F482247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 283 | 1642 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100070240|Ga0068869_1000702403 |
| Length | 158 |
| Sequence | MASRNCWRCYSQVKINAEMIDAEKALQPINQQGLDVRSTPRGEMDLFPLDTFAYEFPGREIKIDFEITEFTAICPFSDFPDFATIRLEYVPNERCVELKSLKLYINSFRQVKIFHEHVINIILEDFVRACDPLSVKLEGDFHVRGNIKTVVRAKYEKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 190 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 191 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 194 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 195 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 196 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 197 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 198 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 199 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 219 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 220 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 221 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 222 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 223 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 224 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 226 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 227 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 234 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 235 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 236 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 238 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 239 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 243 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 246 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 247 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 250 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 251 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 252 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 253 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 254 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 261 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 262 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 267 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 268 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 3.05 |
| Rhizosphere | 95.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100070240 | 3300005334 | Unclassified | 2590 |
| 2 | SwRhRL2b_contig_2960249 | 2162886007 | Bacteria | 1673 |
| 3 | SwRhRL2b_contig_506745 | 2162886007 | Bacteria | 2823 |
| 4 | LJNas_1010919 | 3300000546 | Unclassified | 968 |
| 5 | ARCol0yngRDRAFT_1018397 | 3300000652 | Unclassified | 537 |
| 6 | JGI24737J22298_10073067 | 3300001990 | Bacteria | 1023 |
| 7 | Ga0065714_10002186 | 3300005288 | Bacteria | 191932 |
| 8 | Ga0065704_10003229 | 3300005289 | Bacteria | 6476 |
| 9 | Ga0065704_10014104 | 3300005289 | Bacteria | 1904 |
| 10 | Ga0065704_10135561 | 3300005289 | Bacteria | 1574 |
| 11 | Ga0065704_10221516 | 3300005289 | Unclassified | 1072 |
| 12 | Ga0065704_10236155 | 3300005289 | Bacteria | 1028 |
| 13 | Ga0065704_10242902 | 3300005289 | Bacteria | 1010 |
| 14 | Ga0065704_10658491 | 3300005289 | Unclassified | 579 |
| 15 | Ga0065712_10000113 | 3300005290 | Bacteria | 191931 |
| 16 | Ga0065712_10088637 | 3300005290 | Bacteria | 2510 |
| 17 | Ga0065712_10132261 | 3300005290 | Bacteria | 1535 |
| 18 | Ga0065712_10283056 | 3300005290 | Unclassified | 889 |
| 19 | Ga0065715_10006379 | 3300005293 | Bacteria | 3769 |
| 20 | Ga0065715_10090024 | 3300005293 | Bacteria | 7832 |
| 21 | Ga0065715_10091511 | 3300005293 | Bacteria | 5732 |
| 22 | Ga0065715_10113127 | 3300005293 | Bacteria | 2502 |
| 23 | Ga0065715_10116659 | 3300005293 | Bacteria | 2325 |
| 24 | Ga0065715_10199839 | 3300005293 | Bacteria | 1366 |
| 25 | Ga0065707_10001531 | 3300005295 | Bacteria | 6255 |
| 26 | Ga0065707_10190229 | 3300005295 | Bacteria | 1319 |
| 27 | Ga0065707_10201992 | 3300005295 | Unclassified | 1306 |
| 28 | Ga0065707_10910515 | 3300005295 | Bacteria | 562 |
| 29 | Ga0070676_10205841 | 3300005328 | Bacteria | 1292 |
| 30 | Ga0070676_10379883 | 3300005328 | Bacteria | 978 |
| 31 | Ga0070683_100128569 | 3300005329 | Bacteria | 2396 |
| 32 | Ga0070683_100148445 | 3300005329 | Bacteria | 2223 |
| 33 | Ga0070683_100881912 | 3300005329 | Bacteria | 858 |
| 34 | Ga0070690_100004206 | 3300005330 | Bacteria | 7966 |
| 35 | Ga0070690_100006228 | 3300005330 | Bacteria | 6770 |
| 36 | Ga0070690_100284954 | 3300005330 | Bacteria | 1180 |
| 37 | Ga0070670_100039706 | 3300005331 | Bacteria | 4047 |
| 38 | Ga0070670_100135871 | 3300005331 | Bacteria | 2125 |
| 39 | Ga0068869_100022495 | 3300005334 | Bacteria | 4345 |
| 40 | Ga0068869_100199456 | 3300005334 | Bacteria | 1577 |
| 41 | Ga0068869_100943592 | 3300005334 | Unclassified | 749 |
| 42 | Ga0068869_101155523 | 3300005334 | Bacteria | 679 |
| 43 | Ga0068869_102026881 | 3300005334 | Unclassified | 517 |
| 44 | Ga0070666_10723579 | 3300005335 | Unclassified | 730 |
| 45 | Ga0070680_100000139 | 3300005336 | Bacteria | 44398 |
| 46 | Ga0070682_100000311 | 3300005337 | Bacteria | 33637 |
| 47 | Ga0070682_100028715 | 3300005337 | Bacteria | 3346 |
| 48 | Ga0068868_100504944 | 3300005338 | Bacteria | 1060 |
| 49 | Ga0068868_100784204 | 3300005338 | Unclassified | 859 |
| 50 | Ga0068868_101268905 | 3300005338 | Bacteria | 683 |
| 51 | Ga0068868_102351445 | 3300005338 | Unclassified | 509 |
| 52 | Ga0070660_100053049 | 3300005339 | Bacteria | 3127 |
| 53 | Ga0070689_100368074 | 3300005340 | Bacteria | 1209 |
| 54 | Ga0070689_101299471 | 3300005340 | Bacteria | 655 |
| 55 | Ga0070691_10713700 | 3300005341 | Unclassified | 603 |
| 56 | Ga0070687_100364939 | 3300005343 | Unclassified | 936 |
| 57 | Ga0070687_100378001 | 3300005343 | Bacteria | 922 |
| 58 | Ga0070661_100048060 | 3300005344 | Bacteria | 3123 |
| 59 | Ga0070661_100065157 | 3300005344 | Bacteria | 2677 |
| 60 | Ga0070661_100497970 | 3300005344 | Unclassified | 975 |
| 61 | Ga0070692_10013410 | 3300005345 | Bacteria | 3820 |
| 62 | Ga0070692_10036037 | 3300005345 | Bacteria | 2509 |
| 63 | Ga0070692_10226697 | 3300005345 | Bacteria | 1107 |
| 64 | Ga0070692_10537258 | 3300005345 | Bacteria | 764 |
| 65 | Ga0070692_10914754 | 3300005345 | Bacteria | 607 |
| 66 | Ga0070668_100018588 | 3300005347 | Bacteria | 5218 |
| 67 | Ga0070668_100581261 | 3300005347 | Bacteria | 978 |
| 68 | Ga0070669_100022866 | 3300005353 | Bacteria | 4472 |
| 69 | Ga0070669_100038209 | 3300005353 | Unclassified | 3485 |
| 70 | Ga0070669_100305950 | 3300005353 | Unclassified | 1280 |
| 71 | Ga0070669_100775324 | 3300005353 | Bacteria | 814 |
| 72 | Ga0070675_100547652 | 3300005354 | Unclassified | 1046 |
| 73 | Ga0070671_100088184 | 3300005355 | Bacteria | 2596 |
| 74 | Ga0070671_100121182 | 3300005355 | Bacteria | 2201 |
| 75 | Ga0070671_100896014 | 3300005355 | Bacteria | 775 |
| 76 | Ga0070671_101090580 | 3300005355 | Bacteria | 701 |
| 77 | Ga0070674_100774679 | 3300005356 | Unclassified | 826 |
| 78 | Ga0070673_100020213 | 3300005364 | Unclassified | 4799 |
| 79 | Ga0070673_100135359 | 3300005364 | Bacteria | 2073 |
| 80 | Ga0070659_100002723 | 3300005366 | Bacteria | 12570 |
| 81 | Ga0070659_100649762 | 3300005366 | Unclassified | 909 |
| 82 | Ga0070667_100823795 | 3300005367 | Bacteria | 862 |
| 83 | Ga0070703_10386616 | 3300005406 | Unclassified | 606 |
| 84 | Ga0070701_10031043 | 3300005438 | Bacteria | 2649 |
| 85 | Ga0070701_10844120 | 3300005438 | Unclassified | 628 |
| 86 | Ga0070705_100579965 | 3300005440 | Bacteria | 864 |
| 87 | Ga0070705_100677847 | 3300005440 | Unclassified | 807 |
| 88 | Ga0070700_100003151 | 3300005441 | Bacteria | 8474 |
| 89 | Ga0070700_100026221 | 3300005441 | Bacteria | 3439 |
| 90 | Ga0070700_100385318 | 3300005441 | Bacteria | 1050 |
| 91 | Ga0070694_100064064 | 3300005444 | Bacteria | 2515 |
| 92 | Ga0070694_100090462 | 3300005444 | Bacteria | 2146 |
| 93 | Ga0070694_100109992 | 3300005444 | Unclassified | 1962 |
| 94 | Ga0070694_100123725 | 3300005444 | Bacteria | 1859 |
| 95 | Ga0070708_100157015 | 3300005445 | Bacteria | 2118 |
| 96 | Ga0070708_100328812 | 3300005445 | Bacteria | 1440 |
| 97 | Ga0070663_100366820 | 3300005455 | Bacteria | 1169 |
