001904 | JGI24736J21556_1009690 | JGI24736J21556_10096902 | 452 |
| 792 | 3300002067 | JGI24735J21928_10001316 | JGI24735J21928_100013165 | 452 |
| 793 | 3300005539 | Ga0068853_100100685 | Ga0068853_1001006852 | 452 |
| 794 | 3300005563 | Ga0068855_100034874 | Ga0068855_1000348746 | 452 |
| 795 | 3300005614 | Ga0068856_100023697 | Ga0068856_1000236974 | 452 |
| 796 | 3300005616 | Ga0068852_100065216 | Ga0068852_1000652163 | 452 |
| 797 | 3300009093 | Ga0105240_10016734 | Ga0105240_100167346 | 452 |
| 798 | 3300009174 | Ga0105241_10030818 | Ga0105241_100308185 | 452 |
| 799 | 3300009545 | Ga0105237_10105578 | Ga0105237_101055781 | 452 |
| 800 | 3300009545 | Ga0105237_10220082 | Ga0105237_102200822 | 452 |
| 801 | 3300009551 | Ga0105238_10007176 | Ga0105238_1000717610 | 452 |
| 802 | 3300009551 | Ga0105238_10019406 | Ga0105238_100194062 | 452 |
| 803 | 3300010375 | Ga0105239_10008218 | Ga0105239_100082184 | 452 |
| 804 | 3300010375 | Ga0105239_10037413 | Ga0105239_100374136 | 452 |
| 805 | 3300013102 | Ga0157371_10003453 | Ga0157371_100034537 | 452 |
| 806 | 3300013297 | Ga0157378_10003913 | Ga0157378_100039138 | 452 |
| 807 | 3300014326 | Ga0157380_10000325 | Ga0157380_1000032518 | 452 |
| 808 | 3300025904 | Ga0207647_10003721 | Ga0207647_100037217 | 452 |
| 809 | 3300025911 | Ga0207654_10037169 | Ga0207654_100371692 | 452 |
| 810 | 3300025913 | Ga0207695_10087928 | Ga0207695_100879284 | 452 |
| 811 | 3300025914 | Ga0207671_10116881 | Ga0207671_101168811 | 452 |
| 812 | 3300026116 | Ga0207674_10012951 | Ga0207674_100129516 | 452 |
| 813 | 3300031548 | Ga0307408_100066259 | Ga0307408_1000662592 | 452 |
| 814 | 3300031731 | Ga0307405_10000496 | Ga0307405_100004964 | 452 |
| 815 | 3300031852 | Ga0307410_10002639 | Ga0307410_100026395 | 452 |
| 816 | 3300031911 | Ga0307412_10002152 | Ga0307412_100021524 | 452 |
| 817 | 3300046616 | Ga0495668_0000801 | Ga0495668_0000801_2798_4183 | 452 |
| 818 | 3300049658 | Ga0501211_001797 | Ga0501211_001797_693_2066 | 452 |
| 819 | 3300049705 | Ga0501225_0009277 | Ga0501225_0009277_1124_2497 | 452 |
| 820 | 3300049708 | Ga0501245_006383 | Ga0501245_006383_144_1517 | 452 |
| 821 | 3300053151 | Ga0500604_0008413 | Ga0500604_0008413_801_2186 | 452 |
| 822 | 3300053158 | Ga0500627_0000992 | Ga0500627_0000992_249_1634 | 452 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bcx-assembly1.cif.gz_B | e1 dehydrase | 0.9917 | 19 | 451 |
| 3bb8-assembly1.cif.gz_B | e1 dehydrase h220k mutant | 0.9899 | 19 | 451 |
| 3bcx-assembly1.cif.gz_A | e1 dehydrase | 0.9894 | 19 | 451 |
| 3bcx-assembly1.cif.gz_B | e1 dehydrase | 0.9823 | 19 | 451 |
| 3bb8-assembly1.cif.gz_B | e1 dehydrase h220k mutant | 0.9806 | 19 | 451 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bb8A01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9883 | 19 | 322 | 3.40.640.10 |
| 3bcxB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9864 | 324 | 451 | 3.90.1150.10 |
| 3bb8A01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9849 | 19 | 322 | 3.40.640.10 |
| 3bcxB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9497 | 324 | 451 | 3.90.1150.10 |
| 5u1zA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9469 | 62 | 321 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S4IJM2-F1-model_v4 | L-glutamine:2-deoxy-scyllo-inosose aminotransferase (EC 2.6.1.-) | 0.996 | 150 | 264 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-X1MUZ1-F1-model_v4 | Lipopolysaccharide biosynthesis protein RfbH | 0.9951 | 128 | 252 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A3M7LIY0-F1-model_v4 | deleted | 0.9889 | 77 | 451 |
|
| AF-A0A1J5AIH4-F1-model_v4 | Lipopolysaccharide biosynthesis protein RfbH | 0.9879 | 23 | 452 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-X1MMC8-F1-model_v4 | Aminotransferase class I/classII domain-containing protein | 0.9877 | 25 | 229 |
GO:0000271
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar