F482253
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 337 | 1642 | 56 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10733696|Ga0105241_107336961 |
| Length | 60 |
| Sequence | MKPATDYIRHAARLARKLQMDAAMGTPTPPDAEFYKTLSKALDEIAAGLEQVAARDALPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 169 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 190 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 193 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 195 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 196 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 199 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 200 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 201 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 202 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 258 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 259 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 260 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 261 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 262 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 286 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 287 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 289 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 290 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 291 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 297 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 298 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 299 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 302 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 303 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 311 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 313 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 316 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 317 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 318 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 333 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 334 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.77 |
| Rhizosphere | 90.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105241_10733696 | 3300009174 | Bacteria | 904 |
| 2 | MBSR1b_contig_10799852 | 2162886012 | Bacteria | 1247 |
| 3 | rootL2_10126547 | 3300003322 | Unclassified | 1741 |
| 4 | Ga0065715_10303158 | 3300005293 | Bacteria | 1036 |
| 5 | Ga0065715_10607325 | 3300005293 | Bacteria | 704 |
| 6 | Ga0065707_10167551 | 3300005295 | Unclassified | 1510 |
| 7 | Ga0065707_10282508 | 3300005295 | Bacteria | 1044 |
| 8 | Ga0070676_10379568 | 3300005328 | Unclassified | 978 |
| 9 | Ga0070683_100139425 | 3300005329 | Bacteria | 2297 |
| 10 | Ga0070683_100461097 | 3300005329 | Archaea | 1213 |
| 11 | Ga0070683_102198075 | 3300005329 | Unclassified | 530 |
| 12 | Ga0070690_100104302 | 3300005330 | Bacteria | 1883 |
| 13 | Ga0070690_100508907 | 3300005330 | Unclassified | 902 |
| 14 | Ga0070670_100467440 | 3300005331 | Unclassified | 1119 |
| 15 | Ga0070677_10036338 | 3300005333 | Bacteria | 1916 |
| 16 | Ga0070677_10048686 | 3300005333 | Bacteria | 1704 |
| 17 | Ga0070677_10647278 | 3300005333 | Unclassified | 590 |
| 18 | Ga0068869_102088468 | 3300005334 | Unclassified | 509 |
| 19 | Ga0068869_102137679 | 3300005334 | Bacteria | 503 |
| 20 | Ga0070680_100074875 | 3300005336 | Bacteria | 2786 |
| 21 | Ga0070680_100518244 | 3300005336 | Bacteria | 1021 |
| 22 | Ga0070680_101061743 | 3300005336 | Unclassified | 700 |
| 23 | Ga0070682_100576426 | 3300005337 | Bacteria | 885 |
| 24 | Ga0068868_102238933 | 3300005338 | Unclassified | 521 |
| 25 | Ga0070660_101360025 | 3300005339 | Bacteria | 603 |
| 26 | Ga0070691_10119055 | 3300005341 | Bacteria | 1328 |
| 27 | Ga0070691_10299822 | 3300005341 | Unclassified | 878 |
| 28 | Ga0070661_100083365 | 3300005344 | Bacteria | 2361 |
| 29 | Ga0070661_101189626 | 3300005344 | Bacteria | 637 |
| 30 | Ga0070692_10147345 | 3300005345 | Bacteria | 1338 |
| 31 | Ga0070668_102051259 | 3300005347 | Unclassified | 528 |
| 32 | Ga0070669_100810155 | 3300005353 | Bacteria | 796 |
| 33 | Ga0070675_100139713 | 3300005354 | Unclassified | 2070 |
| 34 | Ga0070675_100319169 | 3300005354 | Bacteria | 1372 |
| 35 | Ga0070675_100834958 | 3300005354 | Unclassified | 843 |
| 36 | Ga0070671_100002000 | 3300005355 | Bacteria | 15651 |
| 37 | Ga0070674_100430496 | 3300005356 | Bacteria | 1085 |
| 38 | Ga0070674_101466482 | 3300005356 | Unclassified | 612 |
| 39 | Ga0070673_100262282 | 3300005364 | Bacteria | 1510 |
| 40 | Ga0070688_100302659 | 3300005365 | Bacteria | 1156 |
| 41 | Ga0070659_100021582 | 3300005366 | Bacteria | 4906 |
| 42 | Ga0070659_100648609 | 3300005366 | Bacteria | 910 |
| 43 | Ga0070667_101794937 | 3300005367 | Bacteria | 577 |
| 44 | Ga0070703_10207784 | 3300005406 | Unclassified | 772 |
| 45 | Ga0070703_10447000 | 3300005406 | Unclassified | 572 |
| 46 | Ga0070709_10257722 | 3300005434 | Bacteria | 1259 |
| 47 | Ga0070709_11173882 | 3300005434 | Bacteria | 616 |
| 48 | Ga0070713_101166380 | 3300005436 | Unclassified | 745 |
| 49 | Ga0070713_101901039 | 3300005436 | Bacteria | 577 |
| 50 | Ga0070710_10371277 | 3300005437 | Bacteria | 952 |
| 51 | Ga0070701_10674958 | 3300005438 | Unclassified | 692 |
| 52 | Ga0070711_100000946 | 3300005439 | Bacteria | 15359 |
| 53 | Ga0070711_100018953 | 3300005439 | Bacteria | 4404 |
| 54 | Ga0070711_100525816 | 3300005439 | Unclassified | 978 |
| 55 | Ga0070711_101168432 | 3300005439 | Bacteria | 665 |
| 56 | Ga0070705_100096969 | 3300005440 | Unclassified | 1852 |
| 57 | Ga0070705_100315068 | 3300005440 | Bacteria | 1127 |
| 58 | Ga0070705_100615722 | 3300005440 | Unclassified | 842 |
| 59 | Ga0070705_100646784 | 3300005440 | Bacteria | 824 |
| 60 | Ga0070700_100479308 | 3300005441 | Unclassified | 953 |
| 61 | Ga0070700_100498419 | 3300005441 | Bacteria | 936 |
| 62 | Ga0070700_101327386 | 3300005441 | Unclassified | 605 |
| 63 | Ga0070700_101688596 | 3300005441 | Bacteria | 543 |
| 64 | Ga0070694_100008730 | 3300005444 | Bacteria | 6207 |
| 65 | Ga0070694_100053528 | 3300005444 | Bacteria | 2732 |
| 66 | Ga0070694_100475841 | 3300005444 | Bacteria | 990 |
| 67 | Ga0070694_101202468 | 3300005444 | Bacteria | 635 |
| 68 | Ga0070708_100001169 | 3300005445 | Bacteria | 20215 |
| 69 | Ga0070708_100042398 | 3300005445 | Bacteria | 3995 |
| 70 | Ga0070708_100655411 | 3300005445 | Bacteria | 989 |
| 71 | Ga0070708_100955988 | 3300005445 | Unclassified | 804 |
| 72 | Ga0070663_100326129 | 3300005455 | Bacteria | 1236 |
| 73 | Ga0070663_100481447 | 3300005455 | Unclassified | 1028 |
| 74 | Ga0070663_101402560 | 3300005455 | Bacteria | 619 |
| 75 | Ga0070678_101443636 | 3300005456 | Bacteria | 643 |
| 76 | Ga0070662_100144496 | 3300005457 | Bacteria | 1847 |
| 77 | Ga0070681_10036835 | 3300005458 | Bacteria | 4911 |
| 78 | Ga0070681_10269462 | 3300005458 | Bacteria | 1614 |
| 79 | Ga0070681_12052801 | 3300005458 | Unclassified | 500 |
| 80 | Ga0068867_100149081 | 3300005459 | Bacteria | 1836 |
| 81 | Ga0068867_100941532 | 3300005459 | Archaea | 780 |
| 82 | Ga0070685_10291147 | 3300005466 | Bacteria | 1097 |
| 83 | Ga0070685_11578788 | 3300005466 | Unclassified | 507 |
| 84 | Ga0070706_100040313 | 3300005467 | Bacteria | 4311 |
| 85 | Ga0070706_100185150 | 3300005467 | Unclassified | 1946 |
| 86 | Ga0070706_100624338 | 3300005467 | Unclassified | 1001 |
| 87 | Ga0070707_100679150 | 3300005468 | Unclassified | 992 |
| 88 | Ga0070707_101024816 | 3300005468 | Bacteria | 791 |
| 89 | Ga0070707_102152627 | 3300005468 | Unclassified | 525 |
| 90 | Ga0070698_100316986 | 3300005471 | Bacteria | 1490 |
| 91 | Ga0070698_100843349 | 3300005471 | Unclassified | 861 |
| 92 | Ga0070698_101035686 | 3300005471 | Unclassified | 768 |
| 93 | Ga0070698_102030468 | 3300005471 | Unclassified | 528 |
| 94 | Ga0070699_100067838 | 3300005518 | Plasmid | 3097 |
| 95 | Ga0070699_100453140 | 3300005518 | Bacteria | 1163 |
| 96 | Ga0070699_100944451 | 3300005518 | Bacteria | 790 |
| 97 | Ga0070699_101070748 | 3300005518 | Bacteria | 740 |
| 98 | Ga0070679_100098788 | 3300005530 | Bacteria | 2907 |
| 99 | Ga0070679_102120442 | 3300005530 | Unclassified | 512 |
| 100 | Ga0070684_100684250 | 3300005535 | Bacteria | 956 |
| 101 | Ga0070684_101437323 | 3300005535 | Bacteria | 650 |
| 102 | Ga0070684_101843037 | 3300005535 | Unclassified | 571 |
| 103 | Ga0070697_100010580 | 3300005536 | Bacteria | 7203 |
| 104 | Ga0070697_100035778 | 3300005536 | Bacteria | 4008 |
| 105 | Ga0070697_100236343 | 3300005536 | Archaea | 1560 |
| 106 | Ga0070697_100570532 | 3300005536 | Bacteria | 993 |
| 107 | Ga0070697_100582133 | 3300005536 | Unclassified | 983 |
| 108 | Ga0070697_100636343 | 3300005536 | Bacteria | 939 |
| 109 | Ga0070697_100654060 | 3300005536 | Bacteria | 926 |
| 110 | Ga0068853_102134555 | 3300005539 | Bacteria | 543 |
| 111 | Ga0070672_100264098 | 3300005543 | Bacteria | 1452 |
| 112 | Ga0070672_100308125 | 3300005543 | Unclassified | 1343 |
| 113 | Ga0070686_100063275 | 3300005544 | Unclassified | 2396 |
| 114 | Ga0070695_100018051 | 3300005545 | Bacteria | 4283 |
| 115 | Ga0070695_100038201 | 3300005545 | Bacteria | 3028 |
| 116 | Ga0070695_100628160 | 3300005545 | Unclassified | 846 |
| 117 | Ga0070696_100000833 | 3300005546 | Bacteria | 19880 |
| 118 | Ga0070696_100212023 | 3300005546 | Unclassified | 1450 |
| 119 | Ga0070696_100377663 | 3300005546 | Unclassified | 1104 |
| 120 | Ga0070696_101284864 | 3300005546 | Bacteria | 621 |
| 121 | Ga0070693_100208262 | 3300005547 | Bacteria | 1274 |
| 122 | Ga0070693_100587692 | 3300005547 | Unclassified | 802 |
| 123 | Ga0070693_100652929 | 3300005547 | Bacteria | 765 |
| 124 | Ga0070704_100002387 | 3300005549 | Bacteria | 10539 |
| 125 | Ga0070704_100132610 | 3300005549 | Unclassified | 1933 |
| 126 | Ga0070704_100166488 | 3300005549 | Unclassified | 1748 |
| 127 | Ga0070704_100318543 | 3300005549 | Bacteria | 1302 |
| 128 | Ga0070664_100005951 | 3300005564 | Bacteria | 9854 |
| 129 | Ga0070664_100006491 | 3300005564 | Bacteria | 9429 |
| 130 | Ga0070664_100243875 | 3300005564 | Bacteria | 1613 |
| 131 | Ga0068857_100291238 | 3300005577 | Bacteria | 1503 |
| 132 | Ga0068857_101116244 | 3300005577 | Unclassified | 762 |
| 133 | Ga0068854_101530710 | 3300005578 | Bacteria | 606 |
| 134 | Ga0070702_100647134 | 3300005615 | Unclassified | 799 |
| 135 | Ga0070702_100909717 | 3300005615 | Unclassified | 689 |
| 136 | Ga0068852_101565219 | 3300005616 | Unclassified | 682 |
| 137 | Ga0068859_100116976 | 3300005617 | Bacteria | 2731 |
| 138 | Ga0068864_100019445 | 3300005618 | Bacteria | 5678 |
| 139 | Ga0068864_100047655 | 3300005618 | Bacteria | 3682 |
| 140 | Ga0068864_100735176 | 3300005618 | Bacteria | 966 |
| 141 | Ga0068861_100244915 | 3300005719 | Unclassified | 1527 |
| 142 | Ga0068861_102420302 | 3300005719 | Unclassified | 528 |
| 143 | Ga0068858_101991817 | 3300005842 | Unclassified | 574 |
| 144 | Ga0068860_101096234 | 3300005843 | Unclassified | 815 |
| 145 | Ga0068862_101540014 | 3300005844 | Unclassified | 671 |
| 146 | Ga0081455_10066837 | 3300005937 | Bacteria | 2999 |
| 147 | Ga0081538_10136747 | 3300005981 | Bacteria | 1139 |
| 148 | Ga0070715_10039502 | 3300006163 | Unclassified | 1966 |
| 149 | Ga0070715_10354579 | 3300006163 | Bacteria | 802 |
| 150 | Ga0070712_100197510 | 3300006175 | Bacteria | 1578 |
| 151 | Ga0070712_100238761 | 3300006175 | Bacteria | 1447 |
| 152 | Ga0070712_100411244 | 3300006175 | Unclassified | 1119 |
| 153 | Ga0097621_100664938 | 3300006237 | Unclassified | 957 |
| 154 | Ga0068871_100337589 | 3300006358 | Unclassified | 1330 |
| 155 | Ga0075428_100011005 | 3300006844 | Bacteria | 10061 |
| 156 | Ga0075428_100064427 | 3300006844 | Bacteria | 4014 |
| 157 | Ga0075430_100072231 | 3300006846 | Bacteria | 2894 |
| 158 | Ga0075430_100204707 | 3300006846 | Unclassified | 1638 |
| 159 | Ga0075430_100395216 | 3300006846 | Bacteria | 1141 |
| 160 | Ga0075430_101534282 | 3300006846 | Unclassified | 547 |
| 161 | Ga0075431_100003213 | 3300006847 | Bacteria | 15816 |
| 162 | Ga0075431_100277807 | 3300006847 | Unclassified | 1696 |
| 163 | Ga0075431_100913703 | 3300006847 | Unclassified | 847 |
| 164 | Ga0075433_10032494 | 3300006852 | Bacteria | 4470 |
| 165 | Ga0075433_10090631 | 3300006852 | Unclassified | 2703 |
| 166 | Ga0075433_10259733 | 3300006852 | Bacteria | 1540 |
| 167 | Ga0075434_100012920 | 3300006871 | Bacteria | 7932 |
| 168 | Ga0075434_100024907 | 3300006871 | Bacteria | 5851 |
| 169 | Ga0075434_100026049 | 3300006871 | Bacteria | 5726 |
| 170 | Ga0075434_100331178 | 3300006871 | Unclassified | 1543 |
| 171 | Ga0075434_100674899 | 3300006871 | Bacteria | 1051 |
| 172 | Ga0075429_100592496 | 3300006880 | Unclassified | 971 |
| 173 | Ga0075436_100017353 | 3300006914 | Bacteria | 4927 |
| 174 | Ga0075436_100237230 | 3300006914 | Bacteria | 1296 |
| 175 | Ga0075436_100363174 | 3300006914 | Bacteria | 1045 |
| 176 | Ga0097620_100116976 | 3300006931 | Bacteria | 2731 |
| 177 | Ga0075435_100136518 | 3300007076 | Bacteria | 2055 |
| 178 | Ga0075435_100895481 | 3300007076 | Bacteria | 774 |
| 179 | Ga0111539_10190212 | 3300009094 | Bacteria | 2395 |
| 180 | Ga0111539_10230831 | 3300009094 | Bacteria | 2155 |
| 181 | Ga0111539_10627900 | 3300009094 | Bacteria | 1251 |
| 182 | Ga0111539_10990659 | 3300009094 | Unclassified | 977 |
| 183 | Ga0105245_10161079 | 3300009098 | Bacteria | 2129 |
| 184 | Ga0105245_10778129 | 3300009098 | Bacteria | 994 |
| 185 | Ga0114129_10002347 | 3300009147 | Bacteria | 26280 |
| 186 | Ga0114129_10021905 | 3300009147 | Bacteria | 9070 |
| 187 | Ga0114129_10235220 | 3300009147 | Bacteria | 2465 |
| 188 | Ga0114129_10390418 | 3300009147 | Bacteria | 1836 |
| 189 | Ga0114129_10537318 | 3300009147 | Unclassified | 1522 |
| 190 | Ga0114129_10540076 | 3300009147 | Bacteria | 1517 |
| 191 | Ga0114129_11816526 | 3300009147 | Unclassified | 741 |
| 192 | Ga0114129_11890155 | 3300009147 | Unclassified | 724 |
| 193 | Ga0114129_12146906 | 3300009147 | Bacteria | 673 |
| 194 | Ga0114129_12262122 | 3300009147 | Unclassified | 653 |
| 195 | Ga0105242_11938837 | 3300009176 | Bacteria | 630 |
| 196 | Ga0105248_10004344 | 3300009177 | Bacteria | 15678 |
| 197 | Ga0105248_10143379 | 3300009177 | Bacteria | 2695 |
| 198 | Ga0105248_10194235 | 3300009177 | Bacteria | 2287 |
| 199 | Ga0105248_10200063 | 3300009177 | Bacteria | 2251 |
| 200 | Ga0105248_10500218 | 3300009177 | Bacteria | 1370 |
| 201 | Ga0105248_10545637 | 3300009177 | Bacteria | 1308 |
| 202 | Ga0105248_10888591 | 3300009177 | Unclassified | 1006 |
| 203 | Ga0105237_10637349 | 3300009545 | Bacteria | 1073 |
| 204 | Ga0105249_10101256 | 3300009553 | Unclassified | 2709 |
| 205 | Ga0105249_10570548 | 3300009553 | Bacteria | 1184 |
| 206 | Ga0105249_10814866 | 3300009553 | Bacteria | 998 |
| 207 | Ga0105249_11563454 | 3300009553 | Unclassified | 732 |
| 208 | Ga0105249_12183236 | 3300009553 | Unclassified | 626 |
| 209 | Ga0105239_10004067 | 3300010375 | Bacteria | 17658 |
| 210 | Ga0105239_11397407 | 3300010375 | Unclassified | 808 |
| 211 | Ga0105246_10130105 | 3300011119 | Bacteria | 1879 |
| 212 | Ga0105246_10661944 | 3300011119 | Archaea | 910 |
| 213 | Ga0105246_11361901 | 3300011119 | Unclassified | 660 |
| 214 | Ga0157373_10397495 | 3300013100 | Bacteria | 987 |
| 215 | Ga0157373_10643577 | 3300013100 | Unclassified | 774 |
| 216 | Ga0157378_11306559 | 3300013297 | Unclassified | 767 |
| 217 | Ga0163162_10001791 | 3300013306 | Bacteria | 20158 |
| 218 | Ga0163162_10166596 | 3300013306 | Bacteria | 2327 |
| 219 | Ga0163162_13178098 | 3300013306 | Unclassified | 527 |
| 220 | Ga0157375_11540433 | 3300013308 | Bacteria | 785 |
| 221 | Ga0157375_11709829 | 3300013308 | Unclassified | 745 |
| 222 | Ga0157375_11954099 | 3300013308 | Unclassified | 697 |
| 223 | Ga0163163_10640913 | 3300014325 | Bacteria | 1126 |
| 224 | Ga0163163_10846019 | 3300014325 | Bacteria | 978 |
| 225 | Ga0163163_11182912 | 3300014325 | Bacteria | 827 |
| 226 | Ga0157380_10559428 | 3300014326 | Unclassified | 1124 |
| 227 | Ga0182008_10081419 | 3300014497 | Unclassified | 1593 |
| 228 | Ga0157377_10319418 | 3300014745 | Unclassified | 1031 |
| 229 | Ga0157379_10024076 | 3300014968 | Bacteria | 5403 |
| 230 | Ga0157376_10210550 | 3300014969 | Unclassified | 1794 |
| 231 | Ga0207682_10175324 | 3300025893 | Bacteria | 977 |
| 232 | Ga0207692_10453070 | 3300025898 | Unclassified | 808 |
| 233 | Ga0207692_10645249 | 3300025898 | Bacteria | 684 |
| 234 | Ga0207642_10400268 | 3300025899 | Unclassified | 821 |
| 235 | Ga0207688_10179843 | 3300025901 | Unclassified | 1261 |
| 236 | Ga0207685_10127815 | 3300025905 | Unclassified | 1124 |
| 237 | Ga0207699_10342596 | 3300025906 | Bacteria | 1053 |
| 238 | Ga0207699_10492862 | 3300025906 | Unclassified | 884 |
| 239 | Ga0207645_10474037 | 3300025907 | Bacteria | 846 |
| 240 | Ga0207684_10003882 | 3300025910 | Bacteria | 14346 |
| 241 | Ga0207684_10403860 | 3300025910 | Unclassified | 1174 |
| 242 | Ga0207684_10434270 | 3300025910 | Bacteria | 1128 |
| 243 | Ga0207684_10551863 | 3300025910 | Archaea | 986 |
| 244 | Ga0207684_10553472 | 3300025910 | Bacteria | 984 |
| 245 | Ga0207684_11312536 | 3300025910 | Unclassified | 595 |
| 246 | Ga0207707_10016778 | 3300025912 | Bacteria | 6380 |
| 247 | Ga0207693_10232650 | 3300025915 | Bacteria | 1447 |
| 248 | Ga0207693_10361392 | 3300025915 | Bacteria | 1136 |
| 249 | Ga0207663_10061534 | 3300025916 | Bacteria | 2383 |
| 250 | Ga0207663_10276138 | 3300025916 | Bacteria | 1246 |
| 251 | Ga0207663_11091276 | 3300025916 | Unclassified | 641 |
| 252 | Ga0207663_11168249 | 3300025916 | Bacteria | 619 |
| 253 | Ga0207660_11066492 | 3300025917 | Bacteria | 659 |
| 254 | Ga0207662_10804679 | 3300025918 | Bacteria | 663 |
| 255 | Ga0207657_10368166 | 3300025919 | Bacteria | 1132 |
| 256 | Ga0207649_10229569 | 3300025920 | Bacteria | 1326 |
| 257 | Ga0207649_10252933 | 3300025920 | Bacteria | 1270 |
| 258 | Ga0207649_10718832 | 3300025920 | Bacteria | 775 |
| 259 | Ga0207652_10323855 | 3300025921 | Unclassified | 1391 |
| 260 | Ga0207652_10403542 | 3300025921 | Unclassified | 1233 |
| 261 | Ga0207646_10022306 | 3300025922 | Bacteria | 5835 |
| 262 | Ga0207646_10158210 | 3300025922 | Bacteria | 2044 |
| 263 | Ga0207659_10302327 | 3300025926 | Bacteria | 1314 |
| 264 | Ga0207659_10677963 | 3300025926 | Bacteria | 882 |
| 265 | Ga0207687_10114251 | 3300025927 | Bacteria | 2009 |
| 266 | Ga0207700_10986584 | 3300025928 | Unclassified | 754 |
| 267 | Ga0207664_10416393 | 3300025929 | Unclassified | 1196 |
| 268 | Ga0207644_10038523 | 3300025931 | Bacteria | 3368 |
| 269 | Ga0207690_10014353 | 3300025932 | Bacteria | 4786 |
| 270 | Ga0207690_10515455 | 3300025932 | Bacteria | 969 |
| 271 | Ga0207706_10117546 | 3300025933 | Bacteria | 2338 |
| 272 | Ga0207706_10386350 | 3300025933 | Bacteria | 1214 |
| 273 | Ga0207706_10932257 | 3300025933 | Bacteria | 732 |
| 274 | Ga0207669_10987255 | 3300025937 | Unclassified | 707 |
| 275 | Ga0207691_10439395 | 3300025940 | Bacteria | 1111 |
| 276 | Ga0207691_11717176 | 3300025940 | Bacteria | 508 |
| 277 | Ga0207711_10038812 | 3300025941 | Bacteria | 4049 |
| 278 | Ga0207711_10121341 | 3300025941 | Unclassified | 2334 |
| 279 | Ga0207711_10466038 | 3300025941 | Bacteria | 1176 |
| 280 | Ga0207711_10567490 | 3300025941 | Unclassified | 1059 |
| 281 | Ga0207711_11269994 | 3300025941 | Bacteria | 678 |
| 282 | Ga0207661_10076169 | 3300025944 | Bacteria | 2755 |
| 283 | Ga0207679_10007026 | 3300025945 | Bacteria | 7135 |
| 284 | Ga0207679_10040981 | 3300025945 | Bacteria | 3318 |
| 285 | Ga0207679_10052311 | 3300025945 | Bacteria | 2995 |
| 286 | Ga0207679_10168457 | 3300025945 | Bacteria | 1801 |
| 287 | Ga0207679_11308579 | 3300025945 | Bacteria | 665 |
| 288 | Ga0207679_11479387 | 3300025945 | Unclassified | 623 |
| 289 | Ga0207651_11183339 | 3300025960 | Unclassified | 686 |
| 290 | Ga0207712_10415155 | 3300025961 | Bacteria | 1134 |
| 291 | Ga0207712_10867455 | 3300025961 | Bacteria | 796 |
| 292 | Ga0207712_11643473 | 3300025961 | Unclassified | 576 |
| 293 | Ga0207668_10064257 | 3300025972 | Bacteria | 2593 |
| 294 | Ga0207668_10325161 | 3300025972 | Unclassified | 1277 |
| 295 | Ga0207668_11178370 | 3300025972 | Unclassified | 688 |
| 296 | Ga0207640_10222222 | 3300025981 | Bacteria | 1447 |
| 297 | Ga0207640_10871387 | 3300025981 | Bacteria | 785 |
| 298 | Ga0207658_11698153 | 3300025986 | Unclassified | 577 |
| 299 | Ga0207703_11747807 | 3300026035 | Unclassified | 598 |
| 300 | Ga0207639_11792953 | 3300026041 | Unclassified | 574 |
| 301 | Ga0207678_10231682 | 3300026067 | Archaea | 1581 |
| 302 | Ga0207678_10698273 | 3300026067 | Unclassified | 893 |
| 303 | Ga0207678_11515430 | 3300026067 | Unclassified | 592 |
| 304 | Ga0207708_10489816 | 3300026075 | Bacteria | 1029 |
| 305 | Ga0207708_11622797 | 3300026075 | Bacteria | 568 |
| 306 | Ga0207641_10343531 | 3300026088 | Unclassified | 1421 |
| 307 | Ga0207641_10634144 | 3300026088 | Bacteria | 1049 |
| 308 | Ga0207648_10068433 | 3300026089 | Bacteria | 3094 |
| 309 | Ga0207648_10147808 | 3300026089 | Unclassified | 2073 |
| 310 | Ga0207676_10034619 | 3300026095 | Bacteria | 3825 |
| 311 | Ga0207676_10050513 | 3300026095 | Bacteria | 3242 |
| 312 | Ga0207676_11168294 | 3300026095 | Bacteria | 762 |
| 313 | Ga0207674_10910092 | 3300026116 | Unclassified | 848 |
| 314 | Ga0207674_11683329 | 3300026116 | Unclassified | 603 |
| 315 | Ga0207675_100484336 | 3300026118 | Bacteria | 1230 |
| 316 | Ga0207698_11080087 | 3300026142 | Bacteria | 815 |
| 317 | Ga0207698_11795600 | 3300026142 | Unclassified | 628 |
| 318 | Ga0209996_1036454 | 3300027395 | Bacteria | 724 |
| 319 | Ga0210002_1081864 | 3300027617 | Unclassified | 575 |
| 320 | Ga0209983_1025609 | 3300027665 | Unclassified | 1245 |
| 321 | Ga0209974_10051375 | 3300027876 | Bacteria | 1386 |
| 322 | Ga0209974_10174148 | 3300027876 | Bacteria | 786 |
| 323 | Ga0207428_10128912 | 3300027907 | Bacteria | 1936 |
| 324 | Ga0268266_10665223 | 3300028379 | Bacteria | 1003 |
| 325 | Ga0268265_10613903 | 3300028380 | Bacteria | 1041 |
| 326 | Ga0268264_11849403 | 3300028381 | Unclassified | 614 |
| 327 | Ga0307408_100017446 | 3300031548 | Bacteria | 4804 |
| 328 | Ga0307408_100035330 | 3300031548 | Unclassified | 3507 |
| 329 | Ga0307408_100046842 | 3300031548 | Unclassified | 3094 |
| 330 | Ga0307408_100120042 | 3300031548 | Unclassified | 2035 |
| 331 | Ga0307408_100142462 | 3300031548 | Unclassified | 1883 |
| 332 | Ga0307408_100161860 | 3300031548 | Bacteria | 1778 |
| 333 | Ga0307408_100303709 | 3300031548 | Bacteria | 1338 |
| 334 | Ga0307408_100346305 | 3300031548 | Bacteria | 1259 |
| 335 | Ga0307408_100368041 | 3300031548 | Unclassified | 1225 |
| 336 | Ga0307408_100944899 | 3300031548 | Bacteria | 791 |
| 337 | Ga0307405_10033706 | 3300031731 | Bacteria | 3040 |
| 338 | Ga0307405_10041167 | 3300031731 | Bacteria | 2803 |
| 339 | Ga0307405_10456718 | 3300031731 | Bacteria | 1014 |
| 340 | Ga0307405_10475762 | 3300031731 | Unclassified | 996 |
| 341 | Ga0307405_11074300 | 3300031731 | Bacteria | 690 |
| 342 | Ga0307413_10002597 | 3300031824 | Bacteria | 7386 |
| 343 | Ga0307413_10013302 | 3300031824 | Bacteria | 4132 |
| 344 | Ga0307413_10013881 | 3300031824 | Unclassified | 4071 |
| 345 | Ga0307413_10024842 | 3300031824 | Unclassified | 3274 |
| 346 | Ga0307413_10044922 | 3300031824 | Bacteria | 2614 |
| 347 | Ga0307413_10356809 | 3300031824 | Bacteria | 1130 |
| 348 | Ga0307413_10400352 | 3300031824 | Bacteria | 1075 |
| 349 | Ga0307413_10401955 | 3300031824 | Bacteria | 1073 |
| 350 | Ga0307413_10534134 | 3300031824 | Bacteria | 948 |
| 351 | Ga0307413_10970259 | 3300031824 | Unclassified | 726 |
| 352 | Ga0307410_10005776 | 3300031852 | Bacteria | 6596 |
| 353 | Ga0307410_10010410 | 3300031852 | Bacteria | 5265 |
| 354 | Ga0307410_10031744 | 3300031852 | Bacteria | 3393 |
| 355 | Ga0307410_10033699 | 3300031852 | Unclassified | 3308 |
| 356 | Ga0307410_10078931 | 3300031852 | Unclassified | 2305 |
| 357 | Ga0307410_10158784 | 3300031852 | Unclassified | 1692 |
| 358 | Ga0307410_10163043 | 3300031852 | Bacteria | 1672 |
| 359 | Ga0307410_10294875 | 3300031852 | Bacteria | 1277 |
| 360 | Ga0307410_10455166 | 3300031852 | Unclassified | 1045 |
| 361 | Ga0307410_10543406 | 3300031852 | Unclassified | 962 |
| 362 | Ga0307410_11785245 | 3300031852 | Bacteria | 546 |
| 363 | Ga0307406_10018933 | 3300031901 | Bacteria | 4033 |
| 364 | Ga0307406_10024952 | 3300031901 | Bacteria | 3575 |
| 365 | Ga0307406_10034168 | 3300031901 | Bacteria | 3118 |
| 366 | Ga0307406_10041436 | 3300031901 | Unclassified | 2869 |
| 367 | Ga0307406_10055373 | 3300031901 | Unclassified | 2535 |
| 368 | Ga0307406_10288915 | 3300031901 | Bacteria | 1254 |
| 369 | Ga0307407_10018255 | 3300031903 | Unclassified | 3543 |
| 370 | Ga0307407_10019247 | 3300031903 | Bacteria | 3472 |
| 371 | Ga0307407_10029885 | 3300031903 | Bacteria | 2932 |
| 372 | Ga0307407_10053604 | 3300031903 | Unclassified | 2321 |
| 373 | Ga0307407_10075528 | 3300031903 | Bacteria | 2020 |
| 374 | Ga0307407_10150509 | 3300031903 | Unclassified | 1512 |
| 375 | Ga0307407_10215296 | 3300031903 | Unclassified | 1296 |
| 376 | Ga0307407_10400691 | 3300031903 | Bacteria | 984 |
| 377 | Ga0307407_10592779 | 3300031903 | Unclassified | 824 |
| 378 | Ga0307407_11494794 | 3300031903 | Bacteria | 534 |
| 379 | Ga0307412_10022076 | 3300031911 | Unclassified | 3896 |
| 380 | Ga0307412_10171773 | 3300031911 | Unclassified | 1621 |
| 381 | Ga0307412_10223447 | 3300031911 | Unclassified | 1445 |
| 382 | Ga0307412_10235025 | 3300031911 | Unclassified | 1414 |
| 383 | Ga0307412_10245613 | 3300031911 | Unclassified | 1387 |
| 384 | Ga0307412_10957641 | 3300031911 | Bacteria | 754 |
| 385 | Ga0307412_11741594 | 3300031911 | Bacteria | 572 |
| 386 | Ga0307412_12026377 | 3300031911 | Bacteria | 533 |
| 387 | Ga0307412_12204420 | 3300031911 | Unclassified | 513 |
| 388 | Ga0307409_100008828 | 3300031995 | Bacteria | 6147 |
| 389 | Ga0307409_100014601 | 3300031995 | Bacteria | 5118 |
| 390 | Ga0307409_100017388 | 3300031995 | Bacteria | 4791 |
| 391 | Ga0307409_100031889 | 3300031995 | Bacteria | 3811 |
| 392 | Ga0307409_100054670 | 3300031995 | Unclassified | 3077 |
| 393 | Ga0307409_100070606 | 3300031995 | Bacteria | 2773 |
| 394 | Ga0307409_100118123 | 3300031995 | Bacteria | 2239 |
| 395 | Ga0307409_100171053 | 3300031995 | Bacteria | 1912 |
| 396 | Ga0307409_100230548 | 3300031995 | Bacteria | 1678 |
| 397 | Ga0307409_100273989 | 3300031995 | Bacteria | 1556 |
| 398 | Ga0307409_100299632 | 3300031995 | Bacteria | 1495 |
| 399 | Ga0307409_100477298 | 3300031995 | Bacteria | 1209 |
| 400 | Ga0307409_100623745 | 3300031995 | Bacteria | 1068 |
| 401 | Ga0307409_100637331 | 3300031995 | Bacteria | 1058 |
| 402 | Ga0307409_101128468 | 3300031995 | Unclassified | 806 |
| 403 | Ga0307409_102163127 | 3300031995 | Unclassified | 586 |
| 404 | Ga0307409_102411344 | 3300031995 | Unclassified | 555 |
| 405 | Ga0307416_100023647 | 3300032002 | Bacteria | 4465 |
| 406 | Ga0307416_100111551 | 3300032002 | Bacteria | 2411 |
| 407 | Ga0307416_100117541 | 3300032002 | Bacteria | 2361 |
| 408 | Ga0307416_100155199 | 3300032002 | Unclassified | 2106 |
| 409 | Ga0307416_100335950 | 3300032002 | Unclassified | 1521 |
| 410 | Ga0307416_100352775 | 3300032002 | Bacteria | 1489 |
| 411 | Ga0307416_100353459 | 3300032002 | Unclassified | 1488 |
| 412 | Ga0307416_100428337 | 3300032002 | Unclassified | 1369 |
| 413 | Ga0307416_100451051 | 3300032002 | Bacteria | 1339 |
| 414 | Ga0307416_100559730 | 3300032002 | Bacteria | 1218 |
| 415 | Ga0307416_100589404 | 3300032002 | Unclassified | 1190 |
| 416 | Ga0307416_101221499 | 3300032002 | Unclassified | 857 |
| 417 | Ga0307416_101530571 | 3300032002 | Bacteria | 773 |
| 418 | Ga0307416_103118313 | 3300032002 | Bacteria | 554 |
| 419 | Ga0307414_10005275 | 3300032004 | Bacteria | 7100 |
| 420 | Ga0307414_10024205 | 3300032004 | Bacteria | 3867 |
| 421 | Ga0307414_10063272 | 3300032004 | Bacteria | 2629 |
| 422 | Ga0307414_10096388 | 3300032004 | Bacteria | 2213 |
| 423 | Ga0307414_10119815 | 3300032004 | Unclassified | 2021 |
| 424 | Ga0307414_10214978 | 3300032004 | Unclassified | 1574 |
| 425 | Ga0307414_10259363 | 3300032004 | Bacteria | 1449 |
| 426 | Ga0307414_10393099 | 3300032004 | Unclassified | 1202 |
| 427 | Ga0307414_10959164 | 3300032004 | Unclassified | 786 |
| 428 | Ga0307414_11377148 | 3300032004 | Bacteria | 655 |
| 429 | Ga0307411_10001034 | 3300032005 | Bacteria | 10749 |
| 430 | Ga0307411_10013184 | 3300032005 | Bacteria | 4549 |
| 431 | Ga0307411_10034789 | 3300032005 | Bacteria | 3139 |
| 432 | Ga0307411_10038164 | 3300032005 | Bacteria | 3027 |
| 433 | Ga0307411_10040009 | 3300032005 | Bacteria | 2970 |
| 434 | Ga0307411_10089549 | 3300032005 | Bacteria | 2144 |
| 435 | Ga0307411_10182155 | 3300032005 | Unclassified | 1595 |
| 436 | Ga0307411_10282292 | 3300032005 | Bacteria | 1322 |
| 437 | Ga0307411_10324593 | 3300032005 | Bacteria | 1244 |
| 438 | Ga0307411_10327041 | 3300032005 | Unclassified | 1240 |
| 439 | Ga0307411_10329784 | 3300032005 | Unclassified | 1236 |
| 440 | Ga0307411_11570490 | 3300032005 | Unclassified | 606 |
| 441 | Ga0307415_100219193 | 3300032126 | Unclassified | 1524 |
| 442 | Ga0307415_100332400 | 3300032126 | Bacteria | 1272 |
| 443 | Ga0307415_100398974 | 3300032126 | Bacteria | 1173 |
| 444 | Ga0307415_100437861 | 3300032126 | Bacteria | 1126 |
| 445 | Ga0307415_100526443 | 3300032126 | Unclassified | 1039 |
| 446 | Ga0307415_100567606 | 3300032126 | Unclassified | 1004 |
| 447 | Ga0307415_100670009 | 3300032126 | Unclassified | 932 |
| 448 | Ga0307415_100857848 | 3300032126 | Unclassified | 834 |
| 449 | Ga0307415_100873034 | 3300032126 | Unclassified | 827 |
| 450 | Ga0307415_101694968 | 3300032126 | Bacteria | 609 |
| 451 | Ga0373930_0049812 | 3300034816 | Bacteria | 912 |
| 452 | Ga0373930_0068407 | 3300034816 | Unclassified | 803 |
| 453 | Ga0373948_0023731 | 3300034817 | Bacteria | 1192 |
| 454 | Ga0373948_0095033 | 3300034817 | Bacteria | 696 |
| 455 | Ga0373958_0049215 | 3300034819 | Unclassified | 886 |
| 456 | Ga0373959_0016460 | 3300034820 | Unclassified | 1371 |
| 457 | Ga0373938_0146176 | 3300034957 | Unclassified | 626 |
| 458 | Ga0373928_0031726 | 3300035084 | Unclassified | 1175 |
| 459 | Ga0373928_0038504 | 3300035084 | Bacteria | 1089 |
| 460 | Ga0373928_0171644 | 3300035084 | Unclassified | 612 |
| 461 | Ga0373929_0020684 | 3300035085 | Bacteria | 1329 |
| 462 | Ga0373940_0026009 | 3300035088 | Bacteria | 1528 |
| 463 | Ga0373940_0066804 | 3300035088 | Unclassified | 1039 |
| 464 | Ga0373944_0169931 | 3300035089 | Unclassified | 777 |
| 465 | Ga0373951_0123447 | 3300035091 | Unclassified | 707 |
| 466 | Ga0373952_0270398 | 3300035092 | Unclassified | 521 |
| 467 | Ga0373932_0021847 | 3300035112 | Bacteria | 1694 |
| 468 | Ga0373939_0103784 | 3300035114 | Unclassified | 980 |
| 469 | Ga0373939_0157143 | 3300035114 | Bacteria | 832 |
| 470 | Ga0373960_0101462 | 3300035121 | Unclassified | 933 |
| 471 | Ga0373960_0116298 | 3300035121 | Bacteria | 883 |
| 472 | Ga0373942_0216396 | 3300035207 | Bacteria | 641 |
| 473 | Ga0373961_0222428 | 3300035241 | Unclassified | 674 |
| 474 | Ga0316574_0712861 | 3300035398 | Bacteria | 615 |
| 475 | Ga0373931_0038441 | 3300035691 | Unclassified | 2503 |
| 476 | Ga0373931_0048130 | 3300035691 | Bacteria | 2259 |
| 477 | Ga0373931_0073546 | 3300035691 | Bacteria | 1870 |
| 478 | Ga0373931_0180578 | 3300035691 | Bacteria | 1249 |
| 479 | Ga0373931_0654022 | 3300035691 | Bacteria | 691 |
| 480 | Ga0373931_0737125 | 3300035691 | Bacteria | 653 |
| 481 | Ga0373937_0098633 | 3300036401 | Bacteria | 2710 |
| 482 | Ga0316584_1175599 | 3300036712 | Bacteria | 507 |
| 483 | Ga0395898_1044879 | 3300037466 | Unclassified | 752 |
| 484 | Ga0395905_0205032 | 3300037471 | Bacteria | 1848 |
| 485 | Ga0395905_0229759 | 3300037471 | Bacteria | 1735 |
| 486 | Ga0395905_0290424 | 3300037471 | Bacteria | 1522 |
| 487 | Ga0395905_0403338 | 3300037471 | Bacteria | 1262 |
| 488 | Ga0395905_0657706 | 3300037471 | Unclassified | 950 |
| 489 | Ga0395905_0884361 | 3300037471 | Unclassified | 796 |
| 490 | Ga0242419_001522 | 3300038698 | Bacteria | 1436 |
| 491 | Ga0242420_004366 | 3300038996 | Bacteria | 2135 |
| 492 | Ga0242420_014804 | 3300038996 | Bacteria | 1342 |
| 493 | Ga0439439_0105766 | 3300041406 | Bacteria | 777 |
| 494 | Ga0439461_0118031 | 3300041410 | Bacteria | 661 |
| 495 | Ga0451807_0058792 | 3300041486 | Bacteria | 946 |
| 496 | Ga0451853_0749134 | 3300041512 | Unclassified | 572 |
| 497 | Ga0439431_0082909 | 3300041997 | Bacteria | 866 |
| 498 | Ga0439445_0055426 | 3300042004 | Bacteria | 1076 |
| 499 | Ga0439448_0080396 | 3300042005 | Unclassified | 1094 |
| 500 | Ga0439448_0142521 | 3300042005 | Bacteria | 830 |
| 501 | Ga0439455_0126557 | 3300042012 | Bacteria | 719 |
| 502 | Ga0439462_0010059 | 3300042015 | Bacteria | 2394 |
| 503 | Ga0450890_025348 | 3300042127 | Bacteria | 822 |
| 504 | Ga0439446_0236499 | 3300042156 | Unclassified | 626 |
| 505 | Ga0439458_0195427 | 3300042157 | Bacteria | 552 |
| 506 | Ga0439434_0324812 | 3300042435 | Unclassified | 534 |
| 507 | Ga0439459_0146663 | 3300042438 | Unclassified | 614 |
| 508 | Ga0439464_0284008 | 3300042439 | Bacteria | 539 |
| 509 | Ga0439460_0259961 | 3300042461 | Bacteria | 601 |
| 510 | Ga0451577_0157437 | 3300042876 | Bacteria | 2045 |
| 511 | Ga0451577_0182070 | 3300042876 | Bacteria | 1894 |
| 512 | Ga0453683_0031796 | 3300044673 | Bacteria | 3333 |
| 513 | Ga0453683_0205342 | 3300044673 | Bacteria | 1251 |
| 514 | Ga0466964_0098028 | 3300044706 | Unclassified | 1287 |
| 515 | Ga0453684_2273931 | 3300044712 | Unclassified | 540 |
| 516 | Ga0466970_0155035 | 3300044765 | Unclassified | 1266 |
| 517 | Ga0466970_0253961 | 3300044765 | Bacteria | 986 |
| 518 | Ga0451576_2002612 | 3300045051 | Unclassified | 597 |
| 519 | Ga0451576_2393083 | 3300045051 | Bacteria | 540 |
| 520 | Ga0466967_0427573 | 3300045976 | Unclassified | 1292 |
| 521 | Ga0495603_0021286 | 3300046455 | Bacteria | 3927 |
| 522 | Ga0495641_0309617 | 3300046461 | Unclassified | 712 |
| 523 | Ga0495580_0101484 | 3300046472 | Bacteria | 2001 |
| 524 | Ga0495580_0134240 | 3300046472 | Bacteria | 1716 |
| 525 | Ga0495582_0080953 | 3300046473 | Unclassified | 1803 |
| 526 | Ga0495639_0022170 | 3300046475 | Bacteria | 2784 |
| 527 | Ga0495662_0215189 | 3300046476 | Bacteria | 947 |
| 528 | Ga0495664_0099602 | 3300046477 | Bacteria | 1750 |
| 529 | Ga0495594_0014838 | 3300046499 | Bacteria | 4088 |
| 530 | Ga0495618_0040569 | 3300046514 | Bacteria | 2930 |
| 531 | Ga0495630_0132616 | 3300046517 | Bacteria | 1892 |
| 532 | Ga0495666_0009103 | 3300046526 | Bacteria | 4967 |
| 533 | Ga0495640_0133709 | 3300046533 | Bacteria | 1603 |
| 534 | Ga0495586_0008369 | 3300046535 | Bacteria | 5505 |
| 535 | Ga0495621_0338828 | 3300046539 | Unclassified | 629 |
| 536 | Ga0495667_0115664 | 3300046559 | Bacteria | 1733 |
| 537 | Ga0495634_0004444 | 3300046642 | Bacteria | 11011 |
| 538 | Ga0495647_0002129 | 3300046681 | Bacteria | 6188 |
| 539 | Ga0495658_0115423 | 3300046683 | Bacteria | 1618 |
| 540 | Ga0495613_0115368 | 3300046689 | Bacteria | 1933 |
| 541 | Ga0495624_0603515 | 3300046690 | Unclassified | 654 |
| 542 | Ga0495670_0225910 | 3300046691 | Unclassified | 995 |
| 543 | Ga0495581_0096350 | 3300047315 | Bacteria | 1718 |
| 544 | Ga0495604_0281727 | 3300047317 | Bacteria | 1123 |
| 545 | Ga0495674_0045772 | 3300047319 | Bacteria | 3885 |
| 546 | Ga0495674_1214591 | 3300047319 | Unclassified | 569 |
| 547 | Ga0495680_0116417 | 3300047322 | Unclassified | 1976 |
| 548 | Ga0495684_0143270 | 3300047471 | Unclassified | 1791 |
| 549 | Ga0495614_0345004 | 3300048089 | Unclassified | 693 |
| 550 | Ga0496100_0059509 | 3300048903 | Bacteria | 2511 |
| 551 | Ga0496100_0509117 | 3300048903 | Unclassified | 928 |
| 552 | Ga0496100_1100024 | 3300048903 | Unclassified | 626 |
| 553 | Ga0496101_0030987 | 3300048904 | Unclassified | 3756 |
| 554 | Ga0496101_0063844 | 3300048904 | Unclassified | 2682 |
| 555 | Ga0496101_0101026 | 3300048904 | Bacteria | 2159 |
| 556 | Ga0496101_0312659 | 3300048904 | Unclassified | 1232 |
| 557 | Ga0496102_0025535 | 3300048905 | Bacteria | 5260 |
| 558 | Ga0496102_0035385 | 3300048905 | Unclassified | 4495 |
| 559 | Ga0496102_0100099 | 3300048905 | Unclassified | 2691 |
| 560 | Ga0496102_0133172 | 3300048905 | Unclassified | 2328 |
| 561 | Ga0496102_0134309 | 3300048905 | Bacteria | 2318 |
| 562 | Ga0496102_0846205 | 3300048905 | Bacteria | 837 |
| 563 | Ga0496102_0959223 | 3300048905 | Unclassified | 776 |
| 564 | Ga0496102_1212359 | 3300048905 | Unclassified | 674 |
| 565 | Ga0496103_0004939 | 3300048906 | Bacteria | 8050 |
| 566 | Ga0496103_0118125 | 3300048906 | Unclassified | 1688 |
| 567 | Ga0496103_0182658 | 3300048906 | Unclassified | 1348 |
| 568 | Ga0496103_0383482 | 3300048906 | Unclassified | 903 |
| 569 | Ga0496104_0011004 | 3300048907 | Bacteria | 8093 |
| 570 | Ga0496104_0051831 | 3300048907 | Bacteria | 3874 |
| 571 | Ga0496104_0112788 | 3300048907 | Bacteria | 2607 |
| 572 | Ga0496104_0610434 | 3300048907 | Unclassified | 1001 |
| 573 | Ga0496105_0015793 | 3300048908 | Bacteria | 6024 |
| 574 | Ga0496105_0271874 | 3300048908 | Unclassified | 1368 |
| 575 | Ga0496105_0494049 | 3300048908 | Unclassified | 961 |
| 576 | Ga0496105_0774498 | 3300048908 | Bacteria | 731 |
| 577 | Ga0496106_0033960 | 3300048909 | Unclassified | 3808 |
| 578 | Ga0496106_0104597 | 3300048909 | Unclassified | 2198 |
| 579 | Ga0496106_0120395 | 3300048909 | Unclassified | 2051 |
| 580 | Ga0496106_0425066 | 3300048909 | Bacteria | 1068 |
| 581 | Ga0496106_0932691 | 3300048909 | Bacteria | 684 |
| 582 | Ga0496107_0171092 | 3300048910 | Unclassified | 1612 |
| 583 | Ga0496107_1205869 | 3300048910 | Unclassified | 544 |
| 584 | Ga0496108_0000296 | 3300048911 | Bacteria | 42798 |
| 585 | Ga0496108_0010751 | 3300048911 | Bacteria | 7430 |
| 586 | Ga0496108_0045481 | 3300048911 | Bacteria | 3666 |
| 587 | Ga0496108_0074660 | 3300048911 | Bacteria | 2863 |
| 588 | Ga0496108_0090199 | 3300048911 | Unclassified | 2606 |
| 589 | Ga0496108_0731962 | 3300048911 | Unclassified | 856 |
| 590 | Ga0496108_1456915 | 3300048911 | Unclassified | 571 |
| 591 | Ga0496109_0000206 | 3300048912 | Bacteria | 58007 |
| 592 | Ga0496109_0007468 | 3300048912 | Bacteria | 9258 |
| 593 | Ga0496109_0015274 | 3300048912 | Bacteria | 6686 |
| 594 | Ga0496109_0024001 | 3300048912 | Bacteria | 5417 |
| 595 | Ga0496109_0434419 | 3300048912 | Bacteria | 1240 |
| 596 | Ga0496109_0537482 | 3300048912 | Bacteria | 1103 |
| 597 | Ga0496110_0000500 | 3300048913 | Bacteria | 26635 |
| 598 | Ga0496110_0006099 | 3300048913 | Bacteria | 9499 |
| 599 | Ga0496110_0011118 | 3300048913 | Bacteria | 7353 |
| 600 | Ga0496110_0070480 | 3300048913 | Bacteria | 3097 |
| 601 | Ga0496110_0594697 | 3300048913 | Bacteria | 1004 |
| 602 | Ga0496111_0004448 | 3300048914 | Bacteria | 8862 |
| 603 | Ga0496111_0026705 | 3300048914 | Bacteria | 4078 |
| 604 | Ga0496111_0029659 | 3300048914 | Bacteria | 3886 |
| 605 | Ga0496111_0172085 | 3300048914 | Unclassified | 1609 |
| 606 | Ga0496111_0493090 | 3300048914 | Unclassified | 902 |
| 607 | Ga0496111_0495571 | 3300048914 | Bacteria | 899 |
| 608 | Ga0496112_0000114 | 3300048915 | Bacteria | 49840 |
| 609 | Ga0496112_0000557 | 3300048915 | Bacteria | 25556 |
| 610 | Ga0496112_0041172 | 3300048915 | Bacteria | 4518 |
| 611 | Ga0496112_0058973 | 3300048915 | Bacteria | 3781 |
| 612 | Ga0496112_1916655 | 3300048915 | Bacteria | 504 |
| 613 | Ga0496113_0000106 | 3300048916 | Bacteria | 35660 |
| 614 | Ga0496113_0016920 | 3300048916 | Bacteria | 5047 |
| 615 | Ga0496113_0021595 | 3300048916 | Bacteria | 4542 |
| 616 | Ga0496113_0135430 | 3300048916 | Bacteria | 1935 |
| 617 | Ga0496114_0287600 | 3300048917 | Bacteria | 1450 |
| 618 | Ga0496114_0329179 | 3300048917 | Bacteria | 1350 |