| 98 | Ga0070663_100481179 | 3300005455 | Unclassified | 1028 |
| 99 | Ga0070663_101085684 | 3300005455 | Bacteria | 699 |
| 100 | Ga0070662_100212418 | 3300005457 | Bacteria | 1540 |
| 101 | Ga0070662_101291897 | 3300005457 | Bacteria | 628 |
| 102 | Ga0070662_101312664 | 3300005457 | Bacteria | 623 |
| 103 | Ga0070662_101831042 | 3300005457 | Unclassified | 524 |
| 104 | Ga0070681_10000350 | 3300005458 | Bacteria | 37194 |
| 105 | Ga0070681_10003130 | 3300005458 | Bacteria | 15367 |
| 106 | Ga0068867_100026995 | 3300005459 | Bacteria | 4125 |
| 107 | Ga0068867_101296706 | 3300005459 | Unclassified | 672 |
| 108 | Ga0070706_100137332 | 3300005467 | Bacteria | 2282 |
| 109 | Ga0070706_101796026 | 3300005467 | Bacteria | 557 |
| 110 | Ga0070707_100161792 | 3300005468 | Bacteria | 2181 |
| 111 | Ga0070707_100539982 | 3300005468 | Unclassified | 1128 |
| 112 | Ga0070698_100012329 | 3300005471 | Bacteria | 9052 |
| 113 | Ga0070698_100032837 | 3300005471 | Bacteria | 5376 |
| 114 | Ga0070698_100570262 | 3300005471 | Bacteria | 1072 |
| 115 | Ga0070699_100060650 | 3300005518 | Bacteria | 3278 |
| 116 | Ga0070699_100156639 | 3300005518 | Bacteria | 2015 |
| 117 | Ga0070699_100487087 | 3300005518 | Bacteria | 1119 |
| 118 | Ga0070699_101079043 | 3300005518 | Bacteria | 737 |
| 119 | Ga0070679_100000059 | 3300005530 | Bacteria | 81792 |
| 120 | Ga0070679_100011688 | 3300005530 | Bacteria | 8370 |
| 121 | Ga0070679_100117327 | 3300005530 | Bacteria | 2646 |
| 122 | Ga0070679_100405576 | 3300005530 | Bacteria | 1309 |
| 123 | Ga0070684_100113229 | 3300005535 | Bacteria | 2434 |
| 124 | Ga0070684_101710759 | 3300005535 | Unclassified | 593 |
| 125 | Ga0070697_100000042 | 3300005536 | Bacteria | 94533 |
| 126 | Ga0070697_100004594 | 3300005536 | Bacteria | 10609 |
| 127 | Ga0070697_100083361 | 3300005536 | Bacteria | 2637 |
| 128 | Ga0070697_100097028 | 3300005536 | Bacteria | 2446 |
| 129 | Ga0070697_100105843 | 3300005536 | Bacteria | 2340 |
| 130 | Ga0070697_100108014 | 3300005536 | Bacteria | 2316 |
| 131 | Ga0070697_100143262 | 3300005536 | Bacteria | 2011 |
| 132 | Ga0070697_100150408 | 3300005536 | Archaea | 1962 |
| 133 | Ga0070697_101437927 | 3300005536 | Unclassified | 616 |
| 134 | Ga0070697_101547094 | 3300005536 | Unclassified | 593 |
| 135 | Ga0068853_100011800 | 3300005539 | Bacteria | 7103 |
| 136 | Ga0068853_100091583 | 3300005539 | Bacteria | 2674 |
| 137 | Ga0068853_100099858 | 3300005539 | Bacteria | 2564 |
| 138 | Ga0068853_100155987 | 3300005539 | Unclassified | 2057 |
| 139 | Ga0068853_100196488 | 3300005539 | Bacteria | 1835 |
| 140 | Ga0070672_100043297 | 3300005543 | Bacteria | 3470 |
| 141 | Ga0070672_100236897 | 3300005543 | Bacteria | 1534 |
| 142 | Ga0070672_100605049 | 3300005543 | Unclassified | 955 |
| 143 | Ga0070686_100007940 | 3300005544 | Bacteria | 5934 |
| 144 | Ga0070686_100145614 | 3300005544 | Bacteria | 1654 |
| 145 | Ga0070695_100017748 | 3300005545 | Bacteria | 4318 |
| 146 | Ga0070695_100054421 | 3300005545 | Bacteria | 2575 |
| 147 | Ga0070695_101019183 | 3300005545 | Bacteria | 674 |
| 148 | Ga0070696_100006190 | 3300005546 | Bacteria | 8001 |
| 149 | Ga0070696_100021784 | 3300005546 | Bacteria | 4347 |
| 150 | Ga0070696_100599474 | 3300005546 | Bacteria | 888 |
| 151 | Ga0070693_100374224 | 3300005547 | Bacteria | 981 |
| 152 | Ga0070693_100735523 | 3300005547 | Bacteria | 726 |
| 153 | Ga0070704_100106415 | 3300005549 | Bacteria | 2125 |
| 154 | Ga0070704_100165334 | 3300005549 | Bacteria | 1754 |
| 155 | Ga0070704_100328183 | 3300005549 | Bacteria | 1284 |
| 156 | Ga0070704_100343171 | 3300005549 | Bacteria | 1258 |
| 157 | Ga0068855_102424576 | 3300005563 | Unclassified | 523 |
| 158 | Ga0070664_100007058 | 3300005564 | Bacteria | 9065 |
| 159 | Ga0070664_100066697 | 3300005564 | Bacteria | 3074 |
| 160 | Ga0070664_100084001 | 3300005564 | Bacteria | 2748 |
| 161 | Ga0070664_100258363 | 3300005564 | Unclassified | 1567 |
| 162 | Ga0070664_100608461 | 3300005564 | Unclassified | 1014 |
| 163 | Ga0070664_100787259 | 3300005564 | Bacteria | 889 |
| 164 | Ga0070664_102071911 | 3300005564 | Unclassified | 540 |
| 165 | Ga0068857_100008041 | 3300005577 | Bacteria | 9095 |
| 166 | Ga0068857_100045462 | 3300005577 | Bacteria | 3896 |
| 167 | Ga0068857_100676387 | 3300005577 | Bacteria | 979 |
| 168 | Ga0068857_100855342 | 3300005577 | Bacteria | 870 |
| 169 | Ga0068857_101013169 | 3300005577 | Bacteria | 800 |
| 170 | Ga0068857_101212234 | 3300005577 | Unclassified | 731 |
| 171 | Ga0068854_100120561 | 3300005578 | Bacteria | 1991 |
| 172 | Ga0068854_100166988 | 3300005578 | Bacteria | 1709 |
| 173 | Ga0068854_100261518 | 3300005578 | Unclassified | 1386 |
| 174 | Ga0068854_100262248 | 3300005578 | Bacteria | 1384 |
| 175 | Ga0068854_100954252 | 3300005578 | Unclassified | 757 |
| 176 | Ga0068854_101830259 | 3300005578 | Unclassified | 557 |
| 177 | Ga0068852_100105697 | 3300005616 | Bacteria | 2551 |
| 178 | Ga0068852_100250766 | 3300005616 | Unclassified | 1696 |
| 179 | Ga0068859_100027753 | 3300005617 | Bacteria | 5678 |
| 180 | Ga0068859_100066720 | 3300005617 | Bacteria | 3633 |
| 181 | Ga0068859_100067920 | 3300005617 | Bacteria | 3600 |
| 182 | Ga0068859_100100077 | 3300005617 | Bacteria | 2954 |
| 183 | Ga0068859_100642430 | 3300005617 | Bacteria | 1153 |
| 184 | Ga0068859_100807562 | 3300005617 | Unclassified | 1025 |
| 185 | Ga0068859_100995464 | 3300005617 | Bacteria | 921 |
| 186 | Ga0068859_101133847 | 3300005617 | Unclassified | 861 |
| 187 | Ga0068859_102840187 | 3300005617 | Bacteria | 531 |
| 188 | Ga0068864_100137240 | 3300005618 | Bacteria | 2203 |
| 189 | Ga0068864_100191905 | 3300005618 | Bacteria | 1873 |
| 190 | Ga0068864_100227925 | 3300005618 | Bacteria | 1722 |
| 191 | Ga0068864_100269135 | 3300005618 | Bacteria | 1587 |
| 192 | Ga0068864_100355857 | 3300005618 | Unclassified | 1383 |
| 193 | Ga0068864_100491831 | 3300005618 | Bacteria | 1179 |
| 194 | Ga0068864_100640432 | 3300005618 | Unclassified | 1034 |
| 195 | Ga0068864_101379924 | 3300005618 | Bacteria | 706 |
| 196 | Ga0068864_102082327 | 3300005618 | Unclassified | 574 |
| 197 | Ga0068864_102157428 | 3300005618 | Bacteria | 563 |
| 198 | Ga0068866_10485909 | 3300005718 | Unclassified | 814 |
| 199 | Ga0068861_100089279 | 3300005719 | Bacteria | 2429 |
| 200 | Ga0068861_100538121 | 3300005719 | Bacteria | 1062 |
| 201 | Ga0068861_101126157 | 3300005719 | Bacteria | 755 |
| 202 | Ga0068851_10025098 | 3300005834 | Bacteria | 2922 |
| 203 | Ga0068870_10553656 | 3300005840 | Bacteria | 775 |
| 204 | Ga0068863_100074385 | 3300005841 | Bacteria | 3214 |
| 205 | Ga0068863_100703930 | 3300005841 | Unclassified | 1004 |
| 206 | Ga0068863_102117639 | 3300005841 | Unclassified | 572 |
| 207 | Ga0068858_100076240 | 3300005842 | Unclassified | 3114 |
| 208 | Ga0068858_100095575 | 3300005842 | Unclassified | 2769 |
| 209 | Ga0068858_100224678 | 3300005842 | Bacteria | 1779 |
| 210 | Ga0068858_100336760 | 3300005842 | Unclassified | 1443 |
| 211 | Ga0068858_102038865 | 3300005842 | Unclassified | 567 |
| 212 | Ga0068860_100020300 | 3300005843 | Bacteria | 6435 |
| 213 | Ga0068860_100355662 | 3300005843 | Bacteria | 1442 |
| 214 | Ga0068860_100830547 | 3300005843 | Unclassified | 938 |
| 215 | Ga0068860_101222965 | 3300005843 | Unclassified | 771 |
| 216 | Ga0068860_101604552 | 3300005843 | Unclassified | 672 |
| 217 | Ga0068862_100030465 | 3300005844 | Bacteria | 4548 |
| 218 | Ga0068862_100070490 | 3300005844 | Bacteria | 3018 |
| 219 | Ga0068862_100347441 | 3300005844 | Unclassified | 1375 |
| 220 | Ga0068862_100442215 | 3300005844 | Unclassified | 1224 |
| 221 | Ga0068862_100624404 | 3300005844 | Bacteria | 1037 |
| 222 | Ga0068862_102579522 | 3300005844 | Unclassified | 520 |
| 223 | Ga0081539_10000360 | 3300005985 | Bacteria | 100156 |
| 224 | Ga0081539_10000669 | 3300005985 | Bacteria | 68738 |
| 225 | Ga0081539_10023171 | 3300005985 | Bacteria | 4075 |
| 226 | Ga0081539_10106916 | 3300005985 | Bacteria | 1416 |
| 227 | Ga0075432_10347193 | 3300006058 | Bacteria | 628 |
| 228 | Ga0070716_100247363 | 3300006173 | Bacteria | 1213 |
| 229 | Ga0068871_100447169 | 3300006358 | Bacteria | 1158 |
| 230 | Ga0068871_100926947 | 3300006358 | Unclassified | 808 |
| 231 | Ga0075428_100527335 | 3300006844 | Bacteria | 1263 |
