F482279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 627 | 435 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_012026|Ga0500643_012026_1703_2788 |
| Length | 361 |
| Sequence | MVIFAKLFGGLRTKRQAGTVFPELPSICLQVPIRLGLAAQLRYLPGWYRQINNRVGAGPREVTPMTSVSFDKLDGFIWMNGEFVKWADAKIHVLTHGLHYASAVFEGERAYGGEIFKLTEHTERLHESARILGFKIPYSVEEIDDACRTLLKKQGFKDAYVRPIAWRGSEQMGVSAQNNRINCAVAIWQWPSYFDPAQKLKGIRLDIAEYRRPDPRTAPSKSKAAGLYMICTISKHAAEAKGYADALMYDWREQVAEATGANVFFVKDGKIHTPKPDCFLDGITRRTAIDLAKRRGIEVIERAIMPEELEGFEQCFLTGTAAEVTPVSEIGPYKFTVGKIAETLMNDYSAEVQPKHAIAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 11 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 12 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 13 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 14 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 15 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 16 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 17 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 18 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 19 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 20 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 21 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 22 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 23 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 24 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 25 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 26 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 27 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 28 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 29 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 30 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 31 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 32 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 33 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 34 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 35 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 36 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 37 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 38 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 39 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 40 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 41 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 42 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 43 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 44 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 45 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 46 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 47 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 48 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 49 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 50 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 51 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 52 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 53 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 54 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 55 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 56 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 57 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 58 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 59 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 60 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 61 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 62 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 63 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 64 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 65 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 66 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 67 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 68 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 69 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 70 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 71 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 72 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 73 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 74 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 75 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 76 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 77 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 78 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 79 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 80 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 81 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 82 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 83 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 84 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 85 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 86 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 87 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 88 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 89 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 90 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 91 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 92 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 93 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 94 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 95 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 96 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 97 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 98 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 99 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 100 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 101 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 102 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 103 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 104 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 105 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 106 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 107 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 108 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 109 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 110 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 111 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 112 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 113 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 114 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 115 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 116 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 117 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 118 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 119 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 120 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 121 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 122 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 123 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 124 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 125 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 126 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 127 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 128 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 129 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 130 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 131 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 132 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 133 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 134 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 135 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 136 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 137 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 138 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 139 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 140 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 141 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 142 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 143 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 144 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 145 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 146 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 147 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 148 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 149 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 150 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 151 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 152 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 153 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 154 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 155 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 156 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 157 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 158 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 159 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 160 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 161 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 162 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 163 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 164 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 165 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 166 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 167 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 168 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 169 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 170 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 171 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 172 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 173 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 174 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 175 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 176 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 177 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 178 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 179 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 180 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 181 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 182 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 183 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 184 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 185 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 186 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 187 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 188 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 189 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 190 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 191 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 192 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 193 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 194 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 195 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 196 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 197 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 198 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 199 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 200 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 201 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 202 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 203 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 204 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 205 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 206 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 207 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 208 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 209 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 210 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 211 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 212 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 213 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 214 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 215 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 216 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 217 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 218 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 219 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 220 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 221 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 222 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 223 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 224 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 225 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 226 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 227 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 228 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 229 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 230 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 231 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 232 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 233 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 234 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 235 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 236 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 237 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 238 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 239 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 240 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 241 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 242 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 243 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 244 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 245 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 246 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 247 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 248 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 249 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 250 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 251 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 252 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 253 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 254 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 255 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 256 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 257 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 258 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 259 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 260 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 261 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 262 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 263 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 264 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 265 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 266 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 267 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 268 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 269 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 270 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 271 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 272 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 273 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 274 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 275 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 276 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 277 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 278 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 279 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 280 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 281 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 282 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 283 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 284 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 285 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 286 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 287 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 288 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 289 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 290 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 291 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 292 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 293 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 294 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 295 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 296 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 297 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 298 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 299 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 300 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 301 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 302 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 303 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 304 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 305 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 306 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 307 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 308 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 309 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 310 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 311 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 312 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 313 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 314 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 315 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 316 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 317 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 318 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 319 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 320 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 321 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 322 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 323 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 324 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 325 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 326 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 327 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 328 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 329 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 330 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 331 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 332 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 333 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 334 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 335 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 336 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 337 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 338 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 339 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 340 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 341 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 342 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 343 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 344 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 345 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 346 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 347 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 348 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 349 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 350 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 351 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 352 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 353 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 354 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 355 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 356 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 357 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 358 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 359 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 360 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 361 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 362 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 363 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 364 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 365 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 366 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 367 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 368 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 369 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 370 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 371 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 372 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 373 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 374 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 375 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 376 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 378 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 379 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 380 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 381 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 382 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 383 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 384 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 385 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 386 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 387 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 388 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 389 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 390 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 391 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 392 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 393 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 394 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 395 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 396 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 397 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 398 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 399 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 400 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 401 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 402 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 403 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 404 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 405 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 406 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 407 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 408 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 409 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 411 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 412 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 413 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 414 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 415 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 416 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 417 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 418 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 419 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 420 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 421 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 422 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 423 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 424 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 425 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 426 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 427 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 428 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 429 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 430 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 431 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 432 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 433 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 434 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 435 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 436 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 438 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 440 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 441 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 442 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 443 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 444 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 445 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 446 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 468 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 470 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 471 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 472 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 473 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 474 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 475 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 476 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 477 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 478 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 479 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 480 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 481 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 482 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 483 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 484 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 485 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 486 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 487 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 488 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 489 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 490 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 491 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 492 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 493 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 494 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 495 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 496 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 497 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 498 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 499 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 500 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 501 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 502 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 503 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 504 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 505 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 506 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 507 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 540 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 541 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 542 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 543 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 544 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 545 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 546 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 547 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 548 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 549 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 550 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 551 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 552 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 553 