F482301

General Info

Members Datasets Scaffolds Average Seq Length
822 429 777 444

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10012640|Ga0105241_100126404
Length 451
Sequence MSTTTTVNFQPQLDKLRNQISELVQQYAEIAHSPKPFVPGQSAVPVSGKVIGAKELQLMVDASLDGWLTTGRFNAMFEERLAKFLGVKYLITVNSGSSANLVAFSTLTSPKLGDRAIKQGDEVIGVAAGFPTTVNPIIQFGAVPVFVDVDLATHNIDASKIEAAITPKTKAIMLAHSLGNPFNLDVVTALCKKYNLWLVEDCCDALGATYNGQMVGTFGDIATLSFYPAHHITMGEGGAVFTNNAELKLIAESFRDWGRDCYCPPGKDNTCDKRFCWTKKDLGGDLPDGYDHKYTYSHLGYNLKISDMQAACALGQMDRLEEFIAKRRANFSYLKNRLASCADFLHLPEATPNSEPSWFGFPLILKESSGVKRTDLINYLEENKIGTRLLFAGNLTKQPYMANRNFRVSGELTNTDVVMNQTFWLGTFPGLGQEQLDYIAGKLEEFFGVGF

Samples

Sample ID Description Type Environment
1 2511231007 Pseudomonas sp. GM18 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
6 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
7 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
8 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
9 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
10 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
11 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
12 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
13 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
14 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
15 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
16 2643221638 Duganella sp. Root336D2 Isolate Unclassified
17 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
18 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
19 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
20 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
21 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
22 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
23 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
24 2855730933 Achromobacter sp. HZ28 Isolate Nodule
25 2855767633 Achromobacter sp. HZ34 Isolate Nodule
26 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
27 2857558681 Duganella sp. R-74565 Isolate Unclassified
28 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
29 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
30 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
31 2914759650 Rhizosphaericola mali Isolate Rhizosphere
32 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
33 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
34 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
35 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
36 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
37 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
50 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
163 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
235 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
243 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
272 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
273 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
277 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
278 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
279 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
280 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
281 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
282 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
283 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
284 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
297 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
298 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
305 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
306 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
307 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
308 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
311 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
324 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
329 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
332 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
333 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
350 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
353 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
354 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
355 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
379 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
385 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
386 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
387 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
388 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
404 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
405 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
406 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
407 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
408 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
409 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
410 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
411 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
412 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
413 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
414 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
415 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
418 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
419 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
420 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
421 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
424 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
425 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
426 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
427 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
428 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
429 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0.12
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.53
Nodule 1.58
Rhizoplane 2.8
Rhizosphere 74.82
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009690 3300001904 Bacteria 1583
2 JGI24741J21665_1008137 3300001915 Bacteria 1993
3 JGI24739J22299_10000336 3300001989 Bacteria 15990
4 JGI24735J21928_10001316 3300002067 Bacteria 8772
5 JGI24735J21928_10002016 3300002067 Bacteria 7144
6 JGI25156J39149_1000313 3300002705 Bacteria 32091
7 JGI25162J39368_1000120 3300002737 Bacteria 86031
8 JGI25154J39366_1000711 3300002738 Bacteria 15124
9 JGI25158J39367_1000009 3300002739 Bacteria 53723
10 JGI25159J45721_1000778 3300002987 Bacteria 13861
11 JGI25159J45721_1002167 3300002987 Bacteria 7649
12 JGI25151J46595_10001656 3300003187 Bacteria 14617
13 rootH1_10023399 3300003316 Bacteria 14787
14 rootH1_10023399 3300003323 Bacteria 18842
15 rootH2_10019449 3300003320 Bacteria 18026
16 rootL2_10002855 3300003322 Bacteria 17523
17 rootL2_10017982 3300003322 Bacteria 5916
18 rootL2_10215171 3300003322 Bacteria 5311
19 JGI25161J50226_1000115 3300003374 Bacteria 62500
20 Ga0006562J51391_1008496 3300003578 Bacteria 16204
21 Ga0055529_1000274 3300003763 Bacteria 61422
22 Ga0055526_1000085 3300003771 Bacteria 86760
23 Ga0055537_1000295 3300003773 Bacteria 35299
24 Ga0055524_1000437 3300003775 Bacteria 34910
25 Ga0055524_1004778 3300003775 Bacteria 6184
26 Ga0055536_1000002 3300003781 Bacteria 605605
27 Ga0055534_1000047 3300003784 Bacteria 94932
28 Ga0055528_1000049 3300003790 Bacteria 94814
29 Ga0055530_10002636 3300003791 Bacteria 11240
30 Ga0055543_1000094 3300004625 Bacteria 78040
31 Ga0055543_1001560 3300004625 Bacteria 8872
32 Ga0065165_1000059 3300005262 Bacteria 182314
33 Ga0065165_1000167 3300005262 Bacteria 115630
34 Ga0065165_1000434 3300005262 Bacteria 65848
35 Ga0065165_1005158 3300005262 Bacteria 7555
36 Ga0065165_1014879 3300005262 Bacteria 2998
37 Ga0065165_1019668 3300005262 Bacteria 2401
38 Ga0065165_1019848 3300005262 Bacteria 2385
39 Ga0065714_10068111 3300005288 Bacteria 4953
40 Ga0065704_10075142 3300005289 Bacteria 5769
41 Ga0070658_10000596 3300005327 Bacteria 31295
42 Ga0070658_10001501 3300005327 Bacteria 19811
43 Ga0070683_100018434 3300005329 Bacteria 6183
44 Ga0070690_100020398 3300005330 Bacteria 4037
45 Ga0070670_100047220 3300005331 Bacteria 3704
46 Ga0070677_10066497 3300005333 Bacteria 1503
47 Ga0070666_10006119 3300005335 Bacteria 7397
48 Ga0070680_100038229 3300005336 Bacteria 3881
49 Ga0068868_100028844 3300005338 Bacteria 4247
50 Ga0068868_100032871 3300005338 Bacteria 3993
51 Ga0070660_100000537 3300005339 Bacteria 25342
52 Ga0070660_100003070 3300005339 Bacteria 11480
53 Ga0070687_100013667 3300005343 Bacteria 3624
54 Ga0070661_100130914 3300005344 Bacteria 1884
55 Ga0070668_100000850 3300005347 Bacteria 21166
56 Ga0070668_100002351 3300005347 Bacteria 13898
57 Ga0070668_100035103 3300005347 Bacteria 3822
58 Ga0070669_100000372 3300005353 Bacteria 34677
59 Ga0070669_100000973 3300005353 Bacteria 20930
60 Ga0070669_100001543 3300005353 Bacteria 16655
61 Ga0070669_100006723 3300005353 Bacteria 8280
62 Ga0070675_100031164 3300005354 Bacteria 4309
63 Ga0070675_100234542 3300005354 Bacteria 1602
64 Ga0070671_100000287 3300005355 Bacteria 34334
65 Ga0070671_100001504 3300005355 Bacteria 17449
66 Ga0070674_100061175 3300005356 Bacteria 2627
67 Ga0070673_100067301 3300005364 Bacteria 2864
68 Ga0070673_100164007 3300005364 Bacteria 1892
69 Ga0070659_100002095 3300005366 Bacteria 14218
70 Ga0070659_100008373 3300005366 Bacteria 7554
71 Ga0070659_100008464 3300005366 Bacteria 7518
72 Ga0070667_100000298 3300005367 Bacteria 55786
73 Ga0070667_100027529 3300005367 Bacteria 4730
74 Ga0070701_10014086 3300005438 Bacteria 3657
75 Ga0070700_100001055 3300005441 Bacteria 13639
76 Ga0070700_100041253 3300005441 Bacteria 2829
77 Ga0070694_100040557 3300005444 Bacteria 3103
78 Ga0070694_100072341 3300005444 Bacteria 2378
79 Ga0070663_100000402 3300005455 Bacteria 22670
80 Ga0070663_100073949 3300005455 Bacteria 2487
81 Ga0070662_100010169 3300005457 Bacteria 6167
82 Ga0070662_100023027 3300005457 Bacteria 4274
83 Ga0070662_100075240 3300005457 Bacteria 2500
84 Ga0070662_100084037 3300005457 Bacteria 2377
85 Ga0070681_10204068 3300005458 Bacteria 1894
86 Ga0068867_100000453 3300005459 Bacteria 27171
87 Ga0068867_100025227 3300005459 Bacteria 4264
88 Ga0068867_100127973 3300005459 Bacteria 1970
89 Ga0070685_10020109 3300005466 Bacteria 3611
90 Ga0070679_100029494 3300005530 Bacteria 5413
91 Ga0070684_100019423 3300005535 Bacteria 5621
92 Ga0068853_100026442 3300005539 Bacteria 4872
93 Ga0068853_100100685 3300005539 Bacteria 2555
94 Ga0070672_100008613 3300005543 Bacteria 6988
95 Ga0070672_100082270 3300005543 Bacteria 2583
96 Ga0070686_100013387 3300005544 Bacteria 4695
97 Ga0070665_100000152 3300005548 Bacteria 126430
98 Ga0070665_100114759 3300005548 Bacteria 2696
99 Ga0070704_100029675 3300005549 Bacteria 3655
100 Ga0068855_100001138 3300005563 Bacteria 32970
101 Ga0068855_100001663 3300005563 Bacteria 27798
102 Ga0068855_100003503 3300005563 Bacteria 19223
103 Ga0068855_100009842 3300005563 Bacteria 11534
104 Ga0068855_100034874 3300005563 Bacteria 5996
105 Ga0070664_100014244 3300005564 Bacteria 6486
106 Ga0070664_100032833 3300005564 Bacteria 4343
107 Ga0068857_100130081 3300005577 Bacteria 2270
108 Ga0068854_100001405 3300005578 Bacteria 14525
109 Ga0068854_100004322 3300005578 Bacteria 8956
110 Ga0068854_100038590 3300005578 Bacteria 3360
111 Ga0068854_100107715 3300005578 Bacteria 2098
112 Ga0068856_100023697 3300005614 Bacteria 5968
113 Ga0068852_100005716 3300005616 Bacteria 8921
114 Ga0068852_100049228 3300005616 Bacteria 3604
115 Ga0068852_100065216 3300005616 Bacteria 3176
116 Ga0068859_100005526 3300005617 Bacteria 12872
117 Ga0068859_100042590 3300005617 Bacteria 4561
118 Ga0068864_100070993 3300005618 Bacteria 3031
119 Ga0068866_10004108 3300005718 Bacteria 5972
120 Ga0068861_100045828 3300005719 Bacteria 3295
121 Ga0068851_10091645 3300005834 Bacteria 1600