| 232 | Ga0075428_100550547 | 3300006844 | Bacteria | 1233 |
| 233 | Ga0075428_100606264 | 3300006844 | Bacteria | 1169 |
| 234 | Ga0075430_100206432 | 3300006846 | Bacteria | 1630 |
| 235 | Ga0075431_100889934 | 3300006847 | Bacteria | 860 |
| 236 | Ga0075433_10010620 | 3300006852 | Bacteria | 7403 |
| 237 | Ga0075433_10029791 | 3300006852 | Bacteria | 4653 |
| 238 | Ga0075433_10307695 | 3300006852 | Bacteria | 1403 |
| 239 | Ga0075433_10418320 | 3300006852 | Bacteria | 1182 |
| 240 | Ga0075433_10498032 | 3300006852 | Unclassified | 1072 |
| 241 | Ga0075433_10996049 | 3300006852 | Unclassified | 730 |
| 242 | Ga0075433_11505207 | 3300006852 | Unclassified | 581 |
| 243 | Ga0075434_101910781 | 3300006871 | Unclassified | 599 |
| 244 | Ga0075434_102423434 | 3300006871 | Unclassified | 527 |
| 245 | Ga0075429_100620114 | 3300006880 | Bacteria | 948 |
| 246 | Ga0068865_100987049 | 3300006881 | Unclassified | 737 |
| 247 | Ga0075436_100022459 | 3300006914 | Bacteria | 4334 |
| 248 | Ga0097620_100027755 | 3300006931 | Bacteria | 5678 |
| 249 | Ga0097620_100066722 | 3300006931 | Bacteria | 3633 |
| 250 | Ga0097620_100067920 | 3300006931 | Bacteria | 3600 |
| 251 | Ga0097620_100100075 | 3300006931 | Bacteria | 2954 |
| 252 | Ga0097620_100642387 | 3300006931 | Bacteria | 1153 |
| 253 | Ga0097620_100807544 | 3300006931 | Unclassified | 1025 |
| 254 | Ga0097620_100995489 | 3300006931 | Bacteria | 921 |
| 255 | Ga0097620_101133796 | 3300006931 | Unclassified | 861 |
| 256 | Ga0097620_102841429 | 3300006931 | Bacteria | 531 |
| 257 | Ga0075435_100344134 | 3300007076 | Bacteria | 1278 |
| 258 | Ga0075435_101740724 | 3300007076 | Bacteria | 547 |
| 259 | Ga0105251_10036530 | 3300009011 | Bacteria | 2417 |
| 260 | Ga0105250_10294458 | 3300009092 | Bacteria | 701 |
| 261 | Ga0105250_10568687 | 3300009092 | Unclassified | 522 |
| 262 | Ga0105250_10594666 | 3300009092 | Unclassified | 512 |
| 263 | Ga0105240_10184648 | 3300009093 | Bacteria | 2457 |
| 264 | Ga0105240_11186845 | 3300009093 | Unclassified | 809 |
| 265 | Ga0111539_10013585 | 3300009094 | Bacteria | 10180 |
| 266 | Ga0111539_10021005 | 3300009094 | Bacteria | 8039 |
| 267 | Ga0111539_10121917 | 3300009094 | Bacteria | 3055 |
| 268 | Ga0111539_10148585 | 3300009094 | Bacteria | 2743 |
| 269 | Ga0111539_10503287 | 3300009094 | Bacteria | 1411 |
| 270 | Ga0111539_10941280 | 3300009094 | Bacteria | 1004 |
| 271 | Ga0105245_10531346 | 3300009098 | Bacteria | 1196 |
| 272 | Ga0105245_10586746 | 3300009098 | Bacteria | 1140 |
| 273 | Ga0105245_10591486 | 3300009098 | Bacteria | 1135 |
| 274 | Ga0105245_11010160 | 3300009098 | Unclassified | 876 |
| 275 | Ga0105245_11219695 | 3300009098 | Bacteria | 800 |
| 276 | Ga0105245_11908222 | 3300009098 | Unclassified | 647 |
| 277 | Ga0105245_12079828 | 3300009098 | Unclassified | 621 |
| 278 | Ga0105247_10033320 | 3300009101 | Bacteria | 3133 |
| 279 | Ga0105247_10053337 | 3300009101 | Bacteria | 2494 |
| 280 | Ga0105247_10346886 | 3300009101 | Bacteria | 1043 |
| 281 | Ga0105247_10462574 | 3300009101 | Bacteria | 917 |
| 282 | Ga0105247_10732357 | 3300009101 | Unclassified | 747 |
| 283 | Ga0114129_10010635 | 3300009147 | Bacteria | 13125 |
| 284 | Ga0114129_10040157 | 3300009147 | Bacteria | 6597 |
| 285 | Ga0114129_10058175 | 3300009147 | Bacteria | 5407 |
| 286 | Ga0114129_10159250 | 3300009147 | Bacteria | 3086 |
| 287 | Ga0114129_10217853 | 3300009147 | Bacteria | 2577 |
| 288 | Ga0114129_11275721 | 3300009147 | Unclassified | 911 |
| 289 | Ga0114129_11622643 | 3300009147 | Unclassified | 791 |
| 290 | Ga0114129_12490829 | 3300009147 | Bacteria | 619 |
| 291 | Ga0105243_10178238 | 3300009148 | Bacteria | 1846 |
| 292 | Ga0105243_10299256 | 3300009148 | Bacteria | 1457 |
| 293 | Ga0105243_10304533 | 3300009148 | Unclassified | 1446 |
| 294 | Ga0105243_10891143 | 3300009148 | Unclassified | 884 |
| 295 | Ga0105243_10999260 | 3300009148 | Unclassified | 839 |
| 296 | Ga0105243_11622419 | 3300009148 | Bacteria | 674 |
| 297 | Ga0105243_11675285 | 3300009148 | Unclassified | 664 |
| 298 | Ga0105243_11869345 | 3300009148 | Unclassified | 633 |
| 299 | Ga0105241_10042588 | 3300009174 | Bacteria | 3436 |
| 300 | Ga0105241_10076458 | 3300009174 | Bacteria | 2611 |
| 301 | Ga0105241_10100176 | 3300009174 | Bacteria | 2302 |
| 302 | Ga0105241_10117704 | 3300009174 | Bacteria | 2136 |
| 303 | Ga0105241_10125607 | 3300009174 | Bacteria | 2071 |
| 304 | Ga0105241_10418812 | 3300009174 | Bacteria | 1178 |
| 305 | Ga0105241_10441112 | 3300009174 | Unclassified | 1150 |
| 306 | Ga0105241_10534563 | 3300009174 | Unclassified | 1050 |
| 307 | Ga0105241_10598481 | 3300009174 | Unclassified | 996 |
| 308 | Ga0105241_11203129 | 3300009174 | Bacteria | 718 |
| 309 | Ga0105241_12004356 | 3300009174 | Unclassified | 570 |
| 310 | Ga0105242_10481578 | 3300009176 | Bacteria | 1176 |
| 311 | Ga0105242_11267949 | 3300009176 | Unclassified | 759 |
| 312 | Ga0105242_11792784 | 3300009176 | Bacteria | 652 |
| 313 | Ga0105242_12467383 | 3300009176 | Bacteria | 568 |
| 314 | Ga0105248_10014958 | 3300009177 | Bacteria | 8542 |
| 315 | Ga0105248_10036451 | 3300009177 | Bacteria | 5500 |
| 316 | Ga0105248_10252526 | 3300009177 | Bacteria | 1985 |
| 317 | Ga0105248_10326581 | 3300009177 | Bacteria | 1728 |
| 318 | Ga0105248_10457596 | 3300009177 | Bacteria | 1438 |
| 319 | Ga0105248_10578169 | 3300009177 | Bacteria | 1267 |
| 320 | Ga0105248_10843401 | 3300009177 | Unclassified | 1034 |
| 321 | Ga0105248_10853842 | 3300009177 | Bacteria | 1028 |
| 322 | Ga0105248_12010667 | 3300009177 | Unclassified | 657 |
| 323 | Ga0105237_10002569 | 3300009545 | Bacteria | 22400 |
| 324 | Ga0105237_10118731 | 3300009545 | Bacteria | 2638 |
| 325 | Ga0105237_10225442 | 3300009545 | Bacteria | 1875 |
| 326 | Ga0105237_11045318 | 3300009545 | Unclassified | 823 |
| 327 | Ga0105238_10003652 | 3300009551 | Bacteria | 15343 |
| 328 | Ga0105238_10098525 | 3300009551 | Bacteria | 2907 |
| 329 | Ga0105238_10950729 | 3300009551 | Bacteria | 879 |
| 330 | Ga0105238_11097746 | 3300009551 | Unclassified | 818 |
| 331 | Ga0105249_10000044 | 3300009553 | Bacteria | 184637 |
| 332 | Ga0105249_10054955 | 3300009553 | Bacteria | 3641 |
| 333 | Ga0105249_10073041 | 3300009553 | Bacteria | 3172 |
| 334 | Ga0105249_10125570 | 3300009553 | Bacteria | 2443 |
| 335 | Ga0105249_10371159 | 3300009553 | Bacteria | 1454 |
| 336 | Ga0105249_10673678 | 3300009553 | Bacteria | 1093 |
| 337 | Ga0105249_11124974 | 3300009553 | Unclassified | 856 |
| 338 | Ga0105249_11373681 | 3300009553 | Unclassified | 778 |
| 339 | Ga0105239_11056135 | 3300010375 | Bacteria | 934 |
| 340 | Ga0105239_11083431 | 3300010375 | Unclassified | 922 |
| 341 | Ga0105239_11854106 | 3300010375 | Unclassified | 699 |
| 342 | Ga0105246_10008236 | 3300011119 | Bacteria | 6403 |
| 343 | Ga0105246_10834728 | 3300011119 | Bacteria | 821 |
| 344 | Ga0105246_11935758 | 3300011119 | Unclassified | 567 |
| 345 | Ga0157373_10006382 | 3300013100 | Bacteria | 8809 |
| 346 | Ga0157373_10217554 | 3300013100 | Bacteria | 1347 |
| 347 | Ga0157373_11085587 | 3300013100 | Bacteria | 600 |
| 348 | Ga0157371_10196493 | 3300013102 | Bacteria | 1445 |
| 349 | Ga0157371_10463508 | 3300013102 | Bacteria | 933 |
| 350 | Ga0157371_10700721 | 3300013102 | Unclassified | 758 |
| 351 | Ga0157370_10036799 | 3300013104 | Bacteria | 4748 |
| 352 | Ga0157370_10263238 | 3300013104 | Bacteria | 1593 |
| 353 | Ga0157370_10742048 | 3300013104 | Bacteria | 895 |
| 354 | Ga0157370_11445740 | 3300013104 | Unclassified | 618 |
| 355 | Ga0157374_10103556 | 3300013296 | Bacteria | 2731 |
| 356 | Ga0157378_10012900 | 3300013297 | Bacteria | 7316 |
| 357 | Ga0157378_10013580 | 3300013297 | Bacteria | 7123 |
| 358 | Ga0157378_10061703 | 3300013297 | Bacteria | 3347 |
| 359 | Ga0157378_10108122 | 3300013297 | Bacteria | 2546 |
| 360 | Ga0157378_10374879 | 3300013297 | Bacteria | 1396 |
| 361 | Ga0157378_10874665 | 3300013297 | Bacteria | 928 |
| 362 | Ga0157378_10939479 | 3300013297 | Unclassified | 897 |
| 363 | Ga0157378_11017971 | 3300013297 | Unclassified | 863 |
| 364 | Ga0157378_11280265 | 3300013297 | Unclassified | 774 |
| 365 | Ga0157378_11385326 | 3300013297 | Unclassified | 746 |
| 366 | Ga0163162_10000025 | 3300013306 | Bacteria | 184648 |
