F482279

General Info

Members Datasets Scaffolds Average Seq Length
821 627 435 296

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_012026|Ga0500643_012026_1703_2788
Length 361
Sequence MVIFAKLFGGLRTKRQAGTVFPELPSICLQVPIRLGLAAQLRYLPGWYRQINNRVGAGPREVTPMTSVSFDKLDGFIWMNGEFVKWADAKIHVLTHGLHYASAVFEGERAYGGEIFKLTEHTERLHESARILGFKIPYSVEEIDDACRTLLKKQGFKDAYVRPIAWRGSEQMGVSAQNNRINCAVAIWQWPSYFDPAQKLKGIRLDIAEYRRPDPRTAPSKSKAAGLYMICTISKHAAEAKGYADALMYDWREQVAEATGANVFFVKDGKIHTPKPDCFLDGITRRTAIDLAKRRGIEVIERAIMPEELEGFEQCFLTGTAAEVTPVSEIGPYKFTVGKIAETLMNDYSAEVQPKHAIAAE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
11 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
12 2512875024 Mesorhizobium loti R88b Isolate Nodule
13 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
17 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
18 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
19 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
21 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
22 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
23 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
24 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
25 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
26 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
27 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
28 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
29 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
30 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
31 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
32 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
33 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
34 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
35 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
36 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
37 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
38 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
39 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
40 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
41 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
42 2643221557 Ensifer sp. Root558 Isolate Unclassified
43 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
44 2643221584 Caulobacter sp. Root656 Isolate Unclassified
45 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
46 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
47 2643221607 Rhizobium sp. Root73 Isolate Unclassified
48 2643221610 Ensifer sp. Root74 Isolate Unclassified
49 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
50 2643221618 Ensifer sp. Root231 Isolate Unclassified
51 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
52 2643221626 Ensifer sp. Root31 Isolate Unclassified
53 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
54 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
55 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
56 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
57 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
58 2643221655 Ensifer sp. Root1252 Isolate Unclassified
59 2643221659 Ensifer sp. Root127 Isolate Unclassified
60 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
61 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
62 2643221668 Ensifer sp. Root423 Isolate Unclassified
63 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
64 2643221675 Ensifer sp. Root1298 Isolate Unclassified
65 2643221680 Ensifer sp. Root1312 Isolate Unclassified
66 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
67 2643221688 Rhizobium sp. Root482 Isolate Unclassified
68 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
69 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
70 2643221698 Ensifer sp. Root142 Isolate Unclassified
71 2643221712 Ensifer sp. Root258 Isolate Unclassified
72 2643221718 Rhizobium sp. Root268 Isolate Unclassified
73 2643221723 Ensifer sp. Root278 Isolate Unclassified
74 2643221726 Ensifer sp. Root954 Isolate Unclassified
75 2643221736 Bosea sp. Root483D1 Isolate Unclassified
76 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
77 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
78 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
79 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
80 2738543024 Aminobacter sp. AP02 Isolate Unclassified
81 2751185800 Brucella pituitosa AA2 Isolate Unclassified
82 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
83 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
84 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
85 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
86 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
87 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
88 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
89 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
90 2818991435 Caulobacter henricii 536 Isolate Unclassified
91 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
92 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
93 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
94 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
95 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
96 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
97 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
98 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
99 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
100 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
101 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
102 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
103 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
104 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
105 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
106 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
107 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
108 2844163670 Ensifer sp. 1H6 Isolate Unclassified
109 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
110 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
111 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
112 2854911287 Brucella lupini LUP21 Isolate Unclassified
113 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
114 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
115 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
116 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
117 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
118 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
119 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
120 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
121 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
122 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
123 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
124 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
125 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
126 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
127 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
128 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
129 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
130 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
131 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
132 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
133 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
134 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
135 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
136 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
137 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
138 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
139 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
140 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
141 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
142 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
143 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
144 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
145 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
146 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
147 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
148 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
149 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
150 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
151 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
152 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
153 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
154 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
155 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
156 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
157 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
158 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
159 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
160 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
161 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
162 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
163 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
164 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
165 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
166 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
167 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
168 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
169 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
170 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
171 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
172 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
173 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
174 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
175 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
176 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
177 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
178 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
179 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
180 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
181 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
182 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
183 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
184 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
185 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
186 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
187 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
188 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
189 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
190 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
191 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
192 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
193 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
194 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
195 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
196 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
197 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
198 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
199 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
200 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
201 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
202 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
203 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
204 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
205 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
206 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
207 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
208 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
209 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
210 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
211 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
212 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
213 2909042592 Labrys sp. LIt4 Isolate Nodule
214 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
215 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
216 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
217 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
218 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
219 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
220 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
221 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
222 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
223 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
224 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
225 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