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 554 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 555 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 556 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 557 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 558 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 559 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 560 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 561 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 562 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 570 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 571 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 572 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 581 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 584 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 585 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 586 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 587 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 588 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 589 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 590 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 591 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 592 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 593 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 594 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 595 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 596 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 597 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 598 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 599 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 600 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 601 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 602 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 604 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 605 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 606 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 607 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 608 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 609 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 610 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 611 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 612 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 613 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 614 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 615 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 616 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 617 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 618 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 619 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 620 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 621 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 622 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 623 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 624 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 625 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 626 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 627 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.5 |
| Metatranscriptomes | 0.49 |
| Isolates | 47.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.62 |
| Nodule | 31.67 |
| Rhizoplane | 2.8 |
| Rhizosphere | 40.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1002269 | 3300002739 | Bacteria | 3181 |
| 2 | JGI25157J39369_1000755 | 3300002741 | Bacteria | 16931 |
| 3 | JGI25159J45721_1000004 | 3300002987 | Bacteria | 215789 |
| 4 | JGI25159J45721_1000877 | 3300002987 | Bacteria | 13071 |
| 5 | JGI25151J46595_10031663 | 3300003187 | Bacteria | 2062 |
| 6 | JGI25406J46586_10043244 | 3300003203 | Bacteria | 1570 |
| 7 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 8 | JGI25160J50197_1000021 | 3300003354 | Bacteria | 215789 |
| 9 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 10 | JGI25161J50226_1000218 | 3300003374 | Bacteria | 36216 |
| 11 | Ga0055529_1007706 | 3300003763 | Bacteria | 1455 |
| 12 | Ga0055526_1001649 | 3300003771 | Bacteria | 15665 |
| 13 | Ga0055526_1008803 | 3300003771 | Bacteria | 4965 |
| 14 | Ga0055524_1002001 | 3300003775 | Bacteria | 10883 |
| 15 | Ga0055524_1012328 | 3300003775 | Bacteria | 3284 |
| 16 | Ga0055536_1000269 | 3300003781 | Bacteria | 39889 |
| 17 | Ga0055530_10007403 | 3300003791 | Bacteria | 4633 |
| 18 | Ga0055540_1028635 | 3300003792 | Bacteria | 1315 |
| 19 | Ga0055531_10045958 | 3300003794 | Bacteria | 1205 |
| 20 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 21 | Ga0055543_1000164 | 3300004625 | Bacteria | 55304 |
| 22 | Ga0058862_12092097 | 3300004803 | Bacteria | 1137 |
| 23 | Ga0065165_1000033 | 3300005262 | Bacteria | 215827 |
| 24 | Ga0070658_10003684 | 3300005327 | Bacteria | 12537 |
| 25 | Ga0070658_10062316 | 3300005327 | Bacteria | 3039 |
| 26 | Ga0070658_10505614 | 3300005327 | Bacteria | 1044 |
| 27 | Ga0070680_100114357 | 3300005336 | Bacteria | 2248 |
| 28 | Ga0070682_100133534 | 3300005337 | Bacteria | 1683 |
| 29 | Ga0070660_100045115 | 3300005339 | Bacteria | 3373 |
| 30 | Ga0070660_100082638 | 3300005339 | Bacteria | 2522 |
| 31 | Ga0070691_10003400 | 3300005341 | Bacteria | 7154 |
| 32 | Ga0070661_100000441 | 3300005344 | Bacteria | 31826 |
| 33 | Ga0070668_100310689 | 3300005347 | Bacteria | 1324 |
| 34 | Ga0070674_100154839 | 3300005356 | Bacteria | 1733 |
| 35 | Ga0070659_100036819 | 3300005366 | Bacteria | 3815 |
| 36 | Ga0070667_100214422 | 3300005367 | Bacteria | 1712 |
| 37 | Ga0070663_100025697 | 3300005455 | Bacteria | 3979 |
| 38 | Ga0070681_10081574 | 3300005458 | Bacteria | 3190 |
| 39 | Ga0068867_100089377 | 3300005459 | Bacteria | 2336 |
| 40 | Ga0068853_100013522 | 3300005539 | Bacteria | 6667 |
| 41 | Ga0068853_100253604 | 3300005539 | Bacteria | 1615 |
| 42 | Ga0070665_100142655 | 3300005548 | Bacteria | 2398 |
| 43 | Ga0070665_100259649 | 3300005548 | Bacteria | 1738 |
| 44 | Ga0068855_100013981 | 3300005563 | Bacteria | 9677 |
| 45 | Ga0068857_100082668 | 3300005577 | Bacteria | 2869 |
| 46 | Ga0068854_100178894 | 3300005578 | Bacteria | 1656 |
| 47 | Ga0068856_100257097 | 3300005614 | Bacteria | 1762 |
| 48 | Ga0068852_100026482 | 3300005616 | Bacteria | 4714 |
| 49 | Ga0081455_10238712 | 3300005937 | Bacteria | 1337 |
| 50 | Ga0081540_1033222 | 3300005983 | Bacteria | 2805 |
| 51 | Ga0081539_10000991 | 3300005985 | Bacteria | 52737 |
| 52 | Ga0075365_10005021 | 3300006038 | Bacteria | 7093 |
| 53 | Ga0075365_10009125 | 3300006038 | Bacteria | 5680 |
| 54 | Ga0075365_10023064 | 3300006038 | Bacteria | 3909 |
| 55 | Ga0075365_10027527 | 3300006038 | Bacteria | 3619 |
| 56 | Ga0075365_10050322 | 3300006038 | Bacteria | 2748 |
| 57 | Ga0075365_10065433 | 3300006038 | Bacteria | 2436 |
| 58 | Ga0075368_10084191 | 3300006042 | Bacteria | 1296 |
| 59 | Ga0075364_10004345 | 3300006051 | Bacteria | 8133 |
| 60 | Ga0075364_10025915 | 3300006051 | Bacteria | 3736 |
| 61 | Ga0075364_10037873 | 3300006051 | Bacteria | 3124 |
| 62 | Ga0075362_10028402 | 3300006177 | Bacteria | 2402 |
| 63 | Ga0075367_10000307 | 3300006178 | Bacteria | 17312 |
| 64 | Ga0075369_10091584 | 3300006186 | Bacteria | 1357 |
| 65 | Ga0075366_10162675 | 3300006195 | Bacteria | 1352 |
| 66 | Ga0075370_10017438 | 3300006353 | Bacteria | 3880 |
| 67 | Ga0075370_10135090 | 3300006353 | Bacteria | 1441 |
| 68 | Ga0105240_10002462 | 3300009093 | Bacteria | 29759 |
| 69 | Ga0105240_10078667 | 3300009093 | Bacteria | 4060 |
| 70 | Ga0105240_10207364 | 3300009093 | Bacteria | 2293 |
| 71 | Ga0105240_10478269 | 3300009093 | Bacteria | 1389 |
| 72 | Ga0105240_10608489 | 3300009093 | Bacteria | 1202 |
| 73 | Ga0105243_10087363 | 3300009148 | Bacteria | 2559 |
| 74 | Ga0105237_10003177 | 3300009545 | Bacteria | 19715 |
| 75 | Ga0105237_10306985 | 3300009545 | Bacteria | 1590 |
| 76 | Ga0105238_10012189 | 3300009551 | Bacteria | 8665 |
| 77 | Ga0105238_10094938 | 3300009551 | Bacteria | 2970 |
| 78 | Ga0105239_10202768 | 3300010375 | Bacteria | 2222 |
| 79 | Ga0105239_10501933 | 3300010375 | Bacteria | 1379 |
| 80 | Ga0157373_10032787 | 3300013100 | Bacteria | 3738 |
| 81 | Ga0157371_10119488 | 3300013102 | Bacteria | 1873 |
| 82 | Ga0157370_10005189 | 3300013104 | Bacteria | 14674 |
| 83 | Ga0157370_10135644 | 3300013104 | Bacteria | 2294 |
| 84 | Ga0157369_10047367 | 3300013105 | Bacteria | 4668 |
| 85 | Ga0157369_10576446 | 3300013105 | Bacteria | 1162 |
| 86 | Ga0171463_1017 | 3300013249 | Bacteria | 48649 |
| 87 | Ga0157372_10039780 | 3300013307 | Bacteria | 5190 |
| 88 | Ga0157372_10417303 | 3300013307 | Bacteria | 1564 |
| 89 | Ga0157375_10564256 | 3300013308 | Bacteria | 1299 |
| 90 | Ga0163163_10022780 | 3300014325 | Bacteria | 5936 |
| 91 | Ga0157379_10003397 | 3300014968 | Bacteria | 13466 |
| 92 | Ga0182006_1017059 | 3300015261 | Bacteria | 3091 |
| 93 | Ga0182007_10036984 | 3300015262 | Bacteria | 1640 |
| 94 | Ga0182005_1006094 | 3300015265 | Bacteria | 3715 |
| 95 | Ga0183363_1050 | 3300015690 | Bacteria | 38817 |
| 96 | Ga0163161_10327398 | 3300017792 | Bacteria | 1213 |
| 97 | Ga0213874_10005742 | 3300021377 | Bacteria | 2906 |
| 98 | Ga0213876_10000410 | 3300021384 | Bacteria | 35997 |
| 99 | Ga0213876_10003699 | 3300021384 | Bacteria | 8674 |
| 100 | Ga0209436_100276 | 3300025208 | Bacteria | 23572 |
| 101 | Ga0209436_105791 | 3300025208 | Bacteria | 2790 |
| 102 | Ga0207425_1020966 | 3300025245 | Bacteria | 1390 |
| 103 | Ga0209026_1000089 | 3300025250 | Bacteria | 175907 |
| 104 | Ga0209148_1000124 | 3300025254 | Bacteria | 185123 |
| 105 | Ga0209759_1000903 | 3300025256 | Bacteria | 22112 |
| 106 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 107 | Ga0209455_1000062 | 3300025272 | Bacteria | 335169 |
| 108 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 109 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 110 | Ga0209130_1005979 | 3300025284 | Bacteria | 4064 |
| 111 | Ga0209676_1000876 | 3300025292 | Bacteria | 38530 |
| 112 | Ga0209025_1000161 | 3300025294 | Bacteria | 166506 |
| 113 | Ga0209025_1000171 | 3300025294 | Bacteria | 160478 |
| 114 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 115 | Ga0209758_1023159 | 3300025297 | Bacteria | 2818 |
| 116 | Ga0209050_1006499 | 3300025298 | Bacteria | 6896 |
| 117 | Ga0209256_1000153 | 3300025299 | Bacteria | 144736 |
| 118 | Ga0209256_1002058 | 3300025299 | Bacteria | 17780 |
| 119 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 120 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 121 | Ga0209051_1003752 | 3300025303 | Bacteria | 9766 |
| 122 | Ga0207647_10046819 | 3300025904 | Bacteria | 2693 |
| 123 | Ga0207645_10174448 | 3300025907 | Bacteria | 1410 |
| 124 | Ga0207705_10000364 | 3300025909 | Bacteria | 41147 |
| 125 | Ga0207705_10075867 | 3300025909 | Bacteria | 2443 |
| 126 | Ga0207654_10121712 | 3300025911 | Bacteria | 1639 |
| 127 | Ga0207707_10001430 | 3300025912 | Bacteria | 22073 |
| 128 | Ga0207695_10001222 | 3300025913 | Bacteria | 44042 |
| 129 | Ga0207695_10119740 | 3300025913 | Bacteria | 2602 |
| 130 | Ga0207695_10223077 | 3300025913 | Bacteria | 1792 |
| 131 | Ga0207671_10002469 | 3300025914 | Bacteria | 19748 |
| 132 | Ga0207671_10020709 | 3300025914 | Bacteria | 5003 |
| 133 | Ga0207660_10003724 | 3300025917 | Bacteria | 9937 |
| 134 | Ga0207657_10000762 | 3300025919 | Bacteria | 34172 |
| 135 | Ga0207657_10052274 | 3300025919 | Bacteria | 3547 |
| 136 | Ga0207649_10000497 | 3300025920 | Bacteria | 27895 |
| 137 | Ga0207652_10002976 | 3300025921 | Bacteria | 14158 |
| 138 | Ga0207694_10010487 | 3300025924 | Bacteria | 6989 |
| 139 | Ga0207690_10048947 | 3300025932 | Bacteria | 2814 |
| 140 | Ga0207669_10040766 | 3300025937 | Bacteria | 2697 |
| 141 | Ga0207669_10190603 | 3300025937 | Bacteria | 1479 |
| 142 | Ga0207667_10187878 | 3300025949 | Bacteria | 2120 |
| 143 | Ga0207667_10254975 | 3300025949 | Bacteria | 1794 |
| 144 | Ga0207668_10013045 | 3300025972 | Bacteria | 5105 |
| 145 | Ga0207640_10209220 | 3300025981 | Bacteria | 1484 |
| 146 | Ga0207639_10048569 | 3300026041 | Bacteria | 3213 |
| 147 | Ga0207678_10046895 | 3300026067 | Bacteria | 3737 |
| 148 | Ga0207678_10379667 | 3300026067 | Bacteria | 1222 |
| 149 | Ga0207678_10409154 | 3300026067 | Bacteria | 1175 |
| 150 | Ga0207674_10044684 | 3300026116 | Bacteria | 4562 |
| 151 | Ga0207674_10240224 | 3300026116 | Bacteria | 1758 |
| 152 | Ga0207683_10196277 | 3300026121 | Bacteria | 1834 |
| 153 | Ga0209813_10050583 | 3300027866 | Bacteria | 1297 |
| 154 | Ga0268266_10030466 | 3300028379 | Bacteria | 4584 |
| 155 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 156 | Ga0307515_10001903 | 3300028794 | Bacteria | 46429 |
| 157 | Ga0307515_10016193 | 3300028794 | Bacteria | 13668 |
| 158 | Ga0265338_10091621 | 3300028800 | Bacteria | 2510 |
| 159 | Ga0265324_10002198 | 3300029957 | Bacteria | 10199 |
| 160 | Ga0265328_10006035 | 3300031239 | Bacteria | 5158 |
| 161 | Ga0265325_10006313 | 3300031241 | Bacteria | 7213 |
| 162 | Ga0265339_10025804 | 3300031249 | Bacteria | 3369 |
| 163 | Ga0265331_10000019 | 3300031250 | Bacteria | 258837 |
| 164 | Ga0265331_10000080 | 3300031250 | Bacteria | 137743 |
| 165 | Ga0265327_10000454 | 3300031251 | Bacteria | 73503 |
| 166 | Ga0265327_10027230 | 3300031251 | Bacteria | 3294 |
| 167 | Ga0265316_10014590 | 3300031344 | Bacteria | 6908 |
| 168 | Ga0307513_10002030 | 3300031456 | Bacteria | 28510 |
| 169 | Ga0307513_10183207 | 3300031456 | Bacteria | 1954 |
| 170 | Ga0307408_100123653 | 3300031548 | Bacteria | 2008 |
| 171 | Ga0265314_10040241 | 3300031711 | Bacteria | 3356 |
| 172 | Ga0265314_10130882 | 3300031711 | Bacteria | 1565 |
| 173 | Ga0307409_100542804 | 3300031995 | Bacteria | 1140 |
| 174 | Ga0316053_103587 | 3300032120 | Bacteria | 926 |
| 175 | Ga0373927_0005801 | 3300035695 | Bacteria | 8473 |
| 176 | Ga0373925_0007826 | 3300037068 | Bacteria | 7782 |
| 177 | Ga0395900_0000318 | 3300037418 | Bacteria | 71328 |
| 178 | Ga0395900_0177761 | 3300037418 | Bacteria | 2164 |
| 179 | Ga0395900_0586506 | 3300037418 | Bacteria | 1056 |
| 180 | Ga0395898_0000547 | 3300037466 | Bacteria | 71322 |
| 181 | Ga0395898_0048465 | 3300037466 | Bacteria | 4166 |