| 367 | Ga0163162_10020033 | 3300013306 | Bacteria | 6569 |
| 368 | Ga0163162_10030465 | 3300013306 | Bacteria | 5345 |
| 369 | Ga0163162_10074816 | 3300013306 | Bacteria | 3446 |
| 370 | Ga0163162_10256605 | 3300013306 | Bacteria | 1880 |
| 371 | Ga0163162_10262379 | 3300013306 | Bacteria | 1859 |
| 372 | Ga0163162_10398506 | 3300013306 | Bacteria | 1509 |
| 373 | Ga0163162_10431749 | 3300013306 | Unclassified | 1449 |
| 374 | Ga0163162_10471956 | 3300013306 | Bacteria | 1386 |
| 375 | Ga0163162_10546749 | 3300013306 | Bacteria | 1286 |
| 376 | Ga0163162_10644056 | 3300013306 | Unclassified | 1184 |
| 377 | Ga0163162_10669861 | 3300013306 | Bacteria | 1161 |
| 378 | Ga0163162_11165683 | 3300013306 | Unclassified | 874 |
| 379 | Ga0163162_11171402 | 3300013306 | Unclassified | 872 |
| 380 | Ga0163162_11266202 | 3300013306 | Bacteria | 838 |
| 381 | Ga0163162_11435939 | 3300013306 | Unclassified | 785 |
| 382 | Ga0163162_11831855 | 3300013306 | Bacteria | 694 |
| 383 | Ga0157372_10031443 | 3300013307 | Bacteria | 5812 |
| 384 | Ga0157372_10249053 | 3300013307 | Bacteria | 2062 |
| 385 | Ga0157372_10426977 | 3300013307 | Bacteria | 1545 |
| 386 | Ga0157372_10859385 | 3300013307 | Bacteria | 1053 |
| 387 | Ga0157375_10047618 | 3300013308 | Bacteria | 4189 |
| 388 | Ga0157375_10069225 | 3300013308 | Bacteria | 3534 |
| 389 | Ga0157375_10128693 | 3300013308 | Unclassified | 2650 |
| 390 | Ga0157375_10532278 | 3300013308 | Bacteria | 1338 |
| 391 | Ga0157375_10778616 | 3300013308 | Bacteria | 1106 |
| 392 | Ga0157375_10959926 | 3300013308 | Unclassified | 996 |
| 393 | Ga0157375_11154279 | 3300013308 | Bacteria | 908 |
| 394 | Ga0157375_11552760 | 3300013308 | Bacteria | 782 |
| 395 | Ga0157375_12363062 | 3300013308 | Unclassified | 634 |
| 396 | Ga0157375_12902154 | 3300013308 | Bacteria | 573 |
| 397 | Ga0163163_10000536 | 3300014325 | Bacteria | 33560 |
| 398 | Ga0163163_10003037 | 3300014325 | Bacteria | 14218 |
| 399 | Ga0163163_10130388 | 3300014325 | Unclassified | 2554 |
| 400 | Ga0163163_10185263 | 3300014325 | Unclassified | 2129 |
| 401 | Ga0163163_10307647 | 3300014325 | Bacteria | 1637 |
| 402 | Ga0163163_10582145 | 3300014325 | Bacteria | 1182 |
| 403 | Ga0163163_10990175 | 3300014325 | Unclassified | 904 |
| 404 | Ga0163163_11162314 | 3300014325 | Unclassified | 834 |
| 405 | Ga0163163_12249792 | 3300014325 | Bacteria | 604 |
| 406 | Ga0157380_10010426 | 3300014326 | Bacteria | 6687 |
| 407 | Ga0157380_10011038 | 3300014326 | Bacteria | 6516 |
| 408 | Ga0157380_10013135 | 3300014326 | Bacteria | 6029 |
| 409 | Ga0157380_10016677 | 3300014326 | Bacteria | 5422 |
| 410 | Ga0157380_10042459 | 3300014326 | Bacteria | 3555 |
| 411 | Ga0157380_10043819 | 3300014326 | Bacteria | 3504 |
| 412 | Ga0157380_10498709 | 3300014326 | Bacteria | 1182 |
| 413 | Ga0157380_10500792 | 3300014326 | Bacteria | 1180 |
| 414 | Ga0157380_11585100 | 3300014326 | Unclassified | 710 |
| 415 | Ga0157377_10200541 | 3300014745 | Bacteria | 1266 |
| 416 | Ga0157377_10257125 | 3300014745 | Bacteria | 1135 |
| 417 | Ga0157377_10329206 | 3300014745 | Unclassified | 1018 |
| 418 | Ga0157377_10490512 | 3300014745 | Bacteria | 856 |
| 419 | Ga0157377_10805215 | 3300014745 | Unclassified | 693 |
| 420 | Ga0157377_10964869 | 3300014745 | Unclassified | 643 |
| 421 | Ga0157377_11376831 | 3300014745 | Unclassified | 555 |
| 422 | Ga0157379_10231371 | 3300014968 | Unclassified | 1675 |
| 423 | Ga0157379_10454870 | 3300014968 | Unclassified | 1182 |
| 424 | Ga0157376_10902474 | 3300014969 | Bacteria | 902 |
| 425 | Ga0157376_11566296 | 3300014969 | Bacteria | 693 |
| 426 | Ga0182007_10258583 | 3300015262 | Unclassified | 627 |
| 427 | Ga0182005_1083091 | 3300015265 | Bacteria | 885 |
| 428 | Ga0213876_10000038 | 3300021384 | Bacteria | 182431 |
| 429 | Ga0213876_10000382 | 3300021384 | Bacteria | 37485 |
| 430 | Ga0207713_1161150 | 3300025735 | Unclassified | 715 |
| 431 | Ga0207653_10005271 | 3300025885 | Bacteria | 4040 |
| 432 | Ga0207653_10272648 | 3300025885 | Unclassified | 652 |
| 433 | Ga0207710_10027307 | 3300025900 | Bacteria | 2471 |
| 434 | Ga0207710_10232447 | 3300025900 | Unclassified | 918 |
| 435 | Ga0207647_10006732 | 3300025904 | Bacteria | 8344 |
| 436 | Ga0207645_10054704 | 3300025907 | Unclassified | 2549 |
| 437 | Ga0207645_10279542 | 3300025907 | Bacteria | 1108 |
| 438 | Ga0207645_11189689 | 3300025907 | Unclassified | 512 |
| 439 | Ga0207643_10001020 | 3300025908 | Bacteria | 16618 |
| 440 | Ga0207643_10493038 | 3300025908 | Bacteria | 783 |
| 441 | Ga0207684_10000079 | 3300025910 | Bacteria | 179842 |
| 442 | Ga0207684_10069867 | 3300025910 | Unclassified | 2985 |
| 443 | Ga0207684_10369919 | 3300025910 | Unclassified | 1233 |
| 444 | Ga0207684_11257742 | 3300025910 | Bacteria | 611 |
| 445 | Ga0207654_10019329 | 3300025911 | Bacteria | 3594 |
| 446 | Ga0207654_10714291 | 3300025911 | Unclassified | 720 |
| 447 | Ga0207707_10000008 | 3300025912 | Bacteria | 330313 |
| 448 | Ga0207707_10000625 | 3300025912 | Bacteria | 35059 |
| 449 | Ga0207707_10019384 | 3300025912 | Bacteria | 5938 |
| 450 | Ga0207707_10285598 | 3300025912 | Unclassified | 1428 |
| 451 | Ga0207707_10522810 | 3300025912 | Bacteria | 1010 |
| 452 | Ga0207663_10574292 | 3300025916 | Unclassified | 884 |
| 453 | Ga0207660_10004225 | 3300025917 | Bacteria | 9357 |
| 454 | Ga0207660_10063317 | 3300025917 | Bacteria | 2666 |
| 455 | Ga0207660_10341254 | 3300025917 | Unclassified | 1199 |
| 456 | Ga0207660_10527802 | 3300025917 | Unclassified | 959 |
| 457 | Ga0207660_10733539 | 3300025917 | Unclassified | 806 |
| 458 | Ga0207662_10002097 | 3300025918 | Bacteria | 9907 |
| 459 | Ga0207657_10036482 | 3300025919 | Bacteria | 4400 |
| 460 | Ga0207649_10626254 | 3300025920 | Unclassified | 829 |
| 461 | Ga0207652_10000085 | 3300025921 | Bacteria | 101176 |
| 462 | Ga0207652_10019341 | 3300025921 | Bacteria | 5600 |
| 463 | Ga0207652_10064650 | 3300025921 | Unclassified | 3165 |
| 464 | Ga0207646_10081792 | 3300025922 | Bacteria | 2888 |
| 465 | Ga0207646_10473391 | 3300025922 | Unclassified | 1130 |
| 466 | Ga0207646_11463773 | 3300025922 | Bacteria | 592 |
| 467 | Ga0207681_10005287 | 3300025923 | Bacteria | 7932 |
| 468 | Ga0207681_10015070 | 3300025923 | Unclassified | 4819 |
| 469 | Ga0207681_10093415 | 3300025923 | Bacteria | 2153 |
| 470 | Ga0207681_10531987 | 3300025923 | Bacteria | 966 |
| 471 | Ga0207694_10039562 | 3300025924 | Bacteria | 3629 |
| 472 | Ga0207650_10035005 | 3300025925 | Bacteria | 3644 |
| 473 | Ga0207650_11860713 | 3300025925 | Unclassified | 509 |
| 474 | Ga0207659_10145690 | 3300025926 | Bacteria | 1844 |
| 475 | Ga0207659_10800326 | 3300025926 | Unclassified | 810 |
| 476 | Ga0207659_10937355 | 3300025926 | Unclassified | 745 |
| 477 | Ga0207687_10669870 | 3300025927 | Bacteria | 879 |
| 478 | Ga0207687_10704882 | 3300025927 | Unclassified | 857 |
| 479 | Ga0207690_10759564 | 3300025932 | Unclassified | 800 |
| 480 | Ga0207706_10071081 | 3300025933 | Bacteria | 3060 |
| 481 | Ga0207706_10232811 | 3300025933 | Bacteria | 1611 |
| 482 | Ga0207706_10741628 | 3300025933 | Unclassified | 837 |
| 483 | Ga0207686_10240867 | 3300025934 | Bacteria | 1316 |
| 484 | Ga0207686_10693494 | 3300025934 | Unclassified | 809 |
| 485 | Ga0207709_10012102 | 3300025935 | Bacteria | 4756 |
| 486 | Ga0207709_10036298 | 3300025935 | Bacteria | 2920 |
| 487 | Ga0207709_10338633 | 3300025935 | Bacteria | 1131 |
| 488 | Ga0207709_11538947 | 3300025935 | Unclassified | 552 |
| 489 | Ga0207670_10000612 | 3300025936 | Bacteria | 19296 |
| 490 | Ga0207670_10317808 | 3300025936 | Bacteria | 1224 |
| 491 | Ga0207665_10006407 | 3300025939 | Bacteria | 7809 |
| 492 | Ga0207691_10016850 | 3300025940 | Bacteria | 6933 |
| 493 | Ga0207691_10989581 | 3300025940 | Unclassified | 702 |
| 494 | Ga0207711_10195267 | 3300025941 | Bacteria | 1846 |
| 495 | Ga0207711_10243263 | 3300025941 | Bacteria | 1650 |
| 496 | Ga0207711_11136585 | 3300025941 | Bacteria | 722 |
| 497 | Ga0207711_11539420 | 3300025941 | Unclassified | 608 |
| 498 | Ga0207689_10002487 | 3300025942 | Bacteria | 17116 |
| 499 | Ga0207689_10060520 | 3300025942 | Bacteria | 3114 |
| 500 | Ga0207689_10080098 | 3300025942 | Bacteria | 2684 |
| 501 | Ga0207689_10435180 | 3300025942 | Bacteria | 1095 |