226 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
227 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
228 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
229 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
230 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
231 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
232 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
233 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
234 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
235 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
236 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
237 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
238 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
239 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
240 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
241 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
242 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
243 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
244 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
245 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
246 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
247 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
248 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
249 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
250 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
251 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
252 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
253 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
254 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
255 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
256 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
257 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
258 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
259 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
260 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
261 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
262 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
263 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
264 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
265 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
266 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
267 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
268 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
269 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
270 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
271 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
272 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
273 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
274 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
275 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
276 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
277 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
278 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
279 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
280 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
281 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
282 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
283 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
284 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
285 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
286 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
287 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
288 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
289 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
290 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
291 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
292 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
293 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
294 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
295 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
296 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
297 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
298 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
299 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
300 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
301 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
302 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
303 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
304 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
305 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
306 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
307 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
308 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
309 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
310 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
311 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
312 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
313 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
314 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
315 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
316 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
317 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
318 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
319 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
320 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
321 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
322 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
323 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
324 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
325 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
326 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
327 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
328 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
329 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
330 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
331 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
332 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
333 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
334 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
335 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
336 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
337 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
338 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
339 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
340 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
341 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
342 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
343 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
344 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
345 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
346 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
347 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
348 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
349 3004167301 Mesorhizobium loti 582 Isolate Unclassified
350 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
351 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
352 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
353 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
354 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
355 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
356 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
357 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
358 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
359 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
360 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
361 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
362 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
363 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
364 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
365 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
366 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
367 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
368 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
369 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
370 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
371 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
372 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
373 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
374 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
375 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
376 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
378 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
379 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
380 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
381 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
382 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
383 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
384 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
385 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
386 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
387 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
388 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
389 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
390 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
391 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
392 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
393 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
394 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
395 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
396 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
397 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
398 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
399 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
400 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
401 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
402 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
403 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
404 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
405 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
406 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
407 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
408 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
409 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
410 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
411 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
412 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
413 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
414 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
415 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
416 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
417 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
418 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
419 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
420 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
421 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
422 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
423 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
424 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
425 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
426 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
427 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
428 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
429 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
430 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
431 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
432 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
433 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
435 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
436 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
438 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
439 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
440 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
441 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
442 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
443 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
444 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
445 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
446 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
468 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
470 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
471 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
472 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
473 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
474 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
475 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
476 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
477 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
478 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
479 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
480 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
481 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
482 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
483 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
484 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
485 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
486 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
487 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
488 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
489 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
490 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
491 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
492 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
493 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
494 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
495 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
496 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
497 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
498 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
499 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
500 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
501 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
502 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
503 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
504 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
505 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
506 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
507 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
508 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
509 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
510 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
511 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
512 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
513 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
514 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
515 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
516 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
517 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
518 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
519 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
520 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
521 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
522 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
523 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
524 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
525 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
526 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
527 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
528 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
529 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
530 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
531 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
532 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
533 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
534 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
535 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
536 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
537 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
538 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
539 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
540 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
541 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
542 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
543 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
544 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
545 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
546 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
547 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
548 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
549 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
550 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
551 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
552 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
553 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
554 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
555 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
556 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
557 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
558 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
559 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
560 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
561 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
562 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
563 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
565 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
566 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
567 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
571 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
572 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
573 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
574 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
575 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
576 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
577 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
578 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
579 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
580 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
581 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
583 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
584 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
585 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
586 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
587 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
588 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
589 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
590 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
591 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
592 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
593 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
594 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
595 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
596 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
597 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
598 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
599 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
600 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
603 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
604 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
605 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
606 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
607 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
608 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
609 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
610 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
611 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
612 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
613 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
614 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
615 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
616 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
617 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
618 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
619 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
620 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
621 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
622 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
623 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
624 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
625 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
626 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
627 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.5
Metatranscriptomes 0.49
Isolates 47.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 31.67
Rhizoplane 2.8
Rhizosphere 40.19
Stem 0
Stem Tuber 0
Unclassified 15.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1002269 3300002739 Bacteria 3181
2 JGI25157J39369_1000755 3300002741 Bacteria 16931
3 JGI25159J45721_1000004 3300002987 Bacteria 215789
4 JGI25159J45721_1000877 3300002987 Bacteria 13071
5 JGI25151J46595_10031663 3300003187 Bacteria 2062
6 JGI25406J46586_10043244 3300003203 Bacteria 1570
7 JGI25160J50197_1000001 3300003354 Bacteria 782301
8 JGI25160J50197_1000021 3300003354 Bacteria 215789
9 JGI25161J50226_1000001 3300003374 Bacteria 655036
10 JGI25161J50226_1000218 3300003374 Bacteria 36216
11 Ga0055529_1007706 3300003763 Bacteria 1455
12 Ga0055526_1001649 3300003771 Bacteria 15665
13 Ga0055526_1008803 3300003771 Bacteria 4965
14 Ga0055524_1002001 3300003775 Bacteria 10883
15 Ga0055524_1012328 3300003775 Bacteria 3284
16 Ga0055536_1000269 3300003781 Bacteria 39889
17 Ga0055530_10007403 3300003791 Bacteria 4633
18 Ga0055540_1028635 3300003792 Bacteria 1315
19 Ga0055531_10045958 3300003794 Bacteria 1205
20 Ga0055543_1000003 3300004625 Bacteria 358656
21 Ga0055543_1000164 3300004625 Bacteria 55304
22 Ga0058862_12092097 3300004803 Bacteria 1137
23 Ga0065165_1000033 3300005262 Bacteria 215827
24 Ga0070658_10003684 3300005327 Bacteria 12537
25 Ga0070658_10062316 3300005327 Bacteria 3039
26 Ga0070658_10505614 3300005327 Bacteria 1044
27 Ga0070680_100114357 3300005336 Bacteria 2248
28 Ga0070682_100133534 3300005337 Bacteria 1683
29 Ga0070660_100045115 3300005339 Bacteria 3373
30 Ga0070660_100082638 3300005339 Bacteria 2522
31 Ga0070691_10003400 3300005341 Bacteria 7154
32 Ga0070661_100000441 3300005344 Bacteria 31826
33 Ga0070668_100310689 3300005347 Bacteria 1324
34 Ga0070674_100154839 3300005356 Bacteria 1733
35 Ga0070659_100036819 3300005366 Bacteria 3815
36 Ga0070667_100214422 3300005367 Bacteria 1712
37 Ga0070663_100025697 3300005455 Bacteria 3979
38 Ga0070681_10081574 3300005458 Bacteria 3190
39 Ga0068867_100089377 3300005459 Bacteria 2336
40 Ga0068853_100013522 3300005539 Bacteria 6667
41 Ga0068853_100253604 3300005539 Bacteria 1615
42 Ga0070665_100142655 3300005548 Bacteria 2398
43 Ga0070665_100259649 3300005548 Bacteria 1738
44 Ga0068855_100013981 3300005563 Bacteria 9677
45 Ga0068857_100082668 3300005577 Bacteria 2869
46 Ga0068854_100178894 3300005578 Bacteria 1656
47 Ga0068856_100257097 3300005614 Bacteria 1762
48 Ga0068852_100026482 3300005616 Bacteria 4714
49 Ga0081455_10238712 3300005937 Bacteria 1337
50 Ga0081540_1033222 3300005983 Bacteria 2805
51 Ga0081539_10000991 3300005985 Bacteria 52737
52 Ga0075365_10005021 3300006038 Bacteria 7093
53 Ga0075365_10009125 3300006038 Bacteria 5680
54 Ga0075365_10023064 3300006038 Bacteria 3909
55 Ga0075365_10027527 3300006038 Bacteria 3619
56 Ga0075365_10050322 3300006038 Bacteria 2748
57 Ga0075365_10065433 3300006038 Bacteria 2436
58 Ga0075368_10084191 3300006042 Bacteria 1296
59 Ga0075364_10004345 3300006051 Bacteria 8133
60 Ga0075364_10025915 3300006051 Bacteria 3736
61 Ga0075364_10037873 3300006051 Bacteria 3124
62 Ga0075362_10028402 3300006177 Bacteria 2402
63 Ga0075367_10000307 3300006178 Bacteria 17312
64 Ga0075369_10091584 3300006186 Bacteria 1357
65 Ga0075366_10162675 3300006195 Bacteria 1352
66 Ga0075370_10017438 3300006353 Bacteria 3880
67 Ga0075370_10135090 3300006353 Bacteria 1441
68 Ga0105240_10002462 3300009093 Bacteria 29759
69 Ga0105240_10078667 3300009093 Bacteria 4060
70 Ga0105240_10207364 3300009093 Bacteria 2293
71 Ga0105240_10478269 3300009093 Bacteria 1389
72 Ga0105240_10608489 3300009093 Bacteria 1202
73 Ga0105243_10087363 3300009148 Bacteria 2559
74 Ga0105237_10003177 3300009545 Bacteria 19715
75 Ga0105237_10306985 3300009545 Bacteria 1590
76 Ga0105238_10012189 3300009551 Bacteria 8665
77 Ga0105238_10094938 3300009551 Bacteria 2970
78 Ga0105239_10202768 3300010375 Bacteria 2222