| 182 | Ga0395905_0000305 | 3300037471 | Bacteria | 71315 |
| 183 | Ga0395905_0000571 | 3300037471 | Bacteria | 49947 |
| 184 | Ga0395905_0007862 | 3300037471 | Bacteria | 10560 |
| 185 | Ga0395905_0033095 | 3300037471 | Bacteria | 4859 |
| 186 | Ga0395905_0040245 | 3300037471 | Bacteria | 4384 |
| 187 | Ga0395905_0046561 | 3300037471 | Bacteria | 4067 |
| 188 | Ga0395905_0103674 | 3300037471 | Bacteria | 2670 |
| 189 | Ga0436364_0194000 | 3300037853 | Bacteria | 2867 |
| 190 | Ga0395901_0000093 | 3300038443 | Bacteria | 120300 |
| 191 | Ga0395901_0027220 | 3300038443 | Bacteria | 5873 |
| 192 | Ga0395901_0118786 | 3300038443 | Bacteria | 2778 |
| 193 | Ga0395901_0140178 | 3300038443 | Bacteria | 2541 |
| 194 | Ga0395901_0175338 | 3300038443 | Bacteria | 2249 |
| 195 | Ga0395901_0393133 | 3300038443 | Bacteria | 1425 |
| 196 | Ga0400485_05700 | 3300038735 | Bacteria | 1442 |
| 197 | Ga0436365_0053390 | 3300039437 | Bacteria | 8756 |
| 198 | Ga0436365_1238706 | 3300039437 | Bacteria | 138652 |
| 199 | Ga0436361_0301911 | 3300039447 | Bacteria | 1855 |
| 200 | Ga0436363_0105350 | 3300039450 | Bacteria | 3172 |
| 201 | Ga0439436_0000675 | 3300041404 | Bacteria | 9161 |
| 202 | Ga0439438_019223 | 3300041405 | Bacteria | 1933 |
| 203 | Ga0439438_025738 | 3300041405 | Bacteria | 1600 |
| 204 | Ga0439447_009157 | 3300041407 | Bacteria | 3018 |
| 205 | Ga0439466_0053595 | 3300041411 | Bacteria | 1315 |
| 206 | Ga0439465_0001295 | 3300041413 | Bacteria | 8044 |
| 207 | Ga0439465_0003165 | 3300041413 | Bacteria | 5369 |
| 208 | Ga0439465_0013380 | 3300041413 | Bacteria | 2560 |
| 209 | Ga0439465_0020602 | 3300041413 | Bacteria | 2067 |
| 210 | Ga0439465_0042638 | 3300041413 | Bacteria | 1471 |
| 211 | Ga0439449_0020546 | 3300042007 | Bacteria | 2474 |
| 212 | Ga0439456_011381 | 3300042013 | Bacteria | 1840 |
| 213 | Ga0450906_000779 | 3300042145 | Bacteria | 6947 |
| 214 | Ga0439434_0015284 | 3300042435 | Bacteria | 2288 |
| 215 | Ga0453684_0020194 | 3300044712 | Bacteria | 10075 |
| 216 | Ga0466960_0003996 | 3300044901 | Bacteria | 5733 |
| 217 | Ga0466959_0017433 | 3300045049 | Bacteria | 5264 |
| 218 | Ga0451576_0005584 | 3300045051 | Bacteria | 15714 |
| 219 | Ga0495638_0000679 | 3300046460 | Bacteria | 36986 |
| 220 | Ga0495638_0011460 | 3300046460 | Bacteria | 6108 |
| 221 | Ga0495638_0033393 | 3300046460 | Bacteria | 3291 |
| 222 | Ga0495580_0002971 | 3300046472 | Bacteria | 14554 |
| 223 | Ga0495605_0001576 | 3300046474 | Bacteria | 14807 |
| 224 | Ga0495662_0005789 | 3300046476 | Bacteria | 6185 |
| 225 | Ga0495585_0011315 | 3300046492 | Bacteria | 5284 |
| 226 | Ga0495585_0146189 | 3300046492 | Bacteria | 1235 |
| 227 | Ga0495583_0001761 | 3300046506 | Bacteria | 20650 |
| 228 | Ga0495583_0055184 | 3300046506 | Bacteria | 1796 |
| 229 | Ga0495606_0001738 | 3300046507 | Bacteria | 27981 |
| 230 | Ga0495606_0175510 | 3300046507 | Bacteria | 1240 |
| 231 | Ga0495610_0108185 | 3300046512 | Bacteria | 1235 |
| 232 | Ga0495610_0108302 | 3300046512 | Bacteria | 1234 |
| 233 | Ga0495616_0020450 | 3300046513 | Bacteria | 3600 |
| 234 | Ga0495620_0067235 | 3300046515 | Bacteria | 1475 |
| 235 | Ga0495631_0000730 | 3300046518 | Bacteria | 21123 |
| 236 | Ga0495632_0013426 | 3300046519 | Bacteria | 4675 |
| 237 | Ga0495643_0010833 | 3300046522 | Bacteria | 5589 |
| 238 | Ga0495643_0060060 | 3300046522 | Bacteria | 2019 |
| 239 | Ga0495587_0084674 | 3300046536 | Bacteria | 1836 |
| 240 | Ga0495609_0011369 | 3300046538 | Bacteria | 4241 |
| 241 | Ga0495597_0140982 | 3300046542 | Bacteria | 994 |
| 242 | Ga0495633_0031225 | 3300046558 | Bacteria | 2585 |
| 243 | Ga0495656_0110228 | 3300046615 | Bacteria | 1286 |
| 244 | Ga0495668_0008861 | 3300046616 | Bacteria | 6234 |
| 245 | Ga0495611_0013690 | 3300046648 | Bacteria | 3457 |
| 246 | Ga0495625_0002939 | 3300046660 | Bacteria | 17768 |
| 247 | Ga0495625_0087967 | 3300046660 | Bacteria | 2153 |
| 248 | Ga0495625_0240197 | 3300046660 | Bacteria | 1180 |
| 249 | Ga0495588_0004788 | 3300046674 | Bacteria | 5988 |
| 250 | Ga0495588_0085964 | 3300046674 | Bacteria | 1645 |
| 251 | Ga0495588_0139954 | 3300046674 | Bacteria | 1278 |
| 252 | Ga0495657_0027610 | 3300046675 | Bacteria | 4003 |
| 253 | Ga0495658_0003511 | 3300046683 | Bacteria | 7758 |
| 254 | Ga0495649_0143104 | 3300046694 | Bacteria | 1258 |
| 255 | Ga0495600_0039364 | 3300046809 | Bacteria | 3078 |
| 256 | Ga0495604_0009407 | 3300047317 | Bacteria | 7728 |
| 257 | Ga0495672_0008168 | 3300047320 | Bacteria | 7764 |
| 258 | Ga0495676_0056828 | 3300047321 | Bacteria | 3092 |
| 259 | Ga0495687_059507 | 3300047443 | Bacteria | 1580 |
| 260 | Ga0495686_0002387 | 3300047472 | Bacteria | 17834 |
| 261 | Ga0495626_0046945 | 3300048091 | Bacteria | 2009 |
| 262 | Ga0496100_0057774 | 3300048903 | Bacteria | 2543 |
| 263 | Ga0496101_0052347 | 3300048904 | Bacteria | 2944 |
| 264 | Ga0496101_0253222 | 3300048904 | Bacteria | 1372 |
| 265 | Ga0496101_0379156 | 3300048904 | Bacteria | 1113 |
| 266 | Ga0496102_0101991 | 3300048905 | Bacteria | 2667 |
| 267 | Ga0496104_0006266 | 3300048907 | Bacteria | 10455 |
| 268 | Ga0496105_0005288 | 3300048908 | Bacteria | 9785 |
| 269 | Ga0496107_0033482 | 3300048910 | Bacteria | 3677 |
| 270 | Ga0496108_0002415 | 3300048911 | Bacteria | 14924 |
| 271 | Ga0496109_0005060 | 3300048912 | Bacteria | 11012 |
| 272 | Ga0496110_0123495 | 3300048913 | Bacteria | 2334 |
| 273 | Ga0496111_0000899 | 3300048914 | Bacteria | 16197 |
| 274 | Ga0496112_0004003 | 3300048915 | Bacteria | 12351 |
| 275 | Ga0496113_0009963 | 3300048916 | Bacteria | 6262 |
| 276 | Ga0496114_0337304 | 3300048917 | Bacteria | 1333 |
| 277 | Ga0496115_0060534 | 3300048918 | Bacteria | 3051 |
| 278 | Ga0496115_0062146 | 3300048918 | Bacteria | 3012 |
| 279 | Ga0496115_0191444 | 3300048918 | Bacteria | 1690 |
| 280 | Ga0496115_0288731 | 3300048918 | Bacteria | 1346 |
| 281 | Ga0496117_0001837 | 3300048920 | Bacteria | 28723 |
| 282 | Ga0496119_0000597 | 3300048922 | Bacteria | 48924 |
| 283 | Ga0496119_0009875 | 3300048922 | Bacteria | 8108 |
| 284 | Ga0496119_0067815 | 3300048922 | Bacteria | 2102 |
| 285 | Ga0496119_0084268 | 3300048922 | Bacteria | 1823 |
| 286 | Ga0496120_0004279 | 3300048923 | Bacteria | 12121 |
| 287 | Ga0496120_0046021 | 3300048923 | Bacteria | 2524 |
| 288 | Ga0496121_0014899 | 3300048924 | Bacteria | 8196 |
| 289 | Ga0496121_0093552 | 3300048924 | Bacteria | 2340 |
| 290 | Ga0496121_0099702 | 3300048924 | Bacteria | 2244 |
| 291 | Ga0496122_0000464 | 3300048925 | Bacteria | 84473 |
| 292 | Ga0496122_0001337 | 3300048925 | Bacteria | 40284 |
| 293 | Ga0496123_0000147 | 3300048926 | Bacteria | 143834 |
| 294 | Ga0496123_0001933 | 3300048926 | Bacteria | 27009 |
| 295 | Ga0496124_0001975 | 3300048927 | Bacteria | 27965 |
| 296 | Ga0496125_0003542 | 3300048928 | Bacteria | 18812 |
| 297 | Ga0496125_0042303 | 3300048928 | Bacteria | 3882 |
| 298 | Ga0496125_0042682 | 3300048928 | Bacteria | 3859 |
| 299 | Ga0496125_0057957 | 3300048928 | Bacteria | 3132 |
| 300 | Ga0496126_0000159 | 3300048929 | Bacteria | 155348 |
| 301 | Ga0496126_0000601 | 3300048929 | Bacteria | 67983 |
| 302 | Ga0496126_0040671 | 3300048929 | Bacteria | 4309 |
| 303 | Ga0496126_0372352 | 3300048929 | Bacteria | 1164 |
| 304 | Ga0495678_007759 | 3300049459 | Bacteria | 5526 |
| 305 | Ga0501031_0037769 | 3300049568 | Bacteria | 3152 |
| 306 | Ga0501031_0040544 | 3300049568 | Bacteria | 3040 |
| 307 | Ga0501031_0158152 | 3300049568 | Bacteria | 1481 |
| 308 | Ga0501032_0000024 | 3300049569 | Bacteria | 143876 |
| 309 | Ga0501032_0025428 | 3300049569 | Bacteria | 4081 |
| 310 | Ga0501032_0059597 | 3300049569 | Bacteria | 2562 |
| 311 | Ga0501033_0000391 | 3300049570 | Bacteria | 42136 |
| 312 | Ga0501033_0000761 | 3300049570 | Bacteria | 29642 |
| 313 | Ga0501033_0026641 | 3300049570 | Bacteria | 4350 |
| 314 | Ga0501033_0077922 | 3300049570 | Bacteria | 2432 |
| 315 | Ga0501033_0085303 | 3300049570 | Bacteria | 2313 |
| 316 | Ga0501033_0170294 | 3300049570 | Bacteria | 1564 |
| 317 | Ga0501033_0293658 | 3300049570 | Bacteria | 1146 |
| 318 | Ga0501034_0000140 | 3300049571 | Bacteria | 134996 |
| 319 | Ga0501034_0001662 | 3300049571 | Bacteria | 28665 |
| 320 | Ga0501034_0012775 | 3300049571 | Bacteria | 8660 |
| 321 | Ga0501034_0032089 | 3300049571 | Bacteria | 5336 |
| 322 | Ga0501034_0046132 | 3300049571 | Bacteria | 4403 |
| 323 | Ga0501034_0110748 | 3300049571 | Bacteria | 2736 |
| 324 | Ga0501034_0126770 | 3300049571 | Bacteria | 2537 |
| 325 | Ga0501034_0133499 | 3300049571 | Bacteria | 2465 |
| 326 | Ga0501034_0321635 | 3300049571 | Bacteria | 1480 |
| 327 | Ga0501036_0000443 | 3300049572 | Bacteria | 29542 |
| 328 | Ga0501037_0000024 | 3300049573 | Bacteria | 146046 |
| 329 | Ga0501037_0000818 | 3300049573 | Bacteria | 23265 |
| 330 | Ga0501037_0085127 | 3300049573 | Bacteria | 2289 |
| 331 | Ga0501037_0107988 | 3300049573 | Bacteria | 2005 |
| 332 | Ga0501037_0134238 | 3300049573 | Bacteria | 1773 |
| 333 | Ga0501037_0192105 | 3300049573 | Bacteria | 1445 |
| 334 | Ga0501038_0000064 | 3300049574 | Bacteria | 87975 |
| 335 | Ga0501038_0035848 | 3300049574 | Bacteria | 4355 |
| 336 | Ga0501038_0071828 | 3300049574 | Bacteria | 2935 |
| 337 | Ga0501038_0114276 | 3300049574 | Bacteria | 2233 |
| 338 | Ga0501038_0199300 | 3300049574 | Bacteria | 1607 |
| 339 | Ga0501039_0000017 | 3300049575 | Bacteria | 189412 |
| 340 | Ga0501039_0102757 | 3300049575 | Bacteria | 2231 |
| 341 | Ga0501043_0000050 | 3300049579 | Bacteria | 107465 |
| 342 | Ga0501043_0000124 | 3300049579 | Bacteria | 70977 |
| 343 | Ga0501043_0003156 | 3300049579 | Bacteria | 13634 |
| 344 | Ga0501043_0045975 | 3300049579 | Bacteria | 3432 |
| 345 | Ga0501043_0162767 | 3300049579 | Bacteria | 1743 |
| 346 | Ga0501047_0002344 | 3300049581 | Bacteria | 18111 |
| 347 | Ga0501047_0130263 | 3300049581 | Bacteria | 2396 |
| 348 | Ga0501047_0223423 | 3300049581 | Bacteria | 1739 |
| 349 | Ga0501047_0278230 | 3300049581 | Bacteria | 1519 |
| 350 | Ga0501068_0164490 | 3300049584 | Bacteria | 1399 |
| 351 | Ga0501069_0000004 | 3300049585 | Bacteria | 192353 |
| 352 | Ga0501069_0029583 | 3300049585 | Bacteria | 3006 |
| 353 | Ga0501069_0041303 | 3300049585 | Bacteria | 2549 |
| 354 | Ga0501069_0191142 | 3300049585 | Bacteria | 1184 |
| 355 | Ga0501070_0000031 | 3300049586 | Bacteria | 138137 |
| 356 | Ga0501070_0000148 | 3300049586 | Bacteria | 64874 |
| 357 | Ga0501070_0000694 | 3300049586 | Bacteria | 30882 |
| 358 | Ga0501070_0001919 | 3300049586 | Bacteria | 18354 |
| 359 | Ga0501070_0017646 | 3300049586 | Bacteria | 5992 |
| 360 | Ga0501070_0052822 | 3300049586 | Bacteria | 3372 |
| 361 | Ga0501070_0241825 | 3300049586 | Bacteria | 1477 |
| 362 | Ga0501073_0031453 | 3300049589 | Bacteria | 3787 |
| 363 | Ga0501073_0112523 | 3300049589 | Bacteria | 1888 |
| 364 | Ga0501074_0000006 | 3300049590 | Bacteria | 112293 |
| 365 | Ga0501074_0020074 | 3300049590 | Bacteria | 4856 |
| 366 | Ga0501074_0098200 | 3300049590 | Bacteria | 2096 |
| 367 | Ga0501074_0230576 | 3300049590 | Bacteria | 1318 |
| 368 | Ga0501074_0243704 | 3300049590 | Bacteria | 1278 |
| 369 | Ga0501080_0000693 | 3300049742 | Bacteria | 27033 |
| 370 | Ga0501080_0003339 | 3300049742 | Bacteria | 14170 |
| 371 | Ga0501080_0005406 | 3300049742 | Bacteria | 11390 |
| 372 | Ga0501080_0132306 | 3300049742 | Bacteria | 2309 |
| 373 | Ga0501080_0148412 | 3300049742 | Bacteria | 2168 |
| 374 | Ga0501080_0388074 | 3300049742 | Bacteria | 1257 |
| 375 | Ga0501083_0000066 | 3300049744 | Bacteria | 71496 |
| 376 | Ga0501083_0011927 | 3300049744 | Bacteria | 6089 |
| 377 | Ga0501273_014424 | 3300049770 | Bacteria | 1017 |
| 378 | Ga0501035_0000011 | 3300049822 | Bacteria | 305794 |
| 379 | Ga0501035_0000021 | 3300049822 | Bacteria | 209085 |
| 380 | Ga0501035_0000593 | 3300049822 | Bacteria | 39882 |
| 381 | Ga0501035_0001755 | 3300049822 | Bacteria | 21897 |
| 382 | Ga0501035_0003715 | 3300049822 | Bacteria | 14551 |
| 383 | Ga0501035_0005312 | 3300049822 | Bacteria | 12184 |
| 384 | Ga0501035_0006966 | 3300049822 | Bacteria | 10558 |
| 385 | Ga0501035_0035511 | 3300049822 | Bacteria | 4523 |
| 386 | Ga0501035_0087852 | 3300049822 | Bacteria | 2740 |
| 387 | Ga0501035_0176204 | 3300049822 | Bacteria | 1844 |
| 388 | Ga0501035_0258932 | 3300049822 | Bacteria | 1475 |
| 389 | Ga0501044_0000588 | 3300049823 | Bacteria | 44117 |
| 390 | Ga0501044_0000803 | 3300049823 | Bacteria | 37863 |
| 391 | Ga0501044_0002607 | 3300049823 | Bacteria | 20483 |
| 392 | Ga0501044_0006574 | 3300049823 | Bacteria | 12830 |
| 393 | Ga0501044_0012369 | 3300049823 | Bacteria | 9238 |
| 394 | Ga0501044_0014696 | 3300049823 | Bacteria | 8442 |
| 395 | Ga0501044_0035448 | 3300049823 | Bacteria | 5225 |
| 396 | Ga0501044_0051016 | 3300049823 | Bacteria | 4267 |
| 397 | Ga0501044_0064037 | 3300049823 | Bacteria | 3754 |
| 398 | Ga0501044_0083723 | 3300049823 | Bacteria | 3225 |
| 399 | Ga0501044_0124050 | 3300049823 | Bacteria | 2581 |
| 400 | Ga0501044_0174053 | 3300049823 | Bacteria | 2122 |
| 401 | Ga0501044_0180460 | 3300049823 | Bacteria | 2078 |
| 402 | Ga0501044_0184173 | 3300049823 | Bacteria | 2054 |
| 403 | Ga0501044_0189219 | 3300049823 | Bacteria | 2022 |
| 404 | Ga0501044_0217547 | 3300049823 | Bacteria | 1862 |
| 405 | Ga0501044_0297099 | 3300049823 | Bacteria | 1545 |
| 406 | Ga0501044_0365018 | 3300049823 | Bacteria | 1361 |
| 407 | nmdc:mga03683_19775_c1 | 3300050489 | Bacteria | 2574 |
| 408 | nmdc:mga00v17_10499_c1 | 3300050491 | Bacteria | 5058 |
| 409 | nmdc:mga0yw44_16779_c1 | 3300050492 | Bacteria | 3966 |
| 410 | nmdc:mga07m45_12959_c1 | 3300050496 | Bacteria | 4411 |
| 411 | nmdc:mga07m45_45525_c2 | 3300050496 | Bacteria | 2088 |
| 412 | Ga0500610_0001958 | 3300053079 | Bacteria | 7335 |
| 413 | Ga0500643_012026 | 3300053087 | Bacteria | 3119 |
| 414 | Ga0500643_015186 | 3300053087 | Bacteria | 2648 |
| 415 | Ga0500556_0000290 | 3300053104 | Bacteria | 39103 |
| 416 | Ga0500557_000475 | 3300053105 | Bacteria | 5336 |
| 417 | Ga0500594_0003391 | 3300053118 | Bacteria | 3493 |
| 418 | Ga0500595_011555 | 3300053119 | Bacteria | 3450 |
| 419 | Ga0500652_007639 | 3300053131 | Bacteria | 3553 |
| 420 | Ga0500568_0000353 | 3300053139 | Bacteria | 35729 |
| 421 | Ga0500568_0000963 | 3300053139 | Bacteria | 19793 |
| 422 | Ga0500616_0000577 | 3300053153 | Bacteria | 44621 |