| 619 | Ga0496114_0427836 | 3300048917 | Bacteria | 1173 |
| 620 | Ga0496115_0031645 | 3300048918 | Bacteria | 4169 |
| 621 | Ga0501292_027836 | 3300049515 | Bacteria | 938 |
| 622 | Ga0501292_115262 | 3300049515 | Bacteria | 544 |
| 623 | Ga0501294_017076 | 3300049517 | Unclassified | 760 |
| 624 | Ga0501295_116830 | 3300049518 | Unclassified | 638 |
| 625 | Ga0501296_014573 | 3300049519 | Bacteria | 966 |
| 626 | Ga0501298_202080 | 3300049521 | Bacteria | 505 |
| 627 | Ga0501299_018658 | 3300049522 | Bacteria | 1249 |
| 628 | Ga0501031_0069426 | 3300049568 | Bacteria | 2295 |
| 629 | Ga0501031_0141770 | 3300049568 | Unclassified | 1571 |
| 630 | Ga0501031_0162050 | 3300049568 | Bacteria | 1462 |
| 631 | Ga0501032_0121953 | 3300049569 | Bacteria | 1723 |
| 632 | Ga0501033_1062469 | 3300049570 | Unclassified | 539 |
| 633 | Ga0501036_0065253 | 3300049572 | Bacteria | 3082 |
| 634 | Ga0501036_0308606 | 3300049572 | Bacteria | 1323 |
| 635 | Ga0501036_1132909 | 3300049572 | Unclassified | 639 |
| 636 | Ga0501037_0026868 | 3300049573 | Bacteria | 4252 |
| 637 | Ga0501037_0659220 | 3300049573 | Bacteria | 699 |
| 638 | Ga0501037_0910203 | 3300049573 | Unclassified | 576 |
| 639 | Ga0501038_0028761 | 3300049574 | Unclassified | 4935 |
| 640 | Ga0501038_0137086 | 3300049574 | Bacteria | 2004 |
| 641 | Ga0501038_0538463 | 3300049574 | Bacteria | 889 |
| 642 | Ga0501038_0803368 | 3300049574 | Bacteria | 699 |
| 643 | Ga0501038_1343047 | 3300049574 | Unclassified | 515 |
| 644 | Ga0501039_0032427 | 3300049575 | Bacteria | 4028 |
| 645 | Ga0501039_1509432 | 3300049575 | Unclassified | 516 |
| 646 | Ga0501040_0019143 | 3300049576 | Bacteria | 4552 |
| 647 | Ga0501040_0056900 | 3300049576 | Unclassified | 2684 |
| 648 | Ga0501041_0050417 | 3300049577 | Unclassified | 2537 |
| 649 | Ga0501041_0066469 | 3300049577 | Unclassified | 2209 |
| 650 | Ga0501041_0979462 | 3300049577 | Bacteria | 544 |
| 651 | Ga0501041_0992884 | 3300049577 | Bacteria | 540 |
| 652 | Ga0501042_0020314 | 3300049578 | Bacteria | 4622 |
| 653 | Ga0501042_0114248 | 3300049578 | Bacteria | 1944 |
| 654 | Ga0501042_0596089 | 3300049578 | Unclassified | 803 |
| 655 | Ga0501042_1164261 | 3300049578 | Unclassified | 562 |
| 656 | Ga0501046_0026077 | 3300049580 | Bacteria | 4776 |
| 657 | Ga0501046_0078142 | 3300049580 | Bacteria | 2561 |
| 658 | Ga0501046_0129083 | 3300049580 | Bacteria | 1918 |
| 659 | Ga0501048_0004804 | 3300049582 | Bacteria | 10298 |
| 660 | Ga0501048_0123609 | 3300049582 | Unclassified | 1829 |
| 661 | Ga0501048_0382068 | 3300049582 | Bacteria | 1006 |
| 662 | Ga0501067_0001508 | 3300049583 | Bacteria | 12682 |
| 663 | Ga0501067_0044924 | 3300049583 | Bacteria | 2454 |
| 664 | Ga0501067_0069572 | 3300049583 | Unclassified | 1949 |
| 665 | Ga0501067_0282016 | 3300049583 | Bacteria | 925 |
| 666 | Ga0501067_0472781 | 3300049583 | Unclassified | 700 |
| 667 | Ga0501067_0612026 | 3300049583 | Unclassified | 611 |
| 668 | Ga0501067_0655560 | 3300049583 | Unclassified | 589 |
| 669 | Ga0501068_0012771 | 3300049584 | Bacteria | 4769 |
| 670 | Ga0501068_0066458 | 3300049584 | Bacteria | 2196 |
| 671 | Ga0501068_0097623 | 3300049584 | Bacteria | 1818 |
| 672 | Ga0501069_0065873 | 3300049585 | Bacteria | 2026 |
| 673 | Ga0501069_0094623 | 3300049585 | Bacteria | 1691 |
| 674 | Ga0501069_0144496 | 3300049585 | Unclassified | 1365 |
| 675 | Ga0501070_0664644 | 3300049586 | Bacteria | 826 |
| 676 | Ga0501070_0885818 | 3300049586 | Unclassified | 697 |
| 677 | Ga0501071_0005331 | 3300049587 | Bacteria | 8256 |
| 678 | Ga0501071_0061047 | 3300049587 | Bacteria | 2730 |
| 679 | Ga0501071_0102577 | 3300049587 | Bacteria | 2110 |
| 680 | Ga0501071_0165679 | 3300049587 | Bacteria | 1654 |
| 681 | Ga0501071_0464016 | 3300049587 | Unclassified | 970 |
| 682 | Ga0501072_0004356 | 3300049588 | Bacteria | 10742 |
| 683 | Ga0501072_0098594 | 3300049588 | Bacteria | 2323 |
| 684 | Ga0501074_0045787 | 3300049590 | Bacteria | 3164 |
| 685 | Ga0501074_0117520 | 3300049590 | Unclassified | 1902 |
| 686 | Ga0501075_0004067 | 3300049591 | Bacteria | 9874 |
| 687 | Ga0501075_0173067 | 3300049591 | Bacteria | 1648 |
| 688 | Ga0501075_0422589 | 3300049591 | Bacteria | 1016 |
| 689 | Ga0501076_0005204 | 3300049592 | Bacteria | 9317 |
| 690 | Ga0501076_0036546 | 3300049592 | Bacteria | 3849 |
| 691 | Ga0501076_0099206 | 3300049592 | Bacteria | 2346 |
| 692 | Ga0501076_0390477 | 3300049592 | Bacteria | 1144 |
| 693 | Ga0501076_0400340 | 3300049592 | Bacteria | 1129 |
| 694 | Ga0501077_0001286 | 3300049593 | Bacteria | 15161 |
| 695 | Ga0501077_0003264 | 3300049593 | Bacteria | 9768 |
| 696 | Ga0501077_0010406 | 3300049593 | Bacteria | 5789 |
| 697 | Ga0501198_035356 | 3300049649 | Unclassified | 849 |
| 698 | Ga0501201_039705 | 3300049651 | Unclassified | 562 |
| 699 | Ga0501202_174882 | 3300049652 | Bacteria | 576 |
| 700 | Ga0501202_206787 | 3300049652 | Unclassified | 539 |
| 701 | Ga0501209_002239 | 3300049656 | Bacteria | 2929 |
| 702 | Ga0501209_026845 | 3300049656 | Unclassified | 1425 |
| 703 | Ga0501209_030409 | 3300049656 | Unclassified | 1365 |
| 704 | Ga0501216_043909 | 3300049660 | Bacteria | 862 |
| 705 | Ga0501217_007548 | 3300049661 | Unclassified | 2334 |
| 706 | Ga0501217_051843 | 3300049661 | Bacteria | 1075 |
| 707 | Ga0501227_119540 | 3300049665 | Bacteria | 711 |
| 708 | Ga0501233_042923 | 3300049668 | Bacteria | 1069 |
| 709 | Ga0501235_166106 | 3300049669 | Unclassified | 580 |
| 710 | Ga0501236_018797 | 3300049670 | Bacteria | 1001 |
| 711 | Ga0501238_060802 | 3300049671 | Unclassified | 577 |
| 712 | Ga0501243_022114 | 3300049675 | Unclassified | 1052 |
| 713 | Ga0501243_049150 | 3300049675 | Bacteria | 757 |
| 714 | Ga0501247_000053 | 3300049677 | Bacteria | 6344 |
| 715 | Ga0501247_064187 | 3300049677 | Bacteria | 569 |
| 716 | Ga0501248_060754 | 3300049678 | Bacteria | 504 |
| 717 | Ga0501249_001020 | 3300049679 | Bacteria | 6017 |
| 718 | Ga0501249_105183 | 3300049679 | Unclassified | 678 |
| 719 | Ga0501249_216558 | 3300049679 | Unclassified | 509 |
| 720 | Ga0501252_018726 | 3300049682 | Bacteria | 889 |
| 721 | Ga0501257_181700 | 3300049686 | Unclassified | 596 |
| 722 | Ga0501221_021259 | 3300049704 | Archaea | 1276 |
| 723 | Ga0501225_0088041 | 3300049705 | Bacteria | 897 |
| 724 | Ga0501225_0179792 | 3300049705 | Unclassified | 660 |
| 725 | Ga0501234_034172 | 3300049707 | Bacteria | 825 |
| 726 | Ga0501245_003819 | 3300049708 | Unclassified | 2060 |
| 727 | Ga0501079_0005929 | 3300049741 | Bacteria | 9154 |
| 728 | Ga0501079_0007043 | 3300049741 | Bacteria | 8484 |
| 729 | Ga0501079_0167762 | 3300049741 | Bacteria | 1712 |
| 730 | Ga0501079_0508694 | 3300049741 | Bacteria | 947 |
| 731 | Ga0501080_0020527 | 3300049742 | Bacteria | 6117 |
| 732 | Ga0501080_0129326 | 3300049742 | Bacteria | 2338 |
| 733 | Ga0501080_0176266 | 3300049742 | Unclassified | 1969 |
| 734 | Ga0501080_1573642 | 3300049742 | Bacteria | 557 |
| 735 | Ga0501081_0005531 | 3300049743 | Bacteria | 8155 |
| 736 | Ga0501081_0013752 | 3300049743 | Bacteria | 5324 |
| 737 | Ga0501081_0025188 | 3300049743 | Bacteria | 4000 |
| 738 | Ga0501083_0019650 | 3300049744 | Bacteria | 4705 |
| 739 | Ga0501083_0344922 | 3300049744 | Unclassified | 968 |
| 740 | Ga0501232_043925 | 3300049757 | Bacteria | 668 |
| 741 | Ga0501268_004128 | 3300049765 | Unclassified | 2032 |
| 742 | Ga0501268_020128 | 3300049765 | Archaea | 1134 |
| 743 | Ga0501268_099602 | 3300049765 | Bacteria | 621 |
| 744 | Ga0501270_022098 | 3300049767 | Unclassified | 979 |
| 745 | Ga0501271_038318 | 3300049768 | Bacteria | 616 |
| 746 | Ga0501271_052322 | 3300049768 | Unclassified | 557 |
| 747 | Ga0501272_000381 | 3300049769 | Unclassified | 3908 |
| 748 | Ga0501273_000747 | 3300049770 | Bacteria | 2790 |
| 749 | Ga0501273_051803 | 3300049770 | Unclassified | 629 |
| 750 | Ga0501275_039322 | 3300049772 | Bacteria | 657 |
| 751 | Ga0501279_078742 | 3300049775 | Bacteria | 565 |
| 752 | Ga0501283_011829 | 3300049779 | Bacteria | 1303 |
| 753 | Ga0501035_0160265 | 3300049822 | Bacteria | 1948 |
| 754 | Ga0501044_0943030 | 3300049823 | Bacteria | 736 |
| 755 | Ga0501045_0002145 | 3300049824 | Bacteria | 13350 |
| 756 | Ga0501045_0015354 | 3300049824 | Bacteria | 5437 |
| 757 | Ga0501045_0019274 | 3300049824 | Bacteria | 4861 |
| 758 | Ga0501045_0518240 | 3300049824 | Bacteria | 885 |
| 759 | Ga0501045_0861580 | 3300049824 | Bacteria | 666 |
| 760 | Ga0501212_059399 | 3300049851 | Bacteria | 660 |
| 761 | Ga0501212_114909 | 3300049851 | Unclassified | 517 |
| 762 | nmdc:mga05p37_108333_c1 | 3300050507 | Unclassified | 3418 |
| 763 | nmdc:mga05p37_1116450_c1 | 3300050507 | Bacteria | 824 |
| 764 | nmdc:mga05p37_1304020_c1 | 3300050507 | Bacteria | 740 |
| 765 | nmdc:mga05p37_1822247_c1 | 3300050507 | Bacteria | 586 |
| 766 | nmdc:mga05p37_32198_c1 | 3300050507 | Bacteria | 6411 |
| 767 | nmdc:mga0qj67_67898_c1 | 3300050509 | Bacteria | 2841 |
| 768 | nmdc:mga0qj67_789222_c1 | 3300050509 | Bacteria | 752 |
| 769 | nmdc:mga06r32_2808_c1 | 3300050510 | Bacteria | 15600 |
| 770 | nmdc:mga06r32_372628_c1 | 3300050510 | Unclassified | 1411 |
| 771 | nmdc:mga08y16_1905528_c1 | 3300050511 | Unclassified | 545 |
| 772 | nmdc:mga08y16_223304_c1 | 3300050511 | Unclassified | 1949 |
| 773 | nmdc:mga08y16_82152_c1 | 3300050511 | Bacteria | 3359 |
| 774 | nmdc:mga0n895_1188838_c1 | 3300050512 | Unclassified | 737 |
| 775 | nmdc:mga0n895_221878_c1 | 3300050512 | Unclassified | 1919 |
| 776 | nmdc:mga0n895_318857_c1 | 3300050512 | Unclassified | 1575 |
| 777 | nmdc:mga0n895_6797_c1 | 3300050512 | Bacteria | 9764 |
| 778 | nmdc:mga0rr50_1148083_c1 | 3300050513 | Bacteria | 660 |
| 779 | nmdc:mga0rr50_149750_c1 | 3300050513 | Bacteria | 1884 |
| 780 | nmdc:mga0rr50_172091_c1 | 3300050513 | Bacteria | 1765 |
| 781 | nmdc:mga0rr50_217855_c1 | 3300050513 | Bacteria | 1575 |
| 782 | nmdc:mga0rr50_903166_c1 | 3300050513 | Unclassified | 753 |
| 783 | nmdc:mga08x19_138214_c1 | 3300050514 | Unclassified | 1644 |
| 784 | nmdc:mga08x19_224541_c1 | 3300050514 | Bacteria | 1291 |
| 785 | nmdc:mga08x19_341210_c1 | 3300050514 | Bacteria | 1045 |
| 786 | nmdc:mga0a205_1251703_c1 | 3300050515 | Unclassified | 590 |
| 787 | nmdc:mga0a205_163474_c1 | 3300050515 | Bacteria | 2122 |
| 788 | nmdc:mga0a205_262172_c1 | 3300050515 | Bacteria | 1606 |
| 789 | nmdc:mga0a205_321349_c1 | 3300050515 | Unclassified | 1419 |
| 790 | Ga0501084_0004925 | 3300054114 | Bacteria | 10912 |
| 791 | Ga0501084_0014371 | 3300054114 | Bacteria | 6561 |
| 792 | Ga0501084_0039259 | 3300054114 | Bacteria | 3959 |
| 793 | Ga0501084_0517527 | 3300054114 | Bacteria | 1009 |
| 794 | Ga0590071_000704 | 3300059421 | Bacteria | 9469 |
| 795 | Ga0590071_006933 | 3300059421 | Bacteria | 2685 |
| 796 | Ga0590071_008655 | 3300059421 | Bacteria | 2393 |
| 797 | Ga0590074_007138 | 3300059423 | Bacteria | 1856 |
| 798 | Ga0590074_008559 | 3300059423 | Unclassified | 1704 |
| 799 | Ga0590074_025508 | 3300059423 | Bacteria | 1030 |
| 800 | Ga0590074_064291 | 3300059423 | Bacteria | 685 |
| 801 | Ga0590075_005634 | 3300059424 | Bacteria | 2958 |
| 802 | Ga0590075_013305 | 3300059424 | Unclassified | 2005 |
| 803 | Ga0590075_060413 | 3300059424 | Bacteria | 977 |
| 804 | Ga0590077_004353 | 3300059426 | Bacteria | 2908 |
| 805 | Ga0590077_025849 | 3300059426 | Unclassified | 1266 |
| 806 | Ga0590077_064342 | 3300059426 | Bacteria | 833 |
| 807 | Ga0501082_0010468 | 3300060353 | Bacteria | 7979 |
| 808 | Ga0501082_0012078 | 3300060353 | Bacteria | 7422 |
| 809 | Ga0501082_0019438 | 3300060353 | Bacteria | 5856 |
| 810 | Ga0501082_0245197 | 3300060353 | Unclassified | 1559 |
| 811 | Ga0501082_0817381 | 3300060353 | Bacteria | 815 |
| 812 | Ga0501082_1000951 | 3300060353 | Bacteria | 731 |
| 813 | Ga0501082_1909520 | 3300060353 | Unclassified | 518 |
| 814 | Ga0530510_0052005 | 3300061734 | Unclassified | 2960 |
| 815 | Ga0530510_0078881 | 3300061734 | Bacteria | 2395 |
| 816 | Ga0530510_0161804 | 3300061734 | Bacteria | 1656 |
| 817 | Ga0530510_0289560 | 3300061734 | Bacteria | 1224 |
| 818 | Ga0530510_0329280 | 3300061734 | Bacteria | 1146 |
| 819 | Ga0530510_0904973 | 3300061734 | Bacteria | 674 |
| 820 | Ga0530510_1329456 | 3300061734 | Bacteria | 551 |
| 821 | Ga0530510_1393251 | 3300061734 | Bacteria | 538 |
| 822 | Ga0105241_10733696 | |||
| 823 | MBSR1b_contig_10799852 | |||
| 824 | rootL2_10126547 | |||
| 825 | Ga0065715_10303158 | |||
| 826 | Ga0065715_10607325 | |||
| 827 | Ga0065707_10167551 | |||
| 828 | Ga0065707_10282508 | |||
| 829 | Ga0070676_10379568 | |||
| 830 | Ga0070683_100139425 | |||
| 831 | Ga0070683_100461097 | |||
| 832 | Ga0070683_102198075 | |||
| 833 | Ga0070690_100104302 | |||
| 834 | Ga0070690_100508907 | |||
| 835 | Ga0070670_100467440 | |||
| 836 | Ga0070677_10036338 | |||
| 837 | Ga0070677_10048686 | |||
| 838 | Ga0070677_10647278 | |||
| 839 | Ga0068869_102088468 | |||
| 840 | Ga0068869_102137679 | |||
| 841 | Ga0070680_100074875 | |||
| 842 | Ga0070680_100518244 | |||
| 843 | Ga0070680_101061743 | |||
| 844 | Ga0070682_100576426 | |||
| 845 | Ga0068868_102238933 | |||
| 846 | Ga0070660_101360025 | |||
| 847 | Ga0070691_10119055 | |||
| 848 | Ga0070691_10299822 | |||
| 849 | Ga0070661_100083365 | |||
| 850 | Ga0070661_101189626 | |||
| 851 | Ga0070692_10147345 | |||
| 852 | Ga0070668_102051259 | |||
| 853 | Ga0070669_100810155 | |||
| 854 | Ga0070675_100139713 | |||
| 855 | Ga0070675_100319169 | |||
| 856 | Ga0070675_100834958 | |||
| 857 | Ga0070671_100002000 | |||
| 858 | Ga0070674_100430496 | |||
| 859 | Ga0070674_101466482 | |||
| 860 | Ga0070673_100262282 | |||
| 861 | Ga0070688_100302659 | |||
| 862 | Ga0070659_100021582 | |||
| 863 | Ga0070659_100648609 | |||
| 864 | Ga0070667_101794937 | |||
| 865 | Ga0070703_10207784 | |||
| 866 | Ga0070703_10447000 | |||
| 867 | Ga0070709_10257722 | |||
| 868 | Ga0070709_11173882 | |||
| 869 | Ga0070713_101166380 | |||
| 870 | Ga0070713_101901039 | |||
| 871 | Ga0070710_10371277 | |||
| 872 | Ga0070701_10674958 | |||
| 873 | Ga0070711_100000946 | |||
| 874 | Ga0070711_100018953 | |||
| 875 | Ga0070711_100525816 | |||
| 876 | Ga0070711_101168432 | |||
| 877 | Ga0070705_100096969 | |||
| 878 | Ga0070705_100315068 | |||
| 879 | Ga0070705_100615722 | |||
| 880 | Ga0070705_100646784 | |||
| 881 | Ga0070700_100479308 | |||
| 882 | Ga0070700_100498419 | |||
| 883 | Ga0070700_101327386 | |||
| 884 | Ga0070700_101688596 | |||
| 885 | Ga0070694_100008730 | |||
| 886 | Ga0070694_100053528 | |||
| 887 | Ga0070694_100475841 | |||
| 888 | Ga0070694_101202468 | |||
| 889 | Ga0070708_100001169 | |||
| 890 | Ga0070708_100042398 | |||
| 891 | Ga0070708_100655411 | |||
| 892 | Ga0070708_100955988 | |||
| 893 | Ga0070663_100326129 | |||
| 894 | Ga0070663_100481447 | |||
| 895 | Ga0070663_101402560 | |||
| 896 | Ga0070678_101443636 | |||
| 897 | Ga0070662_100144496 | |||
| 898 | Ga0070681_10036835 | |||
| 899 | Ga0070681_10269462 | |||
| 900 | Ga0070681_12052801 | |||
| 901 | Ga0068867_100149081 | |||
| 902 | Ga0068867_100941532 | |||
| 903 | Ga0070685_10291147 | |||
| 904 | Ga0070685_11578788 | |||
| 905 | Ga0070706_100040313 | |||
| 906 | Ga0070706_100185150 | |||
| 907 | Ga0070706_100624338 | |||
| 908 | Ga0070707_100679150 | |||
| 909 | Ga0070707_101024816 | |||
| 910 | Ga0070707_102152627 | |||
| 911 | Ga0070698_100316986 | |||
| 912 | Ga0070698_100843349 | |||
| 913 | Ga0070698_101035686 | |||
| 914 | Ga0070698_102030468 | |||
| 915 | Ga0070699_100067838 | |||
| 916 | Ga0070699_100453140 | |||
| 917 | Ga0070699_100944451 | |||
| 918 | Ga0070699_101070748 | |||
| 919 | Ga0070679_100098788 | |||
| 920 | Ga0070679_102120442 | |||
| 921 | Ga0070684_100684250 | |||
| 922 | Ga0070684_101437323 | |||
| 923 | Ga0070684_101843037 | |||
| 924 | Ga0070697_100010580 | |||
| 925 | Ga0070697_100035778 | |||
| 926 | Ga0070697_100236343 | |||
| 927 | Ga0070697_100570532 | |||
| 928 | Ga0070697_100582133 | |||
| 929 | Ga0070697_100636343 | |||
| 930 | Ga0070697_100654060 | |||
| 931 | Ga0068853_102134555 | |||
| 932 | Ga0070672_100264098 | |||
| 933 | Ga0070672_100308125 | |||
| 934 | Ga0070686_100063275 | |||
| 935 | Ga0070695_100018051 | |||
| 936 | Ga0070695_100038201 | |||
| 937 | Ga0070695_100628160 | |||
| 938 | Ga0070696_100000833 | |||
| 939 | Ga0070696_100212023 | |||
| 940 | Ga0070696_100377663 | |||
| 941 | Ga0070696_101284864 | |||
| 942 | Ga0070693_100208262 | |||
| 943 | Ga0070693_100587692 | |||
| 944 | Ga0070693_100652929 | |||
| 945 | Ga0070704_100002387 | |||
| 946 | Ga0070704_100132610 | |||
| 947 | Ga0070704_100166488 | |||
| 948 | Ga0070704_100318543 | |||
| 949 | Ga0070664_100005951 | |||
| 950 | Ga0070664_100006491 | |||
| 951 | Ga0070664_100243875 | |||
| 952 | Ga0068857_100291238 | |||
| 953 | Ga0068857_101116244 | |||
| 954 | Ga0068854_101530710 | |||
| 955 | Ga0070702_100647134 | |||
| 956 | Ga0070702_100909717 | |||
| 957 | Ga0068852_101565219 | |||
| 958 | Ga0068859_100116976 | |||
| 959 | Ga0068864_100019445 | |||
| 960 | Ga0068864_100047655 | |||
| 961 | Ga0068864_100735176 | |||
| 962 | Ga0068861_100244915 | |||
| 963 | Ga0068861_102420302 | |||
| 964 | Ga0068858_101991817 | |||
| 965 | Ga0068860_101096234 | |||
| 966 | Ga0068862_101540014 | |||
| 967 | Ga0081455_10066837 | |||
| 968 | Ga0081538_10136747 | |||
| 969 | Ga0070715_10039502 | |||
| 970 | Ga0070715_10354579 | |||
| 971 | Ga0070712_100197510 | |||
| 972 | Ga0070712_100238761 | |||
| 973 | Ga0070712_100411244 | |||
| 974 | Ga0097621_100664938 | |||
| 975 | Ga0068871_100337589 | |||
| 976 | Ga0075428_100011005 | |||
| 977 | Ga0075428_100064427 | |||
| 978 | Ga0075430_100072231 | |||
| 979 | Ga0075430_100204707 | |||
| 980 | Ga0075430_100395216 | |||
| 981 | Ga0075430_101534282 | |||
| 982 | Ga0075431_100003213 | |||
| 983 | Ga0075431_100277807 | |||
| 984 | Ga0075431_100913703 | |||
| 985 | Ga0075433_10032494 | |||
| 986 | Ga0075433_10090631 | |||
| 987 | Ga0075433_10259733 | |||
| 988 | Ga0075434_100012920 | |||
| 989 | Ga0075434_100024907 | |||
| 990 | Ga0075434_100026049 | |||
| 991 | Ga0075434_100331178 | |||
| 992 | Ga0075434_100674899 | |||
| 993 | Ga0075429_100592496 | |||
| 994 | Ga0075436_100017353 | |||
| 995 | Ga0075436_100237230 | |||
| 996 | Ga0075436_100363174 | |||
| 997 | Ga0097620_100116976 | |||
| 998 | Ga0075435_100136518 | |||
| 999 | Ga0075435_100895481 | |||
| 1000 | Ga0111539_10190212 | |||
| 1001 | Ga0111539_10230831 | |||
| 1002 | Ga0111539_10627900 | |||
| 1003 | Ga0111539_10990659 | |||
| 1004 | Ga0105245_10161079 | |||
| 1005 | Ga0105245_10778129 | |||
| 1006 | Ga0114129_10002347 | |||
| 1007 | Ga0114129_10021905 | |||
| 1008 | Ga0114129_10235220 | |||
| 1009 | Ga0114129_10390418 | |||
| 1010 | Ga0114129_10537318 | |||
| 1011 | Ga0114129_10540076 | |||
| 1012 | Ga0114129_11816526 | |||
| 1013 | Ga0114129_11890155 | |||
| 1014 | Ga0114129_12146906 | |||
| 1015 | Ga0114129_12262122 | |||
| 1016 | Ga0105242_11938837 | |||
| 1017 | Ga0105248_10004344 | |||
| 1018 | Ga0105248_10143379 | |||
| 1019 | Ga0105248_10194235 | |||
| 1020 | Ga0105248_10200063 | |||
| 1021 | Ga0105248_10500218 | |||
| 1022 | Ga0105248_10545637 | |||
| 1023 | Ga0105248_10888591 | |||
| 1024 | Ga0105237_10637349 | |||
| 1025 | Ga0105249_10101256 | |||
| 1026 | Ga0105249_10570548 | |||
| 1027 | Ga0105249_10814866 | |||
| 1028 | Ga0105249_11563454 | |||
| 1029 | Ga0105249_12183236 | |||
| 1030 | Ga0105239_10004067 | |||
| 1031 | Ga0105239_11397407 | |||
| 1032 | Ga0105246_10130105 | |||
| 1033 | Ga0105246_10661944 | |||
| 1034 | Ga0105246_11361901 | |||
| 1035 | Ga0157373_10397495 | |||
| 1036 | Ga0157373_10643577 | |||
| 1037 | Ga0157378_11306559 | |||
| 1038 | Ga0163162_10001791 | |||
| 1039 | Ga0163162_10166596 | |||
| 1040 | Ga0163162_13178098 | |||
| 1041 | Ga0157375_11540433 | |||
| 1042 | Ga0157375_11709829 | |||
| 1043 | Ga0157375_11954099 | |||
| 1044 | Ga0163163_10640913 | |||
| 1045 | Ga0163163_10846019 | |||
| 1046 | Ga0163163_11182912 | |||
| 1047 | Ga0157380_10559428 | |||
| 1048 | Ga0182008_10081419 | |||
| 1049 | Ga0157377_10319418 | |||