| 502 | Ga0207689_10487973 | 3300025942 | Bacteria | 1032 |
| 503 | Ga0207689_10691518 | 3300025942 | Unclassified | 860 |
| 504 | Ga0207689_10699618 | 3300025942 | Unclassified | 855 |
| 505 | Ga0207661_10214346 | 3300025944 | Bacteria | 1699 |
| 506 | Ga0207661_10221428 | 3300025944 | Bacteria | 1673 |
| 507 | Ga0207661_10492093 | 3300025944 | Bacteria | 1120 |
| 508 | Ga0207679_10091246 | 3300025945 | Bacteria | 2357 |
| 509 | Ga0207679_10122911 | 3300025945 | Bacteria | 2069 |
| 510 | Ga0207679_10289507 | 3300025945 | Bacteria | 1408 |
| 511 | Ga0207679_10601859 | 3300025945 | Bacteria | 991 |
| 512 | Ga0207679_12152186 | 3300025945 | Unclassified | 506 |
| 513 | Ga0207667_10678447 | 3300025949 | Unclassified | 1034 |
| 514 | Ga0207667_11396031 | 3300025949 | Unclassified | 674 |
| 515 | Ga0207651_10009393 | 3300025960 | Bacteria | 5351 |
| 516 | Ga0207651_10197068 | 3300025960 | Bacteria | 1611 |
| 517 | Ga0207651_10366606 | 3300025960 | Bacteria | 1217 |
| 518 | Ga0207651_11151075 | 3300025960 | Unclassified | 696 |
| 519 | Ga0207712_10000039 | 3300025961 | Bacteria | 182548 |
| 520 | Ga0207712_10087095 | 3300025961 | Unclassified | 2290 |
| 521 | Ga0207712_10112272 | 3300025961 | Bacteria | 2046 |
| 522 | Ga0207712_10260332 | 3300025961 | Bacteria | 1407 |
| 523 | Ga0207712_11012723 | 3300025961 | Unclassified | 737 |
| 524 | Ga0207712_11405778 | 3300025961 | Bacteria | 624 |
| 525 | Ga0207712_11805287 | 3300025961 | Unclassified | 548 |
| 526 | Ga0207668_10578738 | 3300025972 | Bacteria | 976 |
| 527 | Ga0207640_10037325 | 3300025981 | Unclassified | 3056 |
| 528 | Ga0207640_10150136 | 3300025981 | Bacteria | 1711 |
| 529 | Ga0207640_10220323 | 3300025981 | Bacteria | 1452 |
| 530 | Ga0207640_10280287 | 3300025981 | Bacteria | 1309 |
| 531 | Ga0207640_10317492 | 3300025981 | Bacteria | 1239 |
| 532 | Ga0207640_10428810 | 3300025981 | Bacteria | 1084 |
| 533 | Ga0207640_10444737 | 3300025981 | Unclassified | 1067 |
| 534 | Ga0207640_11276040 | 3300025981 | Unclassified | 655 |
| 535 | Ga0207640_11873936 | 3300025981 | Bacteria | 542 |
| 536 | Ga0207677_10223620 | 3300026023 | Bacteria | 1511 |
| 537 | Ga0207677_10778969 | 3300026023 | Unclassified | 855 |
| 538 | Ga0207703_10056982 | 3300026035 | Unclassified | 3184 |
| 539 | Ga0207703_10222450 | 3300026035 | Unclassified | 1688 |
| 540 | Ga0207703_10236283 | 3300026035 | Bacteria | 1641 |
| 541 | Ga0207703_10492658 | 3300026035 | Unclassified | 1149 |
| 542 | Ga0207639_10070106 | 3300026041 | Bacteria | 2737 |
| 543 | Ga0207639_10181502 | 3300026041 | Bacteria | 1790 |
| 544 | Ga0207639_10269224 | 3300026041 | Bacteria | 1493 |
| 545 | Ga0207639_10835741 | 3300026041 | Unclassified | 859 |
| 546 | Ga0207639_11277871 | 3300026041 | Unclassified | 689 |
| 547 | Ga0207678_10236319 | 3300026067 | Bacteria | 1565 |
| 548 | Ga0207678_10587345 | 3300026067 | Bacteria | 976 |
| 549 | Ga0207678_10728697 | 3300026067 | Bacteria | 873 |
| 550 | Ga0207708_10000453 | 3300026075 | Bacteria | 31845 |
| 551 | Ga0207708_10117833 | 3300026075 | Bacteria | 2067 |
| 552 | Ga0207708_10226247 | 3300026075 | Unclassified | 1500 |
| 553 | Ga0207708_10232819 | 3300026075 | Bacteria | 1479 |
| 554 | Ga0207702_10107763 | 3300026078 | Bacteria | 2471 |
| 555 | Ga0207641_10020800 | 3300026088 | Bacteria | 5393 |
| 556 | Ga0207641_12057094 | 3300026088 | Unclassified | 572 |
| 557 | Ga0207648_10008493 | 3300026089 | Bacteria | 9937 |
| 558 | Ga0207648_10019939 | 3300026089 | Bacteria | 6051 |
| 559 | Ga0207648_10072685 | 3300026089 | Bacteria | 2997 |
| 560 | Ga0207648_10356406 | 3300026089 | Bacteria | 1319 |
| 561 | Ga0207648_11833986 | 3300026089 | Unclassified | 568 |
| 562 | Ga0207676_10397530 | 3300026095 | Bacteria | 1287 |
| 563 | Ga0207676_10487510 | 3300026095 | Unclassified | 1168 |
| 564 | Ga0207676_10516851 | 3300026095 | Unclassified | 1136 |
| 565 | Ga0207676_10627430 | 3300026095 | Bacteria | 1035 |
| 566 | Ga0207676_11338247 | 3300026095 | Bacteria | 711 |
| 567 | Ga0207676_11608775 | 3300026095 | Unclassified | 647 |
| 568 | Ga0207676_11793688 | 3300026095 | Unclassified | 612 |
| 569 | Ga0207674_10004760 | 3300026116 | Bacteria | 16272 |
| 570 | Ga0207674_10106999 | 3300026116 | Bacteria | 2774 |
| 571 | Ga0207674_10543446 | 3300026116 | Unclassified | 1122 |
| 572 | Ga0207674_11278101 | 3300026116 | Bacteria | 703 |
| 573 | Ga0207675_100079194 | 3300026118 | Bacteria | 3079 |
| 574 | Ga0207675_100208533 | 3300026118 | Unclassified | 1879 |
| 575 | Ga0207675_100667862 | 3300026118 | Bacteria | 1046 |
| 576 | Ga0207675_100909220 | 3300026118 | Unclassified | 897 |
| 577 | Ga0207683_10821099 | 3300026121 | Unclassified | 863 |
| 578 | Ga0207683_10908669 | 3300026121 | Bacteria | 817 |
| 579 | Ga0207698_10023978 | 3300026142 | Bacteria | 4273 |
| 580 | Ga0207698_10164225 | 3300026142 | Bacteria | 1946 |
| 581 | Ga0207698_10686965 | 3300026142 | Unclassified | 1017 |
| 582 | Ga0207698_11511429 | 3300026142 | Unclassified | 687 |
| 583 | Ga0207428_10013006 | 3300027907 | Bacteria | 7289 |
| 584 | Ga0268265_10039144 | 3300028380 | Bacteria | 3492 |
| 585 | Ga0268265_10110805 | 3300028380 | Bacteria | 2240 |
| 586 | Ga0268265_10159633 | 3300028380 | Bacteria | 1913 |
| 587 | Ga0268265_10626216 | 3300028380 | Unclassified | 1031 |
| 588 | Ga0268265_10977545 | 3300028380 | Unclassified | 835 |
| 589 | Ga0268265_12442708 | 3300028380 | Unclassified | 529 |
| 590 | Ga0268264_10010363 | 3300028381 | Bacteria | 7709 |
| 591 | Ga0268264_10257119 | 3300028381 | Bacteria | 1625 |
| 592 | Ga0268264_10335979 | 3300028381 | Bacteria | 1433 |
| 593 | Ga0268264_10502083 | 3300028381 | Bacteria | 1183 |
| 594 | Ga0268264_11206250 | 3300028381 | Bacteria | 766 |
| 595 | Ga0316180_1060416 | 3300030736 | Bacteria | 691 |
| 596 | Ga0307513_10036448 | 3300031456 | Bacteria | 5486 |
| 597 | Ga0307513_10795491 | 3300031456 | Bacteria | 651 |
| 598 | Ga0307408_100198268 | 3300031548 | Bacteria | 1623 |
| 599 | Ga0307408_100262976 | 3300031548 | Bacteria | 1429 |
| 600 | Ga0307413_10797560 | 3300031824 | Bacteria | 793 |
| 601 | Ga0307413_10923806 | 3300031824 | Unclassified | 743 |
| 602 | Ga0307410_10039082 | 3300031852 | Bacteria | 3113 |
| 603 | Ga0307410_10123014 | 3300031852 | Bacteria | 1895 |
| 604 | Ga0307406_10017239 | 3300031901 | Bacteria | 4205 |
| 605 | Ga0307406_10066075 | 3300031901 | Bacteria | 2353 |
| 606 | Ga0307406_10620696 | 3300031901 | Bacteria | 894 |
| 607 | Ga0307412_10309737 | 3300031911 | Bacteria | 1251 |
| 608 | Ga0307412_10593732 | 3300031911 | Unclassified | 937 |
| 609 | Ga0307409_100450472 | 3300031995 | Bacteria | 1242 |
| 610 | Ga0307409_100730753 | 3300031995 | Bacteria | 992 |
| 611 | Ga0307409_101790592 | 3300031995 | Bacteria | 643 |
| 612 | Ga0307416_100066307 | 3300032002 | Bacteria | 2972 |
| 613 | Ga0307416_100083639 | 3300032002 | Unclassified | 2709 |
| 614 | Ga0307416_101317985 | 3300032002 | Unclassified | 828 |
| 615 | Ga0307416_101339156 | 3300032002 | Bacteria | 822 |
| 616 | Ga0307414_10229667 | 3300032004 | Bacteria | 1529 |
| 617 | Ga0307414_10391608 | 3300032004 | Bacteria | 1204 |
| 618 | Ga0307411_10492418 | 3300032005 | Bacteria | 1035 |
| 619 | Ga0307411_10618941 | 3300032005 | Bacteria | 933 |
| 620 | Ga0307411_10941043 | 3300032005 | Bacteria | 770 |
| 621 | Ga0307415_100044648 | 3300032126 | Bacteria | 2964 |
| 622 | Ga0307415_100075964 | 3300032126 | Unclassified | 2380 |
| 623 | Ga0307415_100082632 | 3300032126 | Bacteria | 2299 |
| 624 | Ga0307415_100518796 | 3300032126 | Bacteria | 1045 |
| 625 | Ga0307415_100724678 | 3300032126 | Unclassified | 900 |
| 626 | Ga0307415_101363643 | 3300032126 | Unclassified | 674 |
| 627 | Ga0307415_101828435 | 3300032126 | Bacteria | 588 |
| 628 | Ga0373960_0219733 | 3300035121 | Bacteria | 679 |
| 629 | Ga0395899_0727196 | 3300037312 | Bacteria | 620 |
| 630 | Ga0395900_0109634 | 3300037418 | Bacteria | 2836 |
| 631 | Ga0395900_0565523 | 3300037418 | Bacteria | 1080 |
| 632 | Ga0395900_0597261 | 3300037418 | Bacteria | 1045 |
| 633 | Ga0395898_0093773 | 3300037466 | Bacteria | 2885 |
| 634 | Ga0395905_0044236 | 3300037471 | Bacteria | 4179 |
| 635 | Ga0395905_0083065 | 3300037471 | Unclassified | 3001 |
| 636 | Ga0395905_0368276 | 3300037471 | Bacteria | 1330 |