| 423 | Ga0500616_0024660 | 3300053153 | Bacteria | 3340 |
| 424 | Ga0500616_0067490 | 3300053153 | Bacteria | 1834 |
| 425 | Ga0500616_0097589 | 3300053153 | Bacteria | 1442 |
| 426 | Ga0500620_002422 | 3300053155 | Bacteria | 3756 |
| 427 | Ga0500636_0034146 | 3300053177 | Bacteria | 3011 |
| 428 | Ga0500645_022807 | 3300053730 | Bacteria | 1921 |
| 429 | Ga0501084_0175458 | 3300054114 | Bacteria | 1809 |
| 430 | Ga0587080_020673 | 3300059503 | Bacteria | 1077 |
| 431 | Ga0587106_009420 | 3300059605 | Bacteria | 1241 |
| 432 | Ga0501082_0063528 | 3300060353 | Bacteria | 3179 |
| 433 | Ga0501082_0136418 | 3300060353 | Bacteria | 2129 |
| 434 | Ga0501082_0204825 | 3300060353 | Bacteria | 1716 |
| 435 | Ga0530510_0020554 | 3300061734 | Bacteria | 4694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0241825 | Ga0501070_0241825_574_1458 | 288 |
| 2 | iso_pu_bacteria | 2643221541 | 2643730053 | 289 |
| 3 | iso_pu_bacteria | 2643221606 | 2644045539 | 289 |
| 4 | iso_pu_bacteria | 2643221643 | 2644242488 | 289 |
| 5 | iso_pu_bacteria | 2643221671 | 2644392835 | 289 |
| 6 | iso_pu_bacteria | 8054563764 | 8054563843 | 289 |
| 7 | 3300006186 | Ga0075369_10091584 | Ga0075369_100915841 | 290 |
| 8 | 3300029957 | Ga0265324_10002198 | Ga0265324_100021988 | 290 |
| 9 | 3300031250 | Ga0265331_10000019 | Ga0265331_10000019212 | 290 |
| 10 | 3300041413 | Ga0439465_0001295 | Ga0439465_0001295_6835_7707 | 290 |
| 11 | 3300044712 | Ga0453684_0020194 | Ga0453684_0020194_8006_8887 | 290 |
| 12 | iso_pu_bacteria | 2643221636 | 2644204640 | 290 |
| 13 | iso_pu_bacteria | 2510461076 | 2510895535 | 291 |
| 14 | iso_pu_bacteria | 2510917020 | 2511122246 | 291 |
| 15 | iso_pu_bacteria | 2511231027 | 2511390104 | 291 |
| 16 | iso_pu_bacteria | 2582581280 | 2585153002 | 291 |
| 17 | iso_pu_bacteria | 2582581293 | 2585195039 | 291 |
| 18 | iso_pu_bacteria | 2582581299 | 2585228442 | 291 |
| 19 | iso_pu_bacteria | 2643221545 | 2643747166 | 291 |
| 20 | iso_pu_bacteria | 2643221551 | 2643776326 | 291 |
| 21 | iso_pu_bacteria | 2643221552 | 2643781202 | 291 |
| 22 | iso_pu_bacteria | 2643221555 | 2643794773 | 291 |
| 23 | iso_pu_bacteria | 2643221584 | 2643927214 | 291 |
| 24 | iso_pu_bacteria | 2643221598 | 2643998425 | 291 |
| 25 | iso_pu_bacteria | 2643221614 | 2644086708 | 291 |
| 26 | iso_pu_bacteria | 2643221634 | 2644193670 | 291 |
| 27 | iso_pu_bacteria | 2643221661 | 2644341662 | 291 |
| 28 | iso_pu_bacteria | 2643221666 | 2644367949 | 291 |
| 29 | iso_pu_bacteria | 2643221691 | 2644507638 | 291 |
| 30 | iso_pu_bacteria | 2751185800 | 2753359855 | 291 |
| 31 | iso_pu_bacteria | 2757320392 | 2757571648 | 291 |
| 32 | iso_pu_bacteria | 2758568016 | 2758642177 | 291 |
| 33 | iso_pu_bacteria | 2765235802 | 2765466565 | 291 |
| 34 | iso_pu_bacteria | 2767802442 | 2770196921 | 291 |
| 35 | iso_pu_bacteria | 2775506902 | 2776270470 | 291 |
| 36 | iso_pu_bacteria | 2775506904 | 2776281611 | 291 |
| 37 | iso_pu_bacteria | 2818991435 | 2819537562 | 291 |
| 38 | iso_pu_bacteria | 2818991454 | 2819646376 | 291 |
| 39 | iso_pu_bacteria | 2839993093 | 2839997457 | 291 |
| 40 | iso_pu_bacteria | 2840764183 | 2840768930 | 291 |
| 41 | iso_pu_bacteria | 2842871566 | 2842872094 | 291 |
| 42 | iso_pu_bacteria | 2854911287 | 2854912512 | 291 |
| 43 | iso_pu_bacteria | 2891373044 | 2891373506 | 291 |
| 44 | iso_pu_bacteria | 2894652903 | 2894655777 | 291 |
| 45 | iso_pu_bacteria | 2904578770 | 2904582038 | 291 |
| 46 | iso_pu_bacteria | 2915650412 | 2915653239 | 291 |
| 47 | iso_pu_bacteria | 2919119836 | 2919123184 | 291 |
| 48 | iso_pu_bacteria | 2928521798 | 2928524032 | 291 |
| 49 | iso_pu_bacteria | 2939669807 | 2939671825 | 291 |
| 50 | iso_pu_bacteria | 2954011201 | 2954012977 | 291 |
| 51 | iso_pu_bacteria | 2989349275 | 2989349978 | 291 |
| 52 | iso_pu_bacteria | 2989771324 | 2989775727 | 291 |
| 53 | iso_pu_bacteria | 3002141150 | 3002144920 | 291 |
| 54 | iso_pu_bacteria | 8054558443 | 8054561074 | 291 |
| 55 | 3300032120 | Ga0316053_103587 | Ga0316053_1035871 | 292 |
| 56 | 3300049579 | Ga0501043_0003156 | Ga0501043_0003156_11609_12493 | 292 |
| 57 | 3300049581 | Ga0501047_0002344 | Ga0501047_0002344_5729_6613 | 292 |
| 58 | 3300049586 | Ga0501070_0017646 | Ga0501070_0017646_3852_4736 | 292 |
| 59 | 3300049744 | Ga0501083_0011927 | Ga0501083_0011927_1068_1952 | 292 |
| 60 | 3300049823 | Ga0501044_0189219 | Ga0501044_0189219_1078_1962 | 292 |
| 61 | 3300060353 | Ga0501082_0063528 | Ga0501082_0063528_2161_3045 | 292 |
| 62 | iso_pu_bacteria | 2503198000 | 2503200336 | 292 |
| 63 | iso_pu_bacteria | 2508501123 | 2509115035 | 292 |
| 64 | iso_pu_bacteria | 2508501127 | 2509139563 | 292 |
| 65 | iso_pu_bacteria | 2509276018 | 2509373788 | 292 |
| 66 | iso_pu_bacteria | 2509276022 | 2509395142 | 292 |
| 67 | iso_pu_bacteria | 2510065059 | 2510314124 | 292 |
| 68 | iso_pu_bacteria | 2510917028 | 2511182554 | 292 |
| 69 | iso_pu_bacteria | 2512875016 | 2512932298 | 292 |
| 70 | iso_pu_bacteria | 2512875024 | 2512960305 | 292 |
| 71 | iso_pu_bacteria | 2513237090 | 2513614237 | 292 |
| 72 | iso_pu_bacteria | 2513237138 | 2513865843 | 292 |
| 73 | iso_pu_bacteria | 2513237144 | 2513908669 | 292 |
| 74 | iso_pu_bacteria | 2513237146 | 2513925255 | 292 |
| 75 | iso_pu_bacteria | 2513237159 | 2513997747 | 292 |
| 76 | iso_pu_bacteria | 2513237164 | 2514034613 | 292 |
| 77 | iso_pu_bacteria | 2513237305 | 2514419411 | 292 |
| 78 | iso_pu_bacteria | 2513237351 | 2514587748 | 292 |
| 79 | iso_pu_bacteria | 2524023209 | 2524458774 | 292 |
| 80 | iso_pu_bacteria | 2582581283 | 2585167379 | 292 |
| 81 | iso_pu_bacteria | 2582581306 | 2585265600 | 292 |
| 82 | iso_pu_bacteria | 2582581865 | 2585388805 | 292 |
| 83 | iso_pu_bacteria | 2582581866 | 2585395491 | 292 |
| 84 | iso_pu_bacteria | 2582581867 | 2585400876 | 292 |
| 85 | iso_pu_bacteria | 2585427590 | 2585822222 | 292 |
| 86 | iso_pu_bacteria | 2588253730 | 2588518362 | 292 |
| 87 | iso_pu_bacteria | 2597489875 | 2597812333 | 292 |
| 88 | iso_pu_bacteria | 2599185170 | 2599417165 | 292 |
| 89 | iso_pu_bacteria | 2599185301 | 2599936185 | 292 |
| 90 | iso_pu_bacteria | 2599185352 | 2600194770 | 292 |
| 91 | iso_pu_bacteria | 2643221550 | 2643770805 | 292 |
| 92 | iso_pu_bacteria | 2643221557 | 2643804270 | 292 |
| 93 | iso_pu_bacteria | 2643221564 | 2643839233 | 292 |
| 94 | iso_pu_bacteria | 2643221607 | 2644050298 | 292 |
| 95 | iso_pu_bacteria | 2643221610 | 2644064956 | 292 |
| 96 | iso_pu_bacteria | 2643221618 | 2644106982 | 292 |
| 97 | iso_pu_bacteria | 2643221623 | 2644129670 | 292 |
| 98 | iso_pu_bacteria | 2643221626 | 2644148726 | 292 |
| 99 | iso_pu_bacteria | 2643221627 | 2644158281 | 292 |
| 100 | iso_pu_bacteria | 2643221637 | 2644208853 | 292 |
| 101 | iso_pu_bacteria | 2643221655 | 2644309942 | 292 |
| 102 | iso_pu_bacteria | 2643221659 | 2644331088 | 292 |
| 103 | iso_pu_bacteria | 2643221668 | 2644376635 | 292 |
| 104 | iso_pu_bacteria | 2643221675 | 2644416629 | 292 |
| 105 | iso_pu_bacteria | 2643221680 | 2644449669 | 292 |
| 106 | iso_pu_bacteria | 2643221686 | 2644483218 | 292 |
| 107 | iso_pu_bacteria | 2643221688 | 2644494365 | 292 |
| 108 | iso_pu_bacteria | 2643221689 | 2644499776 | 292 |
| 109 | iso_pu_bacteria | 2643221698 | 2644543818 | 292 |
| 110 | iso_pu_bacteria | 2643221712 | 2644616397 | 292 |
| 111 | iso_pu_bacteria | 2643221718 | 2644652383 | 292 |
| 112 | iso_pu_bacteria | 2643221723 | 2644675898 | 292 |
| 113 | iso_pu_bacteria | 2643221726 | 2644689801 | 292 |
| 114 | iso_pu_bacteria | 2643221736 | 2644745202 | 292 |
| 115 | iso_pu_bacteria | 2687453392 | 2688597506 | 292 |
| 116 | iso_pu_bacteria | 2693429783 | 2694631257 | 292 |
| 117 | iso_pu_bacteria | 2693429784 | 2694638739 | 292 |
| 118 | iso_pu_bacteria | 2721755686 | 2723574738 | 292 |
| 119 | iso_pu_bacteria | 2738543024 | 2739310111 | 292 |
| 120 | iso_pu_bacteria | 2756170246 | 2756671800 | 292 |
| 121 | iso_pu_bacteria | 2791355123 | 2792752000 | 292 |
| 122 | iso_pu_bacteria | 2837678835 | 2837680529 | 292 |
| 123 | iso_pu_bacteria | 2838035591 | 2838038631 | 292 |
| 124 | iso_pu_bacteria | 2838074704 | 2838076711 | 292 |
| 125 | iso_pu_bacteria | 2838661181 | 2838661449 | 292 |
| 126 | iso_pu_bacteria | 2841734538 | 2841738341 | 292 |
| 127 | iso_pu_bacteria | 2841911363 | 2841915798 | 292 |
| 128 | iso_pu_bacteria | 2841917233 | 2841921821 | 292 |
| 129 | iso_pu_bacteria | 2842298080 | 2842298122 | 292 |
| 130 | iso_pu_bacteria | 2842357229 | 2842360278 | 292 |
| 131 | iso_pu_bacteria | 2842509118 | 2842510958 | 292 |
| 132 | iso_pu_bacteria | 2842521101 | 2842522005 | 292 |
| 133 | iso_pu_bacteria | 2844002411 | 2844008266 | 292 |
| 134 | iso_pu_bacteria | 2844009547 | 2844012885 | 292 |
| 135 | iso_pu_bacteria | 2844163670 | 2844164096 | 292 |
| 136 | iso_pu_bacteria | 2847670302 | 2847675235 | 292 |
| 137 | iso_pu_bacteria | 2847686936 | 2847691417 | 292 |
| 138 | iso_pu_bacteria | 2852387548 | 2852390398 | 292 |
| 139 | iso_pu_bacteria | 2856314179 | 2856314957 | 292 |
| 140 | iso_pu_bacteria | 2856320880 | 2856323411 | 292 |
| 141 | iso_pu_bacteria | 2856328259 | 2856329282 | 292 |
| 142 | iso_pu_bacteria | 2856334872 | 2856336391 | 292 |
| 143 | iso_pu_bacteria | 2856342000 | 2856342081 | 292 |
| 144 | iso_pu_bacteria | 2856364286 | 2856368296 | 292 |
| 145 | iso_pu_bacteria | 2857349434 | 2857351513 | 292 |
| 146 | iso_pu_bacteria | 2857367948 | 2857375484 | 292 |
| 147 | iso_pu_bacteria | 2869162929 | 2869163973 | 292 |
| 148 | iso_pu_bacteria | 2869169390 | 2869174044 | 292 |
| 149 | iso_pu_bacteria | 2869234852 | 2869241297 | 292 |
| 150 | iso_pu_bacteria | 2869249662 | 2869255180 | 292 |
| 151 | iso_pu_bacteria | 2869256925 | 2869261878 | 292 |
| 152 | iso_pu_bacteria | 2869264136 | 2869266493 | 292 |
| 153 | iso_pu_bacteria | 2869271264 | 2869275395 | 292 |
| 154 | iso_pu_bacteria | 2869278585 | 2869282890 | 292 |
| 155 | iso_pu_bacteria | 2869285874 | 2869290085 | 292 |
| 156 | iso_pu_bacteria | 2871429161 | 2871432369 | 292 |
| 157 | iso_pu_bacteria | 2871435913 | 2871436727 | 292 |
| 158 | iso_pu_bacteria | 2871444079 | 2871450983 | 292 |
| 159 | iso_pu_bacteria | 2871451962 | 2871456655 | 292 |
| 160 | iso_pu_bacteria | 2871459585 | 2871462033 | 292 |
| 161 | iso_pu_bacteria | 2871466892 | 2871472872 | 292 |
| 162 | iso_pu_bacteria | 2871474448 | 2871474891 | 292 |
| 163 | iso_pu_bacteria | 2871481445 | 2871481509 | 292 |
| 164 | iso_pu_bacteria | 2871488783 | 2871492991 | 292 |
| 165 | iso_pu_bacteria | 2871495908 | 2871502552 | 292 |
| 166 | iso_pu_bacteria | 2874102143 | 2874105624 | 292 |
| 167 | iso_pu_bacteria | 2874109183 | 2874110766 | 292 |
| 168 | iso_pu_bacteria | 2874116593 | 2874117021 | 292 |
| 169 | iso_pu_bacteria | 2874123672 | 2874127031 | 292 |
| 170 | iso_pu_bacteria | 2874131515 | 2874133965 | 292 |
| 171 | iso_pu_bacteria | 2874139085 | 2874142551 | 292 |
| 172 | iso_pu_bacteria | 2874146452 | 2874152333 | 292 |
| 173 | iso_pu_bacteria | 2874155637 | 2874159736 | 292 |
| 174 | iso_pu_bacteria | 2874162495 | 2874162852 | 292 |
| 175 | iso_pu_bacteria | 2874168670 | 2874168945 | 292 |
| 176 | iso_pu_bacteria | 2876363079 | 2876367669 | 292 |
| 177 | iso_pu_bacteria | 2876369609 | 2876374921 | 292 |
| 178 | iso_pu_bacteria | 2876377896 | 2876378656 | 292 |
| 179 | iso_pu_bacteria | 2876386047 | 2876389097 | 292 |
| 180 | iso_pu_bacteria | 2876392853 | 2876393970 | 292 |
| 181 | iso_pu_bacteria | 2876399893 | 2876404159 | 292 |
| 182 | iso_pu_bacteria | 2876406927 | 2876409067 | 292 |
| 183 | iso_pu_bacteria | 2876413966 | 2876418252 | 292 |
| 184 | iso_pu_bacteria | 2876420981 | 2876424244 | 292 |
| 185 | iso_pu_bacteria | 2878035449 | 2878042200 | 292 |
| 186 | iso_pu_bacteria | 2878738818 | 2878739207 | 292 |
| 187 | iso_pu_bacteria | 2878745973 | 2878749982 | 292 |
| 188 | iso_pu_bacteria | 2878753008 | 2878757037 | 292 |
| 189 | iso_pu_bacteria | 2878760144 | 2878766444 | 292 |
| 190 | iso_pu_bacteria | 2878767105 | 2878773640 | 292 |
| 191 | iso_pu_bacteria | 2878774303 | 2878779257 | 292 |
| 192 | iso_pu_bacteria | 2878781027 | 2878783695 | 292 |
| 193 | iso_pu_bacteria | 2878788777 | 2878795545 | 292 |
| 194 | iso_pu_bacteria | 2881147464 | 2881150813 | 292 |
| 195 | iso_pu_bacteria | 2881155292 | 2881161346 | 292 |
| 196 | iso_pu_bacteria | 2881161766 | 2881167086 | 292 |
| 197 | iso_pu_bacteria | 2881845957 | 2881849981 | 292 |
| 198 | iso_pu_bacteria | 2881853255 | 2881853858 | 292 |
| 199 | iso_pu_bacteria | 2881861095 | 2881866633 | 292 |
| 200 | iso_pu_bacteria | 2882632389 | 2882640703 | 292 |
| 201 | iso_pu_bacteria | 2882912400 | 2882919576 | 292 |
| 202 | iso_pu_bacteria | 2885305155 | 2885308595 | 292 |
| 203 | iso_pu_bacteria | 2885312484 | 2885312640 | 292 |
| 204 | iso_pu_bacteria | 2885318864 | 2885321460 | 292 |
| 205 | iso_pu_bacteria | 2885334103 | 2885335784 | 292 |
| 206 | iso_pu_bacteria | 2885342637 | 2885349060 | 292 |
| 207 | iso_pu_bacteria | 2885350715 | 2885351614 | 292 |
| 208 | iso_pu_bacteria | 2888337043 | 2888338572 | 292 |
| 209 | iso_pu_bacteria | 2888343758 | 2888346077 | 292 |
| 210 | iso_pu_bacteria | 2888350351 | 2888355395 | 292 |
| 211 | iso_pu_bacteria | 2889010040 | 2889010374 | 292 |
| 212 | iso_pu_bacteria | 2889016732 | 2889017961 | 292 |
| 213 | iso_pu_bacteria | 2889790730 | 2889796024 | 292 |
| 214 | iso_pu_bacteria | 2889914905 | 2889919826 | 292 |
| 215 | iso_pu_bacteria | 2894817345 | 2894820464 | 292 |
| 216 | iso_pu_bacteria | 2896384573 | 2896392152 | 292 |
| 217 | iso_pu_bacteria | 2903448605 | 2903450447 | 292 |
| 218 | iso_pu_bacteria | 2903492973 | 2903500763 | 292 |
| 219 | iso_pu_bacteria | 2903492973 | 2903503287 | 292 |
| 220 | iso_pu_bacteria | 2903513507 | 2903515401 | 292 |
| 221 | iso_pu_bacteria | 2903521522 | 2903521814 | 292 |
| 222 | iso_pu_bacteria | 2903528002 | 2903528191 | 292 |
| 223 | iso_pu_bacteria | 2903540706 | 2903547593 | 292 |
| 224 | iso_pu_bacteria | 2904659560 | 2904660301 | 292 |
| 225 | iso_pu_bacteria | 2906308376 | 2906312341 | 292 |
| 226 | iso_pu_bacteria | 2906321335 | 2906325050 | 292 |
| 227 | iso_pu_bacteria | 2906328253 | 2906330401 | 292 |
| 228 | iso_pu_bacteria | 2906354277 | 2906356570 | 292 |
| 229 | iso_pu_bacteria | 2906363423 | 2906365953 | 292 |
| 230 | iso_pu_bacteria | 2906370794 | 2906376402 | 292 |
| 231 | iso_pu_bacteria | 2906378014 | 2906378929 | 292 |