122 Ga0068863_100003486 3300005841 Bacteria 15521
123 Ga0068863_100007924 3300005841 Bacteria 10383
124 Ga0068858_100022919 3300005842 Bacteria 5824
125 Ga0068858_100033556 3300005842 Bacteria 4761
126 Ga0068860_100000412 3300005843 Bacteria 55786
127 Ga0068860_100001988 3300005843 Bacteria 21589
128 Ga0068860_100009213 3300005843 Bacteria 9812
129 Ga0068860_100016090 3300005843 Bacteria 7297
130 Ga0068860_100054861 3300005843 Bacteria 3788
131 Ga0068860_100101217 3300005843 Bacteria 2749
132 Ga0075363_100015353 3300006048 Bacteria 3763
133 Ga0075362_10000999 3300006177 Bacteria 8674
134 Ga0075362_10023250 3300006177 Bacteria 2620
135 Ga0075367_10003220 3300006178 Bacteria 7716
136 Ga0075367_10057980 3300006178 Bacteria 2303
137 Ga0075369_10000158 3300006186 Bacteria 19172
138 Ga0075366_10000031 3300006195 Bacteria 49332
139 Ga0075366_10014126 3300006195 Bacteria 4556
140 Ga0075366_10019499 3300006195 Bacteria 3925
141 Ga0075366_10028312 3300006195 Bacteria 3289
142 Ga0097621_100015998 3300006237 Bacteria 5656
143 Ga0075370_10003436 3300006353 Bacteria 7540
144 Ga0075370_10020179 3300006353 Bacteria 3639
145 Ga0075370_10022825 3300006353 Bacteria 3441
146 Ga0068871_100060164 3300006358 Bacteria 3098
147 Ga0075430_100000001 3300006846 Bacteria 185803
148 Ga0075433_10046330 3300006852 Bacteria 3781
149 Ga0068865_100001312 3300006881 Bacteria 14481
150 Ga0097620_100005526 3300006931 Bacteria 12872
151 Ga0097620_100016879 3300006931 Bacteria 7328
152 Ga0097620_100027286 3300006931 Bacteria 5728
153 Ga0097620_100042591 3300006931 Bacteria 4561
154 Ga0099823_1000804 3300006944 Bacteria 23356
155 Ga0079104_1000280 3300006946 Bacteria 65859
156 Ga0099826_10000048 3300006948 Bacteria 74895
157 Ga0105251_10001577 3300009011 Bacteria 19514
158 Ga0105251_10001908 3300009011 Bacteria 17107
159 Ga0105244_10000783 3300009036 Bacteria 27093
160 Ga0105250_10002832 3300009092 Bacteria 8498
161 Ga0105240_10016734 3300009093 Bacteria 9919
162 Ga0105240_10016756 3300009093 Bacteria 9911
163 Ga0105240_10024586 3300009093 Bacteria 7935
164 Ga0111539_10204092 3300009094 Bacteria 2304
165 Ga0111539_10230499 3300009094 Bacteria 2156
166 Ga0105245_10011442 3300009098 Bacteria 7727
167 Ga0105247_10016494 3300009101 Bacteria 4428
168 Ga0105243_10005228 3300009148 Bacteria 10156
169 Ga0105241_10012640 3300009174 Bacteria 6196
170 Ga0105241_10030818 3300009174 Bacteria 4011
171 Ga0105241_10071856 3300009174 Bacteria 2687
172 Ga0105241_10167234 3300009174 Bacteria 1813
173 Ga0105242_10002227 3300009176 Bacteria 15303
174 Ga0105242_10010849 3300009176 Bacteria 6998
175 Ga0105242_10024994 3300009176 Bacteria 4721
176 Ga0105248_10005696 3300009177 Bacteria 13689
177 Ga0105248_10016734 3300009177 Bacteria 8074
178 Ga0105248_10019448 3300009177 Bacteria 7514
179 Ga0105248_10048890 3300009177 Bacteria 4744
180 Ga0105248_10050405 3300009177 Bacteria 4669
181 Ga0105237_10001258 3300009545 Bacteria 33852
182 Ga0105237_10001432 3300009545 Bacteria 31551
183 Ga0105237_10001646 3300009545 Bacteria 28976
184 Ga0105237_10046422 3300009545 Bacteria 4369
185 Ga0105237_10075539 3300009545 Bacteria 3361
186 Ga0105237_10105578 3300009545 Bacteria 2808
187 Ga0105237_10157673 3300009545 Bacteria 2267
188 Ga0105237_10220082 3300009545 Bacteria 1899
189 Ga0105238_10007176 3300009551 Bacteria 11145
190 Ga0105238_10019406 3300009551 Bacteria 6924
191 Ga0105238_10027418 3300009551 Bacteria 5804
192 Ga0105238_10034683 3300009551 Bacteria 5133
193 Ga0105249_10028434 3300009553 Bacteria 5045
194 Ga0099796_10009326 3300010159 Bacteria 2653
195 Ga0105239_10000421 3300010375 Bacteria 61717
196 Ga0105239_10001138 3300010375 Bacteria 36690
197 Ga0105239_10001525 3300010375 Bacteria 30758
198 Ga0105239_10008218 3300010375 Bacteria 11904
199 Ga0105239_10008956 3300010375 Bacteria 11325
200 Ga0105239_10037413 3300010375 Bacteria 5320
201 Ga0105246_10000244 3300011119 Bacteria 27958
202 Ga0105246_10000490 3300011119 Bacteria 21442
203 Ga0105246_10003540 3300011119 Bacteria 9453
204 Ga0157373_10000047 3300013100 Bacteria 110376
205 Ga0157373_10017878 3300013100 Bacteria 5162
206 Ga0157373_10025559 3300013100 Bacteria 4270
207 Ga0157371_10002039 3300013102 Bacteria 19908
208 Ga0157371_10003453 3300013102 Bacteria 14329
209 Ga0157371_10004164 3300013102 Bacteria 12745
210 Ga0157370_10000485 3300013104 Bacteria 49509
211 Ga0157370_10000508 3300013104 Bacteria 48558
212 Ga0157370_10001430 3300013104 Bacteria 29613
213 Ga0157370_10002664 3300013104 Bacteria 21422
214 Ga0157370_10004233 3300013104 Bacteria 16607
215 Ga0157370_10023559 3300013104 Bacteria 6110
216 Ga0157370_10033974 3300013104 Bacteria 4969
217 Ga0157370_10038265 3300013104 Bacteria 4641
218 Ga0157369_10000572 3300013105 Bacteria 48524
219 Ga0157369_10000594 3300013105 Bacteria 47098
220 Ga0157374_10088966 3300013296 Bacteria 2942
221 Ga0157374_10259788 3300013296 Bacteria 1710
222 Ga0157378_10003913 3300013297 Bacteria 13198
223 Ga0163162_10001713 3300013306 Bacteria 20541
224 Ga0163162_10053712 3300013306 Bacteria 4050
225 Ga0163162_10066203 3300013306 Bacteria 3661
226 Ga0163162_10119697 3300013306 Bacteria 2736
227 Ga0157372_10031659 3300013307 Bacteria 5791
228 Ga0157372_10034561 3300013307 Bacteria 5558
229 Ga0157372_10048158 3300013307 Bacteria 4738
230 Ga0157372_10289308 3300013307 Bacteria 1906
231 Ga0157375_10000055 3300013308 Bacteria 126704
232 Ga0157375_10000629 3300013308 Bacteria 31341
233 Ga0157375_10013502 3300013308 Bacteria 7272
234 Ga0157375_10073477 3300013308 Bacteria 3439
235 Ga0163163_10067469 3300014325 Bacteria 3557
236 Ga0157380_10000325 3300014326 Bacteria 28843
237 Ga0182008_10000118 3300014497 Bacteria 59429
238 Ga0182008_10002412 3300014497 Bacteria 11737
239 Ga0182008_10013366 3300014497 Bacteria 4316
240 Ga0157377_10000088 3300014745 Bacteria 67719
241 Ga0157379_10040916 3300014968 Bacteria 4137
242 Ga0157379_10063383 3300014968 Bacteria 3305
243 Ga0157376_10052227 3300014969 Bacteria 3398
244 Ga0182006_1000010 3300015261 Bacteria 413414
245 Ga0182006_1000366 3300015261 Bacteria 37493
246 Ga0182007_10000021 3300015262 Bacteria 193408
247 Ga0182007_10000024 3300015262 Bacteria 181761
248 Ga0182007_10001040 3300015262 Bacteria 15203
249 Ga0182005_1000579 3300015265 Bacteria 18027
250 Ga0182005_1001431 3300015265 Bacteria 9604
251 Ga0163161_10007796 3300017792 Bacteria 7406
252 Ga0163161_10013775 3300017792 Bacteria 5634
253 Ga0213872_10000136 3300021361 Bacteria 66682
254 Ga0213872_10000546 3300021361 Bacteria 29266
255 Ga0213872_10005357 3300021361 Bacteria 6621
256 Ga0213872_10010598 3300021361 Bacteria 4381
257 Ga0209436_100042 3300025208 Bacteria 73600
258 Ga0209672_100532 3300025228 Bacteria 20804
259 Ga0209437_100143 3300025233 Bacteria 164970
260 Ga0209437_106660 3300025233 Bacteria 1913
261 Ga0209646_1000169 3300025246 Bacteria 86319
262 Ga0209026_1005102 3300025250 Bacteria 3636
263 Ga0209148_1000237 3300025254 Bacteria 88748
264 Ga0209759_1000562 3300025256 Bacteria 37533
265 Ga0209759_1000574 3300025256 Bacteria 36692
266 Ga0209759_1012361 3300025256 Bacteria 2369
267 Ga0209129_1000329 3300025258 Bacteria 41319
268 Ga0209233_1001868 3300025261 Bacteria 8090
269 Ga0209455_1000253 3300025272 Bacteria 62650
270 Ga0209673_1004452 3300025273 Bacteria 7498
271 Ga0209673_1018432 3300025273 Bacteria 2538
272 Ga0209130_1000016 3300025284 Bacteria 395540
273 Ga0209130_1000227 3300025284 Bacteria 73760
274 Ga0209130_1004602 3300025284 Bacteria 5157
275 Ga0209675_1000546 3300025291 Bacteria 27468
276 Ga0209676_1000022 3300025292 Bacteria 605659
277 Ga0209025_1000039 3300025294 Bacteria 377396
278 Ga0209025_1001164 3300025294 Bacteria 37261
279 Ga0209564_1000010 3300025295 Bacteria 885399
280 Ga0209050_1000020 3300025298 Bacteria 605671
281 Ga0209050_1004070 3300025298 Bacteria 10233
282 Ga0209256_1000424 3300025299 Bacteria 66333
283 Ga0207426_1004366 3300025302 Bacteria 6941
284 Ga0207426_1031442 3300025302 Bacteria 1732
285 Ga0209051_1000469 3300025303 Bacteria 52936
286 Ga0207697_10038625 3300025315 Bacteria 1957
287 Ga0207656_10009379 3300025321 Bacteria 3635
288 Ga0207656_10027777 3300025321 Bacteria 2317
289 Ga0207696_1017168 3300025711 Bacteria 2403
290 Ga0207655_1001036 3300025728 Bacteria 28029
291 Ga0207713_1001686 3300025735 Bacteria 17087
292 Ga0207713_1006601 3300025735 Bacteria 7042
293 Ga0207710_10055557 3300025900 Bacteria 1785
294 Ga0207680_10003093 3300025903 Bacteria 7817
295 Ga0207680_10024889 3300025903 Bacteria 3293
296 Ga0207647_10003721 3300025904 Bacteria 11402
297 Ga0207647_10059443 3300025904 Bacteria 2339
298 Ga0207645_10004012 3300025907 Bacteria 10978
299 Ga0207705_10000344 3300025909 Bacteria 41940
300 Ga0207705_10093407 3300025909 Bacteria 2205
301 Ga0207654_10001203 3300025911 Bacteria 13874
302 Ga0207654_10037169 3300025911 Bacteria 2724
303 Ga0207695_10011856 3300025913 Bacteria 10512
304 Ga0207695_10048140 3300025913 Bacteria 4505
305 Ga0207695_10087928 3300025913 Bacteria 3129
306 Ga0207671_10000987 3300025914 Bacteria 35078
307 Ga0207671_10001650 3300025914 Bacteria 25405
308 Ga0207671_10004477 3300025914 Bacteria 13327
309 Ga0207671_10035500 3300025914 Bacteria 3699
310 Ga0207671_10098803 3300025914 Bacteria 2208
311 Ga0207671_10116881 3300025914 Bacteria 2035
312 Ga0207660_10017143 3300025917 Bacteria 4807
313 Ga0207662_10003922 3300025918 Bacteria 7753
314 Ga0207662_10022336 3300025918 Bacteria 3627
315 Ga0207657_10001327 3300025919 Bacteria 26265
316 Ga0207657_10001827 3300025919 Bacteria 22959
317 Ga0207657_10036177 3300025919 Bacteria 4421
318 Ga0207649_10077687 3300025920 Bacteria 2140
319 Ga0207649_10093041 3300025920 Bacteria 1977
320 Ga0207652_10038392 3300025921 Bacteria 4059
321 Ga0207652_10171132 3300025921 Bacteria 1949
322 Ga0207681_10000269 3300025923 Bacteria 39376
323 Ga0207681_10000703 3300025923 Bacteria 21982
324 Ga0207681_10003185 3300025923 Bacteria 10298
325 Ga0207694_10026822 3300025924 Bacteria 4386
326 Ga0207694_10028497 3300025924 Bacteria 4258
327 Ga0207650_10022834 3300025925 Bacteria 4433
328 Ga0207650_10029108 3300025925 Bacteria 3967
329 Ga0207659_10016916 3300025926 Bacteria 4756
330 Ga0207687_10077399 3300025927 Bacteria 2392
331 Ga0207700_10000009 3300025928 Bacteria 314953
332 Ga0207644_10000163 3300025931 Bacteria 48264
333 Ga0207644_10001973 3300025931 Bacteria 13264
334 Ga0207644_10011155 3300025931 Bacteria 5938
335 Ga0207690_10000615 3300025932 Bacteria 23019
336 Ga0207690_10009413 3300025932 Bacteria 5803
337 Ga0207690_10207911 3300025932 Bacteria 1490
338 Ga0207706_10016727 3300025933 Bacteria 6620
339 Ga0207706_10024393 3300025933 Bacteria 5422
340 Ga0207706_10028266 3300025933 Bacteria 5009
341 Ga0207706_10050704 3300025933 Bacteria 3667
342 Ga0207706_10105166 3300025933 Bacteria 2484
343 Ga0207706_10232030 3300025933 Bacteria 1614
344 Ga0207686_10021148 3300025934 Bacteria 3729
345 Ga0207686_10025577 3300025934 Bacteria 3435
346 Ga0207686_10071820 3300025934 Bacteria 2229
347 Ga0207669_10001655 3300025937 Bacteria 9475
348 Ga0207704_10019891 3300025938 Bacteria 3538
349 Ga0207691_10000575 3300025940 Bacteria 36701
350 Ga0207691_10067823 3300025940 Bacteria 3225
351 Ga0207691_10097206 3300025940 Bacteria 2632
352 Ga0207711_10001635 3300025941 Bacteria 20665
353 Ga0207711_10001666 3300025941 Bacteria 20482
354 Ga0207711_10025493 3300025941 Bacteria 4960
355 Ga0207711_10029581 3300025941 Bacteria 4622
356 Ga0207711_10030848 3300025941 Bacteria 4523
357 Ga0207711_10058424 3300025941 Bacteria 3319
358 Ga0207689_10007647 3300025942 Bacteria 9462
359 Ga0207661_10033723 3300025944 Bacteria 3976
360 Ga0207679_10033488 3300025945 Bacteria 3616
361 Ga0207667_10000427 3300025949 Bacteria 56780
362 Ga0207667_10003296 3300025949 Bacteria 19914
363 Ga0207667_10012152 3300025949 Bacteria 9944
364 Ga0207667_10028397 3300025949 Bacteria 6077
365 Ga0207667_10050793 3300025949 Bacteria 4374
366 Ga0207667_10100602 3300025949 Bacteria 2982