| 637 | Ga0395905_0537571 | 3300037471 | Unclassified | 1070 |
| 638 | Ga0395905_0605021 | 3300037471 | Unclassified | 998 |
| 639 | Ga0436364_0048479 | 3300037853 | Unclassified | 2687 |
| 640 | Ga0242419_003074 | 3300038698 | Bacteria | 1115 |
| 641 | Ga0242422_02143 | 3300038699 | Bacteria | 1344 |
| 642 | Ga0242420_014254 | 3300038996 | Bacteria | 1362 |
| 643 | Ga0242420_045253 | 3300038996 | Unclassified | 849 |
| 644 | Ga0436365_0038900 | 3300039437 | Bacteria | 45987 |
| 645 | Ga0436365_0364607 | 3300039437 | Bacteria | 5238 |
| 646 | Ga0436365_1023949 | 3300039437 | Bacteria | 126686 |
| 647 | Ga0436365_1250677 | 3300039437 | Bacteria | 5329 |
| 648 | Ga0439455_0004976 | 3300042012 | Bacteria | 2671 |
| 649 | Ga0439462_0047576 | 3300042015 | Bacteria | 1150 |
| 650 | Ga0450891_029762 | 3300042129 | Unclassified | 562 |
| 651 | Ga0450892_009122 | 3300042130 | Bacteria | 856 |
| 652 | Ga0439446_0010887 | 3300042156 | Bacteria | 2459 |
| 653 | Ga0439458_0005074 | 3300042157 | Bacteria | 2974 |
| 654 | Ga0439460_0225032 | 3300042461 | Unclassified | 644 |
| 655 | Ga0451577_1440035 | 3300042876 | Unclassified | 610 |
| 656 | Ga0451576_0084913 | 3300045051 | Bacteria | 3293 |
| 657 | Ga0451576_2490482 | 3300045051 | Unclassified | 529 |
| 658 | Ga0495632_0012789 | 3300046519 | Bacteria | 4817 |
| 659 | Ga0495663_0000154 | 3300046525 | Bacteria | 27993 |
| 660 | Ga0495598_0000097 | 3300046537 | Bacteria | 14240 |
| 661 | Ga0495621_0007621 | 3300046539 | Bacteria | 3212 |
| 662 | Ga0495621_0059858 | 3300046539 | Bacteria | 1380 |
| 663 | Ga0495668_0002181 | 3300046616 | Bacteria | 16758 |
| 664 | Ga0495636_0013894 | 3300047318 | Bacteria | 3199 |
| 665 | Ga0495672_0009111 | 3300047320 | Bacteria | 7237 |
| 666 | Ga0496102_0043354 | 3300048905 | Bacteria | 4079 |
| 667 | Ga0496104_0428974 | 3300048907 | Bacteria | 1234 |
| 668 | Ga0496106_0064870 | 3300048909 | Bacteria | 2779 |
| 669 | Ga0496106_0312845 | 3300048909 | Unclassified | 1260 |
| 670 | Ga0496106_1271378 | 3300048909 | Unclassified | 572 |
| 671 | Ga0496108_0035963 | 3300048911 | Bacteria | 4119 |
| 672 | Ga0496108_0068538 | 3300048911 | Bacteria | 2993 |
| 673 | Ga0496108_0310238 | 3300048911 | Bacteria | 1375 |
| 674 | Ga0496109_0478359 | 3300048912 | Bacteria | 1176 |
| 675 | Ga0496109_0617799 | 3300048912 | Unclassified | 1020 |
| 676 | Ga0496109_1295324 | 3300048912 | Unclassified | 665 |
| 677 | Ga0496110_0335820 | 3300048913 | Bacteria | 1377 |
| 678 | Ga0496110_0395939 | 3300048913 | Bacteria | 1259 |
| 679 | Ga0496110_1108607 | 3300048913 | Unclassified | 700 |
| 680 | Ga0496111_0171929 | 3300048914 | Bacteria | 1610 |
| 681 | Ga0496111_0761794 | 3300048914 | Unclassified | 702 |
| 682 | Ga0496112_0094713 | 3300048915 | Bacteria | 2957 |
| 683 | Ga0496112_0216301 | 3300048915 | Bacteria | 1873 |
| 684 | Ga0496112_0291879 | 3300048915 | Bacteria | 1577 |
| 685 | Ga0496112_0313505 | 3300048915 | Bacteria | 1514 |
| 686 | Ga0496112_0398625 | 3300048915 | Bacteria | 1316 |
| 687 | Ga0496112_0462957 | 3300048915 | Bacteria | 1205 |
| 688 | Ga0496112_0651954 | 3300048915 | Unclassified | 982 |
| 689 | Ga0496113_0041685 | 3300048916 | Bacteria | 3389 |
| 690 | Ga0496113_1306865 | 3300048916 | Unclassified | 564 |
| 691 | Ga0501290_036537 | 3300049513 | Bacteria | 722 |
| 692 | Ga0501291_000902 | 3300049514 | Bacteria | 3402 |
| 693 | Ga0501291_003351 | 3300049514 | Bacteria | 1988 |
| 694 | Ga0501292_012772 | 3300049515 | Bacteria | 1285 |
| 695 | Ga0501292_017081 | 3300049515 | Bacteria | 1145 |
| 696 | Ga0501294_020325 | 3300049517 | Unclassified | 716 |
| 697 | Ga0501295_030452 | 3300049518 | Bacteria | 1061 |
| 698 | Ga0501296_000889 | 3300049519 | Bacteria | 2937 |
| 699 | Ga0501296_028906 | 3300049519 | Bacteria | 739 |
| 700 | Ga0501297_003155 | 3300049520 | Bacteria | 1627 |
| 701 | Ga0501297_007613 | 3300049520 | Bacteria | 1181 |
| 702 | Ga0501297_009658 | 3300049520 | Bacteria | 1082 |
| 703 | Ga0501298_009025 | 3300049521 | Bacteria | 1687 |
| 704 | Ga0501298_025440 | 3300049521 | Bacteria | 1133 |
| 705 | Ga0501298_172193 | 3300049521 | Unclassified | 539 |
| 706 | Ga0501299_000266 | 3300049522 | Bacteria | 5989 |
| 707 | Ga0501299_034091 | 3300049522 | Bacteria | 995 |
| 708 | Ga0501303_010150 | 3300049526 | Bacteria | 878 |
| 709 | Ga0501040_1244272 | 3300049576 | Unclassified | 540 |
| 710 | Ga0501074_1168046 | 3300049590 | Unclassified | 540 |
| 711 | Ga0501075_0289107 | 3300049591 | Bacteria | 1249 |
| 712 | Ga0501075_0499060 | 3300049591 | Bacteria | 928 |
| 713 | Ga0501076_0280168 | 3300049592 | Bacteria | 1366 |
| 714 | Ga0501077_0327870 | 3300049593 | Unclassified | 976 |
| 715 | Ga0501198_018537 | 3300049649 | Unclassified | 1090 |
| 716 | Ga0501198_055381 | 3300049649 | Bacteria | 715 |
| 717 | Ga0501206_005472 | 3300049653 | Bacteria | 1635 |
| 718 | Ga0501206_007691 | 3300049653 | Bacteria | 1416 |
| 719 | Ga0501207_012015 | 3300049654 | Bacteria | 1297 |
| 720 | Ga0501207_052627 | 3300049654 | Bacteria | 730 |
| 721 | Ga0501209_153637 | 3300049656 | Bacteria | 694 |
| 722 | Ga0501216_001967 | 3300049660 | Bacteria | 2853 |
| 723 | Ga0501216_038956 | 3300049660 | Bacteria | 902 |
| 724 | Ga0501217_002116 | 3300049661 | Bacteria | 3853 |
| 725 | Ga0501217_075116 | 3300049661 | Bacteria | 926 |
| 726 | Ga0501223_029092 | 3300049663 | Bacteria | 1075 |
| 727 | Ga0501224_009439 | 3300049664 | Bacteria | 1428 |
| 728 | Ga0501224_017715 | 3300049664 | Bacteria | 1059 |
| 729 | Ga0501224_034156 | 3300049664 | Bacteria | 763 |
| 730 | Ga0501227_050169 | 3300049665 | Bacteria | 1051 |
| 731 | Ga0501228_036249 | 3300049666 | Unclassified | 625 |
| 732 | Ga0501233_034280 | 3300049668 | Unclassified | 1164 |
| 733 | Ga0501233_046455 | 3300049668 | Bacteria | 1039 |
| 734 | Ga0501233_128059 | 3300049668 | Bacteria | 691 |
| 735 | Ga0501233_238654 | 3300049668 | Unclassified | 543 |
| 736 | Ga0501235_007600 | 3300049669 | Bacteria | 2361 |
| 737 | Ga0501235_007777 | 3300049669 | Bacteria | 2337 |
| 738 | Ga0501235_017269 | 3300049669 | Bacteria | 1596 |
| 739 | Ga0501242_069914 | 3300049674 | Bacteria | 548 |
| 740 | Ga0501249_116115 | 3300049679 | Bacteria | 650 |
| 741 | Ga0501251_076557 | 3300049681 | Bacteria | 580 |
| 742 | Ga0501252_064134 | 3300049682 | Bacteria | 580 |
| 743 | Ga0501253_002201 | 3300049683 | Bacteria | 2159 |
| 744 | Ga0501253_123468 | 3300049683 | Unclassified | 629 |
| 745 | Ga0501255_021692 | 3300049684 | Bacteria | 836 |
| 746 | Ga0501256_001192 | 3300049685 | Bacteria | 1870 |
| 747 | Ga0501257_045656 | 3300049686 | Bacteria | 1084 |
| 748 | Ga0501257_130161 | 3300049686 | Bacteria | 680 |
| 749 | Ga0501259_059756 | 3300049688 | Bacteria | 794 |
| 750 | Ga0501260_019011 | 3300049689 | Bacteria | 735 |
| 751 | Ga0501261_117993 | 3300049690 | Bacteria | 522 |
| 752 | Ga0501225_0008790 | 3300049705 | Bacteria | 2892 |
| 753 | Ga0501225_0017183 | 3300049705 | Bacteria | 2008 |
| 754 | Ga0501225_0087361 | 3300049705 | Bacteria | 900 |
| 755 | Ga0501225_0106943 | 3300049705 | Unclassified | 822 |
| 756 | Ga0501225_0302669 | 3300049705 | Bacteria | 541 |
| 757 | Ga0501234_034108 | 3300049707 | Bacteria | 825 |
| 758 | Ga0501079_0384125 | 3300049741 | Bacteria | 1101 |
| 759 | Ga0501079_0473001 | 3300049741 | Bacteria | 985 |
| 760 | Ga0501080_0905148 | 3300049742 | Bacteria | 769 |
| 761 | Ga0501232_027800 | 3300049757 | Bacteria | 769 |
| 762 | Ga0501266_010515 | 3300049763 | Bacteria | 1179 |
| 763 | Ga0501266_035854 | 3300049763 | Bacteria | 723 |
| 764 | Ga0501268_007817 | 3300049765 | Bacteria | 1604 |
| 765 | Ga0501268_056610 | 3300049765 | Bacteria | 769 |
| 766 | Ga0501270_028364 | 3300049767 | Bacteria | 907 |
| 767 | Ga0501271_001898 | 3300049768 | Bacteria | 1821 |
| 768 | Ga0501272_059912 | 3300049769 | Bacteria | 542 |
| 769 | Ga0501273_004341 | 3300049770 | Bacteria | 1553 |
| 770 | Ga0501273_020274 | 3300049770 | Bacteria | 896 |
| 771 | Ga0501274_033886 | 3300049771 | Unclassified | 588 |
| 772 | Ga0501278_002852 | 3300049774 | Bacteria | 1215 |
| 773 | Ga0501283_002122 | 3300049779 | Bacteria | 2570 |
| 774 | Ga0501283_032526 | 3300049779 | Bacteria | 880 |
| 775 | Ga0501283_102953 | 3300049779 | Bacteria | 558 |
| 776 | Ga0501045_0737918 | 3300049824 | Unclassified | 726 |