| 232 | iso_pu_bacteria | 2906386501 | 2906392062 | 292 |
| 233 | iso_pu_bacteria | 2906393657 | 2906398037 | 292 |
| 234 | iso_pu_bacteria | 2906401398 | 2906405944 | 292 |
| 235 | iso_pu_bacteria | 2906408224 | 2906411934 | 292 |
| 236 | iso_pu_bacteria | 2906414383 | 2906419601 | 292 |
| 237 | iso_pu_bacteria | 2909042592 | 2909043156 | 292 |
| 238 | iso_pu_bacteria | 2917554339 | 2917556695 | 292 |
| 239 | iso_pu_bacteria | 2919450847 | 2919451946 | 292 |
| 240 | iso_pu_bacteria | 2920760137 | 2920761371 | 292 |
| 241 | iso_pu_bacteria | 2920822456 | 2920825414 | 292 |
| 242 | iso_pu_bacteria | 2922130491 | 2922133852 | 292 |
| 243 | iso_pu_bacteria | 2922151315 | 2922155617 | 292 |
| 244 | iso_pu_bacteria | 2922158528 | 2922164924 | 292 |
| 245 | iso_pu_bacteria | 2922172374 | 2922173630 | 292 |
| 246 | iso_pu_bacteria | 2922178524 | 2922180775 | 292 |
| 247 | iso_pu_bacteria | 2922185730 | 2922187206 | 292 |
| 248 | iso_pu_bacteria | 2923556063 | 2923559251 | 292 |
| 249 | iso_pu_bacteria | 2924710171 | 2924718510 | 292 |
| 250 | iso_pu_bacteria | 2924718760 | 2924720480 | 292 |
| 251 | iso_pu_bacteria | 2924726620 | 2924732240 | 292 |
| 252 | iso_pu_bacteria | 2924733363 | 2924740608 | 292 |
| 253 | iso_pu_bacteria | 2924741084 | 2924744951 | 292 |
| 254 | iso_pu_bacteria | 2924748358 | 2924753355 | 292 |
| 255 | iso_pu_bacteria | 2924754689 | 2924755895 | 292 |
| 256 | iso_pu_bacteria | 2924762789 | 2924763735 | 292 |
| 257 | iso_pu_bacteria | 2924776078 | 2924776672 | 292 |
| 258 | iso_pu_bacteria | 2924784321 | 2924786340 | 292 |
| 259 | iso_pu_bacteria | 2933016740 | 2933023238 | 292 |
| 260 | iso_pu_bacteria | 2937813078 | 2937819517 | 292 |
| 261 | iso_pu_bacteria | 2937822353 | 2937829011 | 292 |
| 262 | iso_pu_bacteria | 2937836603 | 2937839603 | 292 |
| 263 | iso_pu_bacteria | 2937843397 | 2937844354 | 292 |
| 264 | iso_pu_bacteria | 2937848649 | 2937850945 | 292 |
| 265 | iso_pu_bacteria | 2937861824 | 2937863499 | 292 |
| 266 | iso_pu_bacteria | 2937868953 | 2937873427 | 292 |
| 267 | iso_pu_bacteria | 2937877337 | 2937880832 | 292 |
| 268 | iso_pu_bacteria | 2937891427 | 2937897460 | 292 |
| 269 | iso_pu_bacteria | 2937972304 | 2937977024 | 292 |
| 270 | iso_pu_bacteria | 2937980651 | 2937984996 | 292 |
| 271 | iso_pu_bacteria | 2937994558 | 2938001468 | 292 |
| 272 | iso_pu_bacteria | 2938014810 | 2938015512 | 292 |
| 273 | iso_pu_bacteria | 2941499720 | 2941504806 | 292 |
| 274 | iso_pu_bacteria | 2958034702 | 2958039673 | 292 |
| 275 | iso_pu_bacteria | 2958041894 | 2958052698 | 292 |
| 276 | iso_pu_bacteria | 2958064165 | 2958069382 | 292 |
| 277 | iso_pu_bacteria | 2958071322 | 2958073974 | 292 |
| 278 | iso_pu_bacteria | 2958084443 | 2958088612 | 292 |
| 279 | iso_pu_bacteria | 2958092219 | 2958097978 | 292 |
| 280 | iso_pu_bacteria | 2958100919 | 2958107917 | 292 |
| 281 | iso_pu_bacteria | 2958108152 | 2958109774 | 292 |
| 282 | iso_pu_bacteria | 2958115193 | 2958116434 | 292 |
| 283 | iso_pu_bacteria | 2958122699 | 2958125694 | 292 |
| 284 | iso_pu_bacteria | 2958130278 | 2958134472 | 292 |
| 285 | iso_pu_bacteria | 2958137437 | 2958139159 | 292 |
| 286 | iso_pu_bacteria | 2958158011 | 2958159341 | 292 |
| 287 | iso_pu_bacteria | 2958165035 | 2958171622 | 292 |
| 288 | iso_pu_bacteria | 2958172287 | 2958178081 | 292 |
| 289 | iso_pu_bacteria | 2958179912 | 2958180953 | 292 |
| 290 | iso_pu_bacteria | 2961077736 | 2961078790 | 292 |
| 291 | iso_pu_bacteria | 2961114664 | 2961115625 | 292 |
| 292 | iso_pu_bacteria | 2961127735 | 2961131373 | 292 |
| 293 | iso_pu_bacteria | 2961136820 | 2961137959 | 292 |
| 294 | iso_pu_bacteria | 2961163497 | 2961170063 | 292 |
| 295 | iso_pu_bacteria | 2961170736 | 2961175635 | 292 |
| 296 | iso_pu_bacteria | 2961183825 | 2961186912 | 292 |
| 297 | iso_pu_bacteria | 2963644680 | 2963646906 | 292 |
| 298 | iso_pu_bacteria | 2965018300 | 2965024814 | 292 |
| 299 | iso_pu_bacteria | 2965025482 | 2965029747 | 292 |
| 300 | iso_pu_bacteria | 2965032056 | 2965032299 | 292 |
| 301 | iso_pu_bacteria | 2965040258 | 2965045928 | 292 |
| 302 | iso_pu_bacteria | 2965047637 | 2965055373 | 292 |
| 303 | iso_pu_bacteria | 2965062239 | 2965065224 | 292 |
| 304 | iso_pu_bacteria | 2965089291 | 2965093326 | 292 |
| 305 | iso_pu_bacteria | 2965102966 | 2965107040 | 292 |
| 306 | iso_pu_bacteria | 2965119406 | 2965119546 | 292 |
| 307 | iso_pu_bacteria | 2967996073 | 2967999308 | 292 |
| 308 | iso_pu_bacteria | 2968003550 | 2968007721 | 292 |
| 309 | iso_pu_bacteria | 2968016561 | 2968021003 | 292 |
| 310 | iso_pu_bacteria | 2968083720 | 2968088293 | 292 |
| 311 | iso_pu_bacteria | 2968091066 | 2968095054 | 292 |
| 312 | iso_pu_bacteria | 2968097103 | 2968101481 | 292 |
| 313 | iso_pu_bacteria | 2968110612 | 2968111358 | 292 |
| 314 | iso_pu_bacteria | 2968117919 | 2968119625 | 292 |
| 315 | iso_pu_bacteria | 2968128360 | 2968130612 | 292 |
| 316 | iso_pu_bacteria | 2968138860 | 2968144723 | 292 |
| 317 | iso_pu_bacteria | 2968171901 | 2968178455 | 292 |
| 318 | iso_pu_bacteria | 2970469710 | 2970474300 | 292 |
| 319 | iso_pu_bacteria | 2970489779 | 2970494463 | 292 |
| 320 | iso_pu_bacteria | 2970503327 | 2970508223 | 292 |
| 321 | iso_pu_bacteria | 2970510686 | 2970511454 | 292 |
| 322 | iso_pu_bacteria | 2970524798 | 2970527594 | 292 |
| 323 | iso_pu_bacteria | 2970532167 | 2970534907 | 292 |
| 324 | iso_pu_bacteria | 2970540015 | 2970544208 | 292 |
| 325 | iso_pu_bacteria | 2970547951 | 2970554175 | 292 |
| 326 | iso_pu_bacteria | 2970554993 | 2970561300 | 292 |
| 327 | iso_pu_bacteria | 2970593180 | 2970597499 | 292 |
| 328 | iso_pu_bacteria | 2970619444 | 2970624419 | 292 |
| 329 | iso_pu_bacteria | 2970627176 | 2970628594 | 292 |
| 330 | iso_pu_bacteria | 2977821940 | 2977826196 | 292 |
| 331 | iso_pu_bacteria | 2977828996 | 2977834981 | 292 |
| 332 | iso_pu_bacteria | 2977843712 | 2977848129 | 292 |
| 333 | iso_pu_bacteria | 2977851361 | 2977853695 | 292 |
| 334 | iso_pu_bacteria | 2977858184 | 2977864638 | 292 |
| 335 | iso_pu_bacteria | 2977864932 | 2977869077 | 292 |
| 336 | iso_pu_bacteria | 2977872689 | 2977878067 | 292 |
| 337 | iso_pu_bacteria | 2977898635 | 2977899273 | 292 |
| 338 | iso_pu_bacteria | 2977907340 | 2977909752 | 292 |
| 339 | iso_pu_bacteria | 2977915119 | 2977919952 | 292 |
| 340 | iso_pu_bacteria | 2977922695 | 2977923627 | 292 |
| 341 | iso_pu_bacteria | 2977935797 | 2977936537 | 292 |
| 342 | iso_pu_bacteria | 2977942078 | 2977944498 | 292 |
| 343 | iso_pu_bacteria | 2977950692 | 2977952787 | 292 |
| 344 | iso_pu_bacteria | 2977957713 | 2977959183 | 292 |
| 345 | iso_pu_bacteria | 2977971508 | 2977976518 | 292 |
| 346 | iso_pu_bacteria | 2977986579 | 2977990466 | 292 |
| 347 | iso_pu_bacteria | 2979710463 | 2979710594 | 292 |
| 348 | iso_pu_bacteria | 2979742915 | 2979745889 | 292 |
| 349 | iso_pu_bacteria | 2979764755 | 2979771303 | 292 |
| 350 | iso_pu_bacteria | 2979772303 | 2979774868 | 292 |
| 351 | iso_pu_bacteria | 2979793036 | 2979795835 | 292 |
| 352 | iso_pu_bacteria | 2979808191 | 2979813407 | 292 |
| 353 | iso_pu_bacteria | 2987636660 | 2987638697 | 292 |
| 354 | iso_pu_bacteria | 2987645492 | 2987646517 | 292 |
| 355 | iso_pu_bacteria | 2987652177 | 2987654268 | 292 |
| 356 | iso_pu_bacteria | 2987659509 | 2987666304 | 292 |
| 357 | iso_pu_bacteria | 2987666974 | 2987669908 | 292 |
| 358 | iso_pu_bacteria | 2987673487 | 2987676205 | 292 |
| 359 | iso_pu_bacteria | 2996310559 | 2996314390 | 292 |
| 360 | iso_pu_bacteria | 2996336353 | 2996339898 | 292 |
| 361 | iso_pu_bacteria | 2996341866 | 2996345002 | 292 |
| 362 | iso_pu_bacteria | 2996348954 | 2996352364 | 292 |
| 363 | iso_pu_bacteria | 2996386984 | 2996390295 | 292 |
| 364 | iso_pu_bacteria | 3000135777 | 3000139878 | 292 |
| 365 | iso_pu_bacteria | 3004167301 | 3004167937 | 292 |
| 366 | iso_pu_bacteria | 3004188549 | 3004195310 | 292 |
| 367 | iso_pu_bacteria | 3004195979 | 3004203624 | 292 |
| 368 | iso_pu_bacteria | 3004203850 | 3004205060 | 292 |
| 369 | iso_pu_bacteria | 3004211236 | 3004215314 | 292 |
| 370 | iso_pu_bacteria | 3004218560 | 3004225843 | 292 |
| 371 | iso_pu_bacteria | 3004232784 | 3004236683 | 292 |
| 372 | iso_pu_bacteria | 3004248173 | 3004255535 | 292 |
| 373 | iso_pu_bacteria | 3004268573 | 3004275558 | 292 |
| 374 | iso_pu_bacteria | 3004275668 | 3004279046 | 292 |
| 375 | iso_pu_bacteria | 3004334049 | 3004335424 | 292 |
| 376 | iso_pu_bacteria | 3005409236 | 3005414419 | 292 |
| 377 | iso_pu_bacteria | 637000159 | 637075398 | 292 |
| 378 | iso_pu_bacteria | 649633066 | 649872055 | 292 |
| 379 | iso_pu_bacteria | 8001845381 | 8001849964 | 292 |
| 380 | iso_pu_bacteria | 8002285264 | 8002289309 | 292 |
| 381 | iso_pu_bacteria | 8004300914 | 8004301125 | 292 |
| 382 | iso_pu_bacteria | 8004361976 | 8004367719 | 292 |
| 383 | iso_pu_bacteria | 8004374579 | 8004378612 | 292 |
| 384 | iso_pu_bacteria | 8004387939 | 8004392290 | 292 |
| 385 | iso_pu_bacteria | 8004395343 | 8004403178 | 292 |
| 386 | iso_pu_bacteria | 8004445564 | 8004449205 | 292 |
| 387 | iso_pu_bacteria | 8004633249 | 8004638698 | 292 |
| 388 | iso_pu_bacteria | 8004640170 | 8004641131 | 292 |
| 389 | iso_pu_bacteria | 8004703790 | 8004708875 | 292 |
| 390 | iso_pu_bacteria | 8004714634 | 8004718600 | 292 |
| 391 | iso_pu_bacteria | 8004727605 | 8004733551 | 292 |
| 392 | iso_pu_bacteria | 8005301065 | 8005303282 | 292 |
| 393 | iso_pu_bacteria | 8005688590 | 8005691946 | 292 |
| 394 | iso_pu_bacteria | 8024486573 | 8024488171 | 292 |
| 395 | iso_pu_bacteria | 8045864390 | 8045864513 | 292 |
| 396 | iso_pu_bacteria | 8046767195 | 8046771800 | 292 |
| 397 | iso_pu_bacteria | 8055617313 | 8055619806 | 292 |
| 398 | iso_pu_bacteria | 8057575449 | 8057575558 | 292 |
| 399 | 3300005327 | Ga0070658_10505614 | Ga0070658_105056141 | 293 |
| 400 | 3300021384 | Ga0213876_10003699 | Ga0213876_100036995 | 293 |
| 401 | 3300039437 | Ga0436365_0053390 | Ga0436365_0053390_2368_3261 | 293 |
| 402 | 3300049570 | Ga0501033_0077922 | Ga0501033_0077922_1441_2355 | 293 |
| 403 | 3300049573 | Ga0501037_0085127 | Ga0501037_0085127_217_1131 | 293 |
| 404 | 3300049581 | Ga0501047_0278230 | Ga0501047_0278230_180_1073 | 293 |
| 405 | 3300049822 | Ga0501035_0035511 | Ga0501035_0035511_3228_4142 | 293 |
| 406 | 3300049823 | Ga0501044_0035448 | Ga0501044_0035448_1066_1980 | 293 |
| 407 | 3300049823 | Ga0501044_0124050 | Ga0501044_0124050_580_1479 | 293 |
| 408 | 3300053177 | Ga0500636_0034146 | Ga0500636_0034146_1019_1903 | 293 |
| 409 | iso_pu_bacteria | 2958041894 | 2958042770 | 293 |
| 410 | 3300005344 | Ga0070661_100000441 | Ga0070661_10000044123 | 294 |
| 411 | 3300005614 | Ga0068856_100257097 | Ga0068856_1002570972 | 294 |
| 412 | 3300009093 | Ga0105240_10478269 | Ga0105240_104782692 | 294 |
| 413 | 3300021384 | Ga0213876_10000410 | Ga0213876_1000041014 | 294 |
| 414 | 3300025920 | Ga0207649_10000497 | Ga0207649_100004978 | 294 |
| 415 | 3300026067 | Ga0207678_10379667 | Ga0207678_103796672 | 294 |
| 416 | 3300028794 | Ga0307515_10016193 | Ga0307515_1001619315 | 294 |
| 417 | 3300031250 | Ga0265331_10000080 | Ga0265331_1000008091 | 294 |
| 418 | 3300031711 | Ga0265314_10040241 | Ga0265314_100402416 | 294 |
| 419 | 3300039437 | Ga0436365_1238706 | Ga0436365_1238706_5141_6031 | 294 |
| 420 | 3300045051 | Ga0451576_0005584 | Ga0451576_0005584_12281_13177 | 294 |
| 421 | 3300046472 | Ga0495580_0002971 | Ga0495580_0002971_7162_8055 | 294 |
| 422 | 3300046683 | Ga0495658_0003511 | Ga0495658_0003511_4362_5255 | 294 |
| 423 | 3300049581 | Ga0501047_0223423 | Ga0501047_0223423_661_1557 | 294 |
| 424 | 3300005347 | Ga0070668_100310689 | Ga0070668_1003106892 | 295 |
| 425 | 3300005367 | Ga0070667_100214422 | Ga0070667_1002144223 | 295 |
| 426 | 3300005455 | Ga0070663_100025697 | Ga0070663_1000256973 | 295 |
| 427 | 3300005548 | Ga0070665_100142655 | Ga0070665_1001426554 | 295 |
| 428 | 3300006038 | Ga0075365_10009125 | Ga0075365_100091254 | 295 |
| 429 | 3300006051 | Ga0075364_10004345 | Ga0075364_100043456 | 295 |
| 430 | 3300009093 | Ga0105240_10002462 | Ga0105240_1000246213 | 295 |
| 431 | 3300009148 | Ga0105243_10087363 | Ga0105243_100873631 | 295 |
| 432 | 3300009545 | Ga0105237_10003177 | Ga0105237_100031773 | 295 |
| 433 | 3300013308 | Ga0157375_10564256 | Ga0157375_105642562 | 295 |
| 434 | 3300014325 | Ga0163163_10022780 | Ga0163163_100227805 | 295 |
| 435 | 3300015265 | Ga0182005_1006094 | Ga0182005_10060943 | 295 |
| 436 | 3300021377 | Ga0213874_10005742 | Ga0213874_100057422 | 295 |
| 437 | 3300025284 | Ga0209130_1005979 | Ga0209130_10059793 | 295 |
| 438 | 3300025294 | Ga0209025_1000171 | Ga0209025_1000171118 | 295 |
| 439 | 3300025907 | Ga0207645_10174448 | Ga0207645_101744482 | 295 |
| 440 | 3300025913 | Ga0207695_10001222 | Ga0207695_1000122231 | 295 |
| 441 | 3300025914 | Ga0207671_10002469 | Ga0207671_100024692 | 295 |
| 442 | 3300025972 | Ga0207668_10013045 | Ga0207668_100130454 | 295 |
| 443 | 3300026067 | Ga0207678_10046895 | Ga0207678_100468953 | 295 |
| 444 | 3300028794 | Ga0307515_10001903 | Ga0307515_1000190320 | 295 |
| 445 | 3300028800 | Ga0265338_10091621 | Ga0265338_100916211 | 295 |
| 446 | 3300031241 | Ga0265325_10006313 | Ga0265325_100063135 | 295 |
| 447 | 3300031249 | Ga0265339_10025804 | Ga0265339_100258044 | 295 |
| 448 | 3300031251 | Ga0265327_10000454 | Ga0265327_1000045444 | 295 |
| 449 | 3300031456 | Ga0307513_10183207 | Ga0307513_101832073 | 295 |
| 450 | 3300031711 | Ga0265314_10130882 | Ga0265314_101308822 | 295 |
| 451 | 3300031995 | Ga0307409_100542804 | Ga0307409_1005428041 | 295 |
| 452 | 3300035695 | Ga0373927_0005801 | Ga0373927_0005801_5627_6520 | 295 |
| 453 | 3300037068 | Ga0373925_0007826 | Ga0373925_0007826_223_1116 | 295 |
| 454 | 3300037471 | Ga0395905_0000571 | Ga0395905_0000571_42116_43009 | 295 |
| 455 | 3300037471 | Ga0395905_0007862 | Ga0395905_0007862_5299_6192 | 295 |
| 456 | 3300037471 | Ga0395905_0033095 | Ga0395905_0033095_2021_2914 | 295 |
| 457 | 3300037853 | Ga0436364_0194000 | Ga0436364_0194000_724_1611 | 295 |
| 458 | 3300039447 | Ga0436361_0301911 | Ga0436361_0301911_250_1137 | 295 |
| 459 | 3300039450 | Ga0436363_0105350 | Ga0436363_0105350_467_1354 | 295 |
| 460 | 3300041413 | Ga0439465_0013380 | Ga0439465_0013380_1083_1973 | 295 |
| 461 | 3300041413 | Ga0439465_0042638 | Ga0439465_0042638_131_1021 | 295 |
| 462 | 3300045049 | Ga0466959_0017433 | Ga0466959_0017433_2750_3637 | 295 |