367 Ga0207651_10020608 3300025960 Bacteria 3984
368 Ga0207651_10064481 3300025960 Bacteria 2564
369 Ga0207651_10135283 3300025960 Bacteria 1894
370 Ga0207668_10047914 3300025972 Bacteria 2929
371 Ga0207640_10006957 3300025981 Bacteria 6223
372 Ga0207640_10043044 3300025981 Bacteria 2883
373 Ga0207658_10000254 3300025986 Bacteria 55800
374 Ga0207658_10009815 3300025986 Bacteria 6499
375 Ga0207658_10021424 3300025986 Bacteria 4487
376 Ga0207703_10010118 3300026035 Bacteria 7392
377 Ga0207703_10031138 3300026035 Bacteria 4216
378 Ga0207703_10045351 3300026035 Bacteria 3536
379 Ga0207639_10020960 3300026041 Bacteria 4688
380 Ga0207639_10030083 3300026041 Bacteria 3981
381 Ga0207639_10074104 3300026041 Bacteria 2672
382 Ga0207678_10006529 3300026067 Bacteria 10340
383 Ga0207678_10100277 3300026067 Bacteria 2474
384 Ga0207708_10002545 3300026075 Bacteria 13408
385 Ga0207708_10024712 3300026075 Bacteria 4545
386 Ga0207641_10002044 3300026088 Bacteria 19204
387 Ga0207641_10010838 3300026088 Bacteria 7469
388 Ga0207641_10043315 3300026088 Bacteria 3780
389 Ga0207641_10060520 3300026088 Bacteria 3228
390 Ga0207648_10000019 3300026089 Bacteria 144209
391 Ga0207648_10013847 3300026089 Bacteria 7481
392 Ga0207648_10015132 3300026089 Bacteria 7100
393 Ga0207648_10172059 3300026089 Bacteria 1915
394 Ga0207676_10067600 3300026095 Bacteria 2855
395 Ga0207676_10121735 3300026095 Bacteria 2202
396 Ga0207676_10139058 3300026095 Bacteria 2076
397 Ga0207674_10009959 3300026116 Bacteria 10816
398 Ga0207674_10012951 3300026116 Bacteria 9302
399 Ga0207674_10014731 3300026116 Bacteria 8625
400 Ga0207674_10046818 3300026116 Bacteria 4438
401 Ga0207674_10130394 3300026116 Bacteria 2478
402 Ga0207675_100057789 3300026118 Bacteria 3620
403 Ga0207683_10021454 3300026121 Bacteria 5529
404 Ga0207698_10039959 3300026142 Bacteria 3480
405 Ga0207698_10047883 3300026142 Bacteria 3242
406 Ga0207698_10059704 3300026142 Bacteria 2962
407 Ga0209281_1000337 3300027111 Bacteria 79938
408 Ga0209389_1000523 3300027296 Bacteria 23302
409 Ga0209282_1000066 3300027666 Bacteria 87072
410 Ga0209974_10022224 3300027876 Bacteria 2101
411 Ga0268266_10000125 3300028379 Bacteria 151647
412 Ga0268265_10023251 3300028380 Bacteria 4368
413 Ga0268265_10027571 3300028380 Bacteria 4055
414 Ga0268264_10000083 3300028381 Bacteria 245366
415 Ga0268264_10001036 3300028381 Bacteria 27932
416 Ga0268264_10005274 3300028381 Bacteria 10945
417 Ga0268264_10014029 3300028381 Bacteria 6587
418 Ga0268264_10064467 3300028381 Bacteria 3084
419 Ga0307515_10002251 3300028794 Bacteria 42303
420 Ga0307515_10004349 3300028794 Bacteria 29393
421 Ga0307515_10006229 3300028794 Bacteria 23956
422 Ga0307515_10034203 3300028794 Bacteria 8333
423 Ga0265324_10000090 3300029957 Bacteria 70577
424 Ga0265324_10000630 3300029957 Bacteria 24053
425 Ga0265331_10005821 3300031250 Bacteria 7387
426 Ga0307513_10152001 3300031456 Bacteria 2222
427 Ga0307509_10000904 3300031507 Bacteria 50711
428 Ga0307509_10160307 3300031507 Bacteria 2149
429 Ga0307408_100000364 3300031548 Bacteria 41737
430 Ga0307408_100010473 3300031548 Bacteria 6114
431 Ga0307408_100018733 3300031548 Bacteria 4651
432 Ga0307408_100066259 3300031548 Bacteria 2652
433 Ga0307514_10018767 3300031649 Bacteria 5666
434 Ga0307514_10055238 3300031649 Bacteria 3054
435 Ga0265314_10034537 3300031711 Bacteria 3696
436 Ga0307405_10000496 3300031731 Bacteria 14786
437 Ga0307405_10038843 3300031731 Bacteria 2873
438 Ga0307410_10002639 3300031852 Bacteria 8737
439 Ga0307406_10060951 3300031901 Bacteria 2435
440 Ga0307412_10002152 3300031911 Bacteria 10926
441 Ga0307409_100028312 3300031995 Bacteria 3989
442 Ga0307409_100083619 3300031995 Bacteria 2589
443 Ga0307416_100002543 3300032002 Bacteria 10506
444 Ga0307416_100023247 3300032002 Bacteria 4494
445 Ga0307414_10000198 3300032004 Bacteria 40555
446 Ga0307414_10000538 3300032004 Bacteria 19753
447 Ga0307411_10000004 3300032005 Bacteria 460327
448 Ga0307415_100031436 3300032126 Bacteria 3420
449 Ga0307415_100194317 3300032126 Bacteria 1604
450 Ga0307510_10002154 3300033180 Bacteria 22232
451 Ga0307510_10003569 3300033180 Bacteria 18167
452 Ga0373953_0003515 3300035117 Bacteria 4893
453 Ga0373954_0010399 3300035118 Bacteria 4106
454 Ga0373955_0003319 3300035172 Bacteria 7066
455 Ga0373931_0060165 3300035691 Bacteria 2044
456 Ga0373925_0049088 3300037068 Bacteria 3146
457 Ga0395899_0000209 3300037312 Bacteria 85489
458 Ga0395899_0000281 3300037312 Bacteria 66519
459 Ga0395899_0021800 3300037312 Bacteria 4859
460 Ga0395899_0034707 3300037312 Bacteria 3788
461 Ga0395899_0076856 3300037312 Bacteria 2437
462 Ga0395900_0072758 3300037418 Bacteria 3534
463 Ga0395900_0106887 3300037418 Bacteria 2875
464 Ga0395900_0155648 3300037418 Bacteria 2334
465 Ga0395898_0047831 3300037466 Bacteria 4195
466 Ga0395898_0053628 3300037466 Bacteria 3938
467 Ga0395898_0063068 3300037466 Bacteria 3597
468 Ga0395898_0185317 3300037466 Bacteria 1989
469 Ga0395905_0004026 3300037471 Bacteria 15424
470 Ga0395905_0038690 3300037471 Bacteria 4474
471 Ga0395905_0073982 3300037471 Bacteria 3193
472 Ga0395901_0018161 3300038443 Bacteria 7179
473 Ga0395901_0100568 3300038443 Bacteria 3033
474 Ga0395901_0122037 3300038443 Bacteria 2739
475 Ga0400483_277560 3300039062 Unclassified 1748
476 Ga0436361_0141619 3300039447 Bacteria 5339
477 Ga0436361_0151105 3300039447 Bacteria 6131
478 Ga0436361_0399468 3300039447 Bacteria 9484
479 Ga0436361_0658458 3300039447 Bacteria 21346
480 Ga0436361_0954756 3300039447 Bacteria 64588
481 Ga0439438_000623 3300041405 Bacteria 15968
482 Ga0439447_000592 3300041407 Bacteria 13542
483 Ga0439466_0000429 3300041411 Bacteria 16007
484 Ga0439448_0001384 3300042005 Bacteria 6240
485 Ga0439432_000177 3300042006 Bacteria 22560
486 Ga0439451_000069 3300042009 Bacteria 18787
487 Ga0439452_000517 3300042010 Bacteria 20821
488 Ga0439455_0005912 3300042012 Bacteria 2511
489 Ga0439456_001562 3300042013 Bacteria 4617
490 Ga0439463_000134 3300042016 Bacteria 18645
491 Ga0450911_000195 3300042115 Bacteria 23925
492 Ga0439458_0002354 3300042157 Bacteria 4635
493 Ga0439459_0001902 3300042438 Bacteria 3164
494 Ga0450893_0003082 3300042532 Bacteria 2620
495 Ga0451577_0031747 3300042876 Bacteria 4765
496 Ga0451577_0133079 3300042876 Bacteria 2232
497 Ga0466972_0010263 3300044658 Bacteria 4704
498 Ga0466972_0022034 3300044658 Bacteria 3173
499 Ga0453683_0041045 3300044673 Bacteria 2906
500 Ga0466965_0004523 3300044683 Bacteria 6189
501 Ga0466966_0000556 3300044684 Bacteria 23802
502 Ga0466961_0000561 3300044693 Bacteria 23621
503 Ga0466961_0002510 3300044693 Bacteria 11390
504 Ga0466961_0065813 3300044693 Bacteria 2303
505 Ga0466964_0000063 3300044706 Bacteria 23331
506 Ga0466970_0011421 3300044765 Bacteria 4527
507 Ga0466957_0014405 3300044842 Bacteria 4605
508 Ga0466957_0017135 3300044842 Bacteria 4240
509 Ga0466959_0000447 3300045049 Bacteria 24046
510 Ga0466959_0039624 3300045049 Bacteria 3482
511 Ga0451576_0000006 3300045051 Bacteria 949698
512 Ga0451576_0038238 3300045051 Bacteria 5078
513 Ga0466958_0000259 3300045836 Bacteria 20492
514 Ga0466958_0001672 3300045836 Bacteria 10697
515 Ga0495617_002792 3300046452 Bacteria 6737
516 Ga0495627_005535 3300046453 Bacteria 5069
517 Ga0495590_0000056 3300046457 Bacteria 96913
518 Ga0495590_0008633 3300046457 Bacteria 3883
519 Ga0495590_0010545 3300046457 Bacteria 3470
520 Ga0495591_001291 3300046458 Bacteria 15945
521 Ga0495638_0000602 3300046460 Bacteria 40434
522 Ga0495638_0003410 3300046460 Bacteria 12526
523 Ga0495638_0121630 3300046460 Bacteria 1542
524 Ga0495651_0000872 3300046462 Bacteria 23438
525 Ga0495651_0057554 3300046462 Bacteria 2984
526 Ga0495650_0000284 3300046471 Bacteria 96068
527 Ga0495650_0000454 3300046471 Bacteria 64731
528 Ga0495650_0001444 3300046471 Bacteria 22917
529 Ga0495650_0021959 3300046471 Bacteria 3069
530 Ga0495605_0000102 3300046474 Bacteria 107430
531 Ga0495605_0000214 3300046474 Bacteria 71480
532 Ga0495605_0007367 3300046474 Bacteria 6248
533 Ga0495605_0023388 3300046474 Bacteria 3251
534 Ga0495605_0027315 3300046474 Bacteria 2958
535 Ga0495605_0032850 3300046474 Bacteria 2639
536 Ga0495605_0065753 3300046474 Bacteria 1724
537 Ga0495639_0004282 3300046475 Bacteria 6121
538 Ga0495662_0091516 3300046476 Bacteria 1483
539 Ga0495664_0006100 3300046477 Bacteria 6652
540 Ga0495584_0000210 3300046491 Bacteria 42003
541 Ga0495584_0002120 3300046491 Bacteria 11355
542 Ga0495584_0003854 3300046491 Bacteria 8138
543 Ga0495584_0008952 3300046491 Bacteria 5175
544 Ga0495584_0093572 3300046491 Bacteria 1517
545 Ga0495585_0001382 3300046492 Bacteria 19177
546 Ga0495585_0001745 3300046492 Bacteria 16560
547 Ga0495585_0002217 3300046492 Bacteria 14070
548 Ga0495596_0001107 3300046500 Bacteria 15956
549 Ga0495607_0000962 3300046501 Bacteria 26634
550 Ga0495607_0005543 3300046501 Bacteria 9007
551 Ga0495607_0024387 3300046501 Bacteria 3771
552 Ga0495583_0000553 3300046506 Bacteria 52333
553 Ga0495583_0002085 3300046506 Bacteria 18033
554 Ga0495606_0000149 3300046507 Bacteria 120165
555 Ga0495606_0000771 3300046507 Bacteria 49120
556 Ga0495606_0001996 3300046507 Bacteria 25148
557 Ga0495606_0002350 3300046507 Bacteria 22219
558 Ga0495606_0004293 3300046507 Bacteria 14365
559 Ga0495606_0032269 3300046507 Bacteria 3630
560 Ga0495608_0020491 3300046511 Bacteria 4545
561 Ga0495608_0129179 3300046511 Bacteria 1618
562 Ga0495610_0000371 3300046512 Bacteria 46658
563 Ga0495610_0000505 3300046512 Bacteria 39813
564 Ga0495610_0000805 3300046512 Bacteria 29394
565 Ga0495610_0017787 3300046512 Bacteria 4042
566 Ga0495610_0022295 3300046512 Bacteria 3467
567 Ga0495616_0000178 3300046513 Bacteria 54382
568 Ga0495616_0069273 3300046513 Bacteria 1711
569 Ga0495618_0048852 3300046514 Bacteria 2672
570 Ga0495620_0000266 3300046515 Bacteria 38388
571 Ga0495628_0003452 3300046516 Bacteria 14151
572 Ga0495631_0000234 3300046518 Bacteria 38074
573 Ga0495631_0000838 3300046518 Bacteria 19541
574 Ga0495631_0012128 3300046518 Bacteria 4220
575 Ga0495631_0016761 3300046518 Bacteria 3483
576 Ga0495632_0000110 3300046519 Bacteria 84473
577 Ga0495632_0000393 3300046519 Bacteria 41065
578 Ga0495632_0033510 3300046519 Bacteria 2636
579 Ga0495637_0000169 3300046520 Bacteria 50531
580 Ga0495637_0000487 3300046520 Bacteria 28799
581 Ga0495637_0005579 3300046520 Bacteria 6386
582 Ga0495643_0002037 3300046522 Bacteria 16800
583 Ga0495643_0004493 3300046522 Bacteria 9728
584 Ga0495643_0017980 3300046522 Bacteria 4118
585 Ga0495644_0001354 3300046523 Bacteria 10008
586 Ga0495648_0000119 3300046524 Bacteria 95682
587 Ga0495648_0000848 3300046524 Bacteria 32268
588 Ga0495648_0004260 3300046524 Bacteria 12274
589 Ga0495648_0020734 3300046524 Bacteria 4574
590 Ga0495642_0000742 3300046528 Bacteria 16176
591 Ga0495642_0001112 3300046528 Bacteria 12402
592 Ga0495642_0004309 3300046528 Bacteria 5528
593 Ga0495652_0038050 3300046529 Bacteria 4170
594 Ga0495652_0093643 3300046529 Bacteria 2452
595 Ga0495654_0000349 3300046530 Bacteria 39806
596 Ga0495654_0057004 3300046530 Bacteria 1888
597 Ga0495640_0015795 3300046533 Bacteria 5666
598 Ga0495587_0031513 3300046536 Bacteria 3210
599 Ga0495609_0000002 3300046538 Bacteria 739816
600 Ga0495609_0008264 3300046538 Bacteria 5107
601 Ga0495609_0012385 3300046538 Bacteria 4045
602 Ga0495597_0000450 3300046542 Bacteria 35268
603 Ga0495622_0000574 3300046557 Bacteria 22031
604 Ga0495633_0000003 3300046558 Bacteria 472476
605 Ga0495633_0000088 3300046558 Bacteria 124193
606 Ga0495633_0017087 3300046558 Bacteria 3720
607 Ga0495656_0009942 3300046615 Bacteria 3441
608 Ga0495656_0046292 3300046615 Bacteria 1840
609 Ga0495668_0000188 3300046616 Bacteria 92177
610 Ga0495668_0000673 3300046616 Bacteria 41193
611 Ga0495668_0000801 3300046616 Bacteria 36223
612 Ga0495668_0001028 3300046616 Bacteria 29571
613 Ga0495668_0003760 3300046616 Bacteria 11133
614 Ga0495668_0005007 3300046616 Bacteria 9149
615 Ga0495634_0001931 3300046642 Bacteria 17735
616 Ga0495625_0000929 3300046660 Bacteria 39380
617 Ga0495625_0001607 3300046660 Bacteria 26676
618 Ga0495635_0118510 3300046663 Bacteria 1806
619 Ga0495661_0000207 3300046665 Bacteria 67846
620 Ga0495661_0000258 3300046665 Bacteria 60916
621 Ga0495661_0000649 3300046665 Bacteria 35207
622 Ga0495661_0000723 3300046665 Bacteria 32427
623 Ga0495661_0001310 3300046665 Bacteria 21143
624 Ga0495661_0002383 3300046665 Bacteria 14513
625 Ga0495661_0004690 3300046665 Bacteria 9817
626 Ga0495613_0111214 3300046689 Bacteria 1974
627 Ga0495670_0007862 3300046691 Bacteria 5245
628 Ga0495649_0000133 3300046694 Bacteria 65433
629 Ga0495649_0000350 3300046694 Bacteria 39632
630 Ga0495649_0018844 3300046694 Bacteria 3877
631 Ga0495589_0000009 3300046794 Bacteria 256265
632 Ga0495589_0000834 3300046794 Bacteria 19363
633 Ga0495660_0000042 3300046810 Bacteria 167048
634 Ga0495660_0000938 3300046810 Bacteria 21368
635 Ga0495674_0004286 3300047319 Bacteria 13728
636 Ga0495672_0000125 3300047320 Bacteria 118271
637 Ga0495672_0001479 3300047320 Bacteria 23049
638 Ga0495672_0055104 3300047320 Bacteria 2321
639 Ga0495676_0000567 3300047321 Bacteria 30353
640 Ga0495683_0022084 3300047323 Bacteria 3274
641 Ga0495687_000013 3300047443 Bacteria 371058
642 Ga0495687_000811 3300047443 Bacteria 33635
643 Ga0495687_000988 3300047443 Bacteria 28638
644 Ga0495675_0005404 3300047444 Bacteria 7786
645 Ga0495677_0000024 3300047445 Bacteria 99215
646 Ga0495677_0011379 3300047445 Bacteria 3256
647 Ga0495679_000373 3300047446 Bacteria 34281
648 Ga0495679_000766 3300047446 Bacteria 20467
649 Ga0495679_001063 3300047446 Bacteria 16662
650 Ga0495673_0000146 3300047469 Bacteria 127378
651 Ga0495681_0000196 3300047470 Bacteria 50863
652 Ga0495681_0062794 3300047470 Bacteria 1706
653 Ga0495684_0072504 3300047471 Bacteria 2616
654 Ga0495686_0000332 3300047472 Bacteria 77832
655 Ga0495686_0000779 3300047472 Bacteria 41840
656 Ga0495686_0001970 3300047472 Bacteria 20400
657 Ga0495686_0002414 3300047472 Bacteria 17718
658 Ga0495686_0003633 3300047472 Bacteria 13228
659 Ga0495686_0096275 3300047472 Bacteria 1792
660 Ga0495602_0004979 3300048088 Bacteria 13922
661 Ga0495626_0000151 3300048091 Bacteria 86296
662 Ga0495626_0000311 3300048091 Bacteria 51548
663 Ga0495626_0001120 3300048091 Bacteria 22506
664 Ga0495626_0002177 3300048091 Bacteria 14101
665 Ga0495626_0002471 3300048091 Bacteria 12790
666 Ga0495626_0005839 3300048091 Bacteria 7100
667 Ga0495626_0034500 3300048091 Bacteria 2419
668 Ga0496101_0037710 3300048904 Bacteria 3430
669 Ga0496102_0035649 3300048905 Bacteria 4478
670 Ga0496102_0065520 3300048905 Bacteria 3330
671 Ga0496104_0034953 3300048907 Bacteria 4689
672 Ga0496106_0053938 3300048909 Bacteria 3037
673 Ga0496107_0060349 3300048910 Bacteria 2745
674 Ga0496109_0034494 3300048912 Bacteria 4557
675 Ga0496109_0110437 3300048912 Bacteria 2556
676 Ga0496110_0020145 3300048913 Bacteria 5627
677 Ga0496112_0006013 3300048915 Bacteria 10592
678 Ga0496112_0090760 3300048915 Bacteria 3024
679 Ga0496116_0015775 3300048919 Bacteria 5952
680 Ga0496116_0026819 3300048919 Bacteria 4203
681 Ga0496117_0000010 3300048920 Bacteria 611954
682 Ga0496117_0002526 3300048920 Bacteria 22920
683 Ga0496117_0020607 3300048920 Bacteria 5369
684 Ga0496118_0000009 3300048921 Bacteria 611954
685 Ga0496118_0002734 3300048921 Bacteria 23211
686 Ga0496118_0047473 3300048921 Bacteria 3327
687 Ga0496118_0114805 3300048921 Bacteria 1775
688 Ga0496119_0002272 3300048922 Bacteria 21341
689 Ga0496121_0000087 3300048924 Bacteria 222451
690 Ga0496121_0000518 3300048924 Bacteria 73428
691 Ga0496121_0002120 3300048924 Bacteria 31168
692 Ga0496121_0002258 3300048924 Bacteria 30031
693 Ga0496121_0006329 3300048924 Bacteria 14764
694 Ga0496121_0030743 3300048924 Bacteria 4926
695 Ga0496122_0043622 3300048925 Bacteria 3511
696 Ga0496123_0061352 3300048926 Bacteria 2416
697 Ga0496124_0001999 3300048927 Bacteria 27784
698 Ga0496124_0002832 3300048927 Bacteria 21955
699 Ga0496124_0003913 3300048927 Bacteria 17798
700 Ga0496124_0005236 3300048927 Bacteria 14712
701 Ga0496124_0013995 3300048927 Bacteria 7786
702 Ga0496124_0025815 3300048927 Bacteria 5311
703 Ga0496124_0036082 3300048927 Bacteria 4318
704 Ga0496125_0007187 3300048928 Bacteria 11871
705 Ga0496125_0084766 3300048928 Bacteria 2405
706 Ga0496125_0085069 3300048928 Bacteria 2398
707 Ga0496126_0003931 3300048929 Bacteria 18201
708 Ga0496126_0004264 3300048929 Bacteria 17195
709 Ga0496126_0008917 3300048929 Bacteria 10741
710 Ga0496126_0011383 3300048929 Bacteria 9218
711 Ga0496126_0147391 3300048929 Bacteria 2020
712 Ga0495678_002507 3300049459 Bacteria 12363
713 Ga0495678_006851 3300049459 Bacteria 5989
714 Ga0495678_007148 3300049459 Bacteria 5830
715 Ga0501300_005324 3300049523 Bacteria 1899
716 Ga0501034_0056451 3300049571 Bacteria 3951
717 Ga0501038_0034733 3300049574 Bacteria 4432
718 Ga0501047_0108738 3300049581 Bacteria 2655
719 Ga0501070_0089955 3300049586 Bacteria 2541
720 Ga0501211_001797 3300049658 Bacteria 2290
721 Ga0501223_000330 3300049663 Bacteria 11742
722 Ga0501249_000029 3300049679 Bacteria 86766
723 Ga0501225_0009277 3300049705 Bacteria 2804
724 Ga0501245_006383 3300049708 Bacteria 1647
725 Ga0501035_0081534 3300049822 Bacteria 2855
726 Ga0501044_0012728 3300049823 Bacteria 9111
727 Ga0501044_0041388 3300049823 Bacteria 4796
728 nmdc:mga0k408_16770_c1 3300050493 Bacteria 4070
729 nmdc:mga0k408_5180_c1 3300050493 Bacteria 6914
730 nmdc:mga0k408_8160_c1 3300050493 Bacteria 5610
731 nmdc:mga0k408_85_c1 3300050493 Bacteria 43890
732 nmdc:mga06z11_48728_c1 3300050494 Bacteria 2158
733 nmdc:mga07m45_20565_c1 3300050496 Bacteria 3586
734 nmdc:mga07m45_31057_c1 3300050496 Bacteria 2960
735 nmdc:mga07m45_51972_c1 3300050496 Bacteria 2312
736 nmdc:mga0qj67_5357_c1 3300050509 Bacteria 9364
737 nmdc:mga0qj67_99486_c2 3300050509 Bacteria 1960
738 nmdc:mga06r32_78583_c1 3300050510 Bacteria 3207
739 nmdc:mga08y16_32878_c1 3300050511 Bacteria 5452
740 nmdc:mga0a205_1975_c1 3300050515 Bacteria 17865
741 nmdc:mga0a205_78965_c1 3300050515 Bacteria 3179
742 nmdc:mga0sz30_67_c1 3300050516 Bacteria 40523
743 Ga0500635_0000005 3300053080 Bacteria 187821
744 Ga0495595_0004581 3300053084 Bacteria 5559
745 Ga0495619_0022725 3300053085 Bacteria 4016
746 Ga0500643_000416 3300053087 Bacteria 32407
747 Ga0500562_000193 3300053108 Bacteria 16558
748 Ga0500562_012855 3300053108 Bacteria 2131
749 Ga0500592_000009 3300053116 Bacteria 87878
750 Ga0500593_000185 3300053117 Bacteria 25193
751 Ga0500594_0001222 3300053118 Bacteria 5552
752 Ga0500607_000386 3300053121 Bacteria 42198
753 Ga0500618_000774 3300053125 Bacteria 18011
754 Ga0500628_000320 3300053129 Bacteria 9207
755 Ga0500652_001105 3300053131 Bacteria 8693
756 Ga0500655_000476 3300053133 Bacteria 8132
757 Ga0500658_0001514 3300053134 Bacteria 9314
758 Ga0500559_0000174 3300053136 Bacteria 50893
759 Ga0500559_0000788 3300053136 Bacteria 20687
760 Ga0500564_041249 3300053138 Bacteria 2124
761 Ga0500604_0000190 3300053151 Bacteria 17544
762 Ga0500604_0008413 3300053151 Bacteria 2737
763 Ga0500616_0002312 3300053153 Bacteria 16122
764 Ga0500619_000059 3300053154 Bacteria 33814
765 Ga0500619_001478 3300053154 Bacteria 4174
766 Ga0500622_0000001 3300053156 Bacteria 657715
767 Ga0500622_0003702 3300053156 Bacteria 10023
768 Ga0500622_0005025 3300053156 Bacteria 8060
769 Ga0500622_0038554 3300053156 Bacteria 2492
770 Ga0500622_0044722 3300053156 Bacteria 2295
771 Ga0500622_0053841 3300053156 Bacteria 2065
772 Ga0500627_0000114 3300053158 Bacteria 25849
773 Ga0500627_0000992 3300053158 Bacteria 7711
774 Ga0500634_0000104 3300053161 Bacteria 32418
775 Ga0500570_000087 3300053724 Bacteria 25741
776 Ga0500645_000535 3300053730 Bacteria 25399
777 Ga0500587_000474 3300053739 Bacteria 4807

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047470 Ga0495681_0062794 Ga0495681_0062794_19_1188 377
2 3300013307 Ga0157372_10289308 Ga0157372_102893082 387
3 3300025933 Ga0207706_10232030 Ga0207706_102320302 387
4 3300053156 Ga0500622_0005025 Ga0500622_0005025_10_1179 387
5 3300048921 Ga0496118_0114805 Ga0496118_0114805_395_1609 399
6 3300046474 Ga0495605_0023388 Ga0495605_0023388_1973_3199 402
7 3300046694 Ga0495649_0018844 Ga0495649_0018844_2650_3867 403
8 3300003316 rootH1_10023399 rootH1_100233996 404
9 3300046453 Ga0495627_005535 Ga0495627_005535_3793_5028 405
10 3300046491 Ga0495584_0003854 Ga0495584_0003854_141_1454 408
11 3300046507 Ga0495606_0001996 Ga0495606_0001996_18549_19862 408
12 3300046542 Ga0495597_0000450 Ga0495597_0000450_20954_22267 408
13 3300046512 Ga0495610_0000371 Ga0495610_0000371_22713_24017 409
14 3300006946 Ga0079104_1000280 Ga0079104_100028053 413
15 3300027111 Ga0209281_1000337 Ga0209281_100033764 413
16 3300048091 Ga0495626_0001120 Ga0495626_0001120_15_1268 415
17 3300048091 Ga0495626_0034500 Ga0495626_0034500_15_1268 415
18 3300003322 rootL2_10017982 rootL2_100179822 419
19 3300003781 Ga0055536_1000002 Ga0055536_1000002521 419
20 3300003791 Ga0055530_10002636 Ga0055530_100026364 419
21 3300013104 Ga0157370_10004233 Ga0157370_100042336 419
22 3300013105 Ga0157369_10000594 Ga0157369_1000059421 419
23 3300015262 Ga0182007_10000024 Ga0182007_1000002420 419
24 3300025292 Ga0209676_1000022 Ga0209676_100002218 419
25 3300025298 Ga0209050_1000020 Ga0209050_1000020523 419
26 3300046558 Ga0495633_0000003 Ga0495633_0000003_386408_387673 419
27 3300013104 Ga0157370_10001430 Ga0157370_1000143015 422
28 3300049663 Ga0501223_000330 Ga0501223_000330_10456_11730 422
29 3300053156 Ga0500622_0044722 Ga0500622_0044722_247_1521 422
30 3300053730 Ga0500645_000535 Ga0500645_000535_5355_6629 422
31 3300005289 Ga0065704_10075142 Ga0065704_100751423 423
32 3300037312 Ga0395899_0000209 Ga0395899_0000209_80087_81364 423
33 3300042115 Ga0450911_000195 Ga0450911_000195_13709_15022 423
34 3300046491 Ga0495584_0000210 Ga0495584_0000210_17271_18584 423
35 3300046519 Ga0495632_0033510 Ga0495632_0033510_781_2094 423
36 3300046520 Ga0495637_0000169 Ga0495637_0000169_26904_28217 423
37 3300046665 Ga0495661_0000258 Ga0495661_0000258_23668_24981 423
38 3300053138 Ga0500564_041249 Ga0500564_041249_746_2023 423
39 3300005288 Ga0065714_10068111 Ga0065714_100681112 424
40 3300009011 Ga0105251_10001908 Ga0105251_100019085 424
41 3300015265 Ga0182005_1000579 Ga0182005_10005799 424
42 3300025735 Ga0207713_1001686 Ga0207713_100168615 424
43 3300041405 Ga0439438_000623 Ga0439438_000623_4042_5355 424
44 3300041411 Ga0439466_0000429 Ga0439466_0000429_4550_5863 424
45 3300042006 Ga0439432_000177 Ga0439432_000177_4525_5838 424
46 3300042009 Ga0439451_000069 Ga0439451_000069_14996_16309 424
47 3300042010 Ga0439452_000517 Ga0439452_000517_3854_5167 424
48 3300042013 Ga0439456_001562 Ga0439456_001562_2332_3645 424
49 3300046458 Ga0495591_001291 Ga0495591_001291_3783_5096 424
50 3300046460 Ga0495638_0000602 Ga0495638_0000602_25030_26343 424
51 3300046471 Ga0495650_0000454 Ga0495650_0000454_56663_57976 424
52 3300046471 Ga0495650_0021959 Ga0495650_0021959_985_2298 424
53 3300046474 Ga0495605_0000214 Ga0495605_0000214_34390_35703 424
54 3300046474 Ga0495605_0027315 Ga0495605_0027315_1181_2494 424
55 3300046501 Ga0495607_0024387 Ga0495607_0024387_1841_3154 424
56 3300046506 Ga0495583_0000553 Ga0495583_0000553_9442_10755 424
57 3300046506 Ga0495583_0002085 Ga0495583_0002085_1028_2341 424
58 3300046507 Ga0495606_0000771 Ga0495606_0000771_28113_29426 424
59 3300046512 Ga0495610_0000805 Ga0495610_0000805_11059_12372 424
60 3300046512 Ga0495610_0017787 Ga0495610_0017787_1733_3046 424
61 3300046515 Ga0495620_0000266 Ga0495620_0000266_28313_29626 424
62 3300046519 Ga0495632_0000110 Ga0495632_0000110_23300_24613 424
63 3300046519 Ga0495632_0000393 Ga0495632_0000393_24546_25859 424
64 3300046520 Ga0495637_0005579 Ga0495637_0005579_5040_6353 424