79 Ga0105239_10501933 3300010375 Bacteria 1379
80 Ga0157373_10032787 3300013100 Bacteria 3738
81 Ga0157371_10119488 3300013102 Bacteria 1873
82 Ga0157370_10005189 3300013104 Bacteria 14674
83 Ga0157370_10135644 3300013104 Bacteria 2294
84 Ga0157369_10047367 3300013105 Bacteria 4668
85 Ga0157369_10576446 3300013105 Bacteria 1162
86 Ga0171463_1017 3300013249 Bacteria 48649
87 Ga0157372_10039780 3300013307 Bacteria 5190
88 Ga0157372_10417303 3300013307 Bacteria 1564
89 Ga0157375_10564256 3300013308 Bacteria 1299
90 Ga0163163_10022780 3300014325 Bacteria 5936
91 Ga0157379_10003397 3300014968 Bacteria 13466
92 Ga0182006_1017059 3300015261 Bacteria 3091
93 Ga0182007_10036984 3300015262 Bacteria 1640
94 Ga0182005_1006094 3300015265 Bacteria 3715
95 Ga0183363_1050 3300015690 Bacteria 38817
96 Ga0163161_10327398 3300017792 Bacteria 1213
97 Ga0213874_10005742 3300021377 Bacteria 2906
98 Ga0213876_10000410 3300021384 Bacteria 35997
99 Ga0213876_10003699 3300021384 Bacteria 8674
100 Ga0209436_100276 3300025208 Bacteria 23572
101 Ga0209436_105791 3300025208 Bacteria 2790
102 Ga0207425_1020966 3300025245 Bacteria 1390
103 Ga0209026_1000089 3300025250 Bacteria 175907
104 Ga0209148_1000124 3300025254 Bacteria 185123
105 Ga0209759_1000903 3300025256 Bacteria 22112
106 Ga0209233_1000010 3300025261 Bacteria 1194329
107 Ga0209455_1000062 3300025272 Bacteria 335169
108 Ga0209130_1000003 3300025284 Bacteria 677988
109 Ga0209130_1000017 3300025284 Bacteria 388431
110 Ga0209130_1005979 3300025284 Bacteria 4064
111 Ga0209676_1000876 3300025292 Bacteria 38530
112 Ga0209025_1000161 3300025294 Bacteria 166506
113 Ga0209025_1000171 3300025294 Bacteria 160478
114 Ga0209564_1000013 3300025295 Bacteria 775755
115 Ga0209758_1023159 3300025297 Bacteria 2818
116 Ga0209050_1006499 3300025298 Bacteria 6896
117 Ga0209256_1000153 3300025299 Bacteria 144736
118 Ga0209256_1002058 3300025299 Bacteria 17780
119 Ga0207426_1000006 3300025302 Bacteria 1025969
120 Ga0207426_1000011 3300025302 Bacteria 791203
121 Ga0209051_1003752 3300025303 Bacteria 9766
122 Ga0207647_10046819 3300025904 Bacteria 2693
123 Ga0207645_10174448 3300025907 Bacteria 1410
124 Ga0207705_10000364 3300025909 Bacteria 41147
125 Ga0207705_10075867 3300025909 Bacteria 2443
126 Ga0207654_10121712 3300025911 Bacteria 1639
127 Ga0207707_10001430 3300025912 Bacteria 22073
128 Ga0207695_10001222 3300025913 Bacteria 44042
129 Ga0207695_10119740 3300025913 Bacteria 2602
130 Ga0207695_10223077 3300025913 Bacteria 1792
131 Ga0207671_10002469 3300025914 Bacteria 19748
132 Ga0207671_10020709 3300025914 Bacteria 5003
133 Ga0207660_10003724 3300025917 Bacteria 9937
134 Ga0207657_10000762 3300025919 Bacteria 34172
135 Ga0207657_10052274 3300025919 Bacteria 3547
136 Ga0207649_10000497 3300025920 Bacteria 27895
137 Ga0207652_10002976 3300025921 Bacteria 14158
138 Ga0207694_10010487 3300025924 Bacteria 6989
139 Ga0207690_10048947 3300025932 Bacteria 2814
140 Ga0207669_10040766 3300025937 Bacteria 2697
141 Ga0207669_10190603 3300025937 Bacteria 1479
142 Ga0207667_10187878 3300025949 Bacteria 2120
143 Ga0207667_10254975 3300025949 Bacteria 1794
144 Ga0207668_10013045 3300025972 Bacteria 5105
145 Ga0207640_10209220 3300025981 Bacteria 1484
146 Ga0207639_10048569 3300026041 Bacteria 3213
147 Ga0207678_10046895 3300026067 Bacteria 3737
148 Ga0207678_10379667 3300026067 Bacteria 1222
149 Ga0207678_10409154 3300026067 Bacteria 1175
150 Ga0207674_10044684 3300026116 Bacteria 4562
151 Ga0207674_10240224 3300026116 Bacteria 1758
152 Ga0207683_10196277 3300026121 Bacteria 1834
153 Ga0209813_10050583 3300027866 Bacteria 1297
154 Ga0268266_10030466 3300028379 Bacteria 4584
155 Ga0307515_10000017 3300028794 Bacteria 550465
156 Ga0307515_10001903 3300028794 Bacteria 46429
157 Ga0307515_10016193 3300028794 Bacteria 13668
158 Ga0265338_10091621 3300028800 Bacteria 2510
159 Ga0265324_10002198 3300029957 Bacteria 10199
160 Ga0265328_10006035 3300031239 Bacteria 5158
161 Ga0265325_10006313 3300031241 Bacteria 7213
162 Ga0265339_10025804 3300031249 Bacteria 3369
163 Ga0265331_10000019 3300031250 Bacteria 258837
164 Ga0265331_10000080 3300031250 Bacteria 137743
165 Ga0265327_10000454 3300031251 Bacteria 73503
166 Ga0265327_10027230 3300031251 Bacteria 3294
167 Ga0265316_10014590 3300031344 Bacteria 6908
168 Ga0307513_10002030 3300031456 Bacteria 28510
169 Ga0307513_10183207 3300031456 Bacteria 1954
170 Ga0307408_100123653 3300031548 Bacteria 2008
171 Ga0265314_10040241 3300031711 Bacteria 3356
172 Ga0265314_10130882 3300031711 Bacteria 1565
173 Ga0307409_100542804 3300031995 Bacteria 1140
174 Ga0316053_103587 3300032120 Bacteria 926
175 Ga0373927_0005801 3300035695 Bacteria 8473
176 Ga0373925_0007826 3300037068 Bacteria 7782
177 Ga0395900_0000318 3300037418 Bacteria 71328
178 Ga0395900_0177761 3300037418 Bacteria 2164
179 Ga0395900_0586506 3300037418 Bacteria 1056
180 Ga0395898_0000547 3300037466 Bacteria 71322
181 Ga0395898_0048465 3300037466 Bacteria 4166
182 Ga0395905_0000305 3300037471 Bacteria 71315
183 Ga0395905_0000571 3300037471 Bacteria 49947
184 Ga0395905_0007862 3300037471 Bacteria 10560
185 Ga0395905_0033095 3300037471 Bacteria 4859
186 Ga0395905_0040245 3300037471 Bacteria 4384
187 Ga0395905_0046561 3300037471 Bacteria 4067
188 Ga0395905_0103674 3300037471 Bacteria 2670
189 Ga0436364_0194000 3300037853 Bacteria 2867
190 Ga0395901_0000093 3300038443 Bacteria 120300
191 Ga0395901_0027220 3300038443 Bacteria 5873
192 Ga0395901_0118786 3300038443 Bacteria 2778
193 Ga0395901_0140178 3300038443 Bacteria 2541
194 Ga0395901_0175338 3300038443 Bacteria 2249
195 Ga0395901_0393133 3300038443 Bacteria 1425
196 Ga0400485_05700 3300038735 Bacteria 1442
197 Ga0436365_0053390 3300039437 Bacteria 8756
198 Ga0436365_1238706 3300039437 Bacteria 138652
199 Ga0436361_0301911 3300039447 Bacteria 1855
200 Ga0436363_0105350 3300039450 Bacteria 3172
201 Ga0439436_0000675 3300041404 Bacteria 9161
202 Ga0439438_019223 3300041405 Bacteria 1933
203 Ga0439438_025738 3300041405 Bacteria 1600
204 Ga0439447_009157 3300041407 Bacteria 3018
205 Ga0439466_0053595 3300041411 Bacteria 1315
206 Ga0439465_0001295 3300041413 Bacteria 8044
207 Ga0439465_0003165 3300041413 Bacteria 5369
208 Ga0439465_0013380 3300041413 Bacteria 2560
209 Ga0439465_0020602 3300041413 Bacteria 2067
210 Ga0439465_0042638 3300041413 Bacteria 1471
211 Ga0439449_0020546 3300042007 Bacteria 2474
212 Ga0439456_011381 3300042013 Bacteria 1840
213 Ga0450906_000779 3300042145 Bacteria 6947
214 Ga0439434_0015284 3300042435 Bacteria 2288
215 Ga0453684_0020194 3300044712 Bacteria 10075
216 Ga0466960_0003996 3300044901 Bacteria 5733
217 Ga0466959_0017433 3300045049 Bacteria 5264
218 Ga0451576_0005584 3300045051 Bacteria 15714
219 Ga0495638_0000679 3300046460 Bacteria 36986
220 Ga0495638_0011460 3300046460 Bacteria 6108
221 Ga0495638_0033393 3300046460 Bacteria 3291
222 Ga0495580_0002971 3300046472 Bacteria 14554
223 Ga0495605_0001576 3300046474 Bacteria 14807
224 Ga0495662_0005789 3300046476 Bacteria 6185
225 Ga0495585_0011315 3300046492 Bacteria 5284
226 Ga0495585_0146189 3300046492 Bacteria 1235
227 Ga0495583_0001761 3300046506 Bacteria 20650
228 Ga0495583_0055184 3300046506 Bacteria 1796
229 Ga0495606_0001738 3300046507 Bacteria 27981
230 Ga0495606_0175510 3300046507 Bacteria 1240
231 Ga0495610_0108185 3300046512 Bacteria 1235
232 Ga0495610_0108302 3300046512 Bacteria 1234
233 Ga0495616_0020450 3300046513 Bacteria 3600
234 Ga0495620_0067235 3300046515 Bacteria 1475
235 Ga0495631_0000730 3300046518 Bacteria 21123
236 Ga0495632_0013426 3300046519 Bacteria 4675
237 Ga0495643_0010833 3300046522 Bacteria 5589
238 Ga0495643_0060060 3300046522 Bacteria 2019
239 Ga0495587_0084674 3300046536 Bacteria 1836
240 Ga0495609_0011369 3300046538 Bacteria 4241
241 Ga0495597_0140982 3300046542 Bacteria 994
242 Ga0495633_0031225 3300046558 Bacteria 2585
243 Ga0495656_0110228 3300046615 Bacteria 1286
244 Ga0495668_0008861 3300046616 Bacteria 6234
245 Ga0495611_0013690 3300046648 Bacteria 3457
246 Ga0495625_0002939 3300046660 Bacteria 17768
247 Ga0495625_0087967 3300046660 Bacteria 2153
248 Ga0495625_0240197 3300046660 Bacteria 1180
249 Ga0495588_0004788 3300046674 Bacteria 5988
250 Ga0495588_0085964 3300046674 Bacteria 1645
251 Ga0495588_0139954 3300046674 Bacteria 1278
252 Ga0495657_0027610 3300046675 Bacteria 4003
253 Ga0495658_0003511 3300046683 Bacteria 7758
254 Ga0495649_0143104 3300046694 Bacteria 1258
255 Ga0495600_0039364 3300046809 Bacteria 3078
256 Ga0495604_0009407 3300047317 Bacteria 7728
257 Ga0495672_0008168 3300047320 Bacteria 7764
258 Ga0495676_0056828 3300047321 Bacteria 3092
259 Ga0495687_059507 3300047443 Bacteria 1580
260 Ga0495686_0002387 3300047472 Bacteria 17834
261 Ga0495626_0046945 3300048091 Bacteria 2009
262 Ga0496100_0057774 3300048903 Bacteria 2543
263 Ga0496101_0052347 3300048904 Bacteria 2944
264 Ga0496101_0253222 3300048904 Bacteria 1372
265 Ga0496101_0379156 3300048904 Bacteria 1113
266 Ga0496102_0101991 3300048905 Bacteria 2667
267 Ga0496104_0006266 3300048907 Bacteria 10455
268 Ga0496105_0005288 3300048908 Bacteria 9785
269 Ga0496107_0033482 3300048910 Bacteria 3677
270 Ga0496108_0002415 3300048911 Bacteria 14924
271 Ga0496109_0005060 3300048912 Bacteria 11012
272 Ga0496110_0123495 3300048913 Bacteria 2334
273 Ga0496111_0000899 3300048914 Bacteria 16197
274 Ga0496112_0004003 3300048915 Bacteria 12351
275 Ga0496113_0009963 3300048916 Bacteria 6262
276 Ga0496114_0337304 3300048917 Bacteria 1333
277 Ga0496115_0060534 3300048918 Bacteria 3051
278 Ga0496115_0062146 3300048918 Bacteria 3012
279 Ga0496115_0191444 3300048918 Bacteria 1690
280 Ga0496115_0288731 3300048918 Bacteria 1346
281 Ga0496117_0001837 3300048920 Bacteria 28723
282 Ga0496119_0000597 3300048922 Bacteria 48924
283 Ga0496119_0009875 3300048922 Bacteria 8108
284 Ga0496119_0067815 3300048922 Bacteria 2102
285 Ga0496119_0084268 3300048922 Bacteria 1823
286 Ga0496120_0004279 3300048923 Bacteria 12121
287 Ga0496120_0046021 3300048923 Bacteria 2524
288 Ga0496121_0014899 3300048924 Bacteria 8196
289 Ga0496121_0093552 3300048924 Bacteria 2340
290 Ga0496121_0099702 3300048924 Bacteria 2244
291 Ga0496122_0000464 3300048925 Bacteria 84473
292 Ga0496122_0001337 3300048925 Bacteria 40284
293 Ga0496123_0000147 3300048926 Bacteria 143834
294 Ga0496123_0001933 3300048926 Bacteria 27009
295 Ga0496124_0001975 3300048927 Bacteria 27965
296 Ga0496125_0003542 3300048928 Bacteria 18812
297 Ga0496125_0042303 3300048928 Bacteria 3882
298 Ga0496125_0042682 3300048928 Bacteria 3859
299 Ga0496125_0057957 3300048928 Bacteria 3132
300 Ga0496126_0000159 3300048929 Bacteria 155348
301 Ga0496126_0000601 3300048929 Bacteria 67983
302 Ga0496126_0040671 3300048929 Bacteria 4309
303 Ga0496126_0372352 3300048929 Bacteria 1164
304 Ga0495678_007759 3300049459 Bacteria 5526
305 Ga0501031_0037769 3300049568 Bacteria 3152
306 Ga0501031_0040544 3300049568 Bacteria 3040
307 Ga0501031_0158152 3300049568 Bacteria 1481
308 Ga0501032_0000024 3300049569 Bacteria 143876
309 Ga0501032_0025428 3300049569 Bacteria 4081
310 Ga0501032_0059597 3300049569 Bacteria 2562
311 Ga0501033_0000391 3300049570 Bacteria 42136
312 Ga0501033_0000761 3300049570 Bacteria 29642
313 Ga0501033_0026641 3300049570 Bacteria 4350
314 Ga0501033_0077922 3300049570 Bacteria 2432
315 Ga0501033_0085303 3300049570 Bacteria 2313
316 Ga0501033_0170294 3300049570 Bacteria 1564
317 Ga0501033_0293658 3300049570 Bacteria 1146
318 Ga0501034_0000140 3300049571 Bacteria 134996
319 Ga0501034_0001662 3300049571 Bacteria 28665
320 Ga0501034_0012775 3300049571 Bacteria 8660
321 Ga0501034_0032089 3300049571 Bacteria 5336
322 Ga0501034_0046132 3300049571 Bacteria 4403
323 Ga0501034_0110748 3300049571 Bacteria 2736
324 Ga0501034_0126770 3300049571 Bacteria 2537
325 Ga0501034_0133499 3300049571 Bacteria 2465
326 Ga0501034_0321635 3300049571 Bacteria 1480
327 Ga0501036_0000443 3300049572 Bacteria 29542
328 Ga0501037_0000024 3300049573 Bacteria 146046
329 Ga0501037_0000818 3300049573 Bacteria 23265
330 Ga0501037_0085127 3300049573 Bacteria 2289
331 Ga0501037_0107988 3300049573 Bacteria 2005
332 Ga0501037_0134238 3300049573 Bacteria 1773
333 Ga0501037_0192105 3300049573 Bacteria 1445
334 Ga0501038_0000064 3300049574 Bacteria 87975
335 Ga0501038_0035848 3300049574 Bacteria 4355
336 Ga0501038_0071828 3300049574 Bacteria 2935
337 Ga0501038_0114276 3300049574 Bacteria 2233
338 Ga0501038_0199300 3300049574 Bacteria 1607
339 Ga0501039_0000017 3300049575 Bacteria 189412
340 Ga0501039_0102757 3300049575 Bacteria 2231
341 Ga0501043_0000050 3300049579 Bacteria 107465
342 Ga0501043_0000124 3300049579 Bacteria 70977
343 Ga0501043_0003156 3300049579 Bacteria 13634
344 Ga0501043_0045975 3300049579 Bacteria 3432
345 Ga0501043_0162767 3300049579 Bacteria 1743