| 463 | 3300046460 | Ga0495638_0011460 | Ga0495638_0011460_1821_2711 | 295 |
| 464 | 3300046492 | Ga0495585_0146189 | Ga0495585_0146189_47_934 | 295 |
| 465 | 3300046506 | Ga0495583_0001761 | Ga0495583_0001761_11323_12210 | 295 |
| 466 | 3300046558 | Ga0495633_0031225 | Ga0495633_0031225_491_1378 | 295 |
| 467 | 3300046615 | Ga0495656_0110228 | Ga0495656_0110228_305_1192 | 295 |
| 468 | 3300046674 | Ga0495588_0085964 | Ga0495588_0085964_511_1398 | 295 |
| 469 | 3300047321 | Ga0495676_0056828 | Ga0495676_0056828_332_1219 | 295 |
| 470 | 3300048903 | Ga0496100_0057774 | Ga0496100_0057774_1298_2185 | 295 |
| 471 | 3300048904 | Ga0496101_0052347 | Ga0496101_0052347_1723_2610 | 295 |
| 472 | 3300048904 | Ga0496101_0253222 | Ga0496101_0253222_162_1049 | 295 |
| 473 | 3300048905 | Ga0496102_0101991 | Ga0496102_0101991_1026_1913 | 295 |
| 474 | 3300048907 | Ga0496104_0006266 | Ga0496104_0006266_5150_6037 | 295 |
| 475 | 3300048908 | Ga0496105_0005288 | Ga0496105_0005288_8419_9306 | 295 |
| 476 | 3300048910 | Ga0496107_0033482 | Ga0496107_0033482_976_1863 | 295 |
| 477 | 3300048911 | Ga0496108_0002415 | Ga0496108_0002415_1552_2439 | 295 |
| 478 | 3300048912 | Ga0496109_0005060 | Ga0496109_0005060_4568_5455 | 295 |
| 479 | 3300048913 | Ga0496110_0123495 | Ga0496110_0123495_934_1821 | 295 |
| 480 | 3300048914 | Ga0496111_0000899 | Ga0496111_0000899_10736_11623 | 295 |
| 481 | 3300048915 | Ga0496112_0004003 | Ga0496112_0004003_1597_2484 | 295 |
| 482 | 3300048916 | Ga0496113_0009963 | Ga0496113_0009963_3450_4337 | 295 |
| 483 | 3300048918 | Ga0496115_0060534 | Ga0496115_0060534_1927_2814 | 295 |
| 484 | 3300048918 | Ga0496115_0062146 | Ga0496115_0062146_1737_2624 | 295 |
| 485 | 3300048918 | Ga0496115_0288731 | Ga0496115_0288731_152_1039 | 295 |
| 486 | 3300048920 | Ga0496117_0001837 | Ga0496117_0001837_13787_14674 | 295 |
| 487 | 3300048922 | Ga0496119_0000597 | Ga0496119_0000597_18846_19733 | 295 |
| 488 | 3300048922 | Ga0496119_0009875 | Ga0496119_0009875_1125_2015 | 295 |
| 489 | 3300048925 | Ga0496122_0000464 | Ga0496122_0000464_15965_16852 | 295 |
| 490 | 3300048925 | Ga0496122_0001337 | Ga0496122_0001337_18131_19018 | 295 |
| 491 | 3300048926 | Ga0496123_0000147 | Ga0496123_0000147_7889_8776 | 295 |
| 492 | 3300048926 | Ga0496123_0001933 | Ga0496123_0001933_7940_8827 | 295 |
| 493 | 3300048927 | Ga0496124_0001975 | Ga0496124_0001975_19459_20346 | 295 |
| 494 | 3300048928 | Ga0496125_0003542 | Ga0496125_0003542_11251_12138 | 295 |
| 495 | 3300048928 | Ga0496125_0042303 | Ga0496125_0042303_780_1670 | 295 |
| 496 | 3300048929 | Ga0496126_0000601 | Ga0496126_0000601_7464_8351 | 295 |
| 497 | 3300049570 | Ga0501033_0085303 | Ga0501033_0085303_800_1690 | 295 |
| 498 | 3300049571 | Ga0501034_0046132 | Ga0501034_0046132_1815_2702 | 295 |
| 499 | 3300049571 | Ga0501034_0126770 | Ga0501034_0126770_831_1721 | 295 |
| 500 | 3300049571 | Ga0501034_0133499 | Ga0501034_0133499_1373_2269 | 295 |
| 501 | 3300049573 | Ga0501037_0134238 | Ga0501037_0134238_242_1129 | 295 |
| 502 | 3300049574 | Ga0501038_0071828 | Ga0501038_0071828_291_1178 | 295 |
| 503 | 3300049579 | Ga0501043_0162767 | Ga0501043_0162767_674_1564 | 295 |
| 504 | 3300049823 | Ga0501044_0000588 | Ga0501044_0000588_39942_40829 | 295 |
| 505 | 3300049823 | Ga0501044_0014696 | Ga0501044_0014696_4574_5464 | 295 |
| 506 | 3300049823 | Ga0501044_0174053 | Ga0501044_0174053_452_1348 | 295 |
| 507 | 3300053104 | Ga0500556_0000290 | Ga0500556_0000290_1911_2798 | 295 |
| 508 | 3300053119 | Ga0500595_011555 | Ga0500595_011555_2121_3008 | 295 |
| 509 | 3300053131 | Ga0500652_007639 | Ga0500652_007639_1451_2338 | 295 |
| 510 | 3300053153 | Ga0500616_0067490 | Ga0500616_0067490_726_1616 | 295 |
| 511 | 3300053730 | Ga0500645_022807 | Ga0500645_022807_437_1324 | 295 |
| 512 | 3300002739 | JGI25158J39367_1002269 | JGI25158J39367_10022692 | 296 |
| 513 | 3300002741 | JGI25157J39369_1000755 | JGI25157J39369_10007552 | 296 |
| 514 | 3300002987 | JGI25159J45721_1000004 | JGI25159J45721_1000004144 | 296 |
| 515 | 3300002987 | JGI25159J45721_1000877 | JGI25159J45721_10008778 | 296 |
| 516 | 3300003187 | JGI25151J46595_10031663 | JGI25151J46595_100316631 | 296 |
| 517 | 3300003203 | JGI25406J46586_10043244 | JGI25406J46586_100432441 | 296 |
| 518 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001476 | 296 |
| 519 | 3300003354 | JGI25160J50197_1000021 | JGI25160J50197_100002166 | 296 |
| 520 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001281 | 296 |
| 521 | 3300003374 | JGI25161J50226_1000218 | JGI25161J50226_100021815 | 296 |
| 522 | 3300003763 | Ga0055529_1007706 | Ga0055529_10077061 | 296 |
| 523 | 3300003771 | Ga0055526_1001649 | Ga0055526_10016492 | 296 |
| 524 | 3300003771 | Ga0055526_1008803 | Ga0055526_10088032 | 296 |
| 525 | 3300003775 | Ga0055524_1002001 | Ga0055524_100200111 | 296 |
| 526 | 3300003775 | Ga0055524_1012328 | Ga0055524_10123283 | 296 |
| 527 | 3300003781 | Ga0055536_1000269 | Ga0055536_100026913 | 296 |
| 528 | 3300003791 | Ga0055530_10007403 | Ga0055530_100074033 | 296 |
| 529 | 3300003792 | Ga0055540_1028635 | Ga0055540_10286351 | 296 |
| 530 | 3300003794 | Ga0055531_10045958 | Ga0055531_100459581 | 296 |
| 531 | 3300004625 | Ga0055543_1000003 | Ga0055543_1000003297 | 296 |
| 532 | 3300004625 | Ga0055543_1000164 | Ga0055543_10001648 | 296 |
| 533 | 3300004803 | Ga0058862_12092097 | Ga0058862_120920971 | 296 |
| 534 | 3300005262 | Ga0065165_1000033 | Ga0065165_100003366 | 296 |
| 535 | 3300005327 | Ga0070658_10003684 | Ga0070658_100036844 | 296 |
| 536 | 3300005327 | Ga0070658_10062316 | Ga0070658_100623162 | 296 |
| 537 | 3300005336 | Ga0070680_100114357 | Ga0070680_1001143573 | 296 |
| 538 | 3300005337 | Ga0070682_100133534 | Ga0070682_1001335342 | 296 |
| 539 | 3300005339 | Ga0070660_100045115 | Ga0070660_1000451152 | 296 |
| 540 | 3300005339 | Ga0070660_100082638 | Ga0070660_1000826381 | 296 |
| 541 | 3300005341 | Ga0070691_10003400 | Ga0070691_100034009 | 296 |
| 542 | 3300005356 | Ga0070674_100154839 | Ga0070674_1001548392 | 296 |
| 543 | 3300005366 | Ga0070659_100036819 | Ga0070659_1000368194 | 296 |
| 544 | 3300005458 | Ga0070681_10081574 | Ga0070681_100815742 | 296 |
| 545 | 3300005459 | Ga0068867_100089377 | Ga0068867_1000893772 | 296 |
| 546 | 3300005539 | Ga0068853_100013522 | Ga0068853_1000135222 | 296 |
| 547 | 3300005539 | Ga0068853_100253604 | Ga0068853_1002536042 | 296 |
| 548 | 3300005548 | Ga0070665_100259649 | Ga0070665_1002596492 | 296 |
| 549 | 3300005563 | Ga0068855_100013981 | Ga0068855_1000139815 | 296 |
| 550 | 3300005577 | Ga0068857_100082668 | Ga0068857_1000826684 | 296 |
| 551 | 3300005578 | Ga0068854_100178894 | Ga0068854_1001788942 | 296 |
| 552 | 3300005616 | Ga0068852_100026482 | Ga0068852_1000264828 | 296 |
| 553 | 3300005937 | Ga0081455_10238712 | Ga0081455_102387122 | 296 |
| 554 | 3300005983 | Ga0081540_1033222 | Ga0081540_10332223 | 296 |
| 555 | 3300005985 | Ga0081539_10000991 | Ga0081539_1000099110 | 296 |
| 556 | 3300006038 | Ga0075365_10005021 | Ga0075365_100050215 | 296 |
| 557 | 3300006038 | Ga0075365_10023064 | Ga0075365_100230644 | 296 |
| 558 | 3300006038 | Ga0075365_10027527 | Ga0075365_100275275 | 296 |
| 559 | 3300006038 | Ga0075365_10050322 | Ga0075365_100503224 | 296 |
| 560 | 3300006038 | Ga0075365_10065433 | Ga0075365_100654333 | 296 |
| 561 | 3300006042 | Ga0075368_10084191 | Ga0075368_100841911 | 296 |
| 562 | 3300006051 | Ga0075364_10025915 | Ga0075364_100259153 | 296 |
| 563 | 3300006051 | Ga0075364_10037873 | Ga0075364_100378733 | 296 |
| 564 | 3300006177 | Ga0075362_10028402 | Ga0075362_100284023 | 296 |
| 565 | 3300006178 | Ga0075367_10000307 | Ga0075367_100003078 | 296 |
| 566 | 3300006195 | Ga0075366_10162675 | Ga0075366_101626751 | 296 |
| 567 | 3300006353 | Ga0075370_10017438 | Ga0075370_100174386 | 296 |
| 568 | 3300006353 | Ga0075370_10135090 | Ga0075370_101350902 | 296 |
| 569 | 3300009093 | Ga0105240_10078667 | Ga0105240_100786672 | 296 |
| 570 | 3300009093 | Ga0105240_10207364 | Ga0105240_102073642 | 296 |
| 571 | 3300009093 | Ga0105240_10608489 | Ga0105240_106084891 | 296 |
| 572 | 3300009545 | Ga0105237_10306985 | Ga0105237_103069851 | 296 |
| 573 | 3300009551 | Ga0105238_10012189 | Ga0105238_100121895 | 296 |
| 574 | 3300009551 | Ga0105238_10094938 | Ga0105238_100949382 | 296 |
| 575 | 3300010375 | Ga0105239_10202768 | Ga0105239_102027682 | 296 |
| 576 | 3300010375 | Ga0105239_10501933 | Ga0105239_105019331 | 296 |
| 577 | 3300013100 | Ga0157373_10032787 | Ga0157373_100327874 | 296 |
| 578 | 3300013102 | Ga0157371_10119488 | Ga0157371_101194881 | 296 |
| 579 | 3300013104 | Ga0157370_10005189 | Ga0157370_100051897 | 296 |
| 580 | 3300013104 | Ga0157370_10135644 | Ga0157370_101356441 | 296 |
| 581 | 3300013105 | Ga0157369_10047367 | Ga0157369_100473671 | 296 |
| 582 | 3300013105 | Ga0157369_10576446 | Ga0157369_105764462 | 296 |
| 583 | 3300013249 | Ga0171463_1017 | Ga0171463_101723 | 296 |
| 584 | 3300013307 | Ga0157372_10039780 | Ga0157372_100397806 | 296 |
| 585 | 3300013307 | Ga0157372_10417303 | Ga0157372_104173031 | 296 |
| 586 | 3300014968 | Ga0157379_10003397 | Ga0157379_100033978 | 296 |
| 587 | 3300015261 | Ga0182006_1017059 | Ga0182006_10170591 | 296 |
| 588 | 3300015262 | Ga0182007_10036984 | Ga0182007_100369842 | 296 |
| 589 | 3300015690 | Ga0183363_1050 | Ga0183363_105014 | 296 |
| 590 | 3300017792 | Ga0163161_10327398 | Ga0163161_103273981 | 296 |
| 591 | 3300025208 | Ga0209436_100276 | Ga0209436_10027612 | 296 |
| 592 | 3300025208 | Ga0209436_105791 | Ga0209436_1057913 | 296 |
| 593 | 3300025245 | Ga0207425_1020966 | Ga0207425_10209662 | 296 |
| 594 | 3300025250 | Ga0209026_1000089 | Ga0209026_1000089107 | 296 |
| 595 | 3300025254 | Ga0209148_1000124 | Ga0209148_1000124145 | 296 |
| 596 | 3300025256 | Ga0209759_1000903 | Ga0209759_100090321 | 296 |
| 597 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010886 | 296 |
| 598 | 3300025272 | Ga0209455_1000062 | Ga0209455_1000062106 | 296 |
| 599 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003298 | 296 |
| 600 | 3300025284 | Ga0209130_1000017 | Ga0209130_1000017315 | 296 |
| 601 | 3300025292 | Ga0209676_1000876 | Ga0209676_100087628 | 296 |
| 602 | 3300025294 | Ga0209025_1000161 | Ga0209025_1000161141 | 296 |
| 603 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013763 | 296 |
| 604 | 3300025297 | Ga0209758_1023159 | Ga0209758_10231592 | 296 |
| 605 | 3300025298 | Ga0209050_1006499 | Ga0209050_10064992 | 296 |
| 606 | 3300025299 | Ga0209256_1000153 | Ga0209256_10001537 | 296 |
| 607 | 3300025299 | Ga0209256_1002058 | Ga0209256_10020585 | 296 |
| 608 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006314 | 296 |
| 609 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011477 | 296 |
| 610 | 3300025303 | Ga0209051_1003752 | Ga0209051_10037524 | 296 |
| 611 | 3300025904 | Ga0207647_10046819 | Ga0207647_100468193 | 296 |
| 612 | 3300025909 | Ga0207705_10000364 | Ga0207705_100003648 | 296 |
| 613 | 3300025909 | Ga0207705_10075867 | Ga0207705_100758673 | 296 |
| 614 | 3300025911 | Ga0207654_10121712 | Ga0207654_101217122 | 296 |
| 615 | 3300025912 | Ga0207707_10001430 | Ga0207707_100014309 | 296 |
| 616 | 3300025913 | Ga0207695_10119740 | Ga0207695_101197403 | 296 |
| 617 | 3300025913 | Ga0207695_10223077 | Ga0207695_102230772 | 296 |
| 618 | 3300025914 | Ga0207671_10020709 | Ga0207671_100207095 | 296 |
| 619 | 3300025917 | Ga0207660_10003724 | Ga0207660_100037249 | 296 |
| 620 | 3300025919 | Ga0207657_10000762 | Ga0207657_1000076219 | 296 |
| 621 | 3300025919 | Ga0207657_10052274 | Ga0207657_100522743 | 296 |
| 622 | 3300025921 | Ga0207652_10002976 | Ga0207652_100029764 | 296 |
| 623 | 3300025924 | Ga0207694_10010487 | Ga0207694_100104877 | 296 |
| 624 | 3300025932 | Ga0207690_10048947 | Ga0207690_100489474 | 296 |
| 625 | 3300025937 | Ga0207669_10040766 | Ga0207669_100407662 | 296 |
| 626 | 3300025937 | Ga0207669_10190603 | Ga0207669_101906031 | 296 |
| 627 | 3300025949 | Ga0207667_10187878 | Ga0207667_101878783 | 296 |
| 628 | 3300025949 | Ga0207667_10254975 | Ga0207667_102549753 | 296 |
| 629 | 3300025981 | Ga0207640_10209220 | Ga0207640_102092201 | 296 |
| 630 | 3300026041 | Ga0207639_10048569 | Ga0207639_100485694 | 296 |
| 631 | 3300026067 | Ga0207678_10409154 | Ga0207678_104091541 | 296 |
| 632 | 3300026116 | Ga0207674_10044684 | Ga0207674_100446846 | 296 |
| 633 | 3300026116 | Ga0207674_10240224 | Ga0207674_102402241 | 296 |
| 634 | 3300026121 | Ga0207683_10196277 | Ga0207683_101962772 | 296 |
| 635 | 3300027866 | Ga0209813_10050583 | Ga0209813_100505831 | 296 |
| 636 | 3300028379 | Ga0268266_10030466 | Ga0268266_100304666 | 296 |
| 637 | 3300028794 | Ga0307515_10000017 | Ga0307515_1000001720 | 296 |
| 638 | 3300031239 | Ga0265328_10006035 | Ga0265328_100060353 | 296 |
| 639 | 3300031251 | Ga0265327_10027230 | Ga0265327_100272302 | 296 |
| 640 | 3300031344 | Ga0265316_10014590 | Ga0265316_100145907 | 296 |
| 641 | 3300031456 | Ga0307513_10002030 | Ga0307513_1000203020 | 296 |
| 642 | 3300031548 | Ga0307408_100123653 | Ga0307408_1001236532 | 296 |
| 643 | 3300037418 | Ga0395900_0000318 | Ga0395900_0000318_51974_52900 | 296 |
| 644 | 3300037418 | Ga0395900_0177761 | Ga0395900_0177761_1137_2030 | 296 |
| 645 | 3300037418 | Ga0395900_0586506 | Ga0395900_0586506_123_1016 | 296 |
| 646 | 3300037466 | Ga0395898_0000547 | Ga0395898_0000547_18423_19349 | 296 |
| 647 | 3300037466 | Ga0395898_0048465 | Ga0395898_0048465_2311_3204 | 296 |
| 648 | 3300037471 | Ga0395905_0000305 | Ga0395905_0000305_51974_52900 | 296 |
| 649 | 3300037471 | Ga0395905_0040245 | Ga0395905_0040245_1989_2882 | 296 |
| 650 | 3300037471 | Ga0395905_0046561 | Ga0395905_0046561_2363_3256 | 296 |
| 651 | 3300037471 | Ga0395905_0103674 | Ga0395905_0103674_785_1678 | 296 |
| 652 | 3300038443 | Ga0395901_0000093 | Ga0395901_0000093_18404_19330 | 296 |
| 653 | 3300038443 | Ga0395901_0027220 | Ga0395901_0027220_4053_4946 | 296 |
| 654 | 3300038443 | Ga0395901_0118786 | Ga0395901_0118786_1668_2561 | 296 |
| 655 | 3300038443 | Ga0395901_0140178 | Ga0395901_0140178_711_1604 | 296 |
| 656 | 3300038443 | Ga0395901_0175338 | Ga0395901_0175338_900_1793 | 296 |
| 657 | 3300038443 | Ga0395901_0393133 | Ga0395901_0393133_465_1358 | 296 |
| 658 | 3300038735 | Ga0400485_05700 | Ga0400485_05700_261_1160 | 296 |