65 3300046524 Ga0495648_0000848 Ga0495648_0000848_5695_7008 424
66 3300046538 Ga0495609_0008264 Ga0495609_0008264_3533_4846 424
67 3300046665 Ga0495661_0000649 Ga0495661_0000649_8614_9927 424
68 3300046665 Ga0495661_0004690 Ga0495661_0004690_7074_8387 424
69 3300047321 Ga0495676_0000567 Ga0495676_0000567_16675_17988 424
70 3300047446 Ga0495679_001063 Ga0495679_001063_12500_13813 424
71 3300047470 Ga0495681_0000196 Ga0495681_0000196_16447_17760 424
72 3300048927 Ga0496124_0001999 Ga0496124_0001999_20037_21350 424
73 3300049459 Ga0495678_007148 Ga0495678_007148_803_2116 424
74 iso_pu_bacteria 2857627736 2857632398 426
75 iso_pu_bacteria 2945997725 2945998389 426
76 3300042016 Ga0439463_000134 Ga0439463_000134_4372_5694 427
77 iso_pu_bacteria 2585427687 2586209645 427
78 iso_pu_bacteria 2739367857 2740002883 427
79 iso_pu_bacteria 2739367858 2740007700 427
80 iso_pu_bacteria 2914759650 2914761990 427
81 3300003322 rootL2_10215171 rootL2_102151715 428
82 3300005455 Ga0070663_100000402 Ga0070663_10000040210 428
83 3300006195 Ga0075366_10000031 Ga0075366_1000003110 428
84 3300013102 Ga0157371_10004164 Ga0157371_100041648 428
85 3300013104 Ga0157370_10038265 Ga0157370_100382654 428
86 3300017792 Ga0163161_10013775 Ga0163161_100137752 428
87 3300032004 Ga0307414_10000198 Ga0307414_1000019820 428
88 3300032004 Ga0307414_10000538 Ga0307414_1000053812 428
89 3300032005 Ga0307411_10000004 Ga0307411_1000000450 428
90 3300046524 Ga0495648_0004260 Ga0495648_0004260_3991_5292 428
91 3300046538 Ga0495609_0012385 Ga0495609_0012385_219_1520 428
92 3300046616 Ga0495668_0000673 Ga0495668_0000673_16487_17788 428
93 3300050493 nmdc:mga0k408_85_c1 nmdc:mga0k408_85_c1_6356_7657 428
94 3300002737 JGI25162J39368_1000120 JGI25162J39368_100012059 429
95 3300003578 Ga0006562J51391_1008496 Ga0006562J51391_100849610 429
96 3300009545 Ga0105237_10001258 Ga0105237_1000125811 429
97 3300009545 Ga0105237_10001646 Ga0105237_100016468 429
98 3300009545 Ga0105237_10075539 Ga0105237_100755393 429
99 3300010375 Ga0105239_10000421 Ga0105239_1000042116 429
100 3300010375 Ga0105239_10001138 Ga0105239_1000113813 429
101 3300010375 Ga0105239_10001525 Ga0105239_1000152519 429
102 3300013100 Ga0157373_10000047 Ga0157373_1000004788 429
103 3300013102 Ga0157371_10002039 Ga0157371_1000203910 429
104 3300013104 Ga0157370_10000508 Ga0157370_100005082 429
105 3300013105 Ga0157369_10000572 Ga0157369_100005722 429
106 3300025233 Ga0209437_100143 Ga0209437_10014319 429
107 3300025261 Ga0209233_1001868 Ga0209233_10018686 429
108 3300025914 Ga0207671_10000987 Ga0207671_1000098718 429
109 3300025914 Ga0207671_10001650 Ga0207671_1000165016 429
110 3300041407 Ga0439447_000592 Ga0439447_000592_6050_7354 429
111 3300048927 Ga0496124_0005236 Ga0496124_0005236_10287_11591 429
112 3300049679 Ga0501249_000029 Ga0501249_000029_26150_27454 429
113 3300046518 Ga0495631_0000838 Ga0495631_0000838_11117_12418 430
114 3300047446 Ga0495679_000373 Ga0495679_000373_23606_24907 430
115 3300048920 Ga0496117_0002526 Ga0496117_0002526_4978_6279 430
116 3300048921 Ga0496118_0002734 Ga0496118_0002734_5252_6553 430
117 iso_pu_bacteria 2511231007 2511273015 430
118 iso_pu_bacteria 2513237082 2513555969 430
119 iso_pu_bacteria 2515154123 2515688494 430
120 iso_pu_bacteria 2599185160 2599353821 430
121 iso_pu_bacteria 2599185164 2599378929 430
122 iso_pu_bacteria 2599185165 2599386093 430
123 iso_pu_bacteria 2599185181 2599460655 430
124 iso_pu_bacteria 2599185186 2599489676 430
125 iso_pu_bacteria 2599185356 2600213268 430
126 iso_pu_bacteria 2600255313 2601773435 430
127 iso_pu_bacteria 2738541276 2738714005 430
128 iso_pu_bacteria 2834028612 2834029596 430
129 iso_pu_bacteria 2846033681 2846034742 430
130 iso_pu_bacteria 2932422444 2932426367 430
131 iso_pu_bacteria 637000220 637322431 430
132 iso_pu_bacteria 641736154 642416137 430
133 iso_pu_bacteria 8020945358 8020951649 430
134 iso_pu_bacteria 8055817908 8055819695 430
135 3300009094 Ga0111539_10204092 Ga0111539_102040922 431
136 3300046514 Ga0495618_0048852 Ga0495618_0048852_429_1811 431
137 3300046642 Ga0495634_0001931 Ga0495634_0001931_378_1760 431
138 3300047319 Ga0495674_0004286 Ga0495674_0004286_8352_9734 431
139 3300053153 Ga0500616_0002312 Ga0500616_0002312_3269_4612 431
140 iso_pu_bacteria 2919688452 2919688637 431
141 iso_pu_bacteria 2855730933 2855735463 433
142 iso_pu_bacteria 2855767633 2855771246 433
143 iso_pu_bacteria 2881412998 2881416889 433
144 iso_pu_bacteria 2921643360 2921644691 433
145 3300001915 JGI24741J21665_1008137 JGI24741J21665_10081372 434
146 3300002705 JGI25156J39149_1000313 JGI25156J39149_100031318 434
147 3300002987 JGI25159J45721_1002167 JGI25159J45721_10021673 434
148 3300005262 Ga0065165_1000167 Ga0065165_10001676 434
149 3300005339 Ga0070660_100000537 Ga0070660_1000005379 434
150 3300005366 Ga0070659_100002095 Ga0070659_1000020957 434
151 3300005563 Ga0068855_100003503 Ga0068855_10000350315 434
152 3300009036 Ga0105244_10000783 Ga0105244_1000078321 434
153 3300009092 Ga0105250_10002832 Ga0105250_100028324 434
154 3300009093 Ga0105240_10024586 Ga0105240_100245866 434
155 3300009545 Ga0105237_10046422 Ga0105237_100464222 434
156 3300009551 Ga0105238_10027418 Ga0105238_100274184 434
157 3300010375 Ga0105239_10008956 Ga0105239_100089564 434
158 3300011119 Ga0105246_10000244 Ga0105246_1000024424 434
159 3300011119 Ga0105246_10000490 Ga0105246_100004904 434
160 3300013100 Ga0157373_10025559 Ga0157373_100255592 434
161 3300013104 Ga0157370_10002664 Ga0157370_100026644 434
162 3300013104 Ga0157370_10023559 Ga0157370_100235592 434
163 3300013104 Ga0157370_10033974 Ga0157370_100339742 434
164 3300013296 Ga0157374_10259788 Ga0157374_102597881 434
165 3300013308 Ga0157375_10000629 Ga0157375_1000062910 434
166 3300014497 Ga0182008_10000118 Ga0182008_1000011846 434
167 3300014497 Ga0182008_10013366 Ga0182008_100133662 434
168 3300015261 Ga0182006_1000366 Ga0182006_100036622 434
169 3300015265 Ga0182005_1001431 Ga0182005_10014317 434
170 3300025228 Ga0209672_100532 Ga0209672_10053219 434
171 3300025256 Ga0209759_1000562 Ga0209759_100056217 434
172 3300025284 Ga0209130_1000016 Ga0209130_1000016263 434
173 3300025302 Ga0207426_1004366 Ga0207426_10043664 434
174 3300025711 Ga0207696_1017168 Ga0207696_10171682 434
175 3300025728 Ga0207655_1001036 Ga0207655_100103623 434
176 3300025904 Ga0207647_10059443 Ga0207647_100594432 434
177 3300025913 Ga0207695_10011856 Ga0207695_100118564 434
178 3300025914 Ga0207671_10035500 Ga0207671_100355003 434
179 3300025919 Ga0207657_10001827 Ga0207657_1000182717 434
180 3300025924 Ga0207694_10026822 Ga0207694_100268224 434
181 3300025932 Ga0207690_10000615 Ga0207690_1000061517 434
182 3300025949 Ga0207667_10003296 Ga0207667_1000329614 434
183 3300025949 Ga0207667_10050793 Ga0207667_100507934 434
184 3300026067 Ga0207678_10006529 Ga0207678_100065297 434
185 3300032002 Ga0307416_100002543 Ga0307416_1000025438 434
186 3300037471 Ga0395905_0073982 Ga0395905_0073982_625_1938 434
187 3300042876 Ga0451577_0031747 Ga0451577_0031747_1301_2617 434
188 3300042876 Ga0451577_0133079 Ga0451577_0133079_425_1741 434
189 3300044673 Ga0453683_0041045 Ga0453683_0041045_1440_2756 434
190 3300045051 Ga0451576_0000006 Ga0451576_0000006_677317_678633 434
191 3300045051 Ga0451576_0000006 Ga0451576_0000006_692682_693998 434
192 3300046530 Ga0495654_0057004 Ga0495654_0057004_272_1585 434
193 3300046616 Ga0495668_0000188 Ga0495668_0000188_9391_10704 434
194 3300046665 Ga0495661_0000723 Ga0495661_0000723_8527_9840 434
195 3300047472 Ga0495686_0002414 Ga0495686_0002414_6377_7690 434
196 3300048904 Ga0496101_0037710 Ga0496101_0037710_1550_2869 434
197 3300048907 Ga0496104_0034953 Ga0496104_0034953_3302_4621 434
198 3300048915 Ga0496112_0090760 Ga0496112_0090760_849_2168 434
199 3300048919 Ga0496116_0015775 Ga0496116_0015775_1711_3030 434
200 3300048924 Ga0496121_0000518 Ga0496121_0000518_65829_67142 434
201 3300048924 Ga0496121_0002258 Ga0496121_0002258_22234_23547 434
202 3300048924 Ga0496121_0006329 Ga0496121_0006329_2374_3693 434
203 3300048925 Ga0496122_0043622 Ga0496122_0043622_847_2166 434
204 3300048926 Ga0496123_0061352 Ga0496123_0061352_586_1905 434
205 3300048927 Ga0496124_0036082 Ga0496124_0036082_967_2286 434
206 3300048928 Ga0496125_0007187 Ga0496125_0007187_3540_4859 434
207 3300048928 Ga0496125_0085069 Ga0496125_0085069_952_2265 434
208 3300048929 Ga0496126_0004264 Ga0496126_0004264_1887_3200 434
209 3300048929 Ga0496126_0011383 Ga0496126_0011383_587_1900 434
210 3300050509 nmdc:mga0qj67_99486_c2 nmdc:mga0qj67_99486_c2_271_1599 434
211 3300050510 nmdc:mga06r32_78583_c1 nmdc:mga06r32_78583_c1_432_1760 434
212 3300053161 Ga0500634_0000104 Ga0500634_0000104_8556_9869 434
213 iso_pu_bacteria 2600255292 2601666666 434
214 iso_pu_bacteria 2600255292 2601667177 434
215 iso_pu_bacteria 2600255292 2601670720 434
216 iso_pu_bacteria 2600255292 2601671165 434
217 iso_pu_bacteria 2643221638 2644214911 434
218 iso_pu_bacteria 2857547612 2857548431 434
219 iso_pu_bacteria 2857558681 2857564182 434
220 iso_pu_bacteria 2885080285 2885084626 434
221 3300005335 Ga0070666_10006119 Ga0070666_100061192 435
222 3300005344 Ga0070661_100130914 Ga0070661_1001309142 435
223 3300005438 Ga0070701_10014086 Ga0070701_100140863 435
224 3300005444 Ga0070694_100040557 Ga0070694_1000405573 435
225 3300005444 Ga0070694_100072341 Ga0070694_1000723412 435
226 3300005457 Ga0070662_100075240 Ga0070662_1000752402 435
227 3300005466 Ga0070685_10020109 Ga0070685_100201091 435
228 3300005617 Ga0068859_100042590 Ga0068859_1000425902 435
229 3300006178 Ga0075367_10057980 Ga0075367_100579802 435
230 3300006186 Ga0075369_10000158 Ga0075369_100001587 435
231 3300006195 Ga0075366_10028312 Ga0075366_100283124 435
232 3300006353 Ga0075370_10020179 Ga0075370_100201792 435
233 3300006931 Ga0097620_100042591 Ga0097620_1000425912 435
234 3300009094 Ga0111539_10230499 Ga0111539_102304992 435
235 3300013308 Ga0157375_10000055 Ga0157375_10000055111 435
236 3300025903 Ga0207680_10003093 Ga0207680_100030934 435
237 3300025918 Ga0207662_10003922 Ga0207662_100039225 435
238 3300025920 Ga0207649_10077687 Ga0207649_100776872 435
239 3300025933 Ga0207706_10024393 Ga0207706_100243932 435
240 3300025940 Ga0207691_10000575 Ga0207691_1000057514 435
241 3300026095 Ga0207676_10121735 Ga0207676_101217352 435
242 3300026142 Ga0207698_10039959 Ga0207698_100399593 435
243 3300031548 Ga0307408_100000364 Ga0307408_10000036426 435
244 3300035117 Ga0373953_0003515 Ga0373953_0003515_584_1921 435
245 3300035118 Ga0373954_0010399 Ga0373954_0010399_318_1655 435
246 3300035172 Ga0373955_0003319 Ga0373955_0003319_2105_3442 435
247 3300037312 Ga0395899_0034707 Ga0395899_0034707_1248_2567 435
248 3300037466 Ga0395898_0185317 Ga0395898_0185317_539_1858 435
249 3300037471 Ga0395905_0004026 Ga0395905_0004026_4041_5357 435
250 3300044658 Ga0466972_0010263 Ga0466972_0010263_1794_3110 435
251 3300045051 Ga0451576_0038238 Ga0451576_0038238_26_1369 435
252 3300046462 Ga0495651_0057554 Ga0495651_0057554_617_1954 435
253 3300046511 Ga0495608_0020491 Ga0495608_0020491_1169_2506 435
254 3300046516 Ga0495628_0003452 Ga0495628_0003452_11449_12786 435
255 3300046529 Ga0495652_0093643 Ga0495652_0093643_227_1564 435
256 3300046536 Ga0495587_0031513 Ga0495587_0031513_883_2220 435
257 3300046689 Ga0495613_0111214 Ga0495613_0111214_556_1893 435
258 3300047444 Ga0495675_0005404 Ga0495675_0005404_502_1839 435
259 3300047472 Ga0495686_0000332 Ga0495686_0000332_13611_14930 435
260 3300050496 nmdc:mga07m45_31057_c1 nmdc:mga07m45_31057_c1_348_1667 435
261 3300050511 nmdc:mga08y16_32878_c1 nmdc:mga08y16_32878_c1_2396_3733 435
262 3300050516 nmdc:mga0sz30_67_c1 nmdc:mga0sz30_67_c1_28968_30287 435
263 3300053084 Ga0495595_0004581 Ga0495595_0004581_3499_4836 435
264 3300053085 Ga0495619_0022725 Ga0495619_0022725_765_2102 435
265 3300053156 Ga0500622_0000001 Ga0500622_0000001_132598_133914 435
266 iso_pu_bacteria 2838054893 2838054979 435
267 iso_pu_bacteria 8047673197 8047675764 435
268 3300005327 Ga0070658_10000596 Ga0070658_1000059623 436
269 3300005366 Ga0070659_100008464 Ga0070659_1000084645 436
270 3300005563 Ga0068855_100001138 Ga0068855_10000113812 436
271 3300005563 Ga0068855_100001663 Ga0068855_10000166317 436
272 3300013104 Ga0157370_10000485 Ga0157370_1000048530 436
273 3300025254 Ga0209148_1000237 Ga0209148_100023772 436
274 3300025909 Ga0207705_10000344 Ga0207705_1000034431 436
275 3300025932 Ga0207690_10009413 Ga0207690_100094134 436
276 3300025941 Ga0207711_10029581 Ga0207711_100295812 436
277 3300025949 Ga0207667_10000427 Ga0207667_1000042719 436
278 3300025949 Ga0207667_10012152 Ga0207667_100121525 436
279 3300037466 Ga0395898_0053628 Ga0395898_0053628_1404_2726 436
280 3300045049 Ga0466959_0039624 Ga0466959_0039624_1014_2336 436
281 3300045836 Ga0466958_0000259 Ga0466958_0000259_8356_9678 436
282 3300046476 Ga0495662_0091516 Ga0495662_0091516_14_1363 436
283 3300046477 Ga0495664_0006100 Ga0495664_0006100_1268_2617 436
284 3300046511 Ga0495608_0129179 Ga0495608_0129179_254_1603 436
285 3300046533 Ga0495640_0015795 Ga0495640_0015795_477_1826 436
286 3300046663 Ga0495635_0118510 Ga0495635_0118510_430_1779 436
287 3300046665 Ga0495661_0002383 Ga0495661_0002383_9415_10734 436
288 3300047471 Ga0495684_0072504 Ga0495684_0072504_523_1872 436
289 3300048928 Ga0496125_0084766 Ga0496125_0084766_349_1674 436
290 3300050493 nmdc:mga0k408_8160_c1 nmdc:mga0k408_8160_c1_1642_2991 436
291 3300053108 Ga0500562_012855 Ga0500562_012855_440_1789 436
292 3300053724 Ga0500570_000087 Ga0500570_000087_8244_9602 436
293 iso_pu_bacteria 2585428058 2587731156 436
294 3300002738 JGI25154J39366_1000711 JGI25154J39366_10007116 437
295 3300002739 JGI25158J39367_1000009 JGI25158J39367_100000920 437
296 3300002987 JGI25159J45721_1000778 JGI25159J45721_10007787 437
297 3300003187 JGI25151J46595_10001656 JGI25151J46595_100016568 437
298 3300003374 JGI25161J50226_1000115 JGI25161J50226_100011525 437
299 3300003763 Ga0055529_1000274 Ga0055529_100027431 437
300 3300003771 Ga0055526_1000085 Ga0055526_100008513 437
301 3300003773 Ga0055537_1000295 Ga0055537_100029510 437
302 3300003775 Ga0055524_1004778 Ga0055524_10047784 437
303 3300003784 Ga0055534_1000047 Ga0055534_100004759 437
304 3300003790 Ga0055528_1000049 Ga0055528_10000498 437
305 3300004625 Ga0055543_1000094 Ga0055543_100009419 437
306 3300005262 Ga0065165_1000434 Ga0065165_100043425 437
307 3300005262 Ga0065165_1014879 Ga0065165_10148791 437
308 3300005262 Ga0065165_1019668 Ga0065165_10196682 437
309 3300006846 Ga0075430_100000001 Ga0075430_10000000172 437
310 3300006948 Ga0099826_10000048 Ga0099826_1000004816 437
311 3300014497 Ga0182008_10002412 Ga0182008_100024122 437
312 3300015261 Ga0182006_1000010 Ga0182006_1000010241 437
313 3300015262 Ga0182007_10000021 Ga0182007_1000002130 437
314 3300015262 Ga0182007_10001040 Ga0182007_100010405 437
315 3300021361 Ga0213872_10000136 Ga0213872_1000013637 437
316 3300021361 Ga0213872_10000546 Ga0213872_100005469 437
317 3300021361 Ga0213872_10005357 Ga0213872_100053574 437
318 3300021361 Ga0213872_10010598 Ga0213872_100105983 437
319 3300025208 Ga0209436_100042 Ga0209436_10004229 437
320 3300025233 Ga0209437_106660 Ga0209437_1066602 437
321 3300025246 Ga0209646_1000169 Ga0209646_100016946 437
322 3300025250 Ga0209026_1005102 Ga0209026_10051023 437
323 3300025258 Ga0209129_1000329 Ga0209129_100032910 437
324 3300025272 Ga0209455_1000253 Ga0209455_100025331 437
325 3300025284 Ga0209130_1000227 Ga0209130_100022725 437
326 3300025284 Ga0209130_1004602 Ga0209130_10046022 437
327 3300025294 Ga0209025_1000039 Ga0209025_1000039122 437
328 3300025294 Ga0209025_1001164 Ga0209025_100116410 437
329 3300025295 Ga0209564_1000010 Ga0209564_1000010691 437
330 3300025302 Ga0207426_1031442 Ga0207426_10314422 437
331 3300025918 Ga0207662_10022336 Ga0207662_100223363 437
332 3300027666 Ga0209282_1000066 Ga0209282_100006665 437
333 3300031507 Ga0307509_10160307 Ga0307509_101603072 437
334 3300031711 Ga0265314_10034537 Ga0265314_100345373 437
335 3300037312 Ga0395899_0000281 Ga0395899_0000281_55981_57315 437
336 3300037418 Ga0395900_0072758 Ga0395900_0072758_2029_3360 437
337 3300038443 Ga0395901_0100568 Ga0395901_0100568_71_1402 437
338 3300039062 Ga0400483_277560 Ga0400483_277560_107_1429 437
339 3300039447 Ga0436361_0141619 Ga0436361_0141619_2825_4150 437
340 3300039447 Ga0436361_0399468 Ga0436361_0399468_1365_2690 437
341 3300039447 Ga0436361_0658458 Ga0436361_0658458_10101_11426 437
342 3300039447 Ga0436361_0954756 Ga0436361_0954756_12201_13526 437
343 3300046452 Ga0495617_002792 Ga0495617_002792_37_1362 437
344 3300046457 Ga0495590_0000056 Ga0495590_0000056_20274_21599 437
345 3300046457 Ga0495590_0008633 Ga0495590_0008633_2347_3669 437
346 3300046460 Ga0495638_0003410 Ga0495638_0003410_1856_3181 437
347 3300046471 Ga0495650_0000284 Ga0495650_0000284_34351_35676 437
348 3300046471 Ga0495650_0001444 Ga0495650_0001444_9308_10633 437
349 3300046474 Ga0495605_0000102 Ga0495605_0000102_90056_91381 437
350 3300046475 Ga0495639_0004282 Ga0495639_0004282_3377_4702 437
351 3300046491 Ga0495584_0093572 Ga0495584_0093572_162_1493 437
352 3300046492 Ga0495585_0001745 Ga0495585_0001745_3366_4694 437
353 3300046507 Ga0495606_0000149 Ga0495606_0000149_30405_31730 437
354 3300046507 Ga0495606_0002350 Ga0495606_0002350_6449_7774 437
355 3300046507 Ga0495606_0032269 Ga0495606_0032269_188_1513 437
356 3300046513 Ga0495616_0069273 Ga0495616_0069273_61_1395 437
357 3300046520 Ga0495637_0000487 Ga0495637_0000487_10723_12048 437
358 3300046522 Ga0495643_0002037 Ga0495643_0002037_6615_7949 437
359 3300046522 Ga0495643_0004493 Ga0495643_0004493_4149_5474 437
360 3300046524 Ga0495648_0000119 Ga0495648_0000119_13111_14436 437
361 3300046524 Ga0495648_0020734 Ga0495648_0020734_1418_2743 437
362 3300046528 Ga0495642_0001112 Ga0495642_0001112_7289_8614 437
363 3300046557 Ga0495622_0000574 Ga0495622_0000574_8654_9979 437
364 3300046558 Ga0495633_0000088 Ga0495633_0000088_112282_113607 437
365 3300046615 Ga0495656_0009942 Ga0495656_0009942_1412_2737 437
366 3300046616 Ga0495668_0001028 Ga0495668_0001028_20176_21501 437
367 3300046660 Ga0495625_0001607 Ga0495625_0001607_11367_12692 437
368 3300046665 Ga0495661_0001310 Ga0495661_0001310_16045_17370 437
369 3300046694 Ga0495649_0000350 Ga0495649_0000350_10854_12188 437
370 3300046794 Ga0495589_0000834 Ga0495589_0000834_14136_15461 437
371 3300046810 Ga0495660_0000042 Ga0495660_0000042_70549_71874 437
372 3300046810 Ga0495660_0000938 Ga0495660_0000938_1017_2342 437
373 3300047320 Ga0495672_0000125 Ga0495672_0000125_21492_22820 437
374 3300047320 Ga0495672_0001479 Ga0495672_0001479_19056_20381 437
375 3300047323 Ga0495683_0022084 Ga0495683_0022084_1809_3134 437
376 3300047443 Ga0495687_000988 Ga0495687_000988_15947_17272 437
377 3300047445 Ga0495677_0011379 Ga0495677_0011379_714_2039 437
378 3300047469 Ga0495673_0000146 Ga0495673_0000146_20338_21663 437
379 3300047469 Ga0495673_0000146 Ga0495673_0000146_26534_27859 437
380 3300047472 Ga0495686_0003633 Ga0495686_0003633_4490_5815 437
381 3300047472 Ga0495686_0096275 Ga0495686_0096275_406_1731 437
382 3300048091 Ga0495626_0000311 Ga0495626_0000311_33848_35173 437
383 3300048091 Ga0495626_0002471 Ga0495626_0002471_5999_7330 437
384 3300048920 Ga0496117_0000010 Ga0496117_0000010_444290_445615 437
385 3300048921 Ga0496118_0000009 Ga0496118_0000009_166340_167665 437
386 3300048924 Ga0496121_0002120 Ga0496121_0002120_23139_24464 437
387 3300048927 Ga0496124_0003913 Ga0496124_0003913_11293_12615 437
388 3300048927 Ga0496124_0025815 Ga0496124_0025815_2084_3409 437
389 3300049459 Ga0495678_002507 Ga0495678_002507_10214_11539 437
390 3300049459 Ga0495678_006851 Ga0495678_006851_635_1960 437
391 3300050515 nmdc:mga0a205_78965_c1 nmdc:mga0a205_78965_c1_1611_2963 437
392 3300053133 Ga0500655_000476 Ga0500655_000476_6308_7642 437
393 3300053136 Ga0500559_0000788 Ga0500559_0000788_2916_4274 437
394 3300053151 Ga0500604_0000190 Ga0500604_0000190_15707_17041 437
395 3300005333 Ga0070677_10066497 Ga0070677_100664971 438
396 3300005347 Ga0070668_100035103 Ga0070668_1000351033 438
397 3300005353 Ga0070669_100006723 Ga0070669_1000067234 438
398 3300005354 Ga0070675_100031164 Ga0070675_1000311642 438
399 3300005354 Ga0070675_100234542 Ga0070675_1002345422 438
400 3300005364 Ga0070673_100164007 Ga0070673_1001640072 438
401 3300005441 Ga0070700_100041253 Ga0070700_1000412532 438
402 3300005457 Ga0070662_100010169 Ga0070662_1000101692 438
403 3300005459 Ga0068867_100127973 Ga0068867_1001279732 438
404 3300005543 Ga0070672_100008613 Ga0070672_1000086132 438
405 3300005564 Ga0070664_100032833 Ga0070664_1000328333 438
406 3300005618 Ga0068864_100070993 Ga0068864_1000709933 438
407 3300005719 Ga0068861_100045828 Ga0068861_1000458283 438
408 3300005843 Ga0068860_100054861 Ga0068860_1000548612 438
409 3300009176 Ga0105242_10002227 Ga0105242_100022277 438
410 3300009177 Ga0105248_10016734 Ga0105248_100167344 438
411 3300013306 Ga0163162_10066203 Ga0163162_100662032 438
412 3300013307 Ga0157372_10034561 Ga0157372_100345612 438
413 3300013308 Ga0157375_10073477 Ga0157375_100734772 438
414 3300014325 Ga0163163_10067469 Ga0163163_100674692 438
415 3300017792 Ga0163161_10007796 Ga0163161_100077965 438
416 3300025291 Ga0209675_1000546 Ga0209675_100054610 438
417 3300025315 Ga0207697_10038625 Ga0207697_100386252 438
418 3300025923 Ga0207681_10003185 Ga0207681_100031857 438
419 3300025925 Ga0207650_10029108 Ga0207650_100291083 438
420 3300025926 Ga0207659_10016916 Ga0207659_100169163 438
421 3300025928 Ga0207700_10000009 Ga0207700_10000009286 438
422 3300025931 Ga0207644_10011155 Ga0207644_100111556 438
423 3300025933 Ga0207706_10016727 Ga0207706_100167273 438
424 3300025934 Ga0207686_10025577 Ga0207686_100255772 438
425 3300025940 Ga0207691_10067823 Ga0207691_100678232 438
426 3300025941 Ga0207711_10058424 Ga0207711_100584243 438
427 3300025945 Ga0207679_10033488 Ga0207679_100334883 438
428 3300025960 Ga0207651_10135283 Ga0207651_101352832 438
429 3300025972 Ga0207668_10047914 Ga0207668_100479142 438
430 3300026075 Ga0207708_10024712 Ga0207708_100247124 438
431 3300026088 Ga0207641_10043315 Ga0207641_100433153 438
432 3300026089 Ga0207648_10172059 Ga0207648_101720592 438
433 3300026095 Ga0207676_10139058 Ga0207676_101390582 438
434 3300026118 Ga0207675_100057789 Ga0207675_1000577893 438
435 3300028381 Ga0268264_10064467 Ga0268264_100644672 438
436 3300031456 Ga0307513_10152001 Ga0307513_101520012 438
437 3300046528 Ga0495642_0000742 Ga0495642_0000742_4711_6039 438
438 3300048929 Ga0496126_0008917 Ga0496126_0008917_6540_7913 438
439 3300049581 Ga0501047_0108738 Ga0501047_0108738_730_2067 438
440 3300049822 Ga0501035_0081534 Ga0501035_0081534_1209_2546 438
441 3300049823 Ga0501044_0041388 Ga0501044_0041388_1684_3021 438
442 iso_pu_bacteria 2585428057 2587728093 438
443 iso_pu_bacteria 8055225921 8055226157 438
444 3300003320 rootH2_10019449 rootH2_1001944917 439
445 3300003322 rootL2_10002855 rootL2_100028553 439
446 3300003775 Ga0055524_1000437 Ga0055524_100043729 439
447 3300004625 Ga0055543_1001560 Ga0055543_10015606 439
448 3300005262 Ga0065165_1000059 Ga0065165_100005973 439
449 3300005262 Ga0065165_1005158 Ga0065165_10051586 439
450 3300005343 Ga0070687_100013667 Ga0070687_1000136673 439
451 3300005347 Ga0070668_100002351 Ga0070668_1000023516 439
452 3300005353 Ga0070669_100000973 Ga0070669_1000009739 439
453 3300005356 Ga0070674_100061175 Ga0070674_1000611752 439
454 3300005441 Ga0070700_100001055 Ga0070700_10000105513 439
455 3300005459 Ga0068867_100000453 Ga0068867_10000045316 439
456 3300005544 Ga0070686_100013387 Ga0070686_1000133873 439
457 3300006195 Ga0075366_10019499 Ga0075366_100194993 439
458 3300006353 Ga0075370_10022825 Ga0075370_100228253 439
459 3300006881 Ga0068865_100001312 Ga0068865_10000131213 439
460 3300006944 Ga0099823_1000804 Ga0099823_100080416 439
461 3300009174 Ga0105241_10012640 Ga0105241_100126404 439
462 3300014745 Ga0157377_10000088 Ga0157377_1000008852 439
463 3300025273 Ga0209673_1004452 Ga0209673_10044525 439
464 3300025273 Ga0209673_1018432 Ga0209673_10184322 439
465 3300025298 Ga0209050_1004070 Ga0209050_10040704 439
466 3300025299 Ga0209256_1000424 Ga0209256_100042444 439
467 3300025303 Ga0209051_1000469 Ga0209051_100046922 439
468 3300025907 Ga0207645_10004012 Ga0207645_100040129 439
469 3300025911 Ga0207654_10001203 Ga0207654_100012034 439
470 3300025919 Ga0207657_10036177 Ga0207657_100361772 439
471 3300025923 Ga0207681_10000703 Ga0207681_100007039 439
472 3300025925 Ga0207650_10022834 Ga0207650_100228344 439
473 3300025933 Ga0207706_10105166 Ga0207706_101051663 439
474 3300025937 Ga0207669_10001655 Ga0207669_100016557 439
475 3300026075 Ga0207708_10002545 Ga0207708_1000254513 439
476 3300026089 Ga0207648_10000019 Ga0207648_1000001945 439
477 3300026089 Ga0207648_10015132 Ga0207648_100151325 439
478 3300027296 Ga0209389_1000523 Ga0209389_10005237 439
479 3300027876 Ga0209974_10022224 Ga0209974_100222242 439
480 3300028794 Ga0307515_10006229 Ga0307515_1000622912 439
481 3300028794 Ga0307515_10034203 Ga0307515_100342036 439
482 3300031548 Ga0307408_100010473 Ga0307408_1000104734 439
483 3300031548 Ga0307408_100018733 Ga0307408_1000187333 439
484 3300031649 Ga0307514_10055238 Ga0307514_100552382 439
485 3300031901 Ga0307406_10060951 Ga0307406_100609512 439
486 3300031995 Ga0307409_100028312 Ga0307409_1000283122 439
487 3300032002 Ga0307416_100023247 Ga0307416_1000232472 439
488 3300032126 Ga0307415_100031436 Ga0307415_1000314363 439
489 3300037312 Ga0395899_0076856 Ga0395899_0076856_870_2225 439
490 3300037418 Ga0395900_0106887 Ga0395900_0106887_1026_2381 439
491 3300042438 Ga0439459_0001902 Ga0439459_0001902_1229_2581 439
492 3300042532 Ga0450893_0003082 Ga0450893_0003082_657_2009 439
493 3300044683 Ga0466965_0004523 Ga0466965_0004523_4123_5478 439
494 3300044684 Ga0466966_0000556 Ga0466966_0000556_9596_10927 439
495 3300044693 Ga0466961_0002510 Ga0466961_0002510_8838_10169 439
496 3300044693 Ga0466961_0065813 Ga0466961_0065813_709_2064 439
497 3300044706 Ga0466964_0000063 Ga0466964_0000063_397_1752 439
498 3300045049 Ga0466959_0000447 Ga0466959_0000447_7251_8582 439
499 3300046457 Ga0495590_0010545 Ga0495590_0010545_1085_2437 439
500 3300046462 Ga0495651_0000872 Ga0495651_0000872_4403_5737 439
501 3300046474 Ga0495605_0007367 Ga0495605_0007367_1659_3014 439
502 3300046491 Ga0495584_0002120 Ga0495584_0002120_9806_11161 439
503 3300046501 Ga0495607_0000962 Ga0495607_0000962_11792_13147 439
504 3300046507 Ga0495606_0004293 Ga0495606_0004293_10749_12101 439
505 3300046513 Ga0495616_0000178 Ga0495616_0000178_28472_29827 439
506 3300046518 Ga0495631_0000234 Ga0495631_0000234_16826_18157 439
507 3300046518 Ga0495631_0012128 Ga0495631_0012128_1622_2974 439
508 3300046522 Ga0495643_0017980 Ga0495643_0017980_1908_3263 439
509 3300046528 Ga0495642_0004309 Ga0495642_0004309_3229_4581 439
510 3300046529 Ga0495652_0038050 Ga0495652_0038050_1569_2903 439
511 3300046538 Ga0495609_0000002 Ga0495609_0000002_522450_523805 439
512 3300046558 Ga0495633_0017087 Ga0495633_0017087_1876_3228 439
513 3300046615 Ga0495656_0046292 Ga0495656_0046292_40_1395 439
514 3300046616 Ga0495668_0005007 Ga0495668_0005007_5428_6780 439
515 3300046665 Ga0495661_0000207 Ga0495661_0000207_41801_43156 439
516 3300046691 Ga0495670_0007862 Ga0495670_0007862_2481_3833 439
517 3300046794 Ga0495589_0000009 Ga0495589_0000009_213051_214406 439
518 3300047320 Ga0495672_0055104 Ga0495672_0055104_253_1608 439
519 3300047443 Ga0495687_000013 Ga0495687_000013_213051_214406 439
520 3300047443 Ga0495687_000811 Ga0495687_000811_13942_15294 439
521 3300047445 Ga0495677_0000024 Ga0495677_0000024_39867_41222 439
522 3300048088 Ga0495602_0004979 Ga0495602_0004979_8186_9520 439
523 3300048091 Ga0495626_0000151 Ga0495626_0000151_35453_36808 439
524 3300048091 Ga0495626_0005839 Ga0495626_0005839_644_1999 439
525 3300048905 Ga0496102_0065520 Ga0496102_0065520_103_1455 439
526 3300048927 Ga0496124_0013995 Ga0496124_0013995_2403_3755 439
527 3300048929 Ga0496126_0003931 Ga0496126_0003931_10800_12152 439
528 3300049523 Ga0501300_005324 Ga0501300_005324_491_1843 439
529 3300049571 Ga0501034_0056451 Ga0501034_0056451_257_1603 439
530 3300049574 Ga0501038_0034733 Ga0501038_0034733_2029_3375 439
531 3300049586 Ga0501070_0089955 Ga0501070_0089955_736_2082 439
532 3300049823 Ga0501044_0012728 Ga0501044_0012728_7177_8523 439
533 3300050493 nmdc:mga0k408_16770_c1 nmdc:mga0k408_16770_c1_1431_2783 439
534 3300050496 nmdc:mga07m45_20565_c1 nmdc:mga07m45_20565_c1_788_2140 439
535 3300053118 Ga0500594_0001222 Ga0500594_0001222_627_1964 439
536 3300053134 Ga0500658_0001514 Ga0500658_0001514_7712_9064 439
537 3300053154 Ga0500619_001478 Ga0500619_001478_2550_3884 439
538 3300053156 Ga0500622_0038554 Ga0500622_0038554_10_1362 439
539 3300053156 Ga0500622_0053841 Ga0500622_0053841_150_1502 439
540 3300005262 Ga0065165_1019848 Ga0065165_10198482 440
541 3300006048 Ga0075363_100015353 Ga0075363_1000153534 440
542 3300006177 Ga0075362_10023250 Ga0075362_100232502 440
543 3300006178 Ga0075367_10003220 Ga0075367_100032203 440
544 3300013307 Ga0157372_10031659 Ga0157372_100316592 440
545 3300025256 Ga0209759_1000574 Ga0209759_10005749 440
546 3300025256 Ga0209759_1012361 Ga0209759_10123612 440
547 3300025949 Ga0207667_10100602 Ga0207667_101006022 440
548 3300026116 Ga0207674_10046818 Ga0207674_100468184 440
549 3300029957 Ga0265324_10000630 Ga0265324_1000063021 440
550 3300031250 Ga0265331_10005821 Ga0265331_100058212 440
551 3300037312 Ga0395899_0021800 Ga0395899_0021800_2792_4147 440
552 3300037466 Ga0395898_0047831 Ga0395898_0047831_708_2063 440
553 3300037471 Ga0395905_0038690 Ga0395905_0038690_1805_3160 440
554 3300039447 Ga0436361_0151105 Ga0436361_0151105_3703_5052 440
555 3300044658 Ga0466972_0022034 Ga0466972_0022034_56_1390 440
556 3300044693 Ga0466961_0000561 Ga0466961_0000561_14042_15397 440
557 3300044765 Ga0466970_0011421 Ga0466970_0011421_1318_2673 440
558 3300044842 Ga0466957_0014405 Ga0466957_0014405_1247_2593 440
559 3300044842 Ga0466957_0017135 Ga0466957_0017135_518_1873 440
560 3300045836 Ga0466958_0001672 Ga0466958_0001672_7137_8492 440
561 3300046460 Ga0495638_0121630 Ga0495638_0121630_178_1524 440
562 3300046474 Ga0495605_0032850 Ga0495605_0032850_433_1776 440
563 3300046474 Ga0495605_0065753 Ga0495605_0065753_192_1535 440
564 3300046491 Ga0495584_0008952 Ga0495584_0008952_3330_4673 440
565 3300046492 Ga0495585_0001382 Ga0495585_0001382_3223_4566 440
566 3300046492 Ga0495585_0002217 Ga0495585_0002217_4824_6167 440
567 3300046500 Ga0495596_0001107 Ga0495596_0001107_3639_4982 440
568 3300046518 Ga0495631_0016761 Ga0495631_0016761_1916_3259 440
569 3300046523 Ga0495644_0001354 Ga0495644_0001354_2385_3728 440
570 3300046616 Ga0495668_0003760 Ga0495668_0003760_5693_7036 440
571 3300047446 Ga0495679_000766 Ga0495679_000766_7684_9027 440
572 3300047472 Ga0495686_0001970 Ga0495686_0001970_5188_6543 440
573 3300048091 Ga0495626_0002177 Ga0495626_0002177_12336_13679 440
574 3300048921 Ga0496118_0047473 Ga0496118_0047473_1162_2538 440
575 3300048922 Ga0496119_0002272 Ga0496119_0002272_18170_19546 440
576 3300050494 nmdc:mga06z11_48728_c1 nmdc:mga06z11_48728_c1_425_1762 440
577 3300053080 Ga0500635_0000005 Ga0500635_0000005_134276_135619 440
578 3300053129 Ga0500628_000320 Ga0500628_000320_1904_3268 440
579 iso_pu_bacteria 2839138175 2839140630 441
580 3300037068 Ga0373925_0049088 Ga0373925_0049088_683_2029 442
581 3300048905 Ga0496102_0035649 Ga0496102_0035649_2968_4317 442
582 3300053117 Ga0500593_000185 Ga0500593_000185_9379_10740 442
583 3300053154 Ga0500619_000059 Ga0500619_000059_12746_14092 442
584 3300005327 Ga0070658_10001501 Ga0070658_1000150111 443
585 3300005329 Ga0070683_100018434 Ga0070683_1000184344 443
586 3300005336 Ga0070680_100038229 Ga0070680_1000382294 443
587 3300005339 Ga0070660_100003070 Ga0070660_1000030706 443
588 3300005366 Ga0070659_100008373 Ga0070659_1000083735 443
589 3300005455 Ga0070663_100073949 Ga0070663_1000739492 443
590 3300005458 Ga0070681_10204068 Ga0070681_102040682 443
591 3300005530 Ga0070679_100029494 Ga0070679_1000294943 443
592 3300005535 Ga0070684_100019423 Ga0070684_1000194234 443
593 3300005549 Ga0070704_100029675 Ga0070704_1000296753 443
594 3300005564 Ga0070664_100014244 Ga0070664_1000142444 443
595 3300005578 Ga0068854_100004322 Ga0068854_1000043224 443
596 3300005616 Ga0068852_100049228 Ga0068852_1000492283 443
597 3300005834 Ga0068851_10091645 Ga0068851_100916451 443
598 3300009093 Ga0105240_10016756 Ga0105240_100167566 443
599 3300009174 Ga0105241_10071856 Ga0105241_100718562 443
600 3300009551 Ga0105238_10034683 Ga0105238_100346833 443
601 3300013100 Ga0157373_10017878 Ga0157373_100178782 443
602 3300013307 Ga0157372_10048158 Ga0157372_100481582 443
603 3300025913 Ga0207695_10048140 Ga0207695_100481403 443
604 3300025917 Ga0207660_10017143 Ga0207660_100171432 443
605 3300025919 Ga0207657_10001327 Ga0207657_1000132716 443
606 3300025920 Ga0207649_10093041 Ga0207649_100930412 443
607 3300025921 Ga0207652_10038392 Ga0207652_100383922 443
608 3300025924 Ga0207694_10028497 Ga0207694_100284972 443
609 3300025932 Ga0207690_10207911 Ga0207690_102079111 443
610 3300025944 Ga0207661_10033723 Ga0207661_100337234 443
611 3300025949 Ga0207667_10028397 Ga0207667_100283974 443
612 3300026041 Ga0207639_10020960 Ga0207639_100209603 443
613 3300026067 Ga0207678_10100277 Ga0207678_101002772 443
614 3300026116 Ga0207674_10014731 Ga0207674_100147314 443
615 3300026142 Ga0207698_10047883 Ga0207698_100478833 443
616 3300046501 Ga0495607_0005543 Ga0495607_0005543_2822_4168 443
617 3300046694 Ga0495649_0000133 Ga0495649_0000133_18243_19589 443
618 3300053125 Ga0500618_000774 Ga0500618_000774_3150_4496 443
619 3300006177 Ga0075362_10000999 Ga0075362_100009992 444
620 3300053108 Ga0500562_000193 Ga0500562_000193_1665_3017 444
621 3300053131 Ga0500652_001105 Ga0500652_001105_5488_6834 444
622 iso_pu_bacteria 2585428062 2587759337 444
623 3300006195 Ga0075366_10014126 Ga0075366_100141264 445
624 3300006353 Ga0075370_10003436 Ga0075370_100034367 445
625 3300009176 Ga0105242_10010849 Ga0105242_100108495 445
626 3300010159 Ga0099796_10009326 Ga0099796_100093262 445
627 3300025934 Ga0207686_10071820 Ga0207686_100718202 445
628 3300028794 Ga0307515_10002251 Ga0307515_1000225132 445
629 3300028794 Ga0307515_10004349 Ga0307515_1000434916 445
630 3300031507 Ga0307509_10000904 Ga0307509_1000090448 445
631 3300031649 Ga0307514_10018767 Ga0307514_100187672 445
632 3300033180 Ga0307510_10002154 Ga0307510_1000215420 445
633 3300033180 Ga0307510_10003569 Ga0307510_100035692 445
634 3300046512 Ga0495610_0000505 Ga0495610_0000505_17707_19059 445
635 3300046512 Ga0495610_0022295 Ga0495610_0022295_1435_2793 445
636 3300046530 Ga0495654_0000349 Ga0495654_0000349_20743_22095 445
637 3300046660 Ga0495625_0000929 Ga0495625_0000929_14689_16044 445
638 3300050493 nmdc:mga0k408_5180_c1 nmdc:mga0k408_5180_c1_303_1661 445
639 3300050496 nmdc:mga07m45_51972_c1 nmdc:mga07m45_51972_c1_693_2048 445
640 3300053739 Ga0500587_000474 Ga0500587_000474_2025_3383 445
641 3300029957 Ga0265324_10000090 Ga0265324_1000009029 446
642 3300005367 Ga0070667_100000298 Ga0070667_10000029833 447
643 3300005841 Ga0068863_100003486 Ga0068863_1000034866 447
644 3300005843 Ga0068860_100000412 Ga0068860_10000041234 447
645 3300006931 Ga0097620_100027286 Ga0097620_1000272863 447
646 3300025986 Ga0207658_10000254 Ga0207658_1000025433 447
647 3300026088 Ga0207641_10002044 Ga0207641_1000204414 447
648 3300028381 Ga0268264_10000083 Ga0268264_1000008333 447
649 3300031731 Ga0307405_10038843 Ga0307405_100388433 447
650 3300053121 Ga0500607_000386 Ga0500607_000386_13033_14400 447
651 3300005843 Ga0068860_100016090 Ga0068860_1000160904 448
652 3300025921 Ga0207652_10171132 Ga0207652_101711322 448
653 3300028381 Ga0268264_10014029 Ga0268264_100140294 448
654 3300037466 Ga0395898_0063068 Ga0395898_0063068_1069_2469 448
655 3300009545 Ga0105237_10157673 Ga0105237_101576732 449
656 3300025914 Ga0207671_10098803 Ga0207671_100988032 449
657 3300032126 Ga0307415_100194317 Ga0307415_1001943172 449
658 3300001989 JGI24739J22299_10000336 JGI24739J22299_100003365 450
659 3300002067 JGI24735J21928_10002016 JGI24735J21928_100020163 450
660 3300005330 Ga0070690_100020398 Ga0070690_1000203982 450
661 3300005331 Ga0070670_100047220 Ga0070670_1000472203 450
662 3300005338 Ga0068868_100028844 Ga0068868_1000288443 450
663 3300005338 Ga0068868_100032871 Ga0068868_1000328714 450
664 3300005347 Ga0070668_100000850 Ga0070668_10000085018 450
665 3300005353 Ga0070669_100000372 Ga0070669_10000037218 450
666 3300005353 Ga0070669_100001543 Ga0070669_1000015433 450
667 3300005355 Ga0070671_100000287 Ga0070671_10000028718 450
668 3300005355 Ga0070671_100001504 Ga0070671_1000015042 450
669 3300005364 Ga0070673_100067301 Ga0070673_1000673012 450
670 3300005367 Ga0070667_100027529 Ga0070667_1000275293 450
671 3300005457 Ga0070662_100023027 Ga0070662_1000230274 450
672 3300005457 Ga0070662_100084037 Ga0070662_1000840373 450
673 3300005459 Ga0068867_100025227 Ga0068867_1000252275 450
674 3300005539 Ga0068853_100026442 Ga0068853_1000264423 450
675 3300005543 Ga0070672_100082270 Ga0070672_1000822702 450
676 3300005548 Ga0070665_100000152 Ga0070665_10000015227 450
677 3300005548 Ga0070665_100114759 Ga0070665_1001147593 450
678 3300005563 Ga0068855_100009842 Ga0068855_1000098423 450
679 3300005577 Ga0068857_100130081 Ga0068857_1001300812 450
680 3300005578 Ga0068854_100001405 Ga0068854_1000014056 450
681 3300005578 Ga0068854_100038590 Ga0068854_1000385902 450
682 3300005578 Ga0068854_100107715 Ga0068854_1001077152 450
683 3300005616 Ga0068852_100005716 Ga0068852_1000057164 450
684 3300005617 Ga0068859_100005526 Ga0068859_10000552610 450
685 3300005718 Ga0068866_10004108 Ga0068866_100041086 450
686 3300005841 Ga0068863_100007924 Ga0068863_1000079242 450
687 3300005842 Ga0068858_100022919 Ga0068858_1000229195 450
688 3300005842 Ga0068858_100033556 Ga0068858_1000335565 450
689 3300005843 Ga0068860_100001988 Ga0068860_1000019884 450
690 3300005843 Ga0068860_100009213 Ga0068860_1000092136 450
691 3300005843 Ga0068860_100101217 Ga0068860_1001012171 450
692 3300006237 Ga0097621_100015998 Ga0097621_1000159984 450
693 3300006358 Ga0068871_100060164 Ga0068871_1000601642 450
694 3300006852 Ga0075433_10046330 Ga0075433_100463303 450
695 3300006931 Ga0097620_100005526 Ga0097620_10000552610 450
696 3300006931 Ga0097620_100016879 Ga0097620_1000168794 450
697 3300009011 Ga0105251_10001577 Ga0105251_100015777 450
698 3300009098 Ga0105245_10011442 Ga0105245_100114426 450
699 3300009101 Ga0105247_10016494 Ga0105247_100164942 450
700 3300009148 Ga0105243_10005228 Ga0105243_100052283 450
701 3300009174 Ga0105241_10167234 Ga0105241_101672342 450
702 3300009176 Ga0105242_10024994 Ga0105242_100249943 450
703 3300009177 Ga0105248_10005696 Ga0105248_1000569610 450
704 3300009177 Ga0105248_10019448 Ga0105248_100194484 450
705 3300009177 Ga0105248_10048890 Ga0105248_100488903 450
706 3300009177 Ga0105248_10050405 Ga0105248_100504053 450
707 3300009545 Ga0105237_10001432 Ga0105237_1000143215 450
708 3300009553 Ga0105249_10028434 Ga0105249_100284342 450
709 3300011119 Ga0105246_10003540 Ga0105246_100035406 450
710 3300013296 Ga0157374_10088966 Ga0157374_100889662 450
711 3300013306 Ga0163162_10001713 Ga0163162_1000171319 450
712 3300013306 Ga0163162_10053712 Ga0163162_100537123 450
713 3300013306 Ga0163162_10119697 Ga0163162_101196971 450
714 3300013308 Ga0157375_10013502 Ga0157375_100135023 450
715 3300014968 Ga0157379_10040916 Ga0157379_100409163 450
716 3300014968 Ga0157379_10063383 Ga0157379_100633833 450
717 3300014969 Ga0157376_10052227 Ga0157376_100522273 450
718 3300025321 Ga0207656_10009379 Ga0207656_100093794 450
719 3300025321 Ga0207656_10027777 Ga0207656_100277772 450
720 3300025735 Ga0207713_1006601 Ga0207713_10066014 450
721 3300025900 Ga0207710_10055557 Ga0207710_100555572 450
722 3300025903 Ga0207680_10024889 Ga0207680_100248892 450
723 3300025909 Ga0207705_10093407 Ga0207705_100934072 450
724 3300025914 Ga0207671_10004477 Ga0207671_100044772 450
725 3300025923 Ga0207681_10000269 Ga0207681_1000026911 450
726 3300025927 Ga0207687_10077399 Ga0207687_100773992 450
727 3300025931 Ga0207644_10000163 Ga0207644_1000016320 450
728 3300025931 Ga0207644_10001973 Ga0207644_100019732 450
729 3300025933 Ga0207706_10028266 Ga0207706_100282663 450
730 3300025933 Ga0207706_10050704 Ga0207706_100507043 450
731 3300025934 Ga0207686_10021148 Ga0207686_100211482 450
732 3300025938 Ga0207704_10019891 Ga0207704_100198913 450
733 3300025940 Ga0207691_10097206 Ga0207691_100972062 450
734 3300025941 Ga0207711_10001635 Ga0207711_1000163513 450
735 3300025941 Ga0207711_10001666 Ga0207711_1000166616 450
736 3300025941 Ga0207711_10025493 Ga0207711_100254932 450
737 3300025941 Ga0207711_10030848 Ga0207711_100308482 450
738 3300025942 Ga0207689_10007647 Ga0207689_100076474 450
739 3300025960 Ga0207651_10020608 Ga0207651_100206083 450
740 3300025960 Ga0207651_10064481 Ga0207651_100644813 450
741 3300025981 Ga0207640_10006957 Ga0207640_100069575 450
742 3300025981 Ga0207640_10043044 Ga0207640_100430442 450
743 3300025986 Ga0207658_10009815 Ga0207658_100098154 450
744 3300025986 Ga0207658_10021424 Ga0207658_100214243 450
745 3300026035 Ga0207703_10010118 Ga0207703_100101182 450
746 3300026035 Ga0207703_10031138 Ga0207703_100311382 450
747 3300026035 Ga0207703_10045351 Ga0207703_100453511 450
748 3300026041 Ga0207639_10030083 Ga0207639_100300832 450
749 3300026041 Ga0207639_10074104 Ga0207639_100741042 450
750 3300026088 Ga0207641_10010838 Ga0207641_100108386 450
751 3300026088 Ga0207641_10060520 Ga0207641_100605201 450
752 3300026089 Ga0207648_10013847 Ga0207648_100138473 450
753 3300026095 Ga0207676_10067600 Ga0207676_100676002 450
754 3300026116 Ga0207674_10009959 Ga0207674_100099598 450
755 3300026116 Ga0207674_10130394 Ga0207674_101303942 450
756 3300026121 Ga0207683_10021454 Ga0207683_100214543 450
757 3300026142 Ga0207698_10059704 Ga0207698_100597042 450
758 3300028379 Ga0268266_10000125 Ga0268266_1000012535 450
759 3300028380 Ga0268265_10023251 Ga0268265_100232514 450
760 3300028380 Ga0268265_10027571 Ga0268265_100275714 450
761 3300028381 Ga0268264_10001036 Ga0268264_1000103613 450
762 3300028381 Ga0268264_10005274 Ga0268264_100052748 450
763 3300031995 Ga0307409_100083619 Ga0307409_1000836192 450
764 3300035691 Ga0373931_0060165 Ga0373931_0060165_162_1517 450
765 3300037418 Ga0395900_0155648 Ga0395900_0155648_840_2195 450
766 3300038443 Ga0395901_0018161 Ga0395901_0018161_3902_5257 450
767 3300038443 Ga0395901_0122037 Ga0395901_0122037_1043_2401 450
768 3300042005 Ga0439448_0001384 Ga0439448_0001384_2206_3561 450
769 3300042012 Ga0439455_0005912 Ga0439455_0005912_130_1485 450
770 3300042157 Ga0439458_0002354 Ga0439458_0002354_3047_4402 450
771 3300047472 Ga0495686_0000779 Ga0495686_0000779_29233_30588 450
772 3300048909 Ga0496106_0053938 Ga0496106_0053938_623_1978 450
773 3300048910 Ga0496107_0060349 Ga0496107_0060349_540_1895 450
774 3300048912 Ga0496109_0034494 Ga0496109_0034494_814_2169 450
775 3300048912 Ga0496109_0110437 Ga0496109_0110437_582_1937 450
776 3300048913 Ga0496110_0020145 Ga0496110_0020145_2803_4158 450
777 3300048915 Ga0496112_0006013 Ga0496112_0006013_3540_4895 450
778 3300048919 Ga0496116_0026819 Ga0496116_0026819_1582_2979 450
779 3300048920 Ga0496117_0020607 Ga0496117_0020607_226_1587 450
780 3300048924 Ga0496121_0000087 Ga0496121_0000087_118037_119407 450
781 3300048924 Ga0496121_0030743 Ga0496121_0030743_2348_3745 450
782 3300048927 Ga0496124_0002832 Ga0496124_0002832_6316_7692 450
783 3300048929 Ga0496126_0147391 Ga0496126_0147391_235_1602 450
784 3300050509 nmdc:mga0qj67_5357_c1 nmdc:mga0qj67_5357_c1_3852_5216 450
785 3300050515 nmdc:mga0a205_1975_c1 nmdc:mga0a205_1975_c1_1478_2833 450
786 3300053087 Ga0500643_000416 Ga0500643_000416_27803_29167 450
787 3300053116 Ga0500592_000009 Ga0500592_000009_75720_77126 450
788 3300053136 Ga0500559_0000174 Ga0500559_0000174_37473_38840 450
789 3300053156 Ga0500622_0003702 Ga0500622_0003702_8604_9971 450
790 3300053158 Ga0500627_0000114 Ga0500627_0000114_14493_15899 450
791 3300001904 JGI24736J21556_1009690 JGI24736J21556_10096902 452
792 3300002067 JGI24735J21928_10001316 JGI24735J21928_100013165 452
793 3300005539 Ga0068853_100100685 Ga0068853_1001006852 452
794 3300005563 Ga0068855_100034874 Ga0068855_1000348746 452
795 3300005614 Ga0068856_100023697 Ga0068856_1000236974 452
796 3300005616 Ga0068852_100065216 Ga0068852_1000652163 452
797 3300009093 Ga0105240_10016734 Ga0105240_100167346 452
798 3300009174 Ga0105241_10030818 Ga0105241_100308185 452
799 3300009545 Ga0105237_10105578 Ga0105237_101055781 452
800 3300009545 Ga0105237_10220082 Ga0105237_102200822 452
801 3300009551 Ga0105238_10007176 Ga0105238_1000717610 452
802 3300009551 Ga0105238_10019406 Ga0105238_100194062 452
803 3300010375 Ga0105239_10008218 Ga0105239_100082184 452
804 3300010375 Ga0105239_10037413 Ga0105239_100374136 452
805 3300013102 Ga0157371_10003453 Ga0157371_100034537 452
806 3300013297 Ga0157378_10003913 Ga0157378_100039138 452
807 3300014326 Ga0157380_10000325 Ga0157380_1000032518 452
808 3300025904 Ga0207647_10003721 Ga0207647_100037217 452
809 3300025911 Ga0207654_10037169 Ga0207654_100371692 452
810 3300025913 Ga0207695_10087928 Ga0207695_100879284 452
811 3300025914 Ga0207671_10116881 Ga0207671_101168811 452
812 3300026116 Ga0207674_10012951 Ga0207674_100129516 452
813 3300031548 Ga0307408_100066259 Ga0307408_1000662592 452
814 3300031731 Ga0307405_10000496 Ga0307405_100004964 452
815 3300031852 Ga0307410_10002639 Ga0307410_100026395 452
816 3300031911 Ga0307412_10002152 Ga0307412_100021524 452
817 3300046616 Ga0495668_0000801 Ga0495668_0000801_2798_4183 452
818 3300049658 Ga0501211_001797 Ga0501211_001797_693_2066 452
819 3300049705 Ga0501225_0009277 Ga0501225_0009277_1124_2497 452
820 3300049708 Ga0501245_006383 Ga0501245_006383_144_1517 452
821 3300053151 Ga0500604_0008413 Ga0500604_0008413_801_2186 452
822 3300053158 Ga0500627_0000992 Ga0500627_0000992_249_1634 452

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

49

444

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bcx-assembly1.cif.gz_B e1 dehydrase 0.9917 19 451
3bb8-assembly1.cif.gz_B e1 dehydrase h220k mutant 0.9899 19 451
3bcx-assembly1.cif.gz_A e1 dehydrase 0.9894 19 451
3bcx-assembly1.cif.gz_B e1 dehydrase 0.9823 19 451
3bb8-assembly1.cif.gz_B e1 dehydrase h220k mutant 0.9806 19 451
ID Description Score Start End Superfamily
3bb8A01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9883 19 322 3.40.640.10
3bcxB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9864 324 451 3.90.1150.10
3bb8A01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9849 19 322 3.40.640.10
3bcxB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9497 324 451 3.90.1150.10
5u1zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9469 62 321 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A3S4IJM2-F1-model_v4 L-glutamine:2-deoxy-scyllo-inosose aminotransferase (EC 2.6.1.-) 0.996 150 264 GO:0000271
GO:0008483
GO:0030170
AF-X1MUZ1-F1-model_v4 Lipopolysaccharide biosynthesis protein RfbH 0.9951 128 252 GO:0000271
GO:0008483
GO:0030170
AF-A0A3M7LIY0-F1-model_v4 deleted 0.9889 77 451
AF-A0A1J5AIH4-F1-model_v4 Lipopolysaccharide biosynthesis protein RfbH 0.9879 23 452 GO:0000271
GO:0008483
GO:0030170
AF-X1MMC8-F1-model_v4 Aminotransferase class I/classII domain-containing protein 0.9877 25 229 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
92.99 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map