| 777 | Ga0501212_058390 | 3300049851 | Bacteria | 664 |
| 778 | Ga0501212_062125 | 3300049851 | Bacteria | 648 |
| 779 | Ga0501212_069719 | 3300049851 | Unclassified | 621 |
| 780 | nmdc:mga05p37_105816_c1 | 3300050507 | Unclassified | 3461 |
| 781 | nmdc:mga05p37_1064724_c1 | 3300050507 | Unclassified | 851 |
| 782 | nmdc:mga05p37_130170_c1 | 3300050507 | Bacteria | 3087 |
| 783 | nmdc:mga05p37_131323_c1 | 3300050507 | Unclassified | 3073 |
| 784 | nmdc:mga05p37_285564_c1 | 3300050507 | Unclassified | 1966 |
| 785 | nmdc:mga05p37_286538_c1 | 3300050507 | Unclassified | 1962 |
| 786 | nmdc:mga05p37_342735_c1 | 3300050507 | Bacteria | 1762 |
| 787 | nmdc:mga09592_525857_c1 | 3300050508 | Unclassified | 1017 |
| 788 | nmdc:mga09592_552199_c1 | 3300050508 | Unclassified | 989 |
| 789 | nmdc:mga0qj67_206819_c1 | 3300050509 | Unclassified | 1594 |
| 790 | nmdc:mga0qj67_40669_c1 | 3300050509 | Bacteria | 3654 |
| 791 | nmdc:mga0qj67_80966_c1 | 3300050509 | Bacteria | 2603 |
| 792 | nmdc:mga06r32_168110_c1 | 3300050510 | Bacteria | 2176 |
| 793 | nmdc:mga06r32_344617_c1 | 3300050510 | Bacteria | 1474 |
| 794 | nmdc:mga06r32_74883_c1 | 3300050510 | Bacteria | 3283 |
| 795 | nmdc:mga06r32_773379_c1 | 3300050510 | Unclassified | 922 |
| 796 | nmdc:mga08y16_115681_c1 | 3300050511 | Bacteria | 2792 |
| 797 | nmdc:mga08y16_137556_c1 | 3300050511 | Bacteria | 2539 |
| 798 | nmdc:mga08y16_211007_c1 | 3300050511 | Bacteria | 2011 |
| 799 | nmdc:mga08y16_230438_c1 | 3300050511 | Bacteria | 1916 |
| 800 | nmdc:mga08y16_48820_c1 | 3300050511 | Bacteria | 4429 |
| 801 | nmdc:mga08y16_613952_c1 | 3300050511 | Unclassified | 1095 |
| 802 | nmdc:mga08y16_9954_c1 | 3300050511 | Bacteria | 9981 |
| 803 | nmdc:mga0n895_214655_c1 | 3300050512 | Bacteria | 1954 |
| 804 | nmdc:mga0n895_345427_c1 | 3300050512 | Bacteria | 1507 |
| 805 | nmdc:mga0rr50_1560043_c1 | 3300050513 | Bacteria | 558 |
| 806 | nmdc:mga0rr50_98618_c1 | 3300050513 | Bacteria | 2290 |
| 807 | nmdc:mga08x19_30832_c1 | 3300050514 | Bacteria | 3370 |
| 808 | nmdc:mga0a205_136783_c1 | 3300050515 | Bacteria | 2351 |
| 809 | nmdc:mga0a205_1427747_c1 | 3300050515 | Unclassified | 540 |
| 810 | nmdc:mga0a205_258363_c1 | 3300050515 | Bacteria | 1620 |
| 811 | nmdc:mga0a205_382591_c1 | 3300050515 | Bacteria | 1272 |
| 812 | nmdc:mga0a205_38526_c1 | 3300050515 | Bacteria | 4599 |
| 813 | nmdc:mga0a205_409206_c1 | 3300050515 | Bacteria | 1220 |
| 814 | nmdc:mga0a205_504450_c1 | 3300050515 | Bacteria | 1067 |
| 815 | nmdc:mga0a205_58119_c1 | 3300050515 | Bacteria | 3735 |
| 816 | nmdc:mga0a205_62630_c1 | 3300050515 | Bacteria | 3594 |
| 817 | nmdc:mga0a205_903092_c1 | 3300050515 | Unclassified | 730 |
| 818 | nmdc:mga0a205_936177_c1 | 3300050515 | Bacteria | 713 |
| 819 | Ga0500577_0001033 | 3300053142 | Bacteria | 7187 |
| 820 | Ga0501082_0977178 | 3300060353 | Unclassified | 740 |
| 821 | Ga0530510_0889905 | 3300061734 | Bacteria | 680 |
| 822 | Ga0068869_100070240 | |||
| 823 | SwRhRL2b_contig_2960249 | |||
| 824 | SwRhRL2b_contig_506745 | |||
| 825 | LJNas_1010919 | |||
| 826 | ARCol0yngRDRAFT_1018397 | |||
| 827 | JGI24737J22298_10073067 | |||
| 828 | Ga0065714_10002186 | |||
| 829 | Ga0065704_10003229 | |||
| 830 | Ga0065704_10014104 | |||
| 831 | Ga0065704_10135561 | |||
| 832 | Ga0065704_10221516 | |||
| 833 | Ga0065704_10236155 | |||
| 834 | Ga0065704_10242902 | |||
| 835 | Ga0065704_10658491 | |||
| 836 | Ga0065712_10000113 | |||
| 837 | Ga0065712_10088637 | |||
| 838 | Ga0065712_10132261 | |||
| 839 | Ga0065712_10283056 | |||
| 840 | Ga0065715_10006379 | |||
| 841 | Ga0065715_10090024 | |||
| 842 | Ga0065715_10091511 | |||
| 843 | Ga0065715_10113127 | |||
| 844 | Ga0065715_10116659 | |||
| 845 | Ga0065715_10199839 | |||
| 846 | Ga0065707_10001531 | |||
| 847 | Ga0065707_10190229 | |||
| 848 | Ga0065707_10201992 | |||
| 849 | Ga0065707_10910515 | |||
| 850 | Ga0070676_10205841 | |||
| 851 | Ga0070676_10379883 | |||
| 852 | Ga0070683_100128569 | |||
| 853 | Ga0070683_100148445 | |||
| 854 | Ga0070683_100881912 | |||
| 855 | Ga0070690_100004206 | |||
| 856 | Ga0070690_100006228 | |||
| 857 | Ga0070690_100284954 | |||
| 858 | Ga0070670_100039706 | |||
| 859 | Ga0070670_100135871 | |||
| 860 | Ga0068869_100022495 | |||
| 861 | Ga0068869_100199456 | |||
| 862 | Ga0068869_100943592 | |||
| 863 | Ga0068869_101155523 | |||
| 864 | Ga0068869_102026881 | |||
| 865 | Ga0070666_10723579 | |||
| 866 | Ga0070680_100000139 | |||
| 867 | Ga0070682_100000311 | |||
| 868 | Ga0070682_100028715 | |||
| 869 | Ga0068868_100504944 | |||
| 870 | Ga0068868_100784204 | |||
| 871 | Ga0068868_101268905 | |||
| 872 | Ga0068868_102351445 | |||
| 873 | Ga0070660_100053049 | |||
| 874 | Ga0070689_100368074 | |||
| 875 | Ga0070689_101299471 | |||
| 876 | Ga0070691_10713700 | |||
| 877 | Ga0070687_100364939 | |||
| 878 | Ga0070687_100378001 | |||
| 879 | Ga0070661_100048060 | |||
| 880 | Ga0070661_100065157 | |||
| 881 | Ga0070661_100497970 | |||
| 882 | Ga0070692_10013410 | |||
| 883 | Ga0070692_10036037 | |||
| 884 | Ga0070692_10226697 | |||
| 885 | Ga0070692_10537258 | |||
| 886 | Ga0070692_10914754 | |||
| 887 | Ga0070668_100018588 | |||
| 888 | Ga0070668_100581261 | |||
| 889 | Ga0070669_100022866 | |||
| 890 | Ga0070669_100038209 | |||
| 891 | Ga0070669_100305950 | |||
| 892 | Ga0070669_100775324 | |||
| 893 | Ga0070675_100547652 | |||
| 894 | Ga0070671_100088184 | |||
| 895 | Ga0070671_100121182 | |||
| 896 | Ga0070671_100896014 | |||
| 897 | Ga0070671_101090580 | |||
| 898 | Ga0070674_100774679 | |||
| 899 | Ga0070673_100020213 | |||
| 900 | Ga0070673_100135359 | |||
| 901 | Ga0070659_100002723 | |||
| 902 | Ga0070659_100649762 | |||
| 903 | Ga0070667_100823795 | |||
| 904 | Ga0070703_10386616 | |||
| 905 | Ga0070701_10031043 | |||
| 906 | Ga0070701_10844120 | |||
| 907 | Ga0070705_100579965 | |||
| 908 | Ga0070705_100677847 | |||
| 909 | Ga0070700_100003151 | |||
| 910 | Ga0070700_100026221 | |||
| 911 | Ga0070700_100385318 | |||
| 912 | Ga0070694_100064064 | |||
| 913 | Ga0070694_100090462 | |||
| 914 | Ga0070694_100109992 | |||
| 915 | Ga0070694_100123725 | |||
| 916 | Ga0070708_100157015 | |||
| 917 | Ga0070708_100328812 | |||
| 918 | Ga0070663_100366820 | |||
| 919 | Ga0070663_100481179 | |||
| 920 | Ga0070663_101085684 | |||
| 921 | Ga0070662_100212418 | |||
| 922 | Ga0070662_101291897 | |||
| 923 | Ga0070662_101312664 | |||
| 924 | Ga0070662_101831042 | |||
| 925 | Ga0070681_10000350 | |||
| 926 | Ga0070681_10003130 | |||
| 927 | Ga0068867_100026995 | |||
| 928 | Ga0068867_101296706 | |||
| 929 | Ga0070706_100137332 | |||
| 930 | Ga0070706_101796026 | |||
| 931 | Ga0070707_100161792 | |||
| 932 | Ga0070707_100539982 | |||
| 933 | Ga0070698_100012329 | |||
| 934 | Ga0070698_100032837 | |||
| 935 | Ga0070698_100570262 | |||
| 936 | Ga0070699_100060650 | |||
| 937 | Ga0070699_100156639 | |||
| 938 | Ga0070699_100487087 | |||
| 939 | Ga0070699_101079043 | |||
| 940 | Ga0070679_100000059 | |||
| 941 | Ga0070679_100011688 | |||
| 942 | Ga0070679_100117327 | |||
| 943 | Ga0070679_100405576 | |||
| 944 | Ga0070684_100113229 | |||
| 945 | Ga0070684_101710759 | |||
| 946 | Ga0070697_100000042 | |||
| 947 | Ga0070697_100004594 | |||
| 948 | Ga0070697_100083361 | |||
| 949 | Ga0070697_100097028 | |||
| 950 | Ga0070697_100105843 | |||
| 951 | Ga0070697_100108014 | |||
| 952 | Ga0070697_100143262 | |||
| 953 | Ga0070697_100150408 | |||
| 954 | Ga0070697_101437927 | |||
| 955 | Ga0070697_101547094 | |||
| 956 | Ga0068853_100011800 | |||
| 957 | Ga0068853_100091583 | |||
| 958 | Ga0068853_100099858 | |||
| 959 | Ga0068853_100155987 | |||
| 960 | Ga0068853_100196488 | |||
| 961 | Ga0070672_100043297 | |||
| 962 | Ga0070672_100236897 | |||
| 963 | Ga0070672_100605049 | |||
| 964 | Ga0070686_100007940 | |||
| 965 | Ga0070686_100145614 | |||
| 966 | Ga0070695_100017748 | |||
| 967 | Ga0070695_100054421 | |||
| 968 | Ga0070695_101019183 | |||
| 969 | Ga0070696_100006190 | |||
| 970 | Ga0070696_100021784 | |||
| 971 | Ga0070696_100599474 | |||
| 972 | Ga0070693_100374224 | |||
| 973 | Ga0070693_100735523 | |||
| 974 | Ga0070704_100106415 | |||
| 975 | Ga0070704_100165334 | |||
| 976 | Ga0070704_100328183 | |||
| 977 | Ga0070704_100343171 | |||
| 978 | Ga0068855_102424576 | |||
| 979 | Ga0070664_100007058 | |||