| 1050 | Ga0157379_10024076 | |||
| 1051 | Ga0157376_10210550 | |||
| 1052 | Ga0207682_10175324 | |||
| 1053 | Ga0207692_10453070 | |||
| 1054 | Ga0207692_10645249 | |||
| 1055 | Ga0207642_10400268 | |||
| 1056 | Ga0207688_10179843 | |||
| 1057 | Ga0207685_10127815 | |||
| 1058 | Ga0207699_10342596 | |||
| 1059 | Ga0207699_10492862 | |||
| 1060 | Ga0207645_10474037 | |||
| 1061 | Ga0207684_10003882 | |||
| 1062 | Ga0207684_10403860 | |||
| 1063 | Ga0207684_10434270 | |||
| 1064 | Ga0207684_10551863 | |||
| 1065 | Ga0207684_10553472 | |||
| 1066 | Ga0207684_11312536 | |||
| 1067 | Ga0207707_10016778 | |||
| 1068 | Ga0207693_10232650 | |||
| 1069 | Ga0207693_10361392 | |||
| 1070 | Ga0207663_10061534 | |||
| 1071 | Ga0207663_10276138 | |||
| 1072 | Ga0207663_11091276 | |||
| 1073 | Ga0207663_11168249 | |||
| 1074 | Ga0207660_11066492 | |||
| 1075 | Ga0207662_10804679 | |||
| 1076 | Ga0207657_10368166 | |||
| 1077 | Ga0207649_10229569 | |||
| 1078 | Ga0207649_10252933 | |||
| 1079 | Ga0207649_10718832 | |||
| 1080 | Ga0207652_10323855 | |||
| 1081 | Ga0207652_10403542 | |||
| 1082 | Ga0207646_10022306 | |||
| 1083 | Ga0207646_10158210 | |||
| 1084 | Ga0207659_10302327 | |||
| 1085 | Ga0207659_10677963 | |||
| 1086 | Ga0207687_10114251 | |||
| 1087 | Ga0207700_10986584 | |||
| 1088 | Ga0207664_10416393 | |||
| 1089 | Ga0207644_10038523 | |||
| 1090 | Ga0207690_10014353 | |||
| 1091 | Ga0207690_10515455 | |||
| 1092 | Ga0207706_10117546 | |||
| 1093 | Ga0207706_10386350 | |||
| 1094 | Ga0207706_10932257 | |||
| 1095 | Ga0207669_10987255 | |||
| 1096 | Ga0207691_10439395 | |||
| 1097 | Ga0207691_11717176 | |||
| 1098 | Ga0207711_10038812 | |||
| 1099 | Ga0207711_10121341 | |||
| 1100 | Ga0207711_10466038 | |||
| 1101 | Ga0207711_10567490 | |||
| 1102 | Ga0207711_11269994 | |||
| 1103 | Ga0207661_10076169 | |||
| 1104 | Ga0207679_10007026 | |||
| 1105 | Ga0207679_10040981 | |||
| 1106 | Ga0207679_10052311 | |||
| 1107 | Ga0207679_10168457 | |||
| 1108 | Ga0207679_11308579 | |||
| 1109 | Ga0207679_11479387 | |||
| 1110 | Ga0207651_11183339 | |||
| 1111 | Ga0207712_10415155 | |||
| 1112 | Ga0207712_10867455 | |||
| 1113 | Ga0207712_11643473 | |||
| 1114 | Ga0207668_10064257 | |||
| 1115 | Ga0207668_10325161 | |||
| 1116 | Ga0207668_11178370 | |||
| 1117 | Ga0207640_10222222 | |||
| 1118 | Ga0207640_10871387 | |||
| 1119 | Ga0207658_11698153 | |||
| 1120 | Ga0207703_11747807 | |||
| 1121 | Ga0207639_11792953 | |||
| 1122 | Ga0207678_10231682 | |||
| 1123 | Ga0207678_10698273 | |||
| 1124 | Ga0207678_11515430 | |||
| 1125 | Ga0207708_10489816 | |||
| 1126 | Ga0207708_11622797 | |||
| 1127 | Ga0207641_10343531 | |||
| 1128 | Ga0207641_10634144 | |||
| 1129 | Ga0207648_10068433 | |||
| 1130 | Ga0207648_10147808 | |||
| 1131 | Ga0207676_10034619 | |||
| 1132 | Ga0207676_10050513 | |||
| 1133 | Ga0207676_11168294 | |||
| 1134 | Ga0207674_10910092 | |||
| 1135 | Ga0207674_11683329 | |||
| 1136 | Ga0207675_100484336 | |||
| 1137 | Ga0207698_11080087 | |||
| 1138 | Ga0207698_11795600 | |||
| 1139 | Ga0209996_1036454 | |||
| 1140 | Ga0210002_1081864 | |||
| 1141 | Ga0209983_1025609 | |||
| 1142 | Ga0209974_10051375 | |||
| 1143 | Ga0209974_10174148 | |||
| 1144 | Ga0207428_10128912 | |||
| 1145 | Ga0268266_10665223 | |||
| 1146 | Ga0268265_10613903 | |||
| 1147 | Ga0268264_11849403 | |||
| 1148 | Ga0307408_100017446 | |||
| 1149 | Ga0307408_100035330 | |||
| 1150 | Ga0307408_100046842 | |||
| 1151 | Ga0307408_100120042 | |||
| 1152 | Ga0307408_100142462 | |||
| 1153 | Ga0307408_100161860 | |||
| 1154 | Ga0307408_100303709 | |||
| 1155 | Ga0307408_100346305 | |||
| 1156 | Ga0307408_100368041 | |||
| 1157 | Ga0307408_100944899 | |||
| 1158 | Ga0307405_10033706 | |||
| 1159 | Ga0307405_10041167 | |||
| 1160 | Ga0307405_10456718 | |||
| 1161 | Ga0307405_10475762 | |||
| 1162 | Ga0307405_11074300 | |||
| 1163 | Ga0307413_10002597 | |||
| 1164 | Ga0307413_10013302 | |||
| 1165 | Ga0307413_10013881 | |||
| 1166 | Ga0307413_10024842 | |||
| 1167 | Ga0307413_10044922 | |||
| 1168 | Ga0307413_10356809 | |||
| 1169 | Ga0307413_10400352 | |||
| 1170 | Ga0307413_10401955 | |||
| 1171 | Ga0307413_10534134 | |||
| 1172 | Ga0307413_10970259 | |||
| 1173 | Ga0307410_10005776 | |||
| 1174 | Ga0307410_10010410 | |||
| 1175 | Ga0307410_10031744 | |||
| 1176 | Ga0307410_10033699 | |||
| 1177 | Ga0307410_10078931 | |||
| 1178 | Ga0307410_10158784 | |||
| 1179 | Ga0307410_10163043 | |||
| 1180 | Ga0307410_10294875 | |||
| 1181 | Ga0307410_10455166 | |||
| 1182 | Ga0307410_10543406 | |||
| 1183 | Ga0307410_11785245 | |||
| 1184 | Ga0307406_10018933 | |||
| 1185 | Ga0307406_10024952 | |||
| 1186 | Ga0307406_10034168 | |||
| 1187 | Ga0307406_10041436 | |||
| 1188 | Ga0307406_10055373 | |||
| 1189 | Ga0307406_10288915 | |||
| 1190 | Ga0307407_10018255 | |||
| 1191 | Ga0307407_10019247 | |||
| 1192 | Ga0307407_10029885 | |||
| 1193 | Ga0307407_10053604 | |||
| 1194 | Ga0307407_10075528 | |||
| 1195 | Ga0307407_10150509 | |||
| 1196 | Ga0307407_10215296 | |||
| 1197 | Ga0307407_10400691 | |||
| 1198 | Ga0307407_10592779 | |||
| 1199 | Ga0307407_11494794 | |||
| 1200 | Ga0307412_10022076 | |||
| 1201 | Ga0307412_10171773 | |||
| 1202 | Ga0307412_10223447 | |||
| 1203 | Ga0307412_10235025 | |||
| 1204 | Ga0307412_10245613 | |||
| 1205 | Ga0307412_10957641 | |||
| 1206 | Ga0307412_11741594 | |||
| 1207 | Ga0307412_12026377 | |||
| 1208 | Ga0307412_12204420 | |||
| 1209 | Ga0307409_100008828 | |||
| 1210 | Ga0307409_100014601 | |||
| 1211 | Ga0307409_100017388 | |||
| 1212 | Ga0307409_100031889 | |||
| 1213 | Ga0307409_100054670 | |||
| 1214 | Ga0307409_100070606 | |||
| 1215 | Ga0307409_100118123 | |||
| 1216 | Ga0307409_100171053 | |||
| 1217 | Ga0307409_100230548 | |||
| 1218 | Ga0307409_100273989 | |||
| 1219 | Ga0307409_100299632 | |||
| 1220 | Ga0307409_100477298 | |||
| 1221 | Ga0307409_100623745 | |||
| 1222 | Ga0307409_100637331 | |||
| 1223 | Ga0307409_101128468 | |||
| 1224 | Ga0307409_102163127 | |||
| 1225 | Ga0307409_102411344 | |||
| 1226 | Ga0307416_100023647 | |||
| 1227 | Ga0307416_100111551 | |||
| 1228 | Ga0307416_100117541 | |||
| 1229 | Ga0307416_100155199 | |||
| 1230 | Ga0307416_100335950 | |||
| 1231 | Ga0307416_100352775 | |||
| 1232 | Ga0307416_100353459 | |||
| 1233 | Ga0307416_100428337 | |||
| 1234 | Ga0307416_100451051 | |||
| 1235 | Ga0307416_100559730 | |||
| 1236 | Ga0307416_100589404 | |||
| 1237 | Ga0307416_101221499 | |||
| 1238 | Ga0307416_101530571 | |||
| 1239 | Ga0307416_103118313 | |||
| 1240 | Ga0307414_10005275 | |||
| 1241 | Ga0307414_10024205 | |||
| 1242 | Ga0307414_10063272 | |||
| 1243 | Ga0307414_10096388 | |||
| 1244 | Ga0307414_10119815 | |||
| 1245 | Ga0307414_10214978 | |||
| 1246 | Ga0307414_10259363 | |||
| 1247 | Ga0307414_10393099 | |||
| 1248 | Ga0307414_10959164 | |||
| 1249 | Ga0307414_11377148 | |||
| 1250 | Ga0307411_10001034 | |||
| 1251 | Ga0307411_10013184 | |||
| 1252 | Ga0307411_10034789 | |||
| 1253 | Ga0307411_10038164 | |||
| 1254 | Ga0307411_10040009 | |||
| 1255 | Ga0307411_10089549 | |||
| 1256 | Ga0307411_10182155 | |||
| 1257 | Ga0307411_10282292 | |||
| 1258 | Ga0307411_10324593 | |||
| 1259 | Ga0307411_10327041 | |||
| 1260 | Ga0307411_10329784 | |||
| 1261 | Ga0307411_11570490 | |||
| 1262 | Ga0307415_100219193 | |||
| 1263 | Ga0307415_100332400 | |||
| 1264 | Ga0307415_100398974 | |||
| 1265 | Ga0307415_100437861 | |||
| 1266 | Ga0307415_100526443 | |||
| 1267 | Ga0307415_100567606 | |||
| 1268 | Ga0307415_100670009 | |||
| 1269 | Ga0307415_100857848 | |||
| 1270 | Ga0307415_100873034 | |||
| 1271 | Ga0307415_101694968 | |||
| 1272 | Ga0373930_0049812 | |||
| 1273 | Ga0373930_0068407 | |||
| 1274 | Ga0373948_0023731 | |||
| 1275 | Ga0373948_0095033 | |||
| 1276 | Ga0373958_0049215 | |||
| 1277 | Ga0373959_0016460 | |||
| 1278 | Ga0373938_0146176 | |||
| 1279 | Ga0373928_0031726 | |||
| 1280 | Ga0373928_0038504 | |||
| 1281 | Ga0373928_0171644 | |||
| 1282 | Ga0373929_0020684 | |||
| 1283 | Ga0373940_0026009 | |||
| 1284 | Ga0373940_0066804 | |||
| 1285 | Ga0373944_0169931 | |||
| 1286 | Ga0373951_0123447 | |||
| 1287 | Ga0373952_0270398 | |||
| 1288 | Ga0373932_0021847 | |||
| 1289 | Ga0373939_0103784 | |||
| 1290 | Ga0373939_0157143 | |||
| 1291 | Ga0373960_0101462 | |||
| 1292 | Ga0373960_0116298 | |||
| 1293 | Ga0373942_0216396 | |||
| 1294 | Ga0373961_0222428 | |||
| 1295 | Ga0316574_0712861 | |||
| 1296 | Ga0373931_0038441 | |||
| 1297 | Ga0373931_0048130 | |||
| 1298 | Ga0373931_0073546 | |||
| 1299 | Ga0373931_0180578 | |||
| 1300 | Ga0373931_0654022 | |||
| 1301 | Ga0373931_0737125 | |||
| 1302 | Ga0373937_0098633 | |||
| 1303 | Ga0316584_1175599 | |||
| 1304 | Ga0395898_1044879 | |||
| 1305 | Ga0395905_0205032 | |||
| 1306 | Ga0395905_0229759 | |||
| 1307 | Ga0395905_0290424 | |||
| 1308 | Ga0395905_0403338 | |||
| 1309 | Ga0395905_0657706 | |||
| 1310 | Ga0395905_0884361 | |||
| 1311 | Ga0242419_001522 | |||
| 1312 | Ga0242420_004366 | |||
| 1313 | Ga0242420_014804 | |||
| 1314 | Ga0439439_0105766 | |||
| 1315 | Ga0439461_0118031 | |||
| 1316 | Ga0451807_0058792 | |||
| 1317 | Ga0451853_0749134 | |||
| 1318 | Ga0439431_0082909 | |||
| 1319 | Ga0439445_0055426 | |||
| 1320 | Ga0439448_0080396 | |||
| 1321 | Ga0439448_0142521 | |||
| 1322 | Ga0439455_0126557 | |||
| 1323 | Ga0439462_0010059 | |||
| 1324 | Ga0450890_025348 | |||
| 1325 | Ga0439446_0236499 | |||
| 1326 | Ga0439458_0195427 | |||
| 1327 | Ga0439434_0324812 | |||
| 1328 | Ga0439459_0146663 | |||
| 1329 | Ga0439464_0284008 | |||
| 1330 | Ga0439460_0259961 | |||
| 1331 | Ga0451577_0157437 | |||
| 1332 | Ga0451577_0182070 | |||
| 1333 | Ga0453683_0031796 | |||
| 1334 | Ga0453683_0205342 | |||
| 1335 | Ga0466964_0098028 | |||
| 1336 | Ga0453684_2273931 | |||
| 1337 | Ga0466970_0155035 | |||
| 1338 | Ga0466970_0253961 | |||
| 1339 | Ga0451576_2002612 | |||
| 1340 | Ga0451576_2393083 | |||
| 1341 | Ga0466967_0427573 | |||
| 1342 | Ga0495603_0021286 | |||
| 1343 | Ga0495641_0309617 | |||