| 659 | 3300041404 | Ga0439436_0000675 | Ga0439436_0000675_1316_2206 | 296 |
| 660 | 3300041405 | Ga0439438_019223 | Ga0439438_019223_348_1238 | 296 |
| 661 | 3300041405 | Ga0439438_025738 | Ga0439438_025738_259_1149 | 296 |
| 662 | 3300041407 | Ga0439447_009157 | Ga0439447_009157_319_1209 | 296 |
| 663 | 3300041411 | Ga0439466_0053595 | Ga0439466_0053595_351_1241 | 296 |
| 664 | 3300041413 | Ga0439465_0003165 | Ga0439465_0003165_4273_5190 | 296 |
| 665 | 3300041413 | Ga0439465_0020602 | Ga0439465_0020602_489_1382 | 296 |
| 666 | 3300042007 | Ga0439449_0020546 | Ga0439449_0020546_712_1629 | 296 |
| 667 | 3300042013 | Ga0439456_011381 | Ga0439456_011381_789_1697 | 296 |
| 668 | 3300042145 | Ga0450906_000779 | Ga0450906_000779_2701_3591 | 296 |
| 669 | 3300042435 | Ga0439434_0015284 | Ga0439434_0015284_275_1165 | 296 |
| 670 | 3300044901 | Ga0466960_0003996 | Ga0466960_0003996_3454_4347 | 296 |
| 671 | 3300046460 | Ga0495638_0000679 | Ga0495638_0000679_25326_26219 | 296 |
| 672 | 3300046460 | Ga0495638_0033393 | Ga0495638_0033393_303_1196 | 296 |
| 673 | 3300046474 | Ga0495605_0001576 | Ga0495605_0001576_5558_6451 | 296 |
| 674 | 3300046476 | Ga0495662_0005789 | Ga0495662_0005789_3530_4423 | 296 |
| 675 | 3300046492 | Ga0495585_0011315 | Ga0495585_0011315_3670_4563 | 296 |
| 676 | 3300046506 | Ga0495583_0055184 | Ga0495583_0055184_816_1709 | 296 |
| 677 | 3300046507 | Ga0495606_0001738 | Ga0495606_0001738_87_980 | 296 |
| 678 | 3300046507 | Ga0495606_0175510 | Ga0495606_0175510_47_940 | 296 |
| 679 | 3300046512 | Ga0495610_0108185 | Ga0495610_0108185_37_930 | 296 |
| 680 | 3300046512 | Ga0495610_0108302 | Ga0495610_0108302_214_1164 | 296 |
| 681 | 3300046513 | Ga0495616_0020450 | Ga0495616_0020450_1211_2104 | 296 |
| 682 | 3300046515 | Ga0495620_0067235 | Ga0495620_0067235_253_1203 | 296 |
| 683 | 3300046518 | Ga0495631_0000730 | Ga0495631_0000730_10555_11448 | 296 |
| 684 | 3300046519 | Ga0495632_0013426 | Ga0495632_0013426_2305_3198 | 296 |
| 685 | 3300046522 | Ga0495643_0010833 | Ga0495643_0010833_1700_2593 | 296 |
| 686 | 3300046522 | Ga0495643_0060060 | Ga0495643_0060060_422_1315 | 296 |
| 687 | 3300046536 | Ga0495587_0084674 | Ga0495587_0084674_392_1285 | 296 |
| 688 | 3300046538 | Ga0495609_0011369 | Ga0495609_0011369_1201_2094 | 296 |
| 689 | 3300046542 | Ga0495597_0140982 | Ga0495597_0140982_49_942 | 296 |
| 690 | 3300046616 | Ga0495668_0008861 | Ga0495668_0008861_3212_4105 | 296 |
| 691 | 3300046648 | Ga0495611_0013690 | Ga0495611_0013690_854_1747 | 296 |
| 692 | 3300046660 | Ga0495625_0002939 | Ga0495625_0002939_10862_11755 | 296 |
| 693 | 3300046660 | Ga0495625_0087967 | Ga0495625_0087967_220_1113 | 296 |
| 694 | 3300046660 | Ga0495625_0240197 | Ga0495625_0240197_147_1067 | 296 |
| 695 | 3300046674 | Ga0495588_0004788 | Ga0495588_0004788_2606_3499 | 296 |
| 696 | 3300046674 | Ga0495588_0139954 | Ga0495588_0139954_343_1233 | 296 |
| 697 | 3300046675 | Ga0495657_0027610 | Ga0495657_0027610_2295_3188 | 296 |
| 698 | 3300046694 | Ga0495649_0143104 | Ga0495649_0143104_176_1066 | 296 |
| 699 | 3300046809 | Ga0495600_0039364 | Ga0495600_0039364_482_1375 | 296 |
| 700 | 3300047317 | Ga0495604_0009407 | Ga0495604_0009407_2378_3271 | 296 |
| 701 | 3300047320 | Ga0495672_0008168 | Ga0495672_0008168_5449_6342 | 296 |
| 702 | 3300047443 | Ga0495687_059507 | Ga0495687_059507_378_1271 | 296 |
| 703 | 3300047472 | Ga0495686_0002387 | Ga0495686_0002387_11411_12355 | 296 |
| 704 | 3300048091 | Ga0495626_0046945 | Ga0495626_0046945_130_1023 | 296 |
| 705 | 3300048904 | Ga0496101_0379156 | Ga0496101_0379156_196_1089 | 296 |
| 706 | 3300048917 | Ga0496114_0337304 | Ga0496114_0337304_140_1033 | 296 |
| 707 | 3300048918 | Ga0496115_0191444 | Ga0496115_0191444_724_1617 | 296 |
| 708 | 3300048922 | Ga0496119_0067815 | Ga0496119_0067815_347_1240 | 296 |
| 709 | 3300048922 | Ga0496119_0084268 | Ga0496119_0084268_319_1269 | 296 |
| 710 | 3300048923 | Ga0496120_0004279 | Ga0496120_0004279_5528_6421 | 296 |
| 711 | 3300048923 | Ga0496120_0046021 | Ga0496120_0046021_837_1730 | 296 |
| 712 | 3300048924 | Ga0496121_0014899 | Ga0496121_0014899_3272_4165 | 296 |
| 713 | 3300048924 | Ga0496121_0093552 | Ga0496121_0093552_861_1820 | 296 |
| 714 | 3300048924 | Ga0496121_0099702 | Ga0496121_0099702_378_1328 | 296 |
| 715 | 3300048928 | Ga0496125_0042682 | Ga0496125_0042682_2719_3609 | 296 |
| 716 | 3300048928 | Ga0496125_0057957 | Ga0496125_0057957_537_1430 | 296 |
| 717 | 3300048929 | Ga0496126_0000159 | Ga0496126_0000159_18449_19357 | 296 |
| 718 | 3300048929 | Ga0496126_0040671 | Ga0496126_0040671_1347_2240 | 296 |
| 719 | 3300048929 | Ga0496126_0372352 | Ga0496126_0372352_204_1097 | 296 |
| 720 | 3300049459 | Ga0495678_007759 | Ga0495678_007759_2379_3272 | 296 |
| 721 | 3300049568 | Ga0501031_0037769 | Ga0501031_0037769_2124_3116 | 296 |
| 722 | 3300049568 | Ga0501031_0040544 | Ga0501031_0040544_1260_2153 | 296 |
| 723 | 3300049568 | Ga0501031_0158152 | Ga0501031_0158152_13_906 | 296 |
| 724 | 3300049569 | Ga0501032_0000024 | Ga0501032_0000024_85962_86855 | 296 |
| 725 | 3300049569 | Ga0501032_0025428 | Ga0501032_0025428_2195_3199 | 296 |
| 726 | 3300049569 | Ga0501032_0059597 | Ga0501032_0059597_1449_2345 | 296 |
| 727 | 3300049570 | Ga0501033_0000391 | Ga0501033_0000391_39968_40861 | 296 |
| 728 | 3300049570 | Ga0501033_0000761 | Ga0501033_0000761_9941_10945 | 296 |
| 729 | 3300049570 | Ga0501033_0026641 | Ga0501033_0026641_3079_3969 | 296 |
| 730 | 3300049570 | Ga0501033_0170294 | Ga0501033_0170294_618_1511 | 296 |
| 731 | 3300049570 | Ga0501033_0293658 | Ga0501033_0293658_209_1114 | 296 |
| 732 | 3300049571 | Ga0501034_0000140 | Ga0501034_0000140_35820_36713 | 296 |
| 733 | 3300049571 | Ga0501034_0001662 | Ga0501034_0001662_9343_10236 | 296 |
| 734 | 3300049571 | Ga0501034_0012775 | Ga0501034_0012775_7211_8104 | 296 |
| 735 | 3300049571 | Ga0501034_0032089 | Ga0501034_0032089_1153_2043 | 296 |
| 736 | 3300049571 | Ga0501034_0110748 | Ga0501034_0110748_1809_2702 | 296 |
| 737 | 3300049571 | Ga0501034_0321635 | Ga0501034_0321635_80_973 | 296 |
| 738 | 3300049572 | Ga0501036_0000443 | Ga0501036_0000443_27412_28305 | 296 |
| 739 | 3300049573 | Ga0501037_0000024 | Ga0501037_0000024_117750_118643 | 296 |
| 740 | 3300049573 | Ga0501037_0000818 | Ga0501037_0000818_566_1570 | 296 |
| 741 | 3300049573 | Ga0501037_0107988 | Ga0501037_0107988_130_1038 | 296 |
| 742 | 3300049573 | Ga0501037_0192105 | Ga0501037_0192105_506_1402 | 296 |
| 743 | 3300049574 | Ga0501038_0000064 | Ga0501038_0000064_85871_86764 | 296 |
| 744 | 3300049574 | Ga0501038_0035848 | Ga0501038_0035848_2616_3509 | 296 |
| 745 | 3300049574 | Ga0501038_0114276 | Ga0501038_0114276_1262_2158 | 296 |
| 746 | 3300049574 | Ga0501038_0199300 | Ga0501038_0199300_254_1162 | 296 |
| 747 | 3300049575 | Ga0501039_0000017 | Ga0501039_0000017_85777_86670 | 296 |
| 748 | 3300049575 | Ga0501039_0102757 | Ga0501039_0102757_1210_2103 | 296 |
| 749 | 3300049579 | Ga0501043_0000050 | Ga0501043_0000050_85871_86764 | 296 |
| 750 | 3300049579 | Ga0501043_0000124 | Ga0501043_0000124_48255_49259 | 296 |
| 751 | 3300049579 | Ga0501043_0045975 | Ga0501043_0045975_1243_2136 | 296 |
| 752 | 3300049581 | Ga0501047_0130263 | Ga0501047_0130263_1476_2366 | 296 |
| 753 | 3300049584 | Ga0501068_0164490 | Ga0501068_0164490_74_988 | 296 |
| 754 | 3300049585 | Ga0501069_0000004 | Ga0501069_0000004_166359_167363 | 296 |
| 755 | 3300049585 | Ga0501069_0029583 | Ga0501069_0029583_1574_2488 | 296 |
| 756 | 3300049585 | Ga0501069_0041303 | Ga0501069_0041303_198_1094 | 296 |
| 757 | 3300049585 | Ga0501069_0191142 | Ga0501069_0191142_192_1085 | 296 |
| 758 | 3300049586 | Ga0501070_0000031 | Ga0501070_0000031_131843_132751 | 296 |
| 759 | 3300049586 | Ga0501070_0000148 | Ga0501070_0000148_54099_55103 | 296 |
| 760 | 3300049586 | Ga0501070_0000694 | Ga0501070_0000694_6992_7885 | 296 |
| 761 | 3300049586 | Ga0501070_0001919 | Ga0501070_0001919_13010_13906 | 296 |
| 762 | 3300049586 | Ga0501070_0052822 | Ga0501070_0052822_1256_2149 | 296 |
| 763 | 3300049589 | Ga0501073_0031453 | Ga0501073_0031453_2658_3662 | 296 |
| 764 | 3300049589 | Ga0501073_0112523 | Ga0501073_0112523_121_1014 | 296 |
| 765 | 3300049590 | Ga0501074_0000006 | Ga0501074_0000006_63886_64890 | 296 |
| 766 | 3300049590 | Ga0501074_0020074 | Ga0501074_0020074_57_950 | 296 |
| 767 | 3300049590 | Ga0501074_0098200 | Ga0501074_0098200_484_1398 | 296 |
| 768 | 3300049590 | Ga0501074_0230576 | Ga0501074_0230576_60_1100 | 296 |
| 769 | 3300049590 | Ga0501074_0243704 | Ga0501074_0243704_186_1082 | 296 |
| 770 | 3300049742 | Ga0501080_0000693 | Ga0501080_0000693_12871_13779 | 296 |
| 771 | 3300049742 | Ga0501080_0003339 | Ga0501080_0003339_5800_6693 | 296 |
| 772 | 3300049742 | Ga0501080_0005406 | Ga0501080_0005406_615_1619 | 296 |
| 773 | 3300049742 | Ga0501080_0132306 | Ga0501080_0132306_462_1376 | 296 |
| 774 | 3300049742 | Ga0501080_0148412 | Ga0501080_0148412_264_1160 | 296 |
| 775 | 3300049742 | Ga0501080_0388074 | Ga0501080_0388074_248_1144 | 296 |
| 776 | 3300049744 | Ga0501083_0000066 | Ga0501083_0000066_9755_10759 | 296 |
| 777 | 3300049770 | Ga0501273_014424 | Ga0501273_014424_49_939 | 296 |
| 778 | 3300049822 | Ga0501035_0000011 | Ga0501035_0000011_235756_236760 | 296 |
| 779 | 3300049822 | Ga0501035_0000021 | Ga0501035_0000021_122428_123321 | 296 |
| 780 | 3300049822 | Ga0501035_0000593 | Ga0501035_0000593_28670_29578 | 296 |
| 781 | 3300049822 | Ga0501035_0001755 | Ga0501035_0001755_17800_18696 | 296 |
| 782 | 3300049822 | Ga0501035_0003715 | Ga0501035_0003715_4385_5281 | 296 |
| 783 | 3300049822 | Ga0501035_0005312 | Ga0501035_0005312_5295_6188 | 296 |
| 784 | 3300049822 | Ga0501035_0006966 | Ga0501035_0006966_5706_6599 | 296 |
| 785 | 3300049822 | Ga0501035_0087852 | Ga0501035_0087852_328_1218 | 296 |
| 786 | 3300049822 | Ga0501035_0176204 | Ga0501035_0176204_47_940 | 296 |
| 787 | 3300049822 | Ga0501035_0258932 | Ga0501035_0258932_114_1022 | 296 |
| 788 | 3300049823 | Ga0501044_0000803 | Ga0501044_0000803_9772_10776 | 296 |
| 789 | 3300049823 | Ga0501044_0002607 | Ga0501044_0002607_8996_9886 | 296 |
| 790 | 3300049823 | Ga0501044_0006574 | Ga0501044_0006574_1182_2075 | 296 |
| 791 | 3300049823 | Ga0501044_0012369 | Ga0501044_0012369_1440_2333 | 296 |
| 792 | 3300049823 | Ga0501044_0051016 | Ga0501044_0051016_478_1374 | 296 |
| 793 | 3300049823 | Ga0501044_0064037 | Ga0501044_0064037_488_1396 | 296 |
| 794 | 3300049823 | Ga0501044_0083723 | Ga0501044_0083723_2281_3174 | 296 |
| 795 | 3300049823 | Ga0501044_0180460 | Ga0501044_0180460_1105_1998 | 296 |
| 796 | 3300049823 | Ga0501044_0184173 | Ga0501044_0184173_594_1553 | 296 |
| 797 | 3300049823 | Ga0501044_0217547 | Ga0501044_0217547_164_1057 | 296 |
| 798 | 3300049823 | Ga0501044_0297099 | Ga0501044_0297099_209_1099 | 296 |
| 799 | 3300049823 | Ga0501044_0365018 | Ga0501044_0365018_50_958 | 296 |
| 800 | 3300050489 | nmdc:mga03683_19775_c1 | nmdc:mga03683_19775_c1_486_1379 | 296 |
| 801 | 3300050491 | nmdc:mga00v17_10499_c1 | nmdc:mga00v17_10499_c1_2811_3704 | 296 |
| 802 | 3300050492 | nmdc:mga0yw44_16779_c1 | nmdc:mga0yw44_16779_c1_67_960 | 296 |
| 803 | 3300050496 | nmdc:mga07m45_12959_c1 | nmdc:mga07m45_12959_c1_2734_3627 | 296 |
| 804 | 3300050496 | nmdc:mga07m45_45525_c2 | nmdc:mga07m45_45525_c2_313_1206 | 296 |
| 805 | 3300053079 | Ga0500610_0001958 | Ga0500610_0001958_3660_4553 | 296 |
| 806 | 3300053087 | Ga0500643_012026 | Ga0500643_012026_1703_2788 | 296 |
| 807 | 3300053087 | Ga0500643_015186 | Ga0500643_015186_564_1457 | 296 |
| 808 | 3300053105 | Ga0500557_000475 | Ga0500557_000475_2832_3725 | 296 |
| 809 | 3300053118 | Ga0500594_0003391 | Ga0500594_0003391_454_1347 | 296 |
| 810 | 3300053139 | Ga0500568_0000353 | Ga0500568_0000353_33277_34170 | 296 |
| 811 | 3300053139 | Ga0500568_0000963 | Ga0500568_0000963_6718_7611 | 296 |
| 812 | 3300053153 | Ga0500616_0000577 | Ga0500616_0000577_32862_33755 | 296 |
| 813 | 3300053153 | Ga0500616_0024660 | Ga0500616_0024660_471_1367 | 296 |
| 814 | 3300053153 | Ga0500616_0097589 | Ga0500616_0097589_339_1235 | 296 |
| 815 | 3300053155 | Ga0500620_002422 | Ga0500620_002422_826_1719 | 296 |
| 816 | 3300054114 | Ga0501084_0175458 | Ga0501084_0175458_95_988 | 296 |
| 817 | 3300059503 | Ga0587080_020673 | Ga0587080_020673_174_1067 | 296 |
| 818 | 3300059605 | Ga0587106_009420 | Ga0587106_009420_180_1073 | 296 |
| 819 | 3300060353 | Ga0501082_0136418 | Ga0501082_0136418_565_1605 | 296 |
| 820 | 3300060353 | Ga0501082_0204825 | Ga0501082_0204825_82_1086 | 296 |
| 821 | 3300061734 | Ga0530510_0020554 | Ga0530510_0020554_211_1251 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wrv-assembly1.cif.gz_B | crystal structure of t.th.hb8 branched-chain amino acid aminotransferase | 0.9711 | 10 | 288 |
| 4whx-assembly1.cif.gz_E | x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate | 0.9685 | 5 | 288 |
| 3u0g-assembly4.cif.gz_E | crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei | 0.9618 | 5 | 288 |
| 6nst-assembly1.cif.gz_B | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9601 | 5 | 289 |
| 5e25-assembly2.cif.gz_B-2 | crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate | 0.9585 | 10 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u0gF02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9771 | 139 | 288 | 3.20.10.10 |
| 6h65B02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9587 | 138 | 287 | 3.20.10.10 |
| 6gkrB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9561 | 138 | 288 | 3.20.10.10 |
| 1a0gA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9551 | 11 | 126 | 3.30.470.10 |
| 5mr0A02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9537 | 138 | 287 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9DK24-F1-model_v4 | deleted | 0.9911 | 110 | 288 |
|
| AF-A0A7C9GEA6-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.989 | 1 | 295 |
GO:0004084
GO:0005829 GO:0009097 GO:0009098 GO:0009099 |
| AF-A0A6L6WVE5-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9852 | 1 | 291 |
GO:0004084
GO:0005829 GO:0009097 GO:0009098 GO:0009099 |
| AF-C4WFD8-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.985 | 1 | 296 |
GO:0008168
GO:0009097 GO:0009098 GO:0009099 GO:0032259 GO:0052655 GO:0052656 |
| AF-F7XVU9-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9828 | 5 | 288 |
GO:0009097
GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar