F482253

General Info

Members Datasets Scaffolds Average Seq Length
821 337 1642 56

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10733696|Ga0105241_107336961
Length 60
Sequence MKPATDYIRHAARLARKLQMDAAMGTPTPPDAEFYKTLSKALDEIAAGLEQVAARDALPT

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
199 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
200 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
258 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
259 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
260 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
261 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
262 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
286 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
287 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
288 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
289 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
290 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
291 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
292 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
293 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
294 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
295 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
296 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
297 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
298 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
299 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
300 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
301 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
302 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
305 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
311 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
312 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
313 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
314 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
315 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
316 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
317 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
318 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.77
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 35.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10733696 3300009174 Bacteria 904
2 MBSR1b_contig_10799852 2162886012 Bacteria 1247
3 rootL2_10126547 3300003322 Unclassified 1741
4 Ga0065715_10303158 3300005293 Bacteria 1036
5 Ga0065715_10607325 3300005293 Bacteria 704
6 Ga0065707_10167551 3300005295 Unclassified 1510
7 Ga0065707_10282508 3300005295 Bacteria 1044
8 Ga0070676_10379568 3300005328 Unclassified 978
9 Ga0070683_100139425 3300005329 Bacteria 2297
10 Ga0070683_100461097 3300005329 Archaea 1213
11 Ga0070683_102198075 3300005329 Unclassified 530
12 Ga0070690_100104302 3300005330 Bacteria 1883
13 Ga0070690_100508907 3300005330 Unclassified 902
14 Ga0070670_100467440 3300005331 Unclassified 1119
15 Ga0070677_10036338 3300005333 Bacteria 1916
16 Ga0070677_10048686 3300005333 Bacteria 1704
17 Ga0070677_10647278 3300005333 Unclassified 590
18 Ga0068869_102088468 3300005334 Unclassified 509
19 Ga0068869_102137679 3300005334 Bacteria 503
20 Ga0070680_100074875 3300005336 Bacteria 2786
21 Ga0070680_100518244 3300005336 Bacteria 1021
22 Ga0070680_101061743 3300005336 Unclassified 700
23 Ga0070682_100576426 3300005337 Bacteria 885
24 Ga0068868_102238933 3300005338 Unclassified 521
25 Ga0070660_101360025 3300005339 Bacteria 603
26 Ga0070691_10119055 3300005341 Bacteria 1328
27 Ga0070691_10299822 3300005341 Unclassified 878
28 Ga0070661_100083365 3300005344 Bacteria 2361
29 Ga0070661_101189626 3300005344 Bacteria 637
30 Ga0070692_10147345 3300005345 Bacteria 1338
31 Ga0070668_102051259 3300005347 Unclassified 528
32 Ga0070669_100810155 3300005353 Bacteria 796
33 Ga0070675_100139713 3300005354 Unclassified 2070
34 Ga0070675_100319169 3300005354 Bacteria 1372
35 Ga0070675_100834958 3300005354 Unclassified 843
36 Ga0070671_100002000 3300005355 Bacteria 15651
37 Ga0070674_100430496 3300005356 Bacteria 1085
38 Ga0070674_101466482 3300005356 Unclassified 612
39 Ga0070673_100262282 3300005364 Bacteria 1510
40 Ga0070688_100302659 3300005365 Bacteria 1156
41 Ga0070659_100021582 3300005366 Bacteria 4906
42 Ga0070659_100648609 3300005366 Bacteria 910
43 Ga0070667_101794937 3300005367 Bacteria 577
44 Ga0070703_10207784 3300005406 Unclassified 772
45 Ga0070703_10447000 3300005406 Unclassified 572
46 Ga0070709_10257722 3300005434 Bacteria 1259
47 Ga0070709_11173882 3300005434 Bacteria 616
48 Ga0070713_101166380 3300005436 Unclassified 745
49 Ga0070713_101901039 3300005436 Bacteria 577
50 Ga0070710_10371277 3300005437 Bacteria 952
51 Ga0070701_10674958 3300005438 Unclassified 692
52 Ga0070711_100000946 3300005439 Bacteria 15359
53 Ga0070711_100018953 3300005439 Bacteria 4404
54 Ga0070711_100525816 3300005439 Unclassified 978
55 Ga0070711_101168432 3300005439 Bacteria 665
56 Ga0070705_100096969 3300005440 Unclassified 1852
57 Ga0070705_100315068 3300005440 Bacteria 1127
58 Ga0070705_100615722 3300005440 Unclassified 842
59 Ga0070705_100646784 3300005440 Bacteria 824
60 Ga0070700_100479308 3300005441 Unclassified 953
61 Ga0070700_100498419 3300005441 Bacteria 936
62 Ga0070700_101327386 3300005441 Unclassified 605
63 Ga0070700_101688596 3300005441 Bacteria 543
64 Ga0070694_100008730 3300005444 Bacteria 6207
65 Ga0070694_100053528 3300005444 Bacteria 2732
66 Ga0070694_100475841 3300005444 Bacteria 990
67 Ga0070694_101202468 3300005444 Bacteria 635
68 Ga0070708_100001169 3300005445 Bacteria 20215
69 Ga0070708_100042398 3300005445 Bacteria 3995
70 Ga0070708_100655411 3300005445 Bacteria 989
71 Ga0070708_100955988 3300005445 Unclassified 804
72 Ga0070663_100326129 3300005455 Bacteria 1236
73 Ga0070663_100481447 3300005455 Unclassified 1028
74 Ga0070663_101402560 3300005455 Bacteria 619
75 Ga0070678_101443636 3300005456 Bacteria 643
76 Ga0070662_100144496 3300005457 Bacteria 1847
77 Ga0070681_10036835 3300005458 Bacteria 4911
78 Ga0070681_10269462 3300005458 Bacteria 1614
79 Ga0070681_12052801 3300005458 Unclassified 500
80 Ga0068867_100149081 3300005459 Bacteria 1836
81 Ga0068867_100941532 3300005459 Archaea 780
82 Ga0070685_10291147 3300005466 Bacteria 1097
83 Ga0070685_11578788 3300005466 Unclassified 507
84 Ga0070706_100040313 3300005467 Bacteria 4311
85 Ga0070706_100185150 3300005467 Unclassified 1946
86 Ga0070706_100624338 3300005467 Unclassified 1001
87 Ga0070707_100679150 3300005468 Unclassified 992
88 Ga0070707_101024816 3300005468 Bacteria 791
89 Ga0070707_102152627 3300005468 Unclassified 525
90 Ga0070698_100316986 3300005471 Bacteria 1490
91 Ga0070698_100843349 3300005471 Unclassified 861
92 Ga0070698_101035686 3300005471 Unclassified 768
93 Ga0070698_102030468 3300005471 Unclassified 528
94 Ga0070699_100067838 3300005518 Plasmid 3097
95 Ga0070699_100453140 3300005518 Bacteria 1163
96 Ga0070699_100944451 3300005518 Bacteria 790
97 Ga0070699_101070748 3300005518 Bacteria 740
98 Ga0070679_100098788 3300005530 Bacteria 2907
99 Ga0070679_102120442 3300005530 Unclassified 512
100 Ga0070684_100684250 3300005535 Bacteria 956
101 Ga0070684_101437323 3300005535 Bacteria 650
102 Ga0070684_101843037 3300005535 Unclassified 571
103 Ga0070697_100010580 3300005536 Bacteria 7203
104 Ga0070697_100035778 3300005536 Bacteria 4008
105 Ga0070697_100236343 3300005536 Archaea 1560
106 Ga0070697_100570532 3300005536 Bacteria 993
107 Ga0070697_100582133 3300005536 Unclassified 983
108 Ga0070697_100636343 3300005536 Bacteria 939
109 Ga0070697_100654060 3300005536 Bacteria 926
110 Ga0068853_102134555 3300005539 Bacteria 543
111 Ga0070672_100264098 3300005543 Bacteria 1452
112 Ga0070672_100308125 3300005543 Unclassified 1343
113 Ga0070686_100063275 3300005544 Unclassified 2396
114 Ga0070695_100018051 3300005545 Bacteria 4283
115 Ga0070695_100038201 3300005545 Bacteria 3028
116 Ga0070695_100628160 3300005545 Unclassified 846
117 Ga0070696_100000833 3300005546 Bacteria 19880
118 Ga0070696_100212023 3300005546 Unclassified 1450
119 Ga0070696_100377663 3300005546 Unclassified 1104
120 Ga0070696_101284864 3300005546 Bacteria 621
121 Ga0070693_100208262 3300005547 Bacteria 1274
122 Ga0070693_100587692 3300005547 Unclassified 802
123 Ga0070693_100652929 3300005547 Bacteria 765
124 Ga0070704_100002387 3300005549 Bacteria 10539
125 Ga0070704_100132610 3300005549 Unclassified 1933
126 Ga0070704_100166488 3300005549 Unclassified 1748
127 Ga0070704_100318543 3300005549 Bacteria 1302
128 Ga0070664_100005951 3300005564 Bacteria 9854
129 Ga0070664_100006491 3300005564 Bacteria 9429
130 Ga0070664_100243875 3300005564 Bacteria 1613
131 Ga0068857_100291238 3300005577 Bacteria 1503
132 Ga0068857_101116244 3300005577 Unclassified 762
133 Ga0068854_101530710 3300005578 Bacteria 606
134 Ga0070702_100647134 3300005615 Unclassified 799
135 Ga0070702_100909717 3300005615 Unclassified 689
136 Ga0068852_101565219 3300005616 Unclassified 682
137 Ga0068859_100116976 3300005617 Bacteria 2731
138 Ga0068864_100019445 3300005618 Bacteria 5678
139 Ga0068864_100047655 3300005618 Bacteria 3682
140 Ga0068864_100735176 3300005618 Bacteria 966
141 Ga0068861_100244915 3300005719 Unclassified 1527
142 Ga0068861_102420302 3300005719 Unclassified 528
143 Ga0068858_101991817 3300005842 Unclassified 574
144 Ga0068860_101096234 3300005843 Unclassified 815
145 Ga0068862_101540014 3300005844 Unclassified 671
146 Ga0081455_10066837 3300005937 Bacteria 2999
147 Ga0081538_10136747 3300005981 Bacteria 1139
148 Ga0070715_10039502 3300006163 Unclassified 1966
149 Ga0070715_10354579 3300006163 Bacteria 802
150 Ga0070712_100197510 3300006175 Bacteria 1578
151 Ga0070712_100238761 3300006175 Bacteria 1447
152 Ga0070712_100411244 3300006175 Unclassified 1119
153 Ga0097621_100664938 3300006237 Unclassified 957
154 Ga0068871_100337589 3300006358 Unclassified 1330
155 Ga0075428_100011005 3300006844 Bacteria 10061
156 Ga0075428_100064427 3300006844 Bacteria 4014
157 Ga0075430_100072231 3300006846 Bacteria 2894
158 Ga0075430_100204707 3300006846 Unclassified 1638
159 Ga0075430_100395216 3300006846 Bacteria 1141
160 Ga0075430_101534282 3300006846 Unclassified 547
161 Ga0075431_100003213 3300006847 Bacteria 15816
162 Ga0075431_100277807 3300006847 Unclassified 1696
163 Ga0075431_100913703 3300006847 Unclassified 847
164 Ga0075433_10032494 3300006852 Bacteria 4470
165 Ga0075433_10090631 3300006852 Unclassified 2703
166 Ga0075433_10259733 3300006852 Bacteria 1540
167 Ga0075434_100012920 3300006871 Bacteria 7932
168 Ga0075434_100024907 3300006871 Bacteria 5851
169 Ga0075434_100026049 3300006871 Bacteria 5726
170 Ga0075434_100331178 3300006871 Unclassified 1543
171 Ga0075434_100674899 3300006871 Bacteria 1051
172 Ga0075429_100592496 3300006880 Unclassified 971
173 Ga0075436_100017353 3300006914 Bacteria 4927
174 Ga0075436_100237230 3300006914 Bacteria 1296
175 Ga0075436_100363174 3300006914 Bacteria 1045
176 Ga0097620_100116976 3300006931 Bacteria 2731
177 Ga0075435_100136518 3300007076 Bacteria 2055
178 Ga0075435_100895481 3300007076 Bacteria 774
179 Ga0111539_10190212 3300009094 Bacteria 2395
180 Ga0111539_10230831 3300009094 Bacteria 2155
181 Ga0111539_10627900 3300009094 Bacteria 1251
182 Ga0111539_10990659 3300009094 Unclassified 977
183 Ga0105245_10161079 3300009098 Bacteria 2129
184 Ga0105245_10778129 3300009098 Bacteria 994
185 Ga0114129_10002347 3300009147 Bacteria 26280
186 Ga0114129_10021905 3300009147 Bacteria 9070
187 Ga0114129_10235220 3300009147 Bacteria 2465
188 Ga0114129_10390418 3300009147 Bacteria 1836
189 Ga0114129_10537318 3300009147 Unclassified 1522
190 Ga0114129_10540076 3300009147 Bacteria 1517
191 Ga0114129_11816526 3300009147 Unclassified 741
192 Ga0114129_11890155 3300009147 Unclassified 724
193 Ga0114129_12146906 3300009147 Bacteria 673
194 Ga0114129_12262122 3300009147 Unclassified 653
195 Ga0105242_11938837 3300009176 Bacteria 630
196 Ga0105248_10004344 3300009177 Bacteria 15678
197 Ga0105248_10143379 3300009177 Bacteria 2695
198 Ga0105248_10194235 3300009177 Bacteria 2287
199 Ga0105248_10200063 3300009177 Bacteria 2251
200 Ga0105248_10500218 3300009177 Bacteria 1370
201 Ga0105248_10545637 3300009177 Bacteria 1308
202 Ga0105248_10888591 3300009177 Unclassified 1006
203 Ga0105237_10637349 3300009545 Bacteria 1073
204 Ga0105249_10101256 3300009553 Unclassified 2709
205 Ga0105249_10570548 3300009553 Bacteria 1184
206 Ga0105249_10814866 3300009553 Bacteria 998
207 Ga0105249_11563454 3300009553 Unclassified 732
208 Ga0105249_12183236 3300009553 Unclassified 626
209 Ga0105239_10004067 3300010375 Bacteria 17658
210 Ga0105239_11397407 3300010375 Unclassified 808
211 Ga0105246_10130105 3300011119 Bacteria 1879
212 Ga0105246_10661944 3300011119 Archaea 910
213 Ga0105246_11361901 3300011119 Unclassified 660
214 Ga0157373_10397495 3300013100 Bacteria 987
215 Ga0157373_10643577 3300013100 Unclassified 774
216 Ga0157378_11306559 3300013297 Unclassified 767
217 Ga0163162_10001791 3300013306 Bacteria 20158
218 Ga0163162_10166596 3300013306 Bacteria 2327
219 Ga0163162_13178098 3300013306 Unclassified 527
220 Ga0157375_11540433 3300013308 Bacteria 785
221 Ga0157375_11709829 3300013308 Unclassified 745
222 Ga0157375_11954099 3300013308 Unclassified 697
223 Ga0163163_10640913 3300014325 Bacteria 1126
224 Ga0163163_10846019 3300014325 Bacteria 978
225 Ga0163163_11182912 3300014325 Bacteria 827
226 Ga0157380_10559428 3300014326 Unclassified 1124
227 Ga0182008_10081419 3300014497 Unclassified 1593
228 Ga0157377_10319418 3300014745 Unclassified 1031
229 Ga0157379_10024076 3300014968 Bacteria 5403
230 Ga0157376_10210550 3300014969 Unclassified 1794
231 Ga0207682_10175324 3300025893 Bacteria 977
232 Ga0207692_10453070 3300025898 Unclassified 808
233 Ga0207692_10645249 3300025898 Bacteria 684
234 Ga0207642_10400268 3300025899 Unclassified 821
235 Ga0207688_10179843 3300025901 Unclassified 1261
236 Ga0207685_10127815 3300025905 Unclassified 1124
237 Ga0207699_10342596 3300025906 Bacteria 1053
238 Ga0207699_10492862 3300025906 Unclassified 884
239 Ga0207645_10474037 3300025907 Bacteria 846
240 Ga0207684_10003882 3300025910 Bacteria 14346
241 Ga0207684_10403860 3300025910 Unclassified 1174
242 Ga0207684_10434270 3300025910 Bacteria 1128
243 Ga0207684_10551863 3300025910 Archaea 986
244 Ga0207684_10553472 3300025910 Bacteria 984
245 Ga0207684_11312536 3300025910 Unclassified 595
246 Ga0207707_10016778 3300025912 Bacteria 6380
247 Ga0207693_10232650 3300025915 Bacteria 1447
248 Ga0207693_10361392 3300025915 Bacteria 1136
249 Ga0207663_10061534 3300025916 Bacteria 2383
250 Ga0207663_10276138 3300025916 Bacteria 1246
251 Ga0207663_11091276 3300025916 Unclassified 641
252 Ga0207663_11168249 3300025916 Bacteria 619
253 Ga0207660_11066492 3300025917 Bacteria 659
254 Ga0207662_10804679 3300025918 Bacteria 663
255 Ga0207657_10368166 3300025919 Bacteria 1132
256 Ga0207649_10229569 3300025920 Bacteria 1326
257 Ga0207649_10252933 3300025920 Bacteria 1270
258 Ga0207649_10718832 3300025920 Bacteria 775
259 Ga0207652_10323855 3300025921 Unclassified 1391
260 Ga0207652_10403542 3300025921 Unclassified 1233
261 Ga0207646_10022306 3300025922 Bacteria 5835
262 Ga0207646_10158210 3300025922 Bacteria 2044
263 Ga0207659_10302327 3300025926 Bacteria 1314
264 Ga0207659_10677963 3300025926 Bacteria 882
265 Ga0207687_10114251 3300025927 Bacteria 2009
266 Ga0207700_10986584 3300025928 Unclassified 754
267 Ga0207664_10416393 3300025929 Unclassified 1196
268 Ga0207644_10038523 3300025931 Bacteria 3368
269 Ga0207690_10014353 3300025932 Bacteria 4786
270 Ga0207690_10515455 3300025932 Bacteria 969
271 Ga0207706_10117546 3300025933 Bacteria 2338
272 Ga0207706_10386350 3300025933 Bacteria 1214
273 Ga0207706_10932257 3300025933 Bacteria 732
274 Ga0207669_10987255 3300025937 Unclassified 707
275 Ga0207691_10439395 3300025940 Bacteria 1111
276 Ga0207691_11717176 3300025940 Bacteria 508
277 Ga0207711_10038812 3300025941 Bacteria 4049
278 Ga0207711_10121341 3300025941 Unclassified 2334
279 Ga0207711_10466038 3300025941 Bacteria 1176
280 Ga0207711_10567490 3300025941 Unclassified 1059
281 Ga0207711_11269994 3300025941 Bacteria 678
282 Ga0207661_10076169 3300025944 Bacteria 2755
283 Ga0207679_10007026 3300025945 Bacteria 7135
284 Ga0207679_10040981 3300025945 Bacteria 3318
285 Ga0207679_10052311 3300025945 Bacteria 2995
286 Ga0207679_10168457 3300025945 Bacteria 1801
287 Ga0207679_11308579 3300025945 Bacteria 665
288 Ga0207679_11479387 3300025945 Unclassified 623
289 Ga0207651_11183339 3300025960 Unclassified 686
290 Ga0207712_10415155 3300025961 Bacteria 1134
291 Ga0207712_10867455 3300025961 Bacteria 796
292 Ga0207712_11643473 3300025961 Unclassified 576
293 Ga0207668_10064257 3300025972 Bacteria 2593
294 Ga0207668_10325161 3300025972 Unclassified 1277
295 Ga0207668_11178370 3300025972 Unclassified 688
296 Ga0207640_10222222 3300025981 Bacteria 1447
297 Ga0207640_10871387 3300025981 Bacteria 785
298 Ga0207658_11698153 3300025986 Unclassified 577
299 Ga0207703_11747807 3300026035 Unclassified 598
300 Ga0207639_11792953 3300026041 Unclassified 574
301 Ga0207678_10231682 3300026067 Archaea 1581
302 Ga0207678_10698273 3300026067 Unclassified 893
303 Ga0207678_11515430 3300026067 Unclassified 592
304 Ga0207708_10489816 3300026075 Bacteria 1029
305 Ga0207708_11622797 3300026075 Bacteria 568
306 Ga0207641_10343531 3300026088 Unclassified 1421
307 Ga0207641_10634144 3300026088 Bacteria 1049
308 Ga0207648_10068433 3300026089 Bacteria 3094
309 Ga0207648_10147808 3300026089 Unclassified 2073
310 Ga0207676_10034619 3300026095 Bacteria 3825
311 Ga0207676_10050513 3300026095 Bacteria 3242
312 Ga0207676_11168294 3300026095 Bacteria 762
313 Ga0207674_10910092 3300026116 Unclassified 848
314 Ga0207674_11683329 3300026116 Unclassified 603
315 Ga0207675_100484336 3300026118 Bacteria 1230
316 Ga0207698_11080087 3300026142 Bacteria 815
317 Ga0207698_11795600 3300026142 Unclassified 628
318 Ga0209996_1036454 3300027395 Bacteria 724
319 Ga0210002_1081864 3300027617 Unclassified 575
320 Ga0209983_1025609 3300027665 Unclassified 1245
321 Ga0209974_10051375 3300027876 Bacteria 1386
322 Ga0209974_10174148 3300027876 Bacteria 786
323 Ga0207428_10128912 3300027907 Bacteria 1936
324 Ga0268266_10665223 3300028379 Bacteria 1003
325 Ga0268265_10613903 3300028380 Bacteria 1041
326 Ga0268264_11849403 3300028381 Unclassified 614
327 Ga0307408_100017446 3300031548 Bacteria 4804
328 Ga0307408_100035330 3300031548 Unclassified 3507
329 Ga0307408_100046842 3300031548 Unclassified 3094
330 Ga0307408_100120042 3300031548 Unclassified 2035
331 Ga0307408_100142462 3300031548 Unclassified 1883
332 Ga0307408_100161860 3300031548 Bacteria 1778
333 Ga0307408_100303709 3300031548 Bacteria 1338
334 Ga0307408_100346305 3300031548 Bacteria 1259
335 Ga0307408_100368041 3300031548 Unclassified 1225
336 Ga0307408_100944899 3300031548 Bacteria 791
337 Ga0307405_10033706 3300031731 Bacteria 3040
338 Ga0307405_10041167 3300031731 Bacteria 2803
339 Ga0307405_10456718 3300031731 Bacteria 1014
340 Ga0307405_10475762 3300031731 Unclassified 996
341 Ga0307405_11074300 3300031731 Bacteria 690
342 Ga0307413_10002597 3300031824 Bacteria 7386
343 Ga0307413_10013302 3300031824 Bacteria 4132
344 Ga0307413_10013881 3300031824 Unclassified 4071
345 Ga0307413_10024842 3300031824 Unclassified 3274
346 Ga0307413_10044922 3300031824 Bacteria 2614
347 Ga0307413_10356809 3300031824 Bacteria 1130
348 Ga0307413_10400352 3300031824 Bacteria 1075
349 Ga0307413_10401955 3300031824 Bacteria 1073
350 Ga0307413_10534134 3300031824 Bacteria 948
351 Ga0307413_10970259 3300031824 Unclassified 726
352 Ga0307410_10005776 3300031852 Bacteria 6596
353 Ga0307410_10010410 3300031852 Bacteria 5265
354 Ga0307410_10031744 3300031852 Bacteria 3393
355 Ga0307410_10033699 3300031852 Unclassified 3308
356 Ga0307410_10078931 3300031852 Unclassified 2305
357 Ga0307410_10158784 3300031852 Unclassified 1692
358 Ga0307410_10163043 3300031852 Bacteria 1672
359 Ga0307410_10294875 3300031852 Bacteria 1277
360 Ga0307410_10455166 3300031852 Unclassified 1045
361 Ga0307410_10543406 3300031852 Unclassified 962
362 Ga0307410_11785245 3300031852 Bacteria 546
363 Ga0307406_10018933 3300031901 Bacteria 4033
364 Ga0307406_10024952 3300031901 Bacteria 3575
365 Ga0307406_10034168 3300031901 Bacteria 3118
366 Ga0307406_10041436 3300031901 Unclassified 2869
367 Ga0307406_10055373 3300031901 Unclassified 2535
368 Ga0307406_10288915 3300031901 Bacteria 1254
369 Ga0307407_10018255 3300031903 Unclassified 3543
370 Ga0307407_10019247 3300031903 Bacteria 3472
371 Ga0307407_10029885 3300031903 Bacteria 2932
372 Ga0307407_10053604 3300031903 Unclassified 2321
373 Ga0307407_10075528 3300031903 Bacteria 2020
374 Ga0307407_10150509 3300031903 Unclassified 1512
375 Ga0307407_10215296 3300031903 Unclassified 1296
376 Ga0307407_10400691 3300031903 Bacteria 984
377 Ga0307407_10592779 3300031903 Unclassified 824
378 Ga0307407_11494794 3300031903 Bacteria 534
379 Ga0307412_10022076 3300031911 Unclassified 3896
380 Ga0307412_10171773 3300031911 Unclassified 1621
381 Ga0307412_10223447 3300031911 Unclassified 1445
382 Ga0307412_10235025 3300031911 Unclassified 1414
383 Ga0307412_10245613 3300031911 Unclassified 1387
384 Ga0307412_10957641 3300031911 Bacteria 754
385 Ga0307412_11741594 3300031911 Bacteria 572
386 Ga0307412_12026377 3300031911 Bacteria 533
387 Ga0307412_12204420 3300031911 Unclassified 513
388 Ga0307409_100008828 3300031995 Bacteria 6147
389 Ga0307409_100014601 3300031995 Bacteria 5118
390 Ga0307409_100017388 3300031995 Bacteria 4791
391 Ga0307409_100031889 3300031995 Bacteria 3811
392 Ga0307409_100054670 3300031995 Unclassified 3077
393 Ga0307409_100070606 3300031995 Bacteria 2773
394 Ga0307409_100118123 3300031995 Bacteria 2239
395 Ga0307409_100171053 3300031995 Bacteria 1912
396 Ga0307409_100230548 3300031995 Bacteria 1678
397 Ga0307409_100273989 3300031995 Bacteria 1556
398 Ga0307409_100299632 3300031995 Bacteria 1495
399 Ga0307409_100477298 3300031995 Bacteria 1209
400 Ga0307409_100623745 3300031995 Bacteria 1068
401 Ga0307409_100637331 3300031995 Bacteria 1058
402 Ga0307409_101128468 3300031995 Unclassified 806
403 Ga0307409_102163127 3300031995 Unclassified 586
404 Ga0307409_102411344 3300031995 Unclassified 555
405 Ga0307416_100023647 3300032002 Bacteria 4465
406 Ga0307416_100111551 3300032002 Bacteria 2411
407 Ga0307416_100117541 3300032002 Bacteria 2361
408 Ga0307416_100155199 3300032002 Unclassified 2106
409 Ga0307416_100335950 3300032002 Unclassified 1521
410 Ga0307416_100352775 3300032002 Bacteria 1489
411 Ga0307416_100353459 3300032002 Unclassified 1488
412 Ga0307416_100428337 3300032002 Unclassified 1369
413 Ga0307416_100451051 3300032002 Bacteria 1339
414 Ga0307416_100559730 3300032002 Bacteria 1218
415 Ga0307416_100589404 3300032002 Unclassified 1190
416 Ga0307416_101221499 3300032002 Unclassified 857
417 Ga0307416_101530571 3300032002 Bacteria 773
418 Ga0307416_103118313 3300032002 Bacteria 554
419 Ga0307414_10005275 3300032004 Bacteria 7100
420 Ga0307414_10024205 3300032004 Bacteria 3867
421 Ga0307414_10063272 3300032004 Bacteria 2629
422 Ga0307414_10096388 3300032004 Bacteria 2213
423 Ga0307414_10119815 3300032004 Unclassified 2021
424 Ga0307414_10214978 3300032004 Unclassified 1574
425 Ga0307414_10259363 3300032004 Bacteria 1449
426 Ga0307414_10393099 3300032004 Unclassified 1202
427 Ga0307414_10959164 3300032004 Unclassified 786
428 Ga0307414_11377148 3300032004 Bacteria 655
429 Ga0307411_10001034 3300032005 Bacteria 10749
430 Ga0307411_10013184 3300032005 Bacteria 4549
431 Ga0307411_10034789 3300032005 Bacteria 3139
432 Ga0307411_10038164 3300032005 Bacteria 3027
433 Ga0307411_10040009 3300032005 Bacteria 2970
434 Ga0307411_10089549 3300032005 Bacteria 2144
435 Ga0307411_10182155 3300032005 Unclassified 1595
436 Ga0307411_10282292 3300032005 Bacteria 1322
437 Ga0307411_10324593 3300032005 Bacteria 1244
438 Ga0307411_10327041 3300032005 Unclassified 1240
439 Ga0307411_10329784 3300032005 Unclassified 1236
440 Ga0307411_11570490 3300032005 Unclassified 606
441 Ga0307415_100219193 3300032126 Unclassified 1524
442 Ga0307415_100332400 3300032126 Bacteria 1272
443 Ga0307415_100398974 3300032126 Bacteria 1173
444 Ga0307415_100437861 3300032126 Bacteria 1126
445 Ga0307415_100526443 3300032126 Unclassified 1039
446 Ga0307415_100567606 3300032126 Unclassified 1004
447 Ga0307415_100670009 3300032126 Unclassified 932
448 Ga0307415_100857848 3300032126 Unclassified 834
449 Ga0307415_100873034 3300032126 Unclassified 827
450 Ga0307415_101694968 3300032126 Bacteria 609
451 Ga0373930_0049812 3300034816 Bacteria 912
452 Ga0373930_0068407 3300034816 Unclassified 803
453 Ga0373948_0023731 3300034817 Bacteria 1192
454 Ga0373948_0095033 3300034817 Bacteria 696
455 Ga0373958_0049215 3300034819 Unclassified 886
456 Ga0373959_0016460 3300034820 Unclassified 1371
457 Ga0373938_0146176 3300034957 Unclassified 626
458 Ga0373928_0031726 3300035084 Unclassified 1175
459 Ga0373928_0038504 3300035084 Bacteria 1089
460 Ga0373928_0171644 3300035084 Unclassified 612
461 Ga0373929_0020684 3300035085 Bacteria 1329
462 Ga0373940_0026009 3300035088 Bacteria 1528
463 Ga0373940_0066804 3300035088 Unclassified 1039
464 Ga0373944_0169931 3300035089 Unclassified 777
465 Ga0373951_0123447 3300035091 Unclassified 707
466 Ga0373952_0270398 3300035092 Unclassified 521
467 Ga0373932_0021847 3300035112 Bacteria 1694
468 Ga0373939_0103784 3300035114 Unclassified 980
469 Ga0373939_0157143 3300035114 Bacteria 832
470 Ga0373960_0101462 3300035121 Unclassified 933
471 Ga0373960_0116298 3300035121 Bacteria 883
472 Ga0373942_0216396 3300035207 Bacteria 641
473 Ga0373961_0222428 3300035241 Unclassified 674
474 Ga0316574_0712861 3300035398 Bacteria 615
475 Ga0373931_0038441 3300035691 Unclassified 2503
476 Ga0373931_0048130 3300035691 Bacteria 2259
477 Ga0373931_0073546 3300035691 Bacteria 1870
478 Ga0373931_0180578 3300035691 Bacteria 1249
479 Ga0373931_0654022 3300035691 Bacteria 691
480 Ga0373931_0737125 3300035691 Bacteria 653
481 Ga0373937_0098633 3300036401 Bacteria 2710
482 Ga0316584_1175599 3300036712 Bacteria 507
483 Ga0395898_1044879 3300037466 Unclassified 752
484 Ga0395905_0205032 3300037471 Bacteria 1848
485 Ga0395905_0229759 3300037471 Bacteria 1735
486 Ga0395905_0290424 3300037471 Bacteria 1522
487 Ga0395905_0403338 3300037471 Bacteria 1262
488 Ga0395905_0657706 3300037471 Unclassified 950
489 Ga0395905_0884361 3300037471 Unclassified 796
490 Ga0242419_001522 3300038698 Bacteria 1436
491 Ga0242420_004366 3300038996 Bacteria 2135
492 Ga0242420_014804 3300038996 Bacteria 1342
493 Ga0439439_0105766 3300041406 Bacteria 777
494 Ga0439461_0118031 3300041410 Bacteria 661
495 Ga0451807_0058792 3300041486 Bacteria 946
496 Ga0451853_0749134 3300041512 Unclassified 572
497 Ga0439431_0082909 3300041997 Bacteria 866
498 Ga0439445_0055426 3300042004 Bacteria 1076
499 Ga0439448_0080396 3300042005 Unclassified 1094
500 Ga0439448_0142521 3300042005 Bacteria 830
501 Ga0439455_0126557 3300042012 Bacteria 719
502 Ga0439462_0010059 3300042015 Bacteria 2394
503 Ga0450890_025348 3300042127 Bacteria 822
504 Ga0439446_0236499 3300042156 Unclassified 626
505 Ga0439458_0195427 3300042157 Bacteria 552
506 Ga0439434_0324812 3300042435 Unclassified 534
507 Ga0439459_0146663 3300042438 Unclassified 614
508 Ga0439464_0284008 3300042439 Bacteria 539
509 Ga0439460_0259961 3300042461 Bacteria 601
510 Ga0451577_0157437 3300042876 Bacteria 2045
511 Ga0451577_0182070 3300042876 Bacteria 1894
512 Ga0453683_0031796 3300044673 Bacteria 3333
513 Ga0453683_0205342 3300044673 Bacteria 1251
514 Ga0466964_0098028 3300044706 Unclassified 1287
515 Ga0453684_2273931 3300044712 Unclassified 540
516 Ga0466970_0155035 3300044765 Unclassified 1266
517 Ga0466970_0253961 3300044765 Bacteria 986
518 Ga0451576_2002612 3300045051 Unclassified 597
519 Ga0451576_2393083 3300045051 Bacteria 540
520 Ga0466967_0427573 3300045976 Unclassified 1292
521 Ga0495603_0021286 3300046455 Bacteria 3927
522 Ga0495641_0309617 3300046461 Unclassified 712
523 Ga0495580_0101484 3300046472 Bacteria 2001
524 Ga0495580_0134240 3300046472 Bacteria 1716
525 Ga0495582_0080953 3300046473 Unclassified 1803
526 Ga0495639_0022170 3300046475 Bacteria 2784
527 Ga0495662_0215189 3300046476 Bacteria 947
528 Ga0495664_0099602 3300046477 Bacteria 1750
529 Ga0495594_0014838 3300046499 Bacteria 4088
530 Ga0495618_0040569 3300046514 Bacteria 2930
531 Ga0495630_0132616 3300046517 Bacteria 1892
532 Ga0495666_0009103 3300046526 Bacteria 4967
533 Ga0495640_0133709 3300046533 Bacteria 1603
534 Ga0495586_0008369 3300046535 Bacteria 5505
535 Ga0495621_0338828 3300046539 Unclassified 629
536 Ga0495667_0115664 3300046559 Bacteria 1733
537 Ga0495634_0004444 3300046642 Bacteria 11011
538 Ga0495647_0002129 3300046681 Bacteria 6188
539 Ga0495658_0115423 3300046683 Bacteria 1618
540 Ga0495613_0115368 3300046689 Bacteria 1933
541 Ga0495624_0603515 3300046690 Unclassified 654
542 Ga0495670_0225910 3300046691 Unclassified 995
543 Ga0495581_0096350 3300047315 Bacteria 1718
544 Ga0495604_0281727 3300047317 Bacteria 1123
545 Ga0495674_0045772 3300047319 Bacteria 3885
546 Ga0495674_1214591 3300047319 Unclassified 569
547 Ga0495680_0116417 3300047322 Unclassified 1976
548 Ga0495684_0143270 3300047471 Unclassified 1791
549 Ga0495614_0345004 3300048089 Unclassified 693
550 Ga0496100_0059509 3300048903 Bacteria 2511
551 Ga0496100_0509117 3300048903 Unclassified 928
552 Ga0496100_1100024 3300048903 Unclassified 626
553 Ga0496101_0030987 3300048904 Unclassified 3756
554 Ga0496101_0063844 3300048904 Unclassified 2682
555 Ga0496101_0101026 3300048904 Bacteria 2159
556 Ga0496101_0312659 3300048904 Unclassified 1232
557 Ga0496102_0025535 3300048905 Bacteria 5260
558 Ga0496102_0035385 3300048905 Unclassified 4495
559 Ga0496102_0100099 3300048905 Unclassified 2691
560 Ga0496102_0133172 3300048905 Unclassified 2328
561 Ga0496102_0134309 3300048905 Bacteria 2318
562 Ga0496102_0846205 3300048905 Bacteria 837
563 Ga0496102_0959223 3300048905 Unclassified 776
564 Ga0496102_1212359 3300048905 Unclassified 674
565 Ga0496103_0004939 3300048906 Bacteria 8050
566 Ga0496103_0118125 3300048906 Unclassified 1688
567 Ga0496103_0182658 3300048906 Unclassified 1348
568 Ga0496103_0383482 3300048906 Unclassified 903
569 Ga0496104_0011004 3300048907 Bacteria 8093
570 Ga0496104_0051831 3300048907 Bacteria 3874
571 Ga0496104_0112788 3300048907 Bacteria 2607
572 Ga0496104_0610434 3300048907 Unclassified 1001
573 Ga0496105_0015793 3300048908 Bacteria 6024
574 Ga0496105_0271874 3300048908 Unclassified 1368
575 Ga0496105_0494049 3300048908 Unclassified 961
576 Ga0496105_0774498 3300048908 Bacteria 731
577 Ga0496106_0033960 3300048909 Unclassified 3808
578 Ga0496106_0104597 3300048909 Unclassified 2198
579 Ga0496106_0120395 3300048909 Unclassified 2051
580 Ga0496106_0425066 3300048909 Bacteria 1068
581 Ga0496106_0932691 3300048909 Bacteria 684
582 Ga0496107_0171092 3300048910 Unclassified 1612
583 Ga0496107_1205869 3300048910 Unclassified 544
584 Ga0496108_0000296 3300048911 Bacteria 42798
585 Ga0496108_0010751 3300048911 Bacteria 7430
586 Ga0496108_0045481 3300048911 Bacteria 3666
587 Ga0496108_0074660 3300048911 Bacteria 2863
588 Ga0496108_0090199 3300048911 Unclassified 2606
589 Ga0496108_0731962 3300048911 Unclassified 856
590 Ga0496108_1456915 3300048911 Unclassified 571
591 Ga0496109_0000206 3300048912 Bacteria 58007
592 Ga0496109_0007468 3300048912 Bacteria 9258
593 Ga0496109_0015274 3300048912 Bacteria 6686
594 Ga0496109_0024001 3300048912 Bacteria 5417
595 Ga0496109_0434419 3300048912 Bacteria 1240
596 Ga0496109_0537482 3300048912 Bacteria 1103
597 Ga0496110_0000500 3300048913 Bacteria 26635
598 Ga0496110_0006099 3300048913 Bacteria 9499
599 Ga0496110_0011118 3300048913 Bacteria 7353
600 Ga0496110_0070480 3300048913 Bacteria 3097
601 Ga0496110_0594697 3300048913 Bacteria 1004
602 Ga0496111_0004448 3300048914 Bacteria 8862
603 Ga0496111_0026705 3300048914 Bacteria 4078
604 Ga0496111_0029659 3300048914 Bacteria 3886
605 Ga0496111_0172085 3300048914 Unclassified 1609
606 Ga0496111_0493090 3300048914 Unclassified 902
607 Ga0496111_0495571 3300048914 Bacteria 899
608 Ga0496112_0000114 3300048915 Bacteria 49840
609 Ga0496112_0000557 3300048915 Bacteria 25556
610 Ga0496112_0041172 3300048915 Bacteria 4518
611 Ga0496112_0058973 3300048915 Bacteria 3781
612 Ga0496112_1916655 3300048915 Bacteria 504
613 Ga0496113_0000106 3300048916 Bacteria 35660
614 Ga0496113_0016920 3300048916 Bacteria 5047
615 Ga0496113_0021595 3300048916 Bacteria 4542
616 Ga0496113_0135430 3300048916 Bacteria 1935
617 Ga0496114_0287600 3300048917 Bacteria 1450
618 Ga0496114_0329179 3300048917 Bacteria 1350
619 Ga0496114_0427836 3300048917 Bacteria 1173
620 Ga0496115_0031645 3300048918 Bacteria 4169
621 Ga0501292_027836 3300049515 Bacteria 938
622 Ga0501292_115262 3300049515 Bacteria 544
623 Ga0501294_017076 3300049517 Unclassified 760
624 Ga0501295_116830 3300049518 Unclassified 638
625 Ga0501296_014573 3300049519 Bacteria 966
626 Ga0501298_202080 3300049521 Bacteria 505
627 Ga0501299_018658 3300049522 Bacteria 1249
628 Ga0501031_0069426 3300049568 Bacteria 2295
629 Ga0501031_0141770 3300049568 Unclassified 1571
630 Ga0501031_0162050 3300049568 Bacteria 1462
631 Ga0501032_0121953 3300049569 Bacteria 1723
632 Ga0501033_1062469 3300049570 Unclassified 539
633 Ga0501036_0065253 3300049572 Bacteria 3082
634 Ga0501036_0308606 3300049572 Bacteria 1323
635 Ga0501036_1132909 3300049572 Unclassified 639
636 Ga0501037_0026868 3300049573 Bacteria 4252
637 Ga0501037_0659220 3300049573 Bacteria 699
638 Ga0501037_0910203 3300049573 Unclassified 576
639 Ga0501038_0028761 3300049574 Unclassified 4935
640 Ga0501038_0137086 3300049574 Bacteria 2004
641 Ga0501038_0538463 3300049574 Bacteria 889
642 Ga0501038_0803368 3300049574 Bacteria 699
643 Ga0501038_1343047 3300049574 Unclassified 515
644 Ga0501039_0032427 3300049575 Bacteria 4028
645 Ga0501039_1509432 3300049575 Unclassified 516
646 Ga0501040_0019143 3300049576 Bacteria 4552
647 Ga0501040_0056900 3300049576 Unclassified 2684
648 Ga0501041_0050417 3300049577 Unclassified 2537
649 Ga0501041_0066469 3300049577 Unclassified 2209
650 Ga0501041_0979462 3300049577 Bacteria 544
651 Ga0501041_0992884 3300049577 Bacteria 540
652 Ga0501042_0020314 3300049578 Bacteria 4622
653 Ga0501042_0114248 3300049578 Bacteria 1944
654 Ga0501042_0596089 3300049578 Unclassified 803
655 Ga0501042_1164261 3300049578 Unclassified 562
656 Ga0501046_0026077 3300049580 Bacteria 4776
657 Ga0501046_0078142 3300049580 Bacteria 2561
658 Ga0501046_0129083 3300049580 Bacteria 1918
659 Ga0501048_0004804 3300049582 Bacteria 10298
660 Ga0501048_0123609 3300049582 Unclassified 1829
661 Ga0501048_0382068 3300049582 Bacteria 1006
662 Ga0501067_0001508 3300049583 Bacteria 12682
663 Ga0501067_0044924 3300049583 Bacteria 2454
664 Ga0501067_0069572 3300049583 Unclassified 1949
665 Ga0501067_0282016 3300049583 Bacteria 925
666 Ga0501067_0472781 3300049583 Unclassified 700
667 Ga0501067_0612026 3300049583 Unclassified 611
668 Ga0501067_0655560 3300049583 Unclassified 589
669 Ga0501068_0012771 3300049584 Bacteria 4769
670 Ga0501068_0066458 3300049584 Bacteria 2196
671 Ga0501068_0097623 3300049584 Bacteria 1818
672 Ga0501069_0065873 3300049585 Bacteria 2026
673 Ga0501069_0094623 3300049585 Bacteria 1691
674 Ga0501069_0144496 3300049585 Unclassified 1365
675 Ga0501070_0664644 3300049586 Bacteria 826
676 Ga0501070_0885818 3300049586 Unclassified 697
677 Ga0501071_0005331 3300049587 Bacteria 8256
678 Ga0501071_0061047 3300049587 Bacteria 2730
679 Ga0501071_0102577 3300049587 Bacteria 2110
680 Ga0501071_0165679 3300049587 Bacteria 1654
681 Ga0501071_0464016 3300049587 Unclassified 970
682 Ga0501072_0004356 3300049588 Bacteria 10742
683 Ga0501072_0098594 3300049588 Bacteria 2323
684 Ga0501074_0045787 3300049590 Bacteria 3164
685 Ga0501074_0117520 3300049590 Unclassified 1902
686 Ga0501075_0004067 3300049591 Bacteria 9874
687 Ga0501075_0173067 3300049591 Bacteria 1648
688 Ga0501075_0422589 3300049591 Bacteria 1016
689 Ga0501076_0005204 3300049592 Bacteria 9317
690 Ga0501076_0036546 3300049592 Bacteria 3849
691 Ga0501076_0099206 3300049592 Bacteria 2346
692 Ga0501076_0390477 3300049592 Bacteria 1144
693 Ga0501076_0400340 3300049592 Bacteria 1129
694 Ga0501077_0001286 3300049593 Bacteria 15161
695 Ga0501077_0003264 3300049593 Bacteria 9768
696 Ga0501077_0010406 3300049593 Bacteria 5789
697 Ga0501198_035356 3300049649 Unclassified 849
698 Ga0501201_039705 3300049651 Unclassified 562
699 Ga0501202_174882 3300049652 Bacteria 576
700 Ga0501202_206787 3300049652 Unclassified 539
701 Ga0501209_002239 3300049656 Bacteria 2929
702 Ga0501209_026845 3300049656 Unclassified 1425
703 Ga0501209_030409 3300049656 Unclassified 1365
704 Ga0501216_043909 3300049660 Bacteria 862
705 Ga0501217_007548 3300049661 Unclassified 2334
706 Ga0501217_051843 3300049661 Bacteria 1075
707 Ga0501227_119540 3300049665 Bacteria 711
708 Ga0501233_042923 3300049668 Bacteria 1069
709 Ga0501235_166106 3300049669 Unclassified 580
710 Ga0501236_018797 3300049670 Bacteria 1001
711 Ga0501238_060802 3300049671 Unclassified 577
712 Ga0501243_022114 3300049675 Unclassified 1052
713 Ga0501243_049150 3300049675 Bacteria 757
714 Ga0501247_000053 3300049677 Bacteria 6344
715 Ga0501247_064187 3300049677 Bacteria 569
716 Ga0501248_060754 3300049678 Bacteria 504
717 Ga0501249_001020 3300049679 Bacteria 6017
718 Ga0501249_105183 3300049679 Unclassified 678
719 Ga0501249_216558 3300049679 Unclassified 509
720 Ga0501252_018726 3300049682 Bacteria 889
721 Ga0501257_181700 3300049686 Unclassified 596
722 Ga0501221_021259 3300049704 Archaea 1276
723 Ga0501225_0088041 3300049705 Bacteria 897
724 Ga0501225_0179792 3300049705 Unclassified 660
725 Ga0501234_034172 3300049707 Bacteria 825
726 Ga0501245_003819 3300049708 Unclassified 2060
727 Ga0501079_0005929 3300049741 Bacteria 9154
728 Ga0501079_0007043 3300049741 Bacteria 8484
729 Ga0501079_0167762 3300049741 Bacteria 1712
730 Ga0501079_0508694 3300049741 Bacteria 947
731 Ga0501080_0020527 3300049742 Bacteria 6117
732 Ga0501080_0129326 3300049742 Bacteria 2338
733 Ga0501080_0176266 3300049742 Unclassified 1969
734 Ga0501080_1573642 3300049742 Bacteria 557
735 Ga0501081_0005531 3300049743 Bacteria 8155
736 Ga0501081_0013752 3300049743 Bacteria 5324
737 Ga0501081_0025188 3300049743 Bacteria 4000
738 Ga0501083_0019650 3300049744 Bacteria 4705
739 Ga0501083_0344922 3300049744 Unclassified 968
740 Ga0501232_043925 3300049757 Bacteria 668
741 Ga0501268_004128 3300049765 Unclassified 2032
742 Ga0501268_020128 3300049765 Archaea 1134
743 Ga0501268_099602 3300049765 Bacteria 621
744 Ga0501270_022098 3300049767 Unclassified 979
745 Ga0501271_038318 3300049768 Bacteria 616
746 Ga0501271_052322 3300049768 Unclassified 557
747 Ga0501272_000381 3300049769 Unclassified 3908
748 Ga0501273_000747 3300049770 Bacteria 2790
749 Ga0501273_051803 3300049770 Unclassified 629
750 Ga0501275_039322 3300049772 Bacteria 657
751 Ga0501279_078742 3300049775 Bacteria 565
752 Ga0501283_011829 3300049779 Bacteria 1303
753 Ga0501035_0160265 3300049822 Bacteria 1948
754 Ga0501044_0943030 3300049823 Bacteria 736
755 Ga0501045_0002145 3300049824 Bacteria 13350
756 Ga0501045_0015354 3300049824 Bacteria 5437
757 Ga0501045_0019274 3300049824 Bacteria 4861
758 Ga0501045_0518240 3300049824 Bacteria 885
759 Ga0501045_0861580 3300049824 Bacteria 666
760 Ga0501212_059399 3300049851 Bacteria 660
761 Ga0501212_114909 3300049851 Unclassified 517
762 nmdc:mga05p37_108333_c1 3300050507 Unclassified 3418
763 nmdc:mga05p37_1116450_c1 3300050507 Bacteria 824
764 nmdc:mga05p37_1304020_c1 3300050507 Bacteria 740
765 nmdc:mga05p37_1822247_c1 3300050507 Bacteria 586
766 nmdc:mga05p37_32198_c1 3300050507 Bacteria 6411
767 nmdc:mga0qj67_67898_c1 3300050509 Bacteria 2841
768 nmdc:mga0qj67_789222_c1 3300050509 Bacteria 752
769 nmdc:mga06r32_2808_c1 3300050510 Bacteria 15600
770 nmdc:mga06r32_372628_c1 3300050510 Unclassified 1411
771 nmdc:mga08y16_1905528_c1 3300050511 Unclassified 545
772 nmdc:mga08y16_223304_c1 3300050511 Unclassified 1949
773 nmdc:mga08y16_82152_c1 3300050511 Bacteria 3359
774 nmdc:mga0n895_1188838_c1 3300050512 Unclassified 737
775 nmdc:mga0n895_221878_c1 3300050512 Unclassified 1919
776 nmdc:mga0n895_318857_c1 3300050512 Unclassified 1575
777 nmdc:mga0n895_6797_c1 3300050512 Bacteria 9764
778 nmdc:mga0rr50_1148083_c1 3300050513 Bacteria 660
779 nmdc:mga0rr50_149750_c1 3300050513 Bacteria 1884
780 nmdc:mga0rr50_172091_c1 3300050513 Bacteria 1765
781 nmdc:mga0rr50_217855_c1 3300050513 Bacteria 1575
782 nmdc:mga0rr50_903166_c1 3300050513 Unclassified 753
783 nmdc:mga08x19_138214_c1 3300050514 Unclassified 1644
784 nmdc:mga08x19_224541_c1 3300050514 Bacteria 1291
785 nmdc:mga08x19_341210_c1 3300050514 Bacteria 1045
786 nmdc:mga0a205_1251703_c1 3300050515 Unclassified 590
787 nmdc:mga0a205_163474_c1 3300050515 Bacteria 2122
788 nmdc:mga0a205_262172_c1 3300050515 Bacteria 1606
789 nmdc:mga0a205_321349_c1 3300050515 Unclassified 1419
790 Ga0501084_0004925 3300054114 Bacteria 10912
791 Ga0501084_0014371 3300054114 Bacteria 6561
792 Ga0501084_0039259 3300054114 Bacteria 3959
793 Ga0501084_0517527 3300054114 Bacteria 1009
794 Ga0590071_000704 3300059421 Bacteria 9469
795 Ga0590071_006933 3300059421 Bacteria 2685
796 Ga0590071_008655 3300059421 Bacteria 2393
797 Ga0590074_007138 3300059423 Bacteria 1856
798 Ga0590074_008559 3300059423 Unclassified 1704
799 Ga0590074_025508 3300059423 Bacteria 1030
800 Ga0590074_064291 3300059423 Bacteria 685
801 Ga0590075_005634 3300059424 Bacteria 2958
802 Ga0590075_013305 3300059424 Unclassified 2005
803 Ga0590075_060413 3300059424 Bacteria 977
804 Ga0590077_004353 3300059426 Bacteria 2908
805 Ga0590077_025849 3300059426 Unclassified 1266
806 Ga0590077_064342 3300059426 Bacteria 833
807 Ga0501082_0010468 3300060353 Bacteria 7979
808 Ga0501082_0012078 3300060353 Bacteria 7422
809 Ga0501082_0019438 3300060353 Bacteria 5856
810 Ga0501082_0245197 3300060353 Unclassified 1559
811 Ga0501082_0817381 3300060353 Bacteria 815
812 Ga0501082_1000951 3300060353 Bacteria 731
813 Ga0501082_1909520 3300060353 Unclassified 518
814 Ga0530510_0052005 3300061734 Unclassified 2960
815 Ga0530510_0078881 3300061734 Bacteria 2395
816 Ga0530510_0161804 3300061734 Bacteria 1656
817 Ga0530510_0289560 3300061734 Bacteria 1224
818 Ga0530510_0329280 3300061734 Bacteria 1146
819 Ga0530510_0904973 3300061734 Bacteria 674
820 Ga0530510_1329456 3300061734 Bacteria 551
821 Ga0530510_1393251 3300061734 Bacteria 538
822 Ga0105241_10733696
823 MBSR1b_contig_10799852
824 rootL2_10126547
825 Ga0065715_10303158
826 Ga0065715_10607325
827 Ga0065707_10167551
828 Ga0065707_10282508
829 Ga0070676_10379568
830 Ga0070683_100139425
831 Ga0070683_100461097
832 Ga0070683_102198075
833 Ga0070690_100104302
834 Ga0070690_100508907
835 Ga0070670_100467440
836 Ga0070677_10036338
837 Ga0070677_10048686
838 Ga0070677_10647278
839 Ga0068869_102088468
840 Ga0068869_102137679
841 Ga0070680_100074875
842 Ga0070680_100518244
843 Ga0070680_101061743
844 Ga0070682_100576426
845 Ga0068868_102238933
846 Ga0070660_101360025
847 Ga0070691_10119055
848 Ga0070691_10299822
849 Ga0070661_100083365
850 Ga0070661_101189626
851 Ga0070692_10147345
852 Ga0070668_102051259
853 Ga0070669_100810155
854 Ga0070675_100139713
855 Ga0070675_100319169
856 Ga0070675_100834958
857 Ga0070671_100002000
858 Ga0070674_100430496
859 Ga0070674_101466482
860 Ga0070673_100262282
861 Ga0070688_100302659
862 Ga0070659_100021582
863 Ga0070659_100648609
864 Ga0070667_101794937
865 Ga0070703_10207784
866 Ga0070703_10447000
867 Ga0070709_10257722
868 Ga0070709_11173882
869 Ga0070713_101166380
870 Ga0070713_101901039
871 Ga0070710_10371277
872 Ga0070701_10674958
873 Ga0070711_100000946
874 Ga0070711_100018953
875 Ga0070711_100525816
876 Ga0070711_101168432
877 Ga0070705_100096969
878 Ga0070705_100315068
879 Ga0070705_100615722
880 Ga0070705_100646784
881 Ga0070700_100479308
882 Ga0070700_100498419
883 Ga0070700_101327386
884 Ga0070700_101688596
885 Ga0070694_100008730
886 Ga0070694_100053528
887 Ga0070694_100475841
888 Ga0070694_101202468
889 Ga0070708_100001169
890 Ga0070708_100042398
891 Ga0070708_100655411
892 Ga0070708_100955988
893 Ga0070663_100326129
894 Ga0070663_100481447
895 Ga0070663_101402560
896 Ga0070678_101443636
897 Ga0070662_100144496
898 Ga0070681_10036835
899 Ga0070681_10269462
900 Ga0070681_12052801
901 Ga0068867_100149081
902 Ga0068867_100941532
903 Ga0070685_10291147
904 Ga0070685_11578788
905 Ga0070706_100040313
906 Ga0070706_100185150
907 Ga0070706_100624338
908 Ga0070707_100679150
909 Ga0070707_101024816
910 Ga0070707_102152627
911 Ga0070698_100316986
912 Ga0070698_100843349
913 Ga0070698_101035686
914 Ga0070698_102030468
915 Ga0070699_100067838
916 Ga0070699_100453140
917 Ga0070699_100944451
918 Ga0070699_101070748
919 Ga0070679_100098788
920 Ga0070679_102120442
921 Ga0070684_100684250
922 Ga0070684_101437323
923 Ga0070684_101843037
924 Ga0070697_100010580
925 Ga0070697_100035778
926 Ga0070697_100236343
927 Ga0070697_100570532
928 Ga0070697_100582133
929 Ga0070697_100636343
930 Ga0070697_100654060
931 Ga0068853_102134555
932 Ga0070672_100264098
933 Ga0070672_100308125
934 Ga0070686_100063275
935 Ga0070695_100018051
936 Ga0070695_100038201
937 Ga0070695_100628160
938 Ga0070696_100000833
939 Ga0070696_100212023
940 Ga0070696_100377663
941 Ga0070696_101284864
942 Ga0070693_100208262
943 Ga0070693_100587692
944 Ga0070693_100652929
945 Ga0070704_100002387
946 Ga0070704_100132610
947 Ga0070704_100166488
948 Ga0070704_100318543
949 Ga0070664_100005951
950 Ga0070664_100006491
951 Ga0070664_100243875
952 Ga0068857_100291238
953 Ga0068857_101116244
954 Ga0068854_101530710
955 Ga0070702_100647134
956 Ga0070702_100909717
957 Ga0068852_101565219
958 Ga0068859_100116976
959 Ga0068864_100019445
960 Ga0068864_100047655
961 Ga0068864_100735176
962 Ga0068861_100244915
963 Ga0068861_102420302
964 Ga0068858_101991817
965 Ga0068860_101096234
966 Ga0068862_101540014
967 Ga0081455_10066837
968 Ga0081538_10136747
969 Ga0070715_10039502
970 Ga0070715_10354579
971 Ga0070712_100197510
972 Ga0070712_100238761
973 Ga0070712_100411244
974 Ga0097621_100664938
975 Ga0068871_100337589
976 Ga0075428_100011005
977 Ga0075428_100064427
978 Ga0075430_100072231
979 Ga0075430_100204707
980 Ga0075430_100395216
981 Ga0075430_101534282
982 Ga0075431_100003213
983 Ga0075431_100277807
984 Ga0075431_100913703
985 Ga0075433_10032494
986 Ga0075433_10090631
987 Ga0075433_10259733
988 Ga0075434_100012920
989 Ga0075434_100024907
990 Ga0075434_100026049
991 Ga0075434_100331178
992 Ga0075434_100674899
993 Ga0075429_100592496
994 Ga0075436_100017353
995 Ga0075436_100237230
996 Ga0075436_100363174
997 Ga0097620_100116976
998 Ga0075435_100136518
999 Ga0075435_100895481
1000 Ga0111539_10190212
1001 Ga0111539_10230831
1002 Ga0111539_10627900
1003 Ga0111539_10990659
1004 Ga0105245_10161079
1005 Ga0105245_10778129
1006 Ga0114129_10002347
1007 Ga0114129_10021905
1008 Ga0114129_10235220
1009 Ga0114129_10390418
1010 Ga0114129_10537318
1011 Ga0114129_10540076
1012 Ga0114129_11816526
1013 Ga0114129_11890155
1014 Ga0114129_12146906
1015 Ga0114129_12262122
1016 Ga0105242_11938837
1017 Ga0105248_10004344
1018 Ga0105248_10143379
1019 Ga0105248_10194235
1020 Ga0105248_10200063
1021 Ga0105248_10500218
1022 Ga0105248_10545637
1023 Ga0105248_10888591
1024 Ga0105237_10637349
1025 Ga0105249_10101256
1026 Ga0105249_10570548
1027 Ga0105249_10814866
1028 Ga0105249_11563454
1029 Ga0105249_12183236
1030 Ga0105239_10004067
1031 Ga0105239_11397407
1032 Ga0105246_10130105
1033 Ga0105246_10661944
1034 Ga0105246_11361901
1035 Ga0157373_10397495
1036 Ga0157373_10643577
1037 Ga0157378_11306559
1038 Ga0163162_10001791
1039 Ga0163162_10166596
1040 Ga0163162_13178098
1041 Ga0157375_11540433
1042 Ga0157375_11709829
1043 Ga0157375_11954099
1044 Ga0163163_10640913
1045 Ga0163163_10846019
1046 Ga0163163_11182912
1047 Ga0157380_10559428
1048 Ga0182008_10081419
1049 Ga0157377_10319418
1050 Ga0157379_10024076
1051 Ga0157376_10210550
1052 Ga0207682_10175324
1053 Ga0207692_10453070
1054 Ga0207692_10645249
1055 Ga0207642_10400268
1056 Ga0207688_10179843
1057 Ga0207685_10127815
1058 Ga0207699_10342596
1059 Ga0207699_10492862
1060 Ga0207645_10474037
1061 Ga0207684_10003882
1062 Ga0207684_10403860
1063 Ga0207684_10434270
1064 Ga0207684_10551863
1065 Ga0207684_10553472
1066 Ga0207684_11312536
1067 Ga0207707_10016778
1068 Ga0207693_10232650
1069 Ga0207693_10361392
1070 Ga0207663_10061534
1071 Ga0207663_10276138
1072 Ga0207663_11091276
1073 Ga0207663_11168249
1074 Ga0207660_11066492
1075 Ga0207662_10804679
1076 Ga0207657_10368166
1077 Ga0207649_10229569
1078 Ga0207649_10252933
1079 Ga0207649_10718832
1080 Ga0207652_10323855
1081 Ga0207652_10403542
1082 Ga0207646_10022306
1083 Ga0207646_10158210
1084 Ga0207659_10302327
1085 Ga0207659_10677963
1086 Ga0207687_10114251
1087 Ga0207700_10986584
1088 Ga0207664_10416393
1089 Ga0207644_10038523
1090 Ga0207690_10014353
1091 Ga0207690_10515455
1092 Ga0207706_10117546
1093 Ga0207706_10386350
1094 Ga0207706_10932257
1095 Ga0207669_10987255
1096 Ga0207691_10439395
1097 Ga0207691_11717176
1098 Ga0207711_10038812
1099 Ga0207711_10121341
1100 Ga0207711_10466038
1101 Ga0207711_10567490
1102 Ga0207711_11269994
1103 Ga0207661_10076169
1104 Ga0207679_10007026
1105 Ga0207679_10040981
1106 Ga0207679_10052311
1107 Ga0207679_10168457
1108 Ga0207679_11308579
1109 Ga0207679_11479387
1110 Ga0207651_11183339
1111 Ga0207712_10415155
1112 Ga0207712_10867455
1113 Ga0207712_11643473
1114 Ga0207668_10064257
1115 Ga0207668_10325161
1116 Ga0207668_11178370
1117 Ga0207640_10222222
1118 Ga0207640_10871387
1119 Ga0207658_11698153
1120 Ga0207703_11747807
1121 Ga0207639_11792953
1122 Ga0207678_10231682
1123 Ga0207678_10698273
1124 Ga0207678_11515430
1125 Ga0207708_10489816
1126 Ga0207708_11622797
1127 Ga0207641_10343531
1128 Ga0207641_10634144
1129 Ga0207648_10068433
1130 Ga0207648_10147808
1131 Ga0207676_10034619
1132 Ga0207676_10050513
1133 Ga0207676_11168294
1134 Ga0207674_10910092
1135 Ga0207674_11683329
1136 Ga0207675_100484336
1137 Ga0207698_11080087
1138 Ga0207698_11795600
1139 Ga0209996_1036454
1140 Ga0210002_1081864
1141 Ga0209983_1025609
1142 Ga0209974_10051375
1143 Ga0209974_10174148
1144 Ga0207428_10128912
1145 Ga0268266_10665223
1146 Ga0268265_10613903
1147 Ga0268264_11849403
1148 Ga0307408_100017446
1149 Ga0307408_100035330
1150 Ga0307408_100046842
1151 Ga0307408_100120042
1152 Ga0307408_100142462
1153 Ga0307408_100161860
1154 Ga0307408_100303709
1155 Ga0307408_100346305
1156 Ga0307408_100368041
1157 Ga0307408_100944899
1158 Ga0307405_10033706
1159 Ga0307405_10041167
1160 Ga0307405_10456718
1161 Ga0307405_10475762
1162 Ga0307405_11074300
1163 Ga0307413_10002597
1164 Ga0307413_10013302
1165 Ga0307413_10013881
1166 Ga0307413_10024842
1167 Ga0307413_10044922
1168 Ga0307413_10356809
1169 Ga0307413_10400352
1170 Ga0307413_10401955
1171 Ga0307413_10534134
1172 Ga0307413_10970259
1173 Ga0307410_10005776
1174 Ga0307410_10010410
1175 Ga0307410_10031744
1176 Ga0307410_10033699
1177 Ga0307410_10078931
1178 Ga0307410_10158784
1179 Ga0307410_10163043
1180 Ga0307410_10294875
1181 Ga0307410_10455166
1182 Ga0307410_10543406
1183 Ga0307410_11785245
1184 Ga0307406_10018933
1185 Ga0307406_10024952
1186 Ga0307406_10034168
1187 Ga0307406_10041436
1188 Ga0307406_10055373
1189 Ga0307406_10288915
1190 Ga0307407_10018255
1191 Ga0307407_10019247
1192 Ga0307407_10029885
1193 Ga0307407_10053604
1194 Ga0307407_10075528
1195 Ga0307407_10150509
1196 Ga0307407_10215296
1197 Ga0307407_10400691
1198 Ga0307407_10592779
1199 Ga0307407_11494794
1200 Ga0307412_10022076
1201 Ga0307412_10171773
1202 Ga0307412_10223447
1203 Ga0307412_10235025
1204 Ga0307412_10245613
1205 Ga0307412_10957641
1206 Ga0307412_11741594
1207 Ga0307412_12026377
1208 Ga0307412_12204420
1209 Ga0307409_100008828
1210 Ga0307409_100014601
1211 Ga0307409_100017388
1212 Ga0307409_100031889
1213 Ga0307409_100054670
1214 Ga0307409_100070606
1215 Ga0307409_100118123
1216 Ga0307409_100171053
1217 Ga0307409_100230548
1218 Ga0307409_100273989
1219 Ga0307409_100299632
1220 Ga0307409_100477298
1221 Ga0307409_100623745
1222 Ga0307409_100637331
1223 Ga0307409_101128468
1224 Ga0307409_102163127
1225 Ga0307409_102411344
1226 Ga0307416_100023647
1227 Ga0307416_100111551
1228 Ga0307416_100117541
1229 Ga0307416_100155199
1230 Ga0307416_100335950
1231 Ga0307416_100352775
1232 Ga0307416_100353459
1233 Ga0307416_100428337
1234 Ga0307416_100451051
1235 Ga0307416_100559730
1236 Ga0307416_100589404
1237 Ga0307416_101221499
1238 Ga0307416_101530571
1239 Ga0307416_103118313
1240 Ga0307414_10005275
1241 Ga0307414_10024205
1242 Ga0307414_10063272
1243 Ga0307414_10096388
1244 Ga0307414_10119815
1245 Ga0307414_10214978
1246 Ga0307414_10259363
1247 Ga0307414_10393099
1248 Ga0307414_10959164
1249 Ga0307414_11377148
1250 Ga0307411_10001034
1251 Ga0307411_10013184
1252 Ga0307411_10034789
1253 Ga0307411_10038164
1254 Ga0307411_10040009
1255 Ga0307411_10089549
1256 Ga0307411_10182155
1257 Ga0307411_10282292
1258 Ga0307411_10324593
1259 Ga0307411_10327041
1260 Ga0307411_10329784
1261 Ga0307411_11570490
1262 Ga0307415_100219193
1263 Ga0307415_100332400
1264 Ga0307415_100398974
1265 Ga0307415_100437861
1266 Ga0307415_100526443
1267 Ga0307415_100567606
1268 Ga0307415_100670009
1269 Ga0307415_100857848
1270 Ga0307415_100873034
1271 Ga0307415_101694968
1272 Ga0373930_0049812
1273 Ga0373930_0068407
1274 Ga0373948_0023731
1275 Ga0373948_0095033
1276 Ga0373958_0049215
1277 Ga0373959_0016460
1278 Ga0373938_0146176
1279 Ga0373928_0031726
1280 Ga0373928_0038504
1281 Ga0373928_0171644
1282 Ga0373929_0020684
1283 Ga0373940_0026009
1284 Ga0373940_0066804
1285 Ga0373944_0169931
1286 Ga0373951_0123447
1287 Ga0373952_0270398
1288 Ga0373932_0021847
1289 Ga0373939_0103784
1290 Ga0373939_0157143
1291 Ga0373960_0101462
1292 Ga0373960_0116298
1293 Ga0373942_0216396
1294 Ga0373961_0222428
1295 Ga0316574_0712861
1296 Ga0373931_0038441
1297 Ga0373931_0048130
1298 Ga0373931_0073546
1299 Ga0373931_0180578
1300 Ga0373931_0654022
1301 Ga0373931_0737125
1302 Ga0373937_0098633
1303 Ga0316584_1175599
1304 Ga0395898_1044879
1305 Ga0395905_0205032
1306 Ga0395905_0229759
1307 Ga0395905_0290424
1308 Ga0395905_0403338
1309 Ga0395905_0657706
1310 Ga0395905_0884361
1311 Ga0242419_001522
1312 Ga0242420_004366
1313 Ga0242420_014804
1314 Ga0439439_0105766
1315 Ga0439461_0118031
1316 Ga0451807_0058792
1317 Ga0451853_0749134
1318 Ga0439431_0082909
1319 Ga0439445_0055426
1320 Ga0439448_0080396
1321 Ga0439448_0142521
1322 Ga0439455_0126557
1323 Ga0439462_0010059
1324 Ga0450890_025348
1325 Ga0439446_0236499
1326 Ga0439458_0195427
1327 Ga0439434_0324812
1328 Ga0439459_0146663
1329 Ga0439464_0284008
1330 Ga0439460_0259961
1331 Ga0451577_0157437
1332 Ga0451577_0182070
1333 Ga0453683_0031796
1334 Ga0453683_0205342
1335 Ga0466964_0098028
1336 Ga0453684_2273931
1337 Ga0466970_0155035
1338 Ga0466970_0253961
1339 Ga0451576_2002612
1340 Ga0451576_2393083
1341 Ga0466967_0427573
1342 Ga0495603_0021286
1343 Ga0495641_0309617
1344 Ga0495580_0101484
1345 Ga0495580_0134240
1346 Ga0495582_0080953
1347 Ga0495639_0022170
1348 Ga0495662_0215189
1349 Ga0495664_0099602
1350 Ga0495594_0014838
1351 Ga0495618_0040569
1352 Ga0495630_0132616
1353 Ga0495666_0009103
1354 Ga0495640_0133709
1355 Ga0495586_0008369
1356 Ga0495621_0338828
1357 Ga0495667_0115664
1358 Ga0495634_0004444
1359 Ga0495647_0002129
1360 Ga0495658_0115423
1361 Ga0495613_0115368
1362 Ga0495624_0603515
1363 Ga0495670_0225910
1364 Ga0495581_0096350
1365 Ga0495604_0281727
1366 Ga0495674_0045772
1367 Ga0495674_1214591
1368 Ga0495680_0116417
1369 Ga0495684_0143270
1370 Ga0495614_0345004
1371 Ga0496100_0059509
1372 Ga0496100_0509117
1373 Ga0496100_1100024
1374 Ga0496101_0030987
1375 Ga0496101_0063844
1376 Ga0496101_0101026
1377 Ga0496101_0312659
1378 Ga0496102_0025535
1379 Ga0496102_0035385
1380 Ga0496102_0100099
1381 Ga0496102_0133172
1382 Ga0496102_0134309
1383 Ga0496102_0846205
1384 Ga0496102_0959223
1385 Ga0496102_1212359
1386 Ga0496103_0004939
1387 Ga0496103_0118125
1388 Ga0496103_0182658
1389 Ga0496103_0383482
1390 Ga0496104_0011004
1391 Ga0496104_0051831
1392 Ga0496104_0112788
1393 Ga0496104_0610434
1394 Ga0496105_0015793
1395 Ga0496105_0271874
1396 Ga0496105_0494049
1397 Ga0496105_0774498
1398 Ga0496106_0033960
1399 Ga0496106_0104597
1400 Ga0496106_0120395
1401 Ga0496106_0425066
1402 Ga0496106_0932691
1403 Ga0496107_0171092
1404 Ga0496107_1205869
1405 Ga0496108_0000296
1406 Ga0496108_0010751
1407 Ga0496108_0045481
1408 Ga0496108_0074660
1409 Ga0496108_0090199
1410 Ga0496108_0731962
1411 Ga0496108_1456915
1412 Ga0496109_0000206
1413 Ga0496109_0007468
1414 Ga0496109_0015274
1415 Ga0496109_0024001
1416 Ga0496109_0434419
1417 Ga0496109_0537482
1418 Ga0496110_0000500
1419 Ga0496110_0006099
1420 Ga0496110_0011118
1421 Ga0496110_0070480
1422 Ga0496110_0594697
1423 Ga0496111_0004448
1424 Ga0496111_0026705
1425 Ga0496111_0029659
1426 Ga0496111_0172085
1427 Ga0496111_0493090
1428 Ga0496111_0495571
1429 Ga0496112_0000114
1430 Ga0496112_0000557
1431 Ga0496112_0041172
1432 Ga0496112_0058973
1433 Ga0496112_1916655
1434 Ga0496113_0000106
1435 Ga0496113_0016920
1436 Ga0496113_0021595
1437 Ga0496113_0135430
1438 Ga0496114_0287600
1439 Ga0496114_0329179
1440 Ga0496114_0427836
1441 Ga0496115_0031645
1442 Ga0501292_027836
1443 Ga0501292_115262
1444 Ga0501294_017076
1445 Ga0501295_116830
1446 Ga0501296_014573
1447 Ga0501298_202080
1448 Ga0501299_018658
1449 Ga0501031_0069426
1450 Ga0501031_0141770
1451 Ga0501031_0162050
1452 Ga0501032_0121953
1453 Ga0501033_1062469
1454 Ga0501036_0065253
1455 Ga0501036_0308606
1456 Ga0501036_1132909
1457 Ga0501037_0026868
1458 Ga0501037_0659220
1459 Ga0501037_0910203
1460 Ga0501038_0028761
1461 Ga0501038_0137086
1462 Ga0501038_0538463
1463 Ga0501038_0803368
1464 Ga0501038_1343047
1465 Ga0501039_0032427
1466 Ga0501039_1509432
1467 Ga0501040_0019143
1468 Ga0501040_0056900
1469 Ga0501041_0050417
1470 Ga0501041_0066469
1471 Ga0501041_0979462
1472 Ga0501041_0992884
1473 Ga0501042_0020314
1474 Ga0501042_0114248
1475 Ga0501042_0596089
1476 Ga0501042_1164261
1477 Ga0501046_0026077
1478 Ga0501046_0078142
1479 Ga0501046_0129083
1480 Ga0501048_0004804
1481 Ga0501048_0123609
1482 Ga0501048_0382068
1483 Ga0501067_0001508
1484 Ga0501067_0044924
1485 Ga0501067_0069572
1486 Ga0501067_0282016
1487 Ga0501067_0472781
1488 Ga0501067_0612026
1489 Ga0501067_0655560
1490 Ga0501068_0012771
1491 Ga0501068_0066458
1492 Ga0501068_0097623
1493 Ga0501069_0065873
1494 Ga0501069_0094623
1495 Ga0501069_0144496
1496 Ga0501070_0664644
1497 Ga0501070_0885818
1498 Ga0501071_0005331
1499 Ga0501071_0061047
1500 Ga0501071_0102577
1501 Ga0501071_0165679
1502 Ga0501071_0464016
1503 Ga0501072_0004356
1504 Ga0501072_0098594
1505 Ga0501074_0045787
1506 Ga0501074_0117520
1507 Ga0501075_0004067
1508 Ga0501075_0173067
1509 Ga0501075_0422589
1510 Ga0501076_0005204
1511 Ga0501076_0036546
1512 Ga0501076_0099206
1513 Ga0501076_0390477
1514 Ga0501076_0400340
1515 Ga0501077_0001286
1516 Ga0501077_0003264
1517 Ga0501077_0010406
1518 Ga0501198_035356
1519 Ga0501201_039705
1520 Ga0501202_174882
1521 Ga0501202_206787
1522 Ga0501209_002239
1523 Ga0501209_026845
1524 Ga0501209_030409
1525 Ga0501216_043909
1526 Ga0501217_007548
1527 Ga0501217_051843
1528 Ga0501227_119540
1529 Ga0501233_042923
1530 Ga0501235_166106
1531 Ga0501236_018797
1532 Ga0501238_060802
1533 Ga0501243_022114
1534 Ga0501243_049150
1535 Ga0501247_000053
1536 Ga0501247_064187
1537 Ga0501248_060754
1538 Ga0501249_001020
1539 Ga0501249_105183
1540 Ga0501249_216558
1541 Ga0501252_018726
1542 Ga0501257_181700
1543 Ga0501221_021259
1544 Ga0501225_0088041
1545 Ga0501225_0179792
1546 Ga0501234_034172
1547 Ga0501245_003819
1548 Ga0501079_0005929
1549 Ga0501079_0007043
1550 Ga0501079_0167762
1551 Ga0501079_0508694
1552 Ga0501080_0020527
1553 Ga0501080_0129326
1554 Ga0501080_0176266
1555 Ga0501080_1573642
1556 Ga0501081_0005531
1557 Ga0501081_0013752
1558 Ga0501081_0025188
1559 Ga0501083_0019650
1560 Ga0501083_0344922
1561 Ga0501232_043925
1562 Ga0501268_004128
1563 Ga0501268_020128
1564 Ga0501268_099602
1565 Ga0501270_022098
1566 Ga0501271_038318
1567 Ga0501271_052322
1568 Ga0501272_000381
1569 Ga0501273_000747
1570 Ga0501273_051803
1571 Ga0501275_039322
1572 Ga0501279_078742
1573 Ga0501283_011829
1574 Ga0501035_0160265
1575 Ga0501044_0943030
1576 Ga0501045_0002145
1577 Ga0501045_0015354
1578 Ga0501045_0019274
1579 Ga0501045_0518240
1580 Ga0501045_0861580
1581 Ga0501212_059399
1582 Ga0501212_114909
1583 nmdc:mga05p37_108333_c1
1584 nmdc:mga05p37_1116450_c1
1585 nmdc:mga05p37_1304020_c1
1586 nmdc:mga05p37_1822247_c1
1587 nmdc:mga05p37_32198_c1
1588 nmdc:mga0qj67_67898_c1
1589 nmdc:mga0qj67_789222_c1
1590 nmdc:mga06r32_2808_c1
1591 nmdc:mga06r32_372628_c1
1592 nmdc:mga08y16_1905528_c1
1593 nmdc:mga08y16_223304_c1
1594 nmdc:mga08y16_82152_c1
1595 nmdc:mga0n895_1188838_c1
1596 nmdc:mga0n895_221878_c1
1597 nmdc:mga0n895_318857_c1
1598 nmdc:mga0n895_6797_c1
1599 nmdc:mga0rr50_1148083_c1
1600 nmdc:mga0rr50_149750_c1
1601 nmdc:mga0rr50_172091_c1
1602 nmdc:mga0rr50_217855_c1
1603 nmdc:mga0rr50_903166_c1
1604 nmdc:mga08x19_138214_c1
1605 nmdc:mga08x19_224541_c1
1606 nmdc:mga08x19_341210_c1
1607 nmdc:mga0a205_1251703_c1
1608 nmdc:mga0a205_163474_c1
1609 nmdc:mga0a205_262172_c1
1610 nmdc:mga0a205_321349_c1
1611 Ga0501084_0004925
1612 Ga0501084_0014371
1613 Ga0501084_0039259
1614 Ga0501084_0517527
1615 Ga0590071_000704
1616 Ga0590071_006933
1617 Ga0590071_008655
1618 Ga0590074_007138
1619 Ga0590074_008559
1620 Ga0590074_025508
1621 Ga0590074_064291
1622 Ga0590075_005634
1623 Ga0590075_013305
1624 Ga0590075_060413
1625 Ga0590077_004353
1626 Ga0590077_025849
1627 Ga0590077_064342
1628 Ga0501082_0010468
1629 Ga0501082_0012078
1630 Ga0501082_0019438
1631 Ga0501082_0245197
1632 Ga0501082_0817381
1633 Ga0501082_1000951
1634 Ga0501082_1909520
1635 Ga0530510_0052005
1636 Ga0530510_0078881
1637 Ga0530510_0161804
1638 Ga0530510_0289560
1639 Ga0530510_0329280
1640 Ga0530510_0904973
1641 Ga0530510_1329456
1642 Ga0530510_1393251

MSA Aligner

Family Sequences

Map