346 Ga0501047_0002344 3300049581 Bacteria 18111
347 Ga0501047_0130263 3300049581 Bacteria 2396
348 Ga0501047_0223423 3300049581 Bacteria 1739
349 Ga0501047_0278230 3300049581 Bacteria 1519
350 Ga0501068_0164490 3300049584 Bacteria 1399
351 Ga0501069_0000004 3300049585 Bacteria 192353
352 Ga0501069_0029583 3300049585 Bacteria 3006
353 Ga0501069_0041303 3300049585 Bacteria 2549
354 Ga0501069_0191142 3300049585 Bacteria 1184
355 Ga0501070_0000031 3300049586 Bacteria 138137
356 Ga0501070_0000148 3300049586 Bacteria 64874
357 Ga0501070_0000694 3300049586 Bacteria 30882
358 Ga0501070_0001919 3300049586 Bacteria 18354
359 Ga0501070_0017646 3300049586 Bacteria 5992
360 Ga0501070_0052822 3300049586 Bacteria 3372
361 Ga0501070_0241825 3300049586 Bacteria 1477
362 Ga0501073_0031453 3300049589 Bacteria 3787
363 Ga0501073_0112523 3300049589 Bacteria 1888
364 Ga0501074_0000006 3300049590 Bacteria 112293
365 Ga0501074_0020074 3300049590 Bacteria 4856
366 Ga0501074_0098200 3300049590 Bacteria 2096
367 Ga0501074_0230576 3300049590 Bacteria 1318
368 Ga0501074_0243704 3300049590 Bacteria 1278
369 Ga0501080_0000693 3300049742 Bacteria 27033
370 Ga0501080_0003339 3300049742 Bacteria 14170
371 Ga0501080_0005406 3300049742 Bacteria 11390
372 Ga0501080_0132306 3300049742 Bacteria 2309
373 Ga0501080_0148412 3300049742 Bacteria 2168
374 Ga0501080_0388074 3300049742 Bacteria 1257
375 Ga0501083_0000066 3300049744 Bacteria 71496
376 Ga0501083_0011927 3300049744 Bacteria 6089
377 Ga0501273_014424 3300049770 Bacteria 1017
378 Ga0501035_0000011 3300049822 Bacteria 305794
379 Ga0501035_0000021 3300049822 Bacteria 209085
380 Ga0501035_0000593 3300049822 Bacteria 39882
381 Ga0501035_0001755 3300049822 Bacteria 21897
382 Ga0501035_0003715 3300049822 Bacteria 14551
383 Ga0501035_0005312 3300049822 Bacteria 12184
384 Ga0501035_0006966 3300049822 Bacteria 10558
385 Ga0501035_0035511 3300049822 Bacteria 4523
386 Ga0501035_0087852 3300049822 Bacteria 2740
387 Ga0501035_0176204 3300049822 Bacteria 1844
388 Ga0501035_0258932 3300049822 Bacteria 1475
389 Ga0501044_0000588 3300049823 Bacteria 44117
390 Ga0501044_0000803 3300049823 Bacteria 37863
391 Ga0501044_0002607 3300049823 Bacteria 20483
392 Ga0501044_0006574 3300049823 Bacteria 12830
393 Ga0501044_0012369 3300049823 Bacteria 9238
394 Ga0501044_0014696 3300049823 Bacteria 8442
395 Ga0501044_0035448 3300049823 Bacteria 5225
396 Ga0501044_0051016 3300049823 Bacteria 4267
397 Ga0501044_0064037 3300049823 Bacteria 3754
398 Ga0501044_0083723 3300049823 Bacteria 3225
399 Ga0501044_0124050 3300049823 Bacteria 2581
400 Ga0501044_0174053 3300049823 Bacteria 2122
401 Ga0501044_0180460 3300049823 Bacteria 2078
402 Ga0501044_0184173 3300049823 Bacteria 2054
403 Ga0501044_0189219 3300049823 Bacteria 2022
404 Ga0501044_0217547 3300049823 Bacteria 1862
405 Ga0501044_0297099 3300049823 Bacteria 1545
406 Ga0501044_0365018 3300049823 Bacteria 1361
407 nmdc:mga03683_19775_c1 3300050489 Bacteria 2574
408 nmdc:mga00v17_10499_c1 3300050491 Bacteria 5058
409 nmdc:mga0yw44_16779_c1 3300050492 Bacteria 3966
410 nmdc:mga07m45_12959_c1 3300050496 Bacteria 4411
411 nmdc:mga07m45_45525_c2 3300050496 Bacteria 2088
412 Ga0500610_0001958 3300053079 Bacteria 7335
413 Ga0500643_012026 3300053087 Bacteria 3119
414 Ga0500643_015186 3300053087 Bacteria 2648
415 Ga0500556_0000290 3300053104 Bacteria 39103
416 Ga0500557_000475 3300053105 Bacteria 5336
417 Ga0500594_0003391 3300053118 Bacteria 3493
418 Ga0500595_011555 3300053119 Bacteria 3450
419 Ga0500652_007639 3300053131 Bacteria 3553
420 Ga0500568_0000353 3300053139 Bacteria 35729
421 Ga0500568_0000963 3300053139 Bacteria 19793
422 Ga0500616_0000577 3300053153 Bacteria 44621
423 Ga0500616_0024660 3300053153 Bacteria 3340
424 Ga0500616_0067490 3300053153 Bacteria 1834
425 Ga0500616_0097589 3300053153 Bacteria 1442
426 Ga0500620_002422 3300053155 Bacteria 3756
427 Ga0500636_0034146 3300053177 Bacteria 3011
428 Ga0500645_022807 3300053730 Bacteria 1921
429 Ga0501084_0175458 3300054114 Bacteria 1809
430 Ga0587080_020673 3300059503 Bacteria 1077
431 Ga0587106_009420 3300059605 Bacteria 1241
432 Ga0501082_0063528 3300060353 Bacteria 3179
433 Ga0501082_0136418 3300060353 Bacteria 2129
434 Ga0501082_0204825 3300060353 Bacteria 1716
435 Ga0530510_0020554 3300061734 Bacteria 4694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0241825 Ga0501070_0241825_574_1458 288
2 iso_pu_bacteria 2643221541 2643730053 289
3 iso_pu_bacteria 2643221606 2644045539 289
4 iso_pu_bacteria 2643221643 2644242488 289
5 iso_pu_bacteria 2643221671 2644392835 289
6 iso_pu_bacteria 8054563764 8054563843 289
7 3300006186 Ga0075369_10091584 Ga0075369_100915841 290
8 3300029957 Ga0265324_10002198 Ga0265324_100021988 290
9 3300031250 Ga0265331_10000019 Ga0265331_10000019212 290
10 3300041413 Ga0439465_0001295 Ga0439465_0001295_6835_7707 290
11 3300044712 Ga0453684_0020194 Ga0453684_0020194_8006_8887 290
12 iso_pu_bacteria 2643221636 2644204640 290
13 iso_pu_bacteria 2510461076 2510895535 291
14 iso_pu_bacteria 2510917020 2511122246 291
15 iso_pu_bacteria 2511231027 2511390104 291
16 iso_pu_bacteria 2582581280 2585153002 291
17 iso_pu_bacteria 2582581293 2585195039 291
18 iso_pu_bacteria 2582581299 2585228442 291
19 iso_pu_bacteria 2643221545 2643747166 291
20 iso_pu_bacteria 2643221551 2643776326 291
21 iso_pu_bacteria 2643221552 2643781202 291
22 iso_pu_bacteria 2643221555 2643794773 291
23 iso_pu_bacteria 2643221584 2643927214 291
24 iso_pu_bacteria 2643221598 2643998425 291
25 iso_pu_bacteria 2643221614 2644086708 291
26 iso_pu_bacteria 2643221634 2644193670 291
27 iso_pu_bacteria 2643221661 2644341662 291
28 iso_pu_bacteria 2643221666 2644367949 291
29 iso_pu_bacteria 2643221691 2644507638 291
30 iso_pu_bacteria 2751185800 2753359855 291
31 iso_pu_bacteria 2757320392 2757571648 291
32 iso_pu_bacteria 2758568016 2758642177 291
33 iso_pu_bacteria 2765235802 2765466565 291
34 iso_pu_bacteria 2767802442 2770196921 291
35 iso_pu_bacteria 2775506902 2776270470 291
36 iso_pu_bacteria 2775506904 2776281611 291
37 iso_pu_bacteria 2818991435 2819537562 291
38 iso_pu_bacteria 2818991454 2819646376 291
39 iso_pu_bacteria 2839993093 2839997457 291
40 iso_pu_bacteria 2840764183 2840768930 291
41 iso_pu_bacteria 2842871566 2842872094 291
42 iso_pu_bacteria 2854911287 2854912512 291
43 iso_pu_bacteria 2891373044 2891373506 291
44 iso_pu_bacteria 2894652903 2894655777 291
45 iso_pu_bacteria 2904578770 2904582038 291
46 iso_pu_bacteria 2915650412 2915653239 291
47 iso_pu_bacteria 2919119836 2919123184 291
48 iso_pu_bacteria 2928521798 2928524032 291
49 iso_pu_bacteria 2939669807 2939671825 291
50 iso_pu_bacteria 2954011201 2954012977 291
51 iso_pu_bacteria 2989349275 2989349978 291
52 iso_pu_bacteria 2989771324 2989775727 291
53 iso_pu_bacteria 3002141150 3002144920 291
54 iso_pu_bacteria 8054558443 8054561074 291
55 3300032120 Ga0316053_103587 Ga0316053_1035871 292
56 3300049579 Ga0501043_0003156 Ga0501043_0003156_11609_12493 292
57 3300049581 Ga0501047_0002344 Ga0501047_0002344_5729_6613 292
58 3300049586 Ga0501070_0017646 Ga0501070_0017646_3852_4736 292
59 3300049744 Ga0501083_0011927 Ga0501083_0011927_1068_1952 292
60 3300049823 Ga0501044_0189219 Ga0501044_0189219_1078_1962 292
61 3300060353 Ga0501082_0063528 Ga0501082_0063528_2161_3045 292
62 iso_pu_bacteria 2503198000 2503200336 292
63 iso_pu_bacteria 2508501123 2509115035 292
64 iso_pu_bacteria 2508501127 2509139563 292
65 iso_pu_bacteria 2509276018 2509373788 292
66 iso_pu_bacteria 2509276022 2509395142 292
67 iso_pu_bacteria 2510065059 2510314124 292
68 iso_pu_bacteria 2510917028 2511182554 292
69 iso_pu_bacteria 2512875016 2512932298 292
70 iso_pu_bacteria 2512875024 2512960305 292
71 iso_pu_bacteria 2513237090 2513614237 292
72 iso_pu_bacteria 2513237138 2513865843 292
73 iso_pu_bacteria 2513237144 2513908669 292
74 iso_pu_bacteria 2513237146 2513925255 292
75 iso_pu_bacteria 2513237159 2513997747 292
76 iso_pu_bacteria 2513237164 2514034613 292
77 iso_pu_bacteria 2513237305 2514419411 292
78 iso_pu_bacteria 2513237351 2514587748 292
79 iso_pu_bacteria 2524023209 2524458774 292
80 iso_pu_bacteria 2582581283 2585167379 292
81 iso_pu_bacteria 2582581306 2585265600 292
82 iso_pu_bacteria 2582581865 2585388805 292
83 iso_pu_bacteria 2582581866 2585395491 292
84 iso_pu_bacteria 2582581867 2585400876 292
85 iso_pu_bacteria 2585427590 2585822222 292
86 iso_pu_bacteria 2588253730 2588518362 292
87 iso_pu_bacteria 2597489875 2597812333 292
88 iso_pu_bacteria 2599185170 2599417165 292
89 iso_pu_bacteria 2599185301 2599936185 292
90 iso_pu_bacteria 2599185352 2600194770 292
91 iso_pu_bacteria 2643221550 2643770805 292
92 iso_pu_bacteria 2643221557 2643804270 292
93 iso_pu_bacteria 2643221564 2643839233 292
94 iso_pu_bacteria 2643221607 2644050298 292
95 iso_pu_bacteria 2643221610 2644064956 292
96 iso_pu_bacteria 2643221618 2644106982 292
97 iso_pu_bacteria 2643221623 2644129670 292
98 iso_pu_bacteria 2643221626 2644148726 292
99 iso_pu_bacteria 2643221627 2644158281 292
100 iso_pu_bacteria 2643221637 2644208853 292
101 iso_pu_bacteria 2643221655 2644309942 292
102 iso_pu_bacteria 2643221659 2644331088 292
103 iso_pu_bacteria 2643221668 2644376635 292
104 iso_pu_bacteria 2643221675 2644416629 292
105 iso_pu_bacteria 2643221680 2644449669 292
106 iso_pu_bacteria 2643221686 2644483218 292
107 iso_pu_bacteria 2643221688 2644494365 292
108 iso_pu_bacteria 2643221689 2644499776 292
109 iso_pu_bacteria 2643221698 2644543818 292
110 iso_pu_bacteria 2643221712 2644616397 292
111 iso_pu_bacteria 2643221718 2644652383 292
112 iso_pu_bacteria 2643221723 2644675898 292
113 iso_pu_bacteria 2643221726 2644689801 292
114 iso_pu_bacteria 2643221736 2644745202 292
115 iso_pu_bacteria 2687453392 2688597506 292
116 iso_pu_bacteria 2693429783 2694631257 292
117 iso_pu_bacteria 2693429784 2694638739 292
118 iso_pu_bacteria 2721755686 2723574738 292
119 iso_pu_bacteria 2738543024 2739310111 292
120 iso_pu_bacteria 2756170246 2756671800 292
121 iso_pu_bacteria 2791355123 2792752000 292
122 iso_pu_bacteria 2837678835 2837680529 292
123 iso_pu_bacteria 2838035591 2838038631 292
124 iso_pu_bacteria 2838074704 2838076711 292
125 iso_pu_bacteria 2838661181 2838661449 292
126 iso_pu_bacteria 2841734538 2841738341 292
127 iso_pu_bacteria 2841911363 2841915798 292
128 iso_pu_bacteria 2841917233 2841921821 292
129 iso_pu_bacteria 2842298080 2842298122 292
130 iso_pu_bacteria 2842357229 2842360278 292
131 iso_pu_bacteria 2842509118 2842510958 292
132 iso_pu_bacteria 2842521101 2842522005 292
133 iso_pu_bacteria 2844002411 2844008266 292
134 iso_pu_bacteria 2844009547 2844012885 292
135 iso_pu_bacteria 2844163670 2844164096 292
136 iso_pu_bacteria 2847670302 2847675235 292
137 iso_pu_bacteria 2847686936 2847691417 292
138 iso_pu_bacteria 2852387548 2852390398 292
139 iso_pu_bacteria 2856314179 2856314957 292
140 iso_pu_bacteria 2856320880 2856323411 292
141 iso_pu_bacteria 2856328259 2856329282 292
142 iso_pu_bacteria 2856334872 2856336391 292
143 iso_pu_bacteria 2856342000 2856342081 292
144 iso_pu_bacteria 2856364286 2856368296 292
145 iso_pu_bacteria 2857349434 2857351513 292
146 iso_pu_bacteria 2857367948 2857375484 292
147 iso_pu_bacteria 2869162929 2869163973 292
148 iso_pu_bacteria 2869169390 2869174044 292
149 iso_pu_bacteria 2869234852 2869241297 292
150 iso_pu_bacteria 2869249662 2869255180 292
151 iso_pu_bacteria 2869256925 2869261878 292
152 iso_pu_bacteria 2869264136 2869266493 292
153 iso_pu_bacteria 2869271264 2869275395 292
154 iso_pu_bacteria 2869278585 2869282890 292
155 iso_pu_bacteria 2869285874 2869290085 292
156 iso_pu_bacteria 2871429161 2871432369 292
157 iso_pu_bacteria 2871435913 2871436727 292
158 iso_pu_bacteria 2871444079 2871450983 292
159 iso_pu_bacteria 2871451962 2871456655 292
160 iso_pu_bacteria 2871459585 2871462033 292
161 iso_pu_bacteria 2871466892 2871472872 292
162 iso_pu_bacteria 2871474448 2871474891 292
163 iso_pu_bacteria 2871481445 2871481509 292
164 iso_pu_bacteria 2871488783 2871492991 292
165 iso_pu_bacteria 2871495908 2871502552 292
166 iso_pu_bacteria 2874102143 2874105624 292
167 iso_pu_bacteria 2874109183 2874110766 292
168 iso_pu_bacteria 2874116593 2874117021 292
169 iso_pu_bacteria 2874123672 2874127031 292
170 iso_pu_bacteria 2874131515 2874133965 292
171 iso_pu_bacteria 2874139085 2874142551 292
172 iso_pu_bacteria 2874146452 2874152333 292
173 iso_pu_bacteria 2874155637 2874159736 292
174 iso_pu_bacteria 2874162495 2874162852 292
175 iso_pu_bacteria 2874168670 2874168945 292
176 iso_pu_bacteria 2876363079 2876367669 292
177 iso_pu_bacteria 2876369609 2876374921 292
178 iso_pu_bacteria 2876377896 2876378656 292
179 iso_pu_bacteria 2876386047 2876389097 292
180 iso_pu_bacteria 2876392853 2876393970 292
181 iso_pu_bacteria 2876399893 2876404159 292