| 1344 | Ga0495580_0101484 | |||
| 1345 | Ga0495580_0134240 | |||
| 1346 | Ga0495582_0080953 | |||
| 1347 | Ga0495639_0022170 | |||
| 1348 | Ga0495662_0215189 | |||
| 1349 | Ga0495664_0099602 | |||
| 1350 | Ga0495594_0014838 | |||
| 1351 | Ga0495618_0040569 | |||
| 1352 | Ga0495630_0132616 | |||
| 1353 | Ga0495666_0009103 | |||
| 1354 | Ga0495640_0133709 | |||
| 1355 | Ga0495586_0008369 | |||
| 1356 | Ga0495621_0338828 | |||
| 1357 | Ga0495667_0115664 | |||
| 1358 | Ga0495634_0004444 | |||
| 1359 | Ga0495647_0002129 | |||
| 1360 | Ga0495658_0115423 | |||
| 1361 | Ga0495613_0115368 | |||
| 1362 | Ga0495624_0603515 | |||
| 1363 | Ga0495670_0225910 | |||
| 1364 | Ga0495581_0096350 | |||
| 1365 | Ga0495604_0281727 | |||
| 1366 | Ga0495674_0045772 | |||
| 1367 | Ga0495674_1214591 | |||
| 1368 | Ga0495680_0116417 | |||
| 1369 | Ga0495684_0143270 | |||
| 1370 | Ga0495614_0345004 | |||
| 1371 | Ga0496100_0059509 | |||
| 1372 | Ga0496100_0509117 | |||
| 1373 | Ga0496100_1100024 | |||
| 1374 | Ga0496101_0030987 | |||
| 1375 | Ga0496101_0063844 | |||
| 1376 | Ga0496101_0101026 | |||
| 1377 | Ga0496101_0312659 | |||
| 1378 | Ga0496102_0025535 | |||
| 1379 | Ga0496102_0035385 | |||
| 1380 | Ga0496102_0100099 | |||
| 1381 | Ga0496102_0133172 | |||
| 1382 | Ga0496102_0134309 | |||
| 1383 | Ga0496102_0846205 | |||
| 1384 | Ga0496102_0959223 | |||
| 1385 | Ga0496102_1212359 | |||
| 1386 | Ga0496103_0004939 | |||
| 1387 | Ga0496103_0118125 | |||
| 1388 | Ga0496103_0182658 | |||
| 1389 | Ga0496103_0383482 | |||
| 1390 | Ga0496104_0011004 | |||
| 1391 | Ga0496104_0051831 | |||
| 1392 | Ga0496104_0112788 | |||
| 1393 | Ga0496104_0610434 | |||
| 1394 | Ga0496105_0015793 | |||
| 1395 | Ga0496105_0271874 | |||
| 1396 | Ga0496105_0494049 | |||
| 1397 | Ga0496105_0774498 | |||
| 1398 | Ga0496106_0033960 | |||
| 1399 | Ga0496106_0104597 | |||
| 1400 | Ga0496106_0120395 | |||
| 1401 | Ga0496106_0425066 | |||
| 1402 | Ga0496106_0932691 | |||
| 1403 | Ga0496107_0171092 | |||
| 1404 | Ga0496107_1205869 | |||
| 1405 | Ga0496108_0000296 | |||
| 1406 | Ga0496108_0010751 | |||
| 1407 | Ga0496108_0045481 | |||
| 1408 | Ga0496108_0074660 | |||
| 1409 | Ga0496108_0090199 | |||
| 1410 | Ga0496108_0731962 | |||
| 1411 | Ga0496108_1456915 | |||
| 1412 | Ga0496109_0000206 | |||
| 1413 | Ga0496109_0007468 | |||
| 1414 | Ga0496109_0015274 | |||
| 1415 | Ga0496109_0024001 | |||
| 1416 | Ga0496109_0434419 | |||
| 1417 | Ga0496109_0537482 | |||
| 1418 | Ga0496110_0000500 | |||
| 1419 | Ga0496110_0006099 | |||
| 1420 | Ga0496110_0011118 | |||
| 1421 | Ga0496110_0070480 | |||
| 1422 | Ga0496110_0594697 | |||
| 1423 | Ga0496111_0004448 | |||
| 1424 | Ga0496111_0026705 | |||
| 1425 | Ga0496111_0029659 | |||
| 1426 | Ga0496111_0172085 | |||
| 1427 | Ga0496111_0493090 | |||
| 1428 | Ga0496111_0495571 | |||
| 1429 | Ga0496112_0000114 | |||
| 1430 | Ga0496112_0000557 | |||
| 1431 | Ga0496112_0041172 | |||
| 1432 | Ga0496112_0058973 | |||
| 1433 | Ga0496112_1916655 | |||
| 1434 | Ga0496113_0000106 | |||
| 1435 | Ga0496113_0016920 | |||
| 1436 | Ga0496113_0021595 | |||
| 1437 | Ga0496113_0135430 | |||
| 1438 | Ga0496114_0287600 | |||
| 1439 | Ga0496114_0329179 | |||
| 1440 | Ga0496114_0427836 | |||
| 1441 | Ga0496115_0031645 | |||
| 1442 | Ga0501292_027836 | |||
| 1443 | Ga0501292_115262 | |||
| 1444 | Ga0501294_017076 | |||
| 1445 | Ga0501295_116830 | |||
| 1446 | Ga0501296_014573 | |||
| 1447 | Ga0501298_202080 | |||
| 1448 | Ga0501299_018658 | |||
| 1449 | Ga0501031_0069426 | |||
| 1450 | Ga0501031_0141770 | |||
| 1451 | Ga0501031_0162050 | |||
| 1452 | Ga0501032_0121953 | |||
| 1453 | Ga0501033_1062469 | |||
| 1454 | Ga0501036_0065253 | |||
| 1455 | Ga0501036_0308606 | |||
| 1456 | Ga0501036_1132909 | |||
| 1457 | Ga0501037_0026868 | |||
| 1458 | Ga0501037_0659220 | |||
| 1459 | Ga0501037_0910203 | |||
| 1460 | Ga0501038_0028761 | |||
| 1461 | Ga0501038_0137086 | |||
| 1462 | Ga0501038_0538463 | |||
| 1463 | Ga0501038_0803368 | |||
| 1464 | Ga0501038_1343047 | |||
| 1465 | Ga0501039_0032427 | |||
| 1466 | Ga0501039_1509432 | |||
| 1467 | Ga0501040_0019143 | |||
| 1468 | Ga0501040_0056900 | |||
| 1469 | Ga0501041_0050417 | |||
| 1470 | Ga0501041_0066469 | |||
| 1471 | Ga0501041_0979462 | |||
| 1472 | Ga0501041_0992884 | |||
| 1473 | Ga0501042_0020314 | |||
| 1474 | Ga0501042_0114248 | |||
| 1475 | Ga0501042_0596089 | |||
| 1476 | Ga0501042_1164261 | |||
| 1477 | Ga0501046_0026077 | |||
| 1478 | Ga0501046_0078142 | |||
| 1479 | Ga0501046_0129083 | |||
| 1480 | Ga0501048_0004804 | |||
| 1481 | Ga0501048_0123609 | |||
| 1482 | Ga0501048_0382068 | |||
| 1483 | Ga0501067_0001508 | |||
| 1484 | Ga0501067_0044924 | |||
| 1485 | Ga0501067_0069572 | |||
| 1486 | Ga0501067_0282016 | |||
| 1487 | Ga0501067_0472781 | |||
| 1488 | Ga0501067_0612026 | |||
| 1489 | Ga0501067_0655560 | |||
| 1490 | Ga0501068_0012771 | |||
| 1491 | Ga0501068_0066458 | |||
| 1492 | Ga0501068_0097623 | |||
| 1493 | Ga0501069_0065873 | |||
| 1494 | Ga0501069_0094623 | |||
| 1495 | Ga0501069_0144496 | |||
| 1496 | Ga0501070_0664644 | |||
| 1497 | Ga0501070_0885818 | |||
| 1498 | Ga0501071_0005331 | |||
| 1499 | Ga0501071_0061047 | |||
| 1500 | Ga0501071_0102577 | |||
| 1501 | Ga0501071_0165679 | |||
| 1502 | Ga0501071_0464016 | |||
| 1503 | Ga0501072_0004356 | |||
| 1504 | Ga0501072_0098594 | |||
| 1505 | Ga0501074_0045787 | |||
| 1506 | Ga0501074_0117520 | |||
| 1507 | Ga0501075_0004067 | |||
| 1508 | Ga0501075_0173067 | |||
| 1509 | Ga0501075_0422589 | |||
| 1510 | Ga0501076_0005204 | |||
| 1511 | Ga0501076_0036546 | |||
| 1512 | Ga0501076_0099206 | |||
| 1513 | Ga0501076_0390477 | |||
| 1514 | Ga0501076_0400340 | |||
| 1515 | Ga0501077_0001286 | |||
| 1516 | Ga0501077_0003264 | |||
| 1517 | Ga0501077_0010406 | |||
| 1518 | Ga0501198_035356 | |||
| 1519 | Ga0501201_039705 | |||
| 1520 | Ga0501202_174882 | |||
| 1521 | Ga0501202_206787 | |||
| 1522 | Ga0501209_002239 | |||
| 1523 | Ga0501209_026845 | |||
| 1524 | Ga0501209_030409 | |||
| 1525 | Ga0501216_043909 | |||
| 1526 | Ga0501217_007548 | |||
| 1527 | Ga0501217_051843 | |||
| 1528 | Ga0501227_119540 | |||
| 1529 | Ga0501233_042923 | |||
| 1530 | Ga0501235_166106 | |||
| 1531 | Ga0501236_018797 | |||
| 1532 | Ga0501238_060802 | |||
| 1533 | Ga0501243_022114 | |||
| 1534 | Ga0501243_049150 | |||
| 1535 | Ga0501247_000053 | |||
| 1536 | Ga0501247_064187 | |||
| 1537 | Ga0501248_060754 | |||
| 1538 | Ga0501249_001020 | |||
| 1539 | Ga0501249_105183 | |||
| 1540 | Ga0501249_216558 | |||
| 1541 | Ga0501252_018726 | |||
| 1542 | Ga0501257_181700 | |||
| 1543 | Ga0501221_021259 | |||
| 1544 | Ga0501225_0088041 | |||
| 1545 | Ga0501225_0179792 | |||
| 1546 | Ga0501234_034172 | |||
| 1547 | Ga0501245_003819 | |||
| 1548 | Ga0501079_0005929 | |||
| 1549 | Ga0501079_0007043 | |||
| 1550 | Ga0501079_0167762 | |||
| 1551 | Ga0501079_0508694 | |||
| 1552 | Ga0501080_0020527 | |||
| 1553 | Ga0501080_0129326 | |||
| 1554 | Ga0501080_0176266 | |||
| 1555 | Ga0501080_1573642 | |||
| 1556 | Ga0501081_0005531 | |||
| 1557 | Ga0501081_0013752 | |||
| 1558 | Ga0501081_0025188 | |||
| 1559 | Ga0501083_0019650 | |||
| 1560 | Ga0501083_0344922 | |||
| 1561 | Ga0501232_043925 | |||
| 1562 | Ga0501268_004128 | |||
| 1563 | Ga0501268_020128 | |||
| 1564 | Ga0501268_099602 | |||
| 1565 | Ga0501270_022098 | |||
| 1566 | Ga0501271_038318 | |||
| 1567 | Ga0501271_052322 | |||
| 1568 | Ga0501272_000381 | |||
| 1569 | Ga0501273_000747 | |||
| 1570 | Ga0501273_051803 | |||
| 1571 | Ga0501275_039322 | |||
| 1572 | Ga0501279_078742 | |||
| 1573 | Ga0501283_011829 | |||
| 1574 | Ga0501035_0160265 | |||
| 1575 | Ga0501044_0943030 | |||
| 1576 | Ga0501045_0002145 | |||
| 1577 | Ga0501045_0015354 | |||
| 1578 | Ga0501045_0019274 | |||
| 1579 | Ga0501045_0518240 | |||
| 1580 | Ga0501045_0861580 | |||
| 1581 | Ga0501212_059399 | |||
| 1582 | Ga0501212_114909 | |||
| 1583 | nmdc:mga05p37_108333_c1 | |||
| 1584 | nmdc:mga05p37_1116450_c1 | |||
| 1585 | nmdc:mga05p37_1304020_c1 | |||
| 1586 | nmdc:mga05p37_1822247_c1 | |||
| 1587 | nmdc:mga05p37_32198_c1 | |||
| 1588 | nmdc:mga0qj67_67898_c1 | |||
| 1589 | nmdc:mga0qj67_789222_c1 | |||
| 1590 | nmdc:mga06r32_2808_c1 | |||
| 1591 | nmdc:mga06r32_372628_c1 | |||
| 1592 | nmdc:mga08y16_1905528_c1 | |||
| 1593 | nmdc:mga08y16_223304_c1 | |||
| 1594 | nmdc:mga08y16_82152_c1 | |||
| 1595 | nmdc:mga0n895_1188838_c1 | |||
| 1596 | nmdc:mga0n895_221878_c1 | |||
| 1597 | nmdc:mga0n895_318857_c1 | |||
| 1598 | nmdc:mga0n895_6797_c1 | |||
| 1599 | nmdc:mga0rr50_1148083_c1 | |||
| 1600 | nmdc:mga0rr50_149750_c1 | |||
| 1601 | nmdc:mga0rr50_172091_c1 | |||
| 1602 | nmdc:mga0rr50_217855_c1 | |||
| 1603 | nmdc:mga0rr50_903166_c1 | |||
| 1604 | nmdc:mga08x19_138214_c1 | |||
| 1605 | nmdc:mga08x19_224541_c1 | |||
| 1606 | nmdc:mga08x19_341210_c1 | |||
| 1607 | nmdc:mga0a205_1251703_c1 | |||
| 1608 | nmdc:mga0a205_163474_c1 | |||
| 1609 | nmdc:mga0a205_262172_c1 | |||
| 1610 | nmdc:mga0a205_321349_c1 | |||
| 1611 | Ga0501084_0004925 | |||
| 1612 | Ga0501084_0014371 | |||
| 1613 | Ga0501084_0039259 | |||
| 1614 | Ga0501084_0517527 | |||
| 1615 | Ga0590071_000704 | |||
| 1616 | Ga0590071_006933 | |||
| 1617 | Ga0590071_008655 | |||
| 1618 | Ga0590074_007138 | |||
| 1619 | Ga0590074_008559 | |||
| 1620 | Ga0590074_025508 | |||
| 1621 | Ga0590074_064291 | |||
| 1622 | Ga0590075_005634 | |||
| 1623 | Ga0590075_013305 | |||
| 1624 | Ga0590075_060413 | |||
| 1625 | Ga0590077_004353 | |||
| 1626 | Ga0590077_025849 | |||
| 1627 | Ga0590077_064342 | |||
| 1628 | Ga0501082_0010468 | |||
| 1629 | Ga0501082_0012078 | |||
| 1630 | Ga0501082_0019438 | |||
| 1631 | Ga0501082_0245197 | |||
| 1632 | Ga0501082_0817381 | |||
| 1633 | Ga0501082_1000951 | |||
| 1634 | Ga0501082_1909520 | |||
| 1635 | Ga0530510_0052005 | |||
| 1636 | Ga0530510_0078881 | |||
| 1637 | Ga0530510_0161804 | |||
| 1638 | Ga0530510_0289560 | |||
| 1639 | Ga0530510_0329280 | |||
| 1640 | Ga0530510_0904973 | |||
| 1641 | Ga0530510_1329456 | |||
| 1642 | Ga0530510_1393251 |