182 iso_pu_bacteria 2876406927 2876409067 292
183 iso_pu_bacteria 2876413966 2876418252 292
184 iso_pu_bacteria 2876420981 2876424244 292
185 iso_pu_bacteria 2878035449 2878042200 292
186 iso_pu_bacteria 2878738818 2878739207 292
187 iso_pu_bacteria 2878745973 2878749982 292
188 iso_pu_bacteria 2878753008 2878757037 292
189 iso_pu_bacteria 2878760144 2878766444 292
190 iso_pu_bacteria 2878767105 2878773640 292
191 iso_pu_bacteria 2878774303 2878779257 292
192 iso_pu_bacteria 2878781027 2878783695 292
193 iso_pu_bacteria 2878788777 2878795545 292
194 iso_pu_bacteria 2881147464 2881150813 292
195 iso_pu_bacteria 2881155292 2881161346 292
196 iso_pu_bacteria 2881161766 2881167086 292
197 iso_pu_bacteria 2881845957 2881849981 292
198 iso_pu_bacteria 2881853255 2881853858 292
199 iso_pu_bacteria 2881861095 2881866633 292
200 iso_pu_bacteria 2882632389 2882640703 292
201 iso_pu_bacteria 2882912400 2882919576 292
202 iso_pu_bacteria 2885305155 2885308595 292
203 iso_pu_bacteria 2885312484 2885312640 292
204 iso_pu_bacteria 2885318864 2885321460 292
205 iso_pu_bacteria 2885334103 2885335784 292
206 iso_pu_bacteria 2885342637 2885349060 292
207 iso_pu_bacteria 2885350715 2885351614 292
208 iso_pu_bacteria 2888337043 2888338572 292
209 iso_pu_bacteria 2888343758 2888346077 292
210 iso_pu_bacteria 2888350351 2888355395 292
211 iso_pu_bacteria 2889010040 2889010374 292
212 iso_pu_bacteria 2889016732 2889017961 292
213 iso_pu_bacteria 2889790730 2889796024 292
214 iso_pu_bacteria 2889914905 2889919826 292
215 iso_pu_bacteria 2894817345 2894820464 292
216 iso_pu_bacteria 2896384573 2896392152 292
217 iso_pu_bacteria 2903448605 2903450447 292
218 iso_pu_bacteria 2903492973 2903500763 292
219 iso_pu_bacteria 2903492973 2903503287 292
220 iso_pu_bacteria 2903513507 2903515401 292
221 iso_pu_bacteria 2903521522 2903521814 292
222 iso_pu_bacteria 2903528002 2903528191 292
223 iso_pu_bacteria 2903540706 2903547593 292
224 iso_pu_bacteria 2904659560 2904660301 292
225 iso_pu_bacteria 2906308376 2906312341 292
226 iso_pu_bacteria 2906321335 2906325050 292
227 iso_pu_bacteria 2906328253 2906330401 292
228 iso_pu_bacteria 2906354277 2906356570 292
229 iso_pu_bacteria 2906363423 2906365953 292
230 iso_pu_bacteria 2906370794 2906376402 292
231 iso_pu_bacteria 2906378014 2906378929 292
232 iso_pu_bacteria 2906386501 2906392062 292
233 iso_pu_bacteria 2906393657 2906398037 292
234 iso_pu_bacteria 2906401398 2906405944 292
235 iso_pu_bacteria 2906408224 2906411934 292
236 iso_pu_bacteria 2906414383 2906419601 292
237 iso_pu_bacteria 2909042592 2909043156 292
238 iso_pu_bacteria 2917554339 2917556695 292
239 iso_pu_bacteria 2919450847 2919451946 292
240 iso_pu_bacteria 2920760137 2920761371 292
241 iso_pu_bacteria 2920822456 2920825414 292
242 iso_pu_bacteria 2922130491 2922133852 292
243 iso_pu_bacteria 2922151315 2922155617 292
244 iso_pu_bacteria 2922158528 2922164924 292
245 iso_pu_bacteria 2922172374 2922173630 292
246 iso_pu_bacteria 2922178524 2922180775 292
247 iso_pu_bacteria 2922185730 2922187206 292
248 iso_pu_bacteria 2923556063 2923559251 292
249 iso_pu_bacteria 2924710171 2924718510 292
250 iso_pu_bacteria 2924718760 2924720480 292
251 iso_pu_bacteria 2924726620 2924732240 292
252 iso_pu_bacteria 2924733363 2924740608 292
253 iso_pu_bacteria 2924741084 2924744951 292
254 iso_pu_bacteria 2924748358 2924753355 292
255 iso_pu_bacteria 2924754689 2924755895 292
256 iso_pu_bacteria 2924762789 2924763735 292
257 iso_pu_bacteria 2924776078 2924776672 292
258 iso_pu_bacteria 2924784321 2924786340 292
259 iso_pu_bacteria 2933016740 2933023238 292
260 iso_pu_bacteria 2937813078 2937819517 292
261 iso_pu_bacteria 2937822353 2937829011 292
262 iso_pu_bacteria 2937836603 2937839603 292
263 iso_pu_bacteria 2937843397 2937844354 292
264 iso_pu_bacteria 2937848649 2937850945 292
265 iso_pu_bacteria 2937861824 2937863499 292
266 iso_pu_bacteria 2937868953 2937873427 292
267 iso_pu_bacteria 2937877337 2937880832 292
268 iso_pu_bacteria 2937891427 2937897460 292
269 iso_pu_bacteria 2937972304 2937977024 292
270 iso_pu_bacteria 2937980651 2937984996 292
271 iso_pu_bacteria 2937994558 2938001468 292
272 iso_pu_bacteria 2938014810 2938015512 292
273 iso_pu_bacteria 2941499720 2941504806 292
274 iso_pu_bacteria 2958034702 2958039673 292
275 iso_pu_bacteria 2958041894 2958052698 292
276 iso_pu_bacteria 2958064165 2958069382 292
277 iso_pu_bacteria 2958071322 2958073974 292
278 iso_pu_bacteria 2958084443 2958088612 292
279 iso_pu_bacteria 2958092219 2958097978 292
280 iso_pu_bacteria 2958100919 2958107917 292
281 iso_pu_bacteria 2958108152 2958109774 292
282 iso_pu_bacteria 2958115193 2958116434 292
283 iso_pu_bacteria 2958122699 2958125694 292
284 iso_pu_bacteria 2958130278 2958134472 292
285 iso_pu_bacteria 2958137437 2958139159 292
286 iso_pu_bacteria 2958158011 2958159341 292
287 iso_pu_bacteria 2958165035 2958171622 292
288 iso_pu_bacteria 2958172287 2958178081 292
289 iso_pu_bacteria 2958179912 2958180953 292
290 iso_pu_bacteria 2961077736 2961078790 292
291 iso_pu_bacteria 2961114664 2961115625 292
292 iso_pu_bacteria 2961127735 2961131373 292
293 iso_pu_bacteria 2961136820 2961137959 292
294 iso_pu_bacteria 2961163497 2961170063 292
295 iso_pu_bacteria 2961170736 2961175635 292
296 iso_pu_bacteria 2961183825 2961186912 292
297 iso_pu_bacteria 2963644680 2963646906 292
298 iso_pu_bacteria 2965018300 2965024814 292
299 iso_pu_bacteria 2965025482 2965029747 292
300 iso_pu_bacteria 2965032056 2965032299 292
301 iso_pu_bacteria 2965040258 2965045928 292
302 iso_pu_bacteria 2965047637 2965055373 292
303 iso_pu_bacteria 2965062239 2965065224 292
304 iso_pu_bacteria 2965089291 2965093326 292
305 iso_pu_bacteria 2965102966 2965107040 292
306 iso_pu_bacteria 2965119406 2965119546 292
307 iso_pu_bacteria 2967996073 2967999308 292
308 iso_pu_bacteria 2968003550 2968007721 292
309 iso_pu_bacteria 2968016561 2968021003 292
310 iso_pu_bacteria 2968083720 2968088293 292
311 iso_pu_bacteria 2968091066 2968095054 292
312 iso_pu_bacteria 2968097103 2968101481 292
313 iso_pu_bacteria 2968110612 2968111358 292
314 iso_pu_bacteria 2968117919 2968119625 292
315 iso_pu_bacteria 2968128360 2968130612 292
316 iso_pu_bacteria 2968138860 2968144723 292
317 iso_pu_bacteria 2968171901 2968178455 292
318 iso_pu_bacteria 2970469710 2970474300 292
319 iso_pu_bacteria 2970489779 2970494463 292
320 iso_pu_bacteria 2970503327 2970508223 292
321 iso_pu_bacteria 2970510686 2970511454 292
322 iso_pu_bacteria 2970524798 2970527594 292
323 iso_pu_bacteria 2970532167 2970534907 292
324 iso_pu_bacteria 2970540015 2970544208 292
325 iso_pu_bacteria 2970547951 2970554175 292
326 iso_pu_bacteria 2970554993 2970561300 292
327 iso_pu_bacteria 2970593180 2970597499 292
328 iso_pu_bacteria 2970619444 2970624419 292
329 iso_pu_bacteria 2970627176 2970628594 292
330 iso_pu_bacteria 2977821940 2977826196 292
331 iso_pu_bacteria 2977828996 2977834981 292
332 iso_pu_bacteria 2977843712 2977848129 292
333 iso_pu_bacteria 2977851361 2977853695 292
334 iso_pu_bacteria 2977858184 2977864638 292
335 iso_pu_bacteria 2977864932 2977869077 292
336 iso_pu_bacteria 2977872689 2977878067 292
337 iso_pu_bacteria 2977898635 2977899273 292
338 iso_pu_bacteria 2977907340 2977909752 292
339 iso_pu_bacteria 2977915119 2977919952 292
340 iso_pu_bacteria 2977922695 2977923627 292
341 iso_pu_bacteria 2977935797 2977936537 292
342 iso_pu_bacteria 2977942078 2977944498 292
343 iso_pu_bacteria 2977950692 2977952787 292
344 iso_pu_bacteria 2977957713 2977959183 292
345 iso_pu_bacteria 2977971508 2977976518 292
346 iso_pu_bacteria 2977986579 2977990466 292
347 iso_pu_bacteria 2979710463 2979710594 292
348 iso_pu_bacteria 2979742915 2979745889 292
349 iso_pu_bacteria 2979764755 2979771303 292
350 iso_pu_bacteria 2979772303 2979774868 292
351 iso_pu_bacteria 2979793036 2979795835 292
352 iso_pu_bacteria 2979808191 2979813407 292
353 iso_pu_bacteria 2987636660 2987638697 292
354 iso_pu_bacteria 2987645492 2987646517 292
355 iso_pu_bacteria 2987652177 2987654268 292
356 iso_pu_bacteria 2987659509 2987666304 292
357 iso_pu_bacteria 2987666974 2987669908 292
358 iso_pu_bacteria 2987673487 2987676205 292
359 iso_pu_bacteria 2996310559 2996314390 292
360 iso_pu_bacteria 2996336353 2996339898 292
361 iso_pu_bacteria 2996341866 2996345002 292
362 iso_pu_bacteria 2996348954 2996352364 292
363 iso_pu_bacteria 2996386984 2996390295 292
364 iso_pu_bacteria 3000135777 3000139878 292
365 iso_pu_bacteria 3004167301 3004167937 292
366 iso_pu_bacteria 3004188549 3004195310 292
367 iso_pu_bacteria 3004195979 3004203624 292
368 iso_pu_bacteria 3004203850 3004205060 292
369 iso_pu_bacteria 3004211236 3004215314 292
370 iso_pu_bacteria 3004218560 3004225843 292
371 iso_pu_bacteria 3004232784 3004236683 292
372 iso_pu_bacteria 3004248173 3004255535 292
373 iso_pu_bacteria 3004268573 3004275558 292
374 iso_pu_bacteria 3004275668 3004279046 292
375 iso_pu_bacteria 3004334049 3004335424 292
376 iso_pu_bacteria 3005409236 3005414419 292
377 iso_pu_bacteria 637000159 637075398 292
378 iso_pu_bacteria 649633066 649872055 292
379 iso_pu_bacteria 8001845381 8001849964 292
380 iso_pu_bacteria 8002285264 8002289309 292
381 iso_pu_bacteria 8004300914 8004301125 292
382 iso_pu_bacteria 8004361976 8004367719 292
383 iso_pu_bacteria 8004374579 8004378612 292
384 iso_pu_bacteria 8004387939 8004392290 292
385 iso_pu_bacteria 8004395343 8004403178 292
386 iso_pu_bacteria 8004445564 8004449205 292
387 iso_pu_bacteria 8004633249 8004638698 292
388 iso_pu_bacteria 8004640170 8004641131 292
389 iso_pu_bacteria 8004703790 8004708875 292
390 iso_pu_bacteria 8004714634 8004718600 292
391 iso_pu_bacteria 8004727605 8004733551 292
392 iso_pu_bacteria 8005301065 8005303282 292
393 iso_pu_bacteria 8005688590 8005691946 292
394 iso_pu_bacteria 8024486573 8024488171 292
395 iso_pu_bacteria 8045864390 8045864513 292
396 iso_pu_bacteria 8046767195 8046771800 292
397 iso_pu_bacteria 8055617313 8055619806 292
398 iso_pu_bacteria 8057575449 8057575558 292
399 3300005327 Ga0070658_10505614 Ga0070658_105056141 293
400 3300021384 Ga0213876_10003699 Ga0213876_100036995 293
401 3300039437 Ga0436365_0053390 Ga0436365_0053390_2368_3261 293
402 3300049570 Ga0501033_0077922 Ga0501033_0077922_1441_2355 293
403 3300049573 Ga0501037_0085127 Ga0501037_0085127_217_1131 293
404 3300049581 Ga0501047_0278230 Ga0501047_0278230_180_1073 293
405 3300049822 Ga0501035_0035511 Ga0501035_0035511_3228_4142 293
406 3300049823 Ga0501044_0035448 Ga0501044_0035448_1066_1980 293
407 3300049823 Ga0501044_0124050 Ga0501044_0124050_580_1479 293
408 3300053177 Ga0500636_0034146 Ga0500636_0034146_1019_1903 293
409 iso_pu_bacteria 2958041894 2958042770 293
410 3300005344 Ga0070661_100000441 Ga0070661_10000044123 294
411 3300005614 Ga0068856_100257097 Ga0068856_1002570972 294
412 3300009093 Ga0105240_10478269 Ga0105240_104782692 294
413 3300021384 Ga0213876_10000410 Ga0213876_1000041014 294
414 3300025920 Ga0207649_10000497 Ga0207649_100004978 294
415 3300026067 Ga0207678_10379667 Ga0207678_103796672 294
416 3300028794 Ga0307515_10016193 Ga0307515_1001619315 294
417 3300031250 Ga0265331_10000080 Ga0265331_1000008091 294
418 3300031711 Ga0265314_10040241 Ga0265314_100402416 294
419 3300039437 Ga0436365_1238706 Ga0436365_1238706_5141_6031 294
420 3300045051 Ga0451576_0005584 Ga0451576_0005584_12281_13177 294
421 3300046472 Ga0495580_0002971 Ga0495580_0002971_7162_8055 294
422 3300046683 Ga0495658_0003511 Ga0495658_0003511_4362_5255 294
423 3300049581 Ga0501047_0223423 Ga0501047_0223423_661_1557 294
424 3300005347 Ga0070668_100310689 Ga0070668_1003106892 295
425 3300005367 Ga0070667_100214422 Ga0070667_1002144223 295
426 3300005455 Ga0070663_100025697 Ga0070663_1000256973 295
427 3300005548 Ga0070665_100142655 Ga0070665_1001426554 295
428 3300006038 Ga0075365_10009125 Ga0075365_100091254 295
429 3300006051 Ga0075364_10004345 Ga0075364_100043456 295
430 3300009093 Ga0105240_10002462 Ga0105240_1000246213 295
431 3300009148 Ga0105243_10087363 Ga0105243_100873631 295
432 3300009545 Ga0105237_10003177 Ga0105237_100031773 295
433 3300013308 Ga0157375_10564256 Ga0157375_105642562 295
434 3300014325 Ga0163163_10022780 Ga0163163_100227805 295
435 3300015265 Ga0182005_1006094 Ga0182005_10060943 295
436 3300021377 Ga0213874_10005742 Ga0213874_100057422 295
437 3300025284 Ga0209130_1005979 Ga0209130_10059793 295
438 3300025294 Ga0209025_1000171 Ga0209025_1000171118 295
439 3300025907 Ga0207645_10174448 Ga0207645_101744482 295
440 3300025913 Ga0207695_10001222 Ga0207695_1000122231 295
441 3300025914 Ga0207671_10002469 Ga0207671_100024692 295
442 3300025972 Ga0207668_10013045 Ga0207668_100130454 295
443 3300026067 Ga0207678_10046895 Ga0207678_100468953 295
444 3300028794 Ga0307515_10001903 Ga0307515_1000190320 295
445 3300028800 Ga0265338_10091621 Ga0265338_100916211 295
446 3300031241 Ga0265325_10006313 Ga0265325_100063135 295
447 3300031249 Ga0265339_10025804 Ga0265339_100258044 295
448 3300031251 Ga0265327_10000454 Ga0265327_1000045444 295
449 3300031456 Ga0307513_10183207 Ga0307513_101832073 295
450 3300031711 Ga0265314_10130882 Ga0265314_101308822 295
451 3300031995 Ga0307409_100542804 Ga0307409_1005428041 295
452 3300035695 Ga0373927_0005801 Ga0373927_0005801_5627_6520 295
453 3300037068 Ga0373925_0007826 Ga0373925_0007826_223_1116 295
454 3300037471 Ga0395905_0000571 Ga0395905_0000571_42116_43009 295
455 3300037471 Ga0395905_0007862 Ga0395905_0007862_5299_6192 295
456 3300037471 Ga0395905_0033095 Ga0395905_0033095_2021_2914 295
457 3300037853 Ga0436364_0194000 Ga0436364_0194000_724_1611 295
458 3300039447 Ga0436361_0301911 Ga0436361_0301911_250_1137 295
459 3300039450 Ga0436363_0105350 Ga0436363_0105350_467_1354 295
460 3300041413 Ga0439465_0013380 Ga0439465_0013380_1083_1973 295
461 3300041413 Ga0439465_0042638 Ga0439465_0042638_131_1021 295
462 3300045049 Ga0466959_0017433 Ga0466959_0017433_2750_3637 295
463 3300046460 Ga0495638_0011460 Ga0495638_0011460_1821_2711 295
464 3300046492 Ga0495585_0146189 Ga0495585_0146189_47_934 295
465 3300046506 Ga0495583_0001761 Ga0495583_0001761_11323_12210 295
466 3300046558 Ga0495633_0031225 Ga0495633_0031225_491_1378 295
467 3300046615 Ga0495656_0110228 Ga0495656_0110228_305_1192 295
468 3300046674 Ga0495588_0085964 Ga0495588_0085964_511_1398 295
469 3300047321 Ga0495676_0056828 Ga0495676_0056828_332_1219 295
470 3300048903 Ga0496100_0057774 Ga0496100_0057774_1298_2185 295
471 3300048904 Ga0496101_0052347 Ga0496101_0052347_1723_2610 295
472 3300048904 Ga0496101_0253222 Ga0496101_0253222_162_1049 295
473 3300048905 Ga0496102_0101991 Ga0496102_0101991_1026_1913 295
474 3300048907 Ga0496104_0006266 Ga0496104_0006266_5150_6037 295
475 3300048908 Ga0496105_0005288 Ga0496105_0005288_8419_9306 295
476 3300048910 Ga0496107_0033482 Ga0496107_0033482_976_1863 295
477 3300048911 Ga0496108_0002415 Ga0496108_0002415_1552_2439 295
478 3300048912 Ga0496109_0005060 Ga0496109_0005060_4568_5455 295
479 3300048913 Ga0496110_0123495 Ga0496110_0123495_934_1821 295
480 3300048914 Ga0496111_0000899 Ga0496111_0000899_10736_11623 295
481 3300048915 Ga0496112_0004003 Ga0496112_0004003_1597_2484 295
482 3300048916 Ga0496113_0009963 Ga0496113_0009963_3450_4337 295
483 3300048918 Ga0496115_0060534 Ga0496115_0060534_1927_2814 295
484 3300048918 Ga0496115_0062146 Ga0496115_0062146_1737_2624 295
485 3300048918 Ga0496115_0288731 Ga0496115_0288731_152_1039 295
486 3300048920 Ga0496117_0001837 Ga0496117_0001837_13787_14674 295
487 3300048922 Ga0496119_0000597 Ga0496119_0000597_18846_19733 295
488 3300048922 Ga0496119_0009875 Ga0496119_0009875_1125_2015 295
489 3300048925 Ga0496122_0000464 Ga0496122_0000464_15965_16852 295
490 3300048925 Ga0496122_0001337 Ga0496122_0001337_18131_19018 295
491 3300048926 Ga0496123_0000147 Ga0496123_0000147_7889_8776 295
492 3300048926 Ga0496123_0001933 Ga0496123_0001933_7940_8827 295
493 3300048927 Ga0496124_0001975 Ga0496124_0001975_19459_20346 295
494 3300048928 Ga0496125_0003542 Ga0496125_0003542_11251_12138 295
495 3300048928 Ga0496125_0042303 Ga0496125_0042303_780_1670 295
496 3300048929 Ga0496126_0000601 Ga0496126_0000601_7464_8351 295
497 3300049570 Ga0501033_0085303 Ga0501033_0085303_800_1690 295
498 3300049571 Ga0501034_0046132 Ga0501034_0046132_1815_2702 295
499 3300049571 Ga0501034_0126770 Ga0501034_0126770_831_1721 295
500 3300049571 Ga0501034_0133499 Ga0501034_0133499_1373_2269 295
501 3300049573 Ga0501037_0134238 Ga0501037_0134238_242_1129 295
502 3300049574 Ga0501038_0071828 Ga0501038_0071828_291_1178 295
503 3300049579 Ga0501043_0162767 Ga0501043_0162767_674_1564 295
504 3300049823 Ga0501044_0000588 Ga0501044_0000588_39942_40829 295
505 3300049823 Ga0501044_0014696 Ga0501044_0014696_4574_5464 295
506 3300049823 Ga0501044_0174053 Ga0501044_0174053_452_1348 295
507 3300053104 Ga0500556_0000290 Ga0500556_0000290_1911_2798 295
508 3300053119 Ga0500595_011555 Ga0500595_011555_2121_3008 295
509 3300053131 Ga0500652_007639 Ga0500652_007639_1451_2338 295
510 3300053153 Ga0500616_0067490 Ga0500616_0067490_726_1616 295
511 3300053730 Ga0500645_022807 Ga0500645_022807_437_1324 295
512 3300002739 JGI25158J39367_1002269 JGI25158J39367_10022692 296
513 3300002741 JGI25157J39369_1000755 JGI25157J39369_10007552 296
514 3300002987 JGI25159J45721_1000004 JGI25159J45721_1000004144 296
515 3300002987 JGI25159J45721_1000877 JGI25159J45721_10008778 296
516 3300003187 JGI25151J46595_10031663 JGI25151J46595_100316631 296
517 3300003203 JGI25406J46586_10043244 JGI25406J46586_100432441 296
518 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001476 296
519 3300003354 JGI25160J50197_1000021 JGI25160J50197_100002166 296
520 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001281 296
521 3300003374 JGI25161J50226_1000218 JGI25161J50226_100021815 296
522 3300003763 Ga0055529_1007706 Ga0055529_10077061 296
523 3300003771 Ga0055526_1001649 Ga0055526_10016492 296
524 3300003771 Ga0055526_1008803 Ga0055526_10088032 296
525 3300003775 Ga0055524_1002001 Ga0055524_100200111 296
526 3300003775 Ga0055524_1012328 Ga0055524_10123283 296
527 3300003781 Ga0055536_1000269 Ga0055536_100026913 296
528 3300003791 Ga0055530_10007403 Ga0055530_100074033 296
529 3300003792 Ga0055540_1028635 Ga0055540_10286351 296
530 3300003794 Ga0055531_10045958 Ga0055531_100459581 296
531 3300004625 Ga0055543_1000003 Ga0055543_1000003297 296
532 3300004625 Ga0055543_1000164 Ga0055543_10001648 296
533 3300004803 Ga0058862_12092097 Ga0058862_120920971 296
534 3300005262 Ga0065165_1000033 Ga0065165_100003366 296
535 3300005327 Ga0070658_10003684 Ga0070658_100036844 296
536 3300005327 Ga0070658_10062316 Ga0070658_100623162 296
537 3300005336 Ga0070680_100114357 Ga0070680_1001143573 296
538 3300005337 Ga0070682_100133534 Ga0070682_1001335342 296
539 3300005339 Ga0070660_100045115 Ga0070660_1000451152 296
540 3300005339 Ga0070660_100082638 Ga0070660_1000826381 296
541 3300005341 Ga0070691_10003400 Ga0070691_100034009 296
542 3300005356 Ga0070674_100154839 Ga0070674_1001548392 296
543 3300005366 Ga0070659_100036819 Ga0070659_1000368194 296
544 3300005458 Ga0070681_10081574 Ga0070681_100815742 296
545 3300005459 Ga0068867_100089377 Ga0068867_1000893772 296
546 3300005539 Ga0068853_100013522 Ga0068853_1000135222 296
547 3300005539 Ga0068853_100253604 Ga0068853_1002536042 296
548 3300005548 Ga0070665_100259649 Ga0070665_1002596492 296
549 3300005563 Ga0068855_100013981 Ga0068855_1000139815 296
550 3300005577 Ga0068857_100082668 Ga0068857_1000826684 296
551 3300005578 Ga0068854_100178894 Ga0068854_1001788942 296
552 3300005616 Ga0068852_100026482 Ga0068852_1000264828 296
553 3300005937 Ga0081455_10238712 Ga0081455_102387122 296
554 3300005983 Ga0081540_1033222 Ga0081540_10332223 296
555 3300005985 Ga0081539_10000991 Ga0081539_1000099110 296
556 3300006038 Ga0075365_10005021 Ga0075365_100050215 296
557 3300006038 Ga0075365_10023064 Ga0075365_100230644 296
558 3300006038 Ga0075365_10027527 Ga0075365_100275275 296
559 3300006038 Ga0075365_10050322 Ga0075365_100503224 296
560 3300006038 Ga0075365_10065433 Ga0075365_100654333 296
561 3300006042 Ga0075368_10084191 Ga0075368_100841911 296
562 3300006051 Ga0075364_10025915 Ga0075364_100259153 296
563 3300006051 Ga0075364_10037873 Ga0075364_100378733 296
564 3300006177 Ga0075362_10028402 Ga0075362_100284023 296
565 3300006178 Ga0075367_10000307 Ga0075367_100003078 296
566 3300006195 Ga0075366_10162675 Ga0075366_101626751 296
567 3300006353 Ga0075370_10017438 Ga0075370_100174386 296
568 3300006353 Ga0075370_10135090 Ga0075370_101350902 296
569 3300009093 Ga0105240_10078667 Ga0105240_100786672 296
570 3300009093 Ga0105240_10207364 Ga0105240_102073642 296
571 3300009093 Ga0105240_10608489 Ga0105240_106084891 296
572 3300009545 Ga0105237_10306985 Ga0105237_103069851 296
573 3300009551 Ga0105238_10012189 Ga0105238_100121895 296
574 3300009551 Ga0105238_10094938 Ga0105238_100949382 296
575 3300010375 Ga0105239_10202768 Ga0105239_102027682 296
576 3300010375 Ga0105239_10501933 Ga0105239_105019331 296
577 3300013100 Ga0157373_10032787 Ga0157373_100327874 296
578 3300013102 Ga0157371_10119488 Ga0157371_101194881 296
579 3300013104 Ga0157370_10005189 Ga0157370_100051897 296
580 3300013104 Ga0157370_10135644 Ga0157370_101356441 296
581 3300013105 Ga0157369_10047367 Ga0157369_100473671 296
582 3300013105 Ga0157369_10576446 Ga0157369_105764462 296
583 3300013249 Ga0171463_1017 Ga0171463_101723 296
584 3300013307 Ga0157372_10039780 Ga0157372_100397806 296
585 3300013307 Ga0157372_10417303 Ga0157372_104173031 296
586 3300014968 Ga0157379_10003397 Ga0157379_100033978 296
587 3300015261 Ga0182006_1017059 Ga0182006_10170591 296
588 3300015262 Ga0182007_10036984 Ga0182007_100369842 296
589 3300015690 Ga0183363_1050 Ga0183363_105014 296
590 3300017792 Ga0163161_10327398 Ga0163161_103273981 296
591 3300025208 Ga0209436_100276 Ga0209436_10027612 296
592 3300025208 Ga0209436_105791 Ga0209436_1057913 296
593 3300025245 Ga0207425_1020966 Ga0207425_10209662 296
594 3300025250 Ga0209026_1000089 Ga0209026_1000089107 296
595 3300025254 Ga0209148_1000124 Ga0209148_1000124145 296
596 3300025256 Ga0209759_1000903 Ga0209759_100090321 296
597 3300025261 Ga0209233_1000010 Ga0209233_1000010886 296
598 3300025272 Ga0209455_1000062 Ga0209455_1000062106 296
599 3300025284 Ga0209130_1000003 Ga0209130_1000003298 296
600 3300025284 Ga0209130_1000017 Ga0209130_1000017315 296
601 3300025292 Ga0209676_1000876 Ga0209676_100087628 296
602 3300025294 Ga0209025_1000161 Ga0209025_1000161141 296
603 3300025295 Ga0209564_1000013 Ga0209564_1000013763 296
604 3300025297 Ga0209758_1023159 Ga0209758_10231592 296
605 3300025298 Ga0209050_1006499 Ga0209050_10064992 296
606 3300025299 Ga0209256_1000153 Ga0209256_10001537 296
607 3300025299 Ga0209256_1002058 Ga0209256_10020585 296
608 3300025302 Ga0207426_1000006 Ga0207426_1000006314 296
609 3300025302 Ga0207426_1000011 Ga0207426_1000011477 296
610 3300025303 Ga0209051_1003752 Ga0209051_10037524 296
611 3300025904 Ga0207647_10046819 Ga0207647_100468193 296
612 3300025909 Ga0207705_10000364 Ga0207705_100003648 296
613 3300025909 Ga0207705_10075867 Ga0207705_100758673 296
614 3300025911 Ga0207654_10121712 Ga0207654_101217122 296
615 3300025912 Ga0207707_10001430 Ga0207707_100014309 296
616 3300025913 Ga0207695_10119740 Ga0207695_101197403 296
617 3300025913 Ga0207695_10223077 Ga0207695_102230772 296
618 3300025914 Ga0207671_10020709 Ga0207671_100207095 296
619 3300025917 Ga0207660_10003724 Ga0207660_100037249 296
620 3300025919 Ga0207657_10000762 Ga0207657_1000076219 296
621 3300025919 Ga0207657_10052274 Ga0207657_100522743 296
622 3300025921 Ga0207652_10002976 Ga0207652_100029764 296
623 3300025924 Ga0207694_10010487 Ga0207694_100104877 296
624 3300025932 Ga0207690_10048947 Ga0207690_100489474 296
625 3300025937 Ga0207669_10040766 Ga0207669_100407662 296
626 3300025937 Ga0207669_10190603 Ga0207669_101906031 296
627 3300025949 Ga0207667_10187878 Ga0207667_101878783 296
628 3300025949 Ga0207667_10254975 Ga0207667_102549753 296
629 3300025981 Ga0207640_10209220 Ga0207640_102092201 296
630 3300026041 Ga0207639_10048569 Ga0207639_100485694 296
631 3300026067 Ga0207678_10409154 Ga0207678_104091541 296
632 3300026116 Ga0207674_10044684 Ga0207674_100446846 296
633 3300026116 Ga0207674_10240224 Ga0207674_102402241 296
634 3300026121 Ga0207683_10196277 Ga0207683_101962772 296
635 3300027866 Ga0209813_10050583 Ga0209813_100505831 296
636 3300028379 Ga0268266_10030466 Ga0268266_100304666 296
637 3300028794 Ga0307515_10000017 Ga0307515_1000001720 296
638 3300031239 Ga0265328_10006035 Ga0265328_100060353 296
639 3300031251 Ga0265327_10027230 Ga0265327_100272302 296
640 3300031344 Ga0265316_10014590 Ga0265316_100145907 296
641 3300031456 Ga0307513_10002030 Ga0307513_1000203020 296
642 3300031548 Ga0307408_100123653 Ga0307408_1001236532 296
643 3300037418 Ga0395900_0000318 Ga0395900_0000318_51974_52900 296
644 3300037418 Ga0395900_0177761 Ga0395900_0177761_1137_2030 296
645 3300037418 Ga0395900_0586506 Ga0395900_0586506_123_1016 296
646 3300037466 Ga0395898_0000547 Ga0395898_0000547_18423_19349 296
647 3300037466 Ga0395898_0048465 Ga0395898_0048465_2311_3204 296
648 3300037471 Ga0395905_0000305 Ga0395905_0000305_51974_52900 296
649 3300037471 Ga0395905_0040245 Ga0395905_0040245_1989_2882 296
650 3300037471 Ga0395905_0046561 Ga0395905_0046561_2363_3256 296
651 3300037471 Ga0395905_0103674 Ga0395905_0103674_785_1678 296
652 3300038443 Ga0395901_0000093 Ga0395901_0000093_18404_19330 296
653 3300038443 Ga0395901_0027220 Ga0395901_0027220_4053_4946 296
654 3300038443 Ga0395901_0118786 Ga0395901_0118786_1668_2561 296
655 3300038443 Ga0395901_0140178 Ga0395901_0140178_711_1604 296
656 3300038443 Ga0395901_0175338 Ga0395901_0175338_900_1793 296
657 3300038443 Ga0395901_0393133 Ga0395901_0393133_465_1358 296
658 3300038735 Ga0400485_05700 Ga0400485_05700_261_1160 296
659 3300041404 Ga0439436_0000675 Ga0439436_0000675_1316_2206 296
660 3300041405 Ga0439438_019223 Ga0439438_019223_348_1238 296
661 3300041405 Ga0439438_025738 Ga0439438_025738_259_1149 296
662 3300041407 Ga0439447_009157 Ga0439447_009157_319_1209 296
663 3300041411 Ga0439466_0053595 Ga0439466_0053595_351_1241 296
664 3300041413 Ga0439465_0003165 Ga0439465_0003165_4273_5190 296
665 3300041413 Ga0439465_0020602 Ga0439465_0020602_489_1382 296
666 3300042007 Ga0439449_0020546 Ga0439449_0020546_712_1629 296
667 3300042013 Ga0439456_011381 Ga0439456_011381_789_1697 296
668 3300042145 Ga0450906_000779 Ga0450906_000779_2701_3591 296
669 3300042435 Ga0439434_0015284 Ga0439434_0015284_275_1165 296
670 3300044901 Ga0466960_0003996 Ga0466960_0003996_3454_4347 296
671 3300046460 Ga0495638_0000679 Ga0495638_0000679_25326_26219 296
672 3300046460 Ga0495638_0033393 Ga0495638_0033393_303_1196 296
673 3300046474 Ga0495605_0001576 Ga0495605_0001576_5558_6451 296
674 3300046476 Ga0495662_0005789 Ga0495662_0005789_3530_4423 296
675 3300046492 Ga0495585_0011315 Ga0495585_0011315_3670_4563 296
676 3300046506 Ga0495583_0055184 Ga0495583_0055184_816_1709 296
677 3300046507 Ga0495606_0001738 Ga0495606_0001738_87_980 296
678 3300046507 Ga0495606_0175510 Ga0495606_0175510_47_940 296
679 3300046512 Ga0495610_0108185 Ga0495610_0108185_37_930 296
680 3300046512 Ga0495610_0108302 Ga0495610_0108302_214_1164 296
681 3300046513 Ga0495616_0020450 Ga0495616_0020450_1211_2104 296
682 3300046515 Ga0495620_0067235 Ga0495620_0067235_253_1203 296
683 3300046518 Ga0495631_0000730 Ga0495631_0000730_10555_11448 296
684 3300046519 Ga0495632_0013426 Ga0495632_0013426_2305_3198 296
685 3300046522 Ga0495643_0010833 Ga0495643_0010833_1700_2593 296
686 3300046522 Ga0495643_0060060 Ga0495643_0060060_422_1315 296
687 3300046536 Ga0495587_0084674 Ga0495587_0084674_392_1285 296
688 3300046538 Ga0495609_0011369 Ga0495609_0011369_1201_2094 296
689 3300046542 Ga0495597_0140982 Ga0495597_0140982_49_942 296
690 3300046616 Ga0495668_0008861 Ga0495668_0008861_3212_4105 296
691 3300046648 Ga0495611_0013690 Ga0495611_0013690_854_1747 296
692 3300046660 Ga0495625_0002939 Ga0495625_0002939_10862_11755 296
693 3300046660 Ga0495625_0087967 Ga0495625_0087967_220_1113 296
694 3300046660 Ga0495625_0240197 Ga0495625_0240197_147_1067 296
695 3300046674 Ga0495588_0004788 Ga0495588_0004788_2606_3499 296
696 3300046674 Ga0495588_0139954 Ga0495588_0139954_343_1233 296
697 3300046675 Ga0495657_0027610 Ga0495657_0027610_2295_3188 296
698 3300046694 Ga0495649_0143104 Ga0495649_0143104_176_1066 296
699 3300046809 Ga0495600_0039364 Ga0495600_0039364_482_1375 296
700 3300047317 Ga0495604_0009407 Ga0495604_0009407_2378_3271 296
701 3300047320 Ga0495672_0008168 Ga0495672_0008168_5449_6342 296
702 3300047443 Ga0495687_059507 Ga0495687_059507_378_1271 296
703 3300047472 Ga0495686_0002387 Ga0495686_0002387_11411_12355 296
704 3300048091 Ga0495626_0046945 Ga0495626_0046945_130_1023 296
705 3300048904 Ga0496101_0379156 Ga0496101_0379156_196_1089 296
706 3300048917 Ga0496114_0337304 Ga0496114_0337304_140_1033 296
707 3300048918 Ga0496115_0191444 Ga0496115_0191444_724_1617 296
708 3300048922 Ga0496119_0067815 Ga0496119_0067815_347_1240 296
709 3300048922 Ga0496119_0084268 Ga0496119_0084268_319_1269 296
710 3300048923 Ga0496120_0004279 Ga0496120_0004279_5528_6421 296
711 3300048923 Ga0496120_0046021 Ga0496120_0046021_837_1730 296
712 3300048924 Ga0496121_0014899 Ga0496121_0014899_3272_4165 296
713 3300048924 Ga0496121_0093552 Ga0496121_0093552_861_1820 296
714 3300048924 Ga0496121_0099702 Ga0496121_0099702_378_1328 296
715 3300048928 Ga0496125_0042682 Ga0496125_0042682_2719_3609 296
716 3300048928 Ga0496125_0057957 Ga0496125_0057957_537_1430 296
717 3300048929 Ga0496126_0000159 Ga0496126_0000159_18449_19357 296
718 3300048929 Ga0496126_0040671 Ga0496126_0040671_1347_2240 296
719 3300048929 Ga0496126_0372352 Ga0496126_0372352_204_1097 296
720 3300049459 Ga0495678_007759 Ga0495678_007759_2379_3272 296
721 3300049568 Ga0501031_0037769 Ga0501031_0037769_2124_3116 296
722 3300049568 Ga0501031_0040544 Ga0501031_0040544_1260_2153 296
723 3300049568 Ga0501031_0158152 Ga0501031_0158152_13_906 296
724 3300049569 Ga0501032_0000024 Ga0501032_0000024_85962_86855 296
725 3300049569 Ga0501032_0025428 Ga0501032_0025428_2195_3199 296
726 3300049569 Ga0501032_0059597 Ga0501032_0059597_1449_2345 296
727 3300049570 Ga0501033_0000391 Ga0501033_0000391_39968_40861 296
728 3300049570 Ga0501033_0000761 Ga0501033_0000761_9941_10945 296
729 3300049570 Ga0501033_0026641 Ga0501033_0026641_3079_3969 296
730 3300049570 Ga0501033_0170294 Ga0501033_0170294_618_1511 296
731 3300049570 Ga0501033_0293658 Ga0501033_0293658_209_1114 296
732 3300049571 Ga0501034_0000140 Ga0501034_0000140_35820_36713 296
733 3300049571 Ga0501034_0001662 Ga0501034_0001662_9343_10236 296
734 3300049571 Ga0501034_0012775 Ga0501034_0012775_7211_8104 296
735 3300049571 Ga0501034_0032089 Ga0501034_0032089_1153_2043 296
736 3300049571 Ga0501034_0110748 Ga0501034_0110748_1809_2702 296
737 3300049571 Ga0501034_0321635 Ga0501034_0321635_80_973 296
738 3300049572 Ga0501036_0000443 Ga0501036_0000443_27412_28305 296
739 3300049573 Ga0501037_0000024 Ga0501037_0000024_117750_118643 296
740 3300049573 Ga0501037_0000818 Ga0501037_0000818_566_1570 296
741 3300049573 Ga0501037_0107988 Ga0501037_0107988_130_1038 296
742 3300049573 Ga0501037_0192105 Ga0501037_0192105_506_1402 296
743 3300049574 Ga0501038_0000064 Ga0501038_0000064_85871_86764 296
744 3300049574 Ga0501038_0035848 Ga0501038_0035848_2616_3509 296
745 3300049574 Ga0501038_0114276 Ga0501038_0114276_1262_2158 296
746 3300049574 Ga0501038_0199300 Ga0501038_0199300_254_1162 296
747 3300049575 Ga0501039_0000017 Ga0501039_0000017_85777_86670 296
748 3300049575 Ga0501039_0102757 Ga0501039_0102757_1210_2103 296
749 3300049579 Ga0501043_0000050 Ga0501043_0000050_85871_86764 296
750 3300049579 Ga0501043_0000124 Ga0501043_0000124_48255_49259 296
751 3300049579 Ga0501043_0045975 Ga0501043_0045975_1243_2136 296
752 3300049581 Ga0501047_0130263 Ga0501047_0130263_1476_2366 296
753 3300049584 Ga0501068_0164490 Ga0501068_0164490_74_988 296
754 3300049585 Ga0501069_0000004 Ga0501069_0000004_166359_167363 296
755 3300049585 Ga0501069_0029583 Ga0501069_0029583_1574_2488 296
756 3300049585 Ga0501069_0041303 Ga0501069_0041303_198_1094 296
757 3300049585 Ga0501069_0191142 Ga0501069_0191142_192_1085 296
758 3300049586 Ga0501070_0000031 Ga0501070_0000031_131843_132751 296
759 3300049586 Ga0501070_0000148 Ga0501070_0000148_54099_55103 296
760 3300049586 Ga0501070_0000694 Ga0501070_0000694_6992_7885 296
761 3300049586 Ga0501070_0001919 Ga0501070_0001919_13010_13906 296
762 3300049586 Ga0501070_0052822 Ga0501070_0052822_1256_2149 296
763 3300049589 Ga0501073_0031453 Ga0501073_0031453_2658_3662 296
764 3300049589 Ga0501073_0112523 Ga0501073_0112523_121_1014 296
765 3300049590 Ga0501074_0000006 Ga0501074_0000006_63886_64890 296
766 3300049590 Ga0501074_0020074 Ga0501074_0020074_57_950 296
767 3300049590 Ga0501074_0098200 Ga0501074_0098200_484_1398 296
768 3300049590 Ga0501074_0230576 Ga0501074_0230576_60_1100 296
769 3300049590 Ga0501074_0243704 Ga0501074_0243704_186_1082 296
770 3300049742 Ga0501080_0000693 Ga0501080_0000693_12871_13779 296
771 3300049742 Ga0501080_0003339 Ga0501080_0003339_5800_6693 296
772 3300049742 Ga0501080_0005406 Ga0501080_0005406_615_1619 296
773 3300049742 Ga0501080_0132306 Ga0501080_0132306_462_1376 296
774 3300049742 Ga0501080_0148412 Ga0501080_0148412_264_1160 296
775 3300049742 Ga0501080_0388074 Ga0501080_0388074_248_1144 296
776 3300049744 Ga0501083_0000066 Ga0501083_0000066_9755_10759 296
777 3300049770 Ga0501273_014424 Ga0501273_014424_49_939 296
778 3300049822 Ga0501035_0000011 Ga0501035_0000011_235756_236760 296
779 3300049822 Ga0501035_0000021 Ga0501035_0000021_122428_123321 296
780 3300049822 Ga0501035_0000593 Ga0501035_0000593_28670_29578 296
781 3300049822 Ga0501035_0001755 Ga0501035_0001755_17800_18696 296
782 3300049822 Ga0501035_0003715 Ga0501035_0003715_4385_5281 296
783 3300049822 Ga0501035_0005312 Ga0501035_0005312_5295_6188 296
784 3300049822 Ga0501035_0006966 Ga0501035_0006966_5706_6599 296
785 3300049822 Ga0501035_0087852 Ga0501035_0087852_328_1218 296
786 3300049822 Ga0501035_0176204 Ga0501035_0176204_47_940 296
787 3300049822 Ga0501035_0258932 Ga0501035_0258932_114_1022 296
788 3300049823 Ga0501044_0000803 Ga0501044_0000803_9772_10776 296
789 3300049823 Ga0501044_0002607 Ga0501044_0002607_8996_9886 296
790 3300049823 Ga0501044_0006574 Ga0501044_0006574_1182_2075 296
791 3300049823 Ga0501044_0012369 Ga0501044_0012369_1440_2333 296
792 3300049823 Ga0501044_0051016 Ga0501044_0051016_478_1374 296
793 3300049823 Ga0501044_0064037 Ga0501044_0064037_488_1396 296
794 3300049823 Ga0501044_0083723 Ga0501044_0083723_2281_3174 296
795 3300049823 Ga0501044_0180460 Ga0501044_0180460_1105_1998 296
796 3300049823 Ga0501044_0184173 Ga0501044_0184173_594_1553 296
797 3300049823 Ga0501044_0217547 Ga0501044_0217547_164_1057 296
798 3300049823 Ga0501044_0297099 Ga0501044_0297099_209_1099 296
799 3300049823 Ga0501044_0365018 Ga0501044_0365018_50_958 296
800 3300050489 nmdc:mga03683_19775_c1 nmdc:mga03683_19775_c1_486_1379 296
801 3300050491 nmdc:mga00v17_10499_c1 nmdc:mga00v17_10499_c1_2811_3704 296
802 3300050492 nmdc:mga0yw44_16779_c1 nmdc:mga0yw44_16779_c1_67_960 296
803 3300050496 nmdc:mga07m45_12959_c1 nmdc:mga07m45_12959_c1_2734_3627 296
804 3300050496 nmdc:mga07m45_45525_c2 nmdc:mga07m45_45525_c2_313_1206 296
805 3300053079 Ga0500610_0001958 Ga0500610_0001958_3660_4553 296
806 3300053087 Ga0500643_012026 Ga0500643_012026_1703_2788 296
807 3300053087 Ga0500643_015186 Ga0500643_015186_564_1457 296
808 3300053105 Ga0500557_000475 Ga0500557_000475_2832_3725 296
809 3300053118 Ga0500594_0003391 Ga0500594_0003391_454_1347 296
810 3300053139 Ga0500568_0000353 Ga0500568_0000353_33277_34170 296
811 3300053139 Ga0500568_0000963 Ga0500568_0000963_6718_7611 296
812 3300053153 Ga0500616_0000577 Ga0500616_0000577_32862_33755 296
813 3300053153 Ga0500616_0024660 Ga0500616_0024660_471_1367 296
814 3300053153 Ga0500616_0097589 Ga0500616_0097589_339_1235 296
815 3300053155 Ga0500620_002422 Ga0500620_002422_826_1719 296
816 3300054114 Ga0501084_0175458 Ga0501084_0175458_95_988 296
817 3300059503 Ga0587080_020673 Ga0587080_020673_174_1067 296
818 3300059605 Ga0587106_009420 Ga0587106_009420_180_1073 296
819 3300060353 Ga0501082_0136418 Ga0501082_0136418_565_1605 296
820 3300060353 Ga0501082_0204825 Ga0501082_0204825_82_1086 296
821 3300061734 Ga0530510_0020554 Ga0530510_0020554_211_1251 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

103

330

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wrv-assembly1.cif.gz_B crystal structure of t.th.hb8 branched-chain amino acid aminotransferase 0.9711 10 288
4whx-assembly1.cif.gz_E x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate 0.9685 5 288
3u0g-assembly4.cif.gz_E crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei 0.9618 5 288
6nst-assembly1.cif.gz_B crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9601 5 289
5e25-assembly2.cif.gz_B-2 crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate 0.9585 10 288
ID Description Score Start End Superfamily
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9771 139 288 3.20.10.10
6h65B02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9587 138 287 3.20.10.10
6gkrB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9561 138 288 3.20.10.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9551 11 126 3.30.470.10
5mr0A02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9537 138 287 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A3B9DK24-F1-model_v4 deleted 0.9911 110 288
AF-A0A7C9GEA6-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.989 1 295 GO:0004084
GO:0005829
GO:0009097
GO:0009098
GO:0009099
AF-A0A6L6WVE5-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9852 1 291 GO:0004084
GO:0005829
GO:0009097
GO:0009098
GO:0009099
AF-C4WFD8-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.985 1 296 GO:0008168
GO:0009097
GO:0009098
GO:0009099
GO:0032259
GO:0052655
GO:0052656
AF-F7XVU9-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9828 5 288 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656

Feature Viewer

pLDDT pTM Quality
92.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map