| 980 | Ga0070664_100066697 | |||
| 981 | Ga0070664_100084001 | |||
| 982 | Ga0070664_100258363 | |||
| 983 | Ga0070664_100608461 | |||
| 984 | Ga0070664_100787259 | |||
| 985 | Ga0070664_102071911 | |||
| 986 | Ga0068857_100008041 | |||
| 987 | Ga0068857_100045462 | |||
| 988 | Ga0068857_100676387 | |||
| 989 | Ga0068857_100855342 | |||
| 990 | Ga0068857_101013169 | |||
| 991 | Ga0068857_101212234 | |||
| 992 | Ga0068854_100120561 | |||
| 993 | Ga0068854_100166988 | |||
| 994 | Ga0068854_100261518 | |||
| 995 | Ga0068854_100262248 | |||
| 996 | Ga0068854_100954252 | |||
| 997 | Ga0068854_101830259 | |||
| 998 | Ga0068852_100105697 | |||
| 999 | Ga0068852_100250766 | |||
| 1000 | Ga0068859_100027753 | |||
| 1001 | Ga0068859_100066720 | |||
| 1002 | Ga0068859_100067920 | |||
| 1003 | Ga0068859_100100077 | |||
| 1004 | Ga0068859_100642430 | |||
| 1005 | Ga0068859_100807562 | |||
| 1006 | Ga0068859_100995464 | |||
| 1007 | Ga0068859_101133847 | |||
| 1008 | Ga0068859_102840187 | |||
| 1009 | Ga0068864_100137240 | |||
| 1010 | Ga0068864_100191905 | |||
| 1011 | Ga0068864_100227925 | |||
| 1012 | Ga0068864_100269135 | |||
| 1013 | Ga0068864_100355857 | |||
| 1014 | Ga0068864_100491831 | |||
| 1015 | Ga0068864_100640432 | |||
| 1016 | Ga0068864_101379924 | |||
| 1017 | Ga0068864_102082327 | |||
| 1018 | Ga0068864_102157428 | |||
| 1019 | Ga0068866_10485909 | |||
| 1020 | Ga0068861_100089279 | |||
| 1021 | Ga0068861_100538121 | |||
| 1022 | Ga0068861_101126157 | |||
| 1023 | Ga0068851_10025098 | |||
| 1024 | Ga0068870_10553656 | |||
| 1025 | Ga0068863_100074385 | |||
| 1026 | Ga0068863_100703930 | |||
| 1027 | Ga0068863_102117639 | |||
| 1028 | Ga0068858_100076240 | |||
| 1029 | Ga0068858_100095575 | |||
| 1030 | Ga0068858_100224678 | |||
| 1031 | Ga0068858_100336760 | |||
| 1032 | Ga0068858_102038865 | |||
| 1033 | Ga0068860_100020300 | |||
| 1034 | Ga0068860_100355662 | |||
| 1035 | Ga0068860_100830547 | |||
| 1036 | Ga0068860_101222965 | |||
| 1037 | Ga0068860_101604552 | |||
| 1038 | Ga0068862_100030465 | |||
| 1039 | Ga0068862_100070490 | |||
| 1040 | Ga0068862_100347441 | |||
| 1041 | Ga0068862_100442215 | |||
| 1042 | Ga0068862_100624404 | |||
| 1043 | Ga0068862_102579522 | |||
| 1044 | Ga0081539_10000360 | |||
| 1045 | Ga0081539_10000669 | |||
| 1046 | Ga0081539_10023171 | |||
| 1047 | Ga0081539_10106916 | |||
| 1048 | Ga0075432_10347193 | |||
| 1049 | Ga0070716_100247363 | |||
| 1050 | Ga0068871_100447169 | |||
| 1051 | Ga0068871_100926947 | |||
| 1052 | Ga0075428_100527335 | |||
| 1053 | Ga0075428_100550547 | |||
| 1054 | Ga0075428_100606264 | |||
| 1055 | Ga0075430_100206432 | |||
| 1056 | Ga0075431_100889934 | |||
| 1057 | Ga0075433_10010620 | |||
| 1058 | Ga0075433_10029791 | |||
| 1059 | Ga0075433_10307695 | |||
| 1060 | Ga0075433_10418320 | |||
| 1061 | Ga0075433_10498032 | |||
| 1062 | Ga0075433_10996049 | |||
| 1063 | Ga0075433_11505207 | |||
| 1064 | Ga0075434_101910781 | |||
| 1065 | Ga0075434_102423434 | |||
| 1066 | Ga0075429_100620114 | |||
| 1067 | Ga0068865_100987049 | |||
| 1068 | Ga0075436_100022459 | |||
| 1069 | Ga0097620_100027755 | |||
| 1070 | Ga0097620_100066722 | |||
| 1071 | Ga0097620_100067920 | |||
| 1072 | Ga0097620_100100075 | |||
| 1073 | Ga0097620_100642387 | |||
| 1074 | Ga0097620_100807544 | |||
| 1075 | Ga0097620_100995489 | |||
| 1076 | Ga0097620_101133796 | |||
| 1077 | Ga0097620_102841429 | |||
| 1078 | Ga0075435_100344134 | |||
| 1079 | Ga0075435_101740724 | |||
| 1080 | Ga0105251_10036530 | |||
| 1081 | Ga0105250_10294458 | |||
| 1082 | Ga0105250_10568687 | |||
| 1083 | Ga0105250_10594666 | |||
| 1084 | Ga0105240_10184648 | |||
| 1085 | Ga0105240_11186845 | |||
| 1086 | Ga0111539_10013585 | |||
| 1087 | Ga0111539_10021005 | |||
| 1088 | Ga0111539_10121917 | |||
| 1089 | Ga0111539_10148585 | |||
| 1090 | Ga0111539_10503287 | |||
| 1091 | Ga0111539_10941280 | |||
| 1092 | Ga0105245_10531346 | |||
| 1093 | Ga0105245_10586746 | |||
| 1094 | Ga0105245_10591486 | |||
| 1095 | Ga0105245_11010160 | |||
| 1096 | Ga0105245_11219695 | |||
| 1097 | Ga0105245_11908222 | |||
| 1098 | Ga0105245_12079828 | |||
| 1099 | Ga0105247_10033320 | |||
| 1100 | Ga0105247_10053337 | |||
| 1101 | Ga0105247_10346886 | |||
| 1102 | Ga0105247_10462574 | |||
| 1103 | Ga0105247_10732357 | |||
| 1104 | Ga0114129_10010635 | |||
| 1105 | Ga0114129_10040157 | |||
| 1106 | Ga0114129_10058175 | |||
| 1107 | Ga0114129_10159250 | |||
| 1108 | Ga0114129_10217853 | |||
| 1109 | Ga0114129_11275721 | |||
| 1110 | Ga0114129_11622643 | |||
| 1111 | Ga0114129_12490829 | |||
| 1112 | Ga0105243_10178238 | |||
| 1113 | Ga0105243_10299256 | |||
| 1114 | Ga0105243_10304533 | |||
| 1115 | Ga0105243_10891143 | |||
| 1116 | Ga0105243_10999260 | |||
| 1117 | Ga0105243_11622419 | |||
| 1118 | Ga0105243_11675285 | |||
| 1119 | Ga0105243_11869345 | |||
| 1120 | Ga0105241_10042588 | |||
| 1121 | Ga0105241_10076458 | |||
| 1122 | Ga0105241_10100176 | |||
| 1123 | Ga0105241_10117704 | |||
| 1124 | Ga0105241_10125607 | |||
| 1125 | Ga0105241_10418812 | |||
| 1126 | Ga0105241_10441112 | |||
| 1127 | Ga0105241_10534563 | |||
| 1128 | Ga0105241_10598481 | |||
| 1129 | Ga0105241_11203129 | |||
| 1130 | Ga0105241_12004356 | |||
| 1131 | Ga0105242_10481578 | |||
| 1132 | Ga0105242_11267949 | |||
| 1133 | Ga0105242_11792784 | |||
| 1134 | Ga0105242_12467383 | |||
| 1135 | Ga0105248_10014958 | |||
| 1136 | Ga0105248_10036451 | |||
| 1137 | Ga0105248_10252526 | |||
| 1138 | Ga0105248_10326581 | |||
| 1139 | Ga0105248_10457596 | |||
| 1140 | Ga0105248_10578169 | |||
| 1141 | Ga0105248_10843401 | |||
| 1142 | Ga0105248_10853842 | |||
| 1143 | Ga0105248_12010667 | |||
| 1144 | Ga0105237_10002569 | |||
| 1145 | Ga0105237_10118731 | |||
| 1146 | Ga0105237_10225442 | |||
| 1147 | Ga0105237_11045318 | |||
| 1148 | Ga0105238_10003652 | |||
| 1149 | Ga0105238_10098525 | |||
| 1150 | Ga0105238_10950729 | |||
| 1151 | Ga0105238_11097746 | |||
| 1152 | Ga0105249_10000044 | |||
| 1153 | Ga0105249_10054955 | |||
| 1154 | Ga0105249_10073041 | |||
| 1155 | Ga0105249_10125570 | |||
| 1156 | Ga0105249_10371159 | |||
| 1157 | Ga0105249_10673678 | |||
| 1158 | Ga0105249_11124974 | |||
| 1159 | Ga0105249_11373681 | |||
| 1160 | Ga0105239_11056135 | |||
| 1161 | Ga0105239_11083431 | |||
| 1162 | Ga0105239_11854106 | |||
| 1163 | Ga0105246_10008236 | |||
| 1164 | Ga0105246_10834728 | |||
| 1165 | Ga0105246_11935758 | |||
| 1166 | Ga0157373_10006382 | |||
| 1167 | Ga0157373_10217554 | |||
| 1168 | Ga0157373_11085587 | |||
| 1169 | Ga0157371_10196493 | |||
| 1170 | Ga0157371_10463508 | |||
| 1171 | Ga0157371_10700721 | |||
| 1172 | Ga0157370_10036799 | |||
| 1173 | Ga0157370_10263238 | |||
| 1174 | Ga0157370_10742048 | |||
| 1175 | Ga0157370_11445740 | |||
| 1176 | Ga0157374_10103556 | |||
| 1177 | Ga0157378_10012900 | |||
| 1178 | Ga0157378_10013580 | |||
| 1179 | Ga0157378_10061703 | |||
| 1180 | Ga0157378_10108122 | |||
| 1181 | Ga0157378_10374879 | |||
| 1182 | Ga0157378_10874665 | |||
| 1183 | Ga0157378_10939479 | |||
| 1184 | Ga0157378_11017971 | |||
| 1185 | Ga0157378_11280265 | |||
| 1186 | Ga0157378_11385326 | |||
| 1187 | Ga0163162_10000025 | |||
| 1188 | Ga0163162_10020033 | |||
| 1189 | Ga0163162_10030465 | |||
| 1190 | Ga0163162_10074816 | |||
| 1191 | Ga0163162_10256605 | |||
| 1192 | Ga0163162_10262379 | |||
| 1193 | Ga0163162_10398506 | |||
| 1194 | Ga0163162_10431749 | |||
| 1195 | Ga0163162_10471956 | |||
| 1196 | Ga0163162_10546749 | |||
| 1197 | Ga0163162_10644056 | |||
| 1198 | Ga0163162_10669861 | |||
| 1199 | Ga0163162_11165683 | |||
| 1200 | Ga0163162_11171402 | |||
| 1201 | Ga0163162_11266202 | |||
| 1202 | Ga0163162_11435939 | |||
| 1203 | Ga0163162_11831855 | |||
| 1204 | Ga0157372_10031443 | |||
| 1205 | Ga0157372_10249053 | |||
| 1206 | Ga0157372_10426977 | |||
| 1207 | Ga0157372_10859385 | |||
| 1208 | Ga0157375_10047618 | |||
| 1209 | Ga0157375_10069225 | |||
| 1210 | Ga0157375_10128693 | |||
| 1211 | Ga0157375_10532278 | |||
| 1212 | Ga0157375_10778616 | |||
| 1213 | Ga0157375_10959926 | |||
| 1214 | Ga0157375_11154279 | |||
| 1215 | Ga0157375_11552760 | |||
| 1216 | Ga0157375_12363062 | |||
| 1217 | Ga0157375_12902154 | |||
| 1218 | Ga0163163_10000536 | |||
| 1219 | Ga0163163_10003037 | |||
| 1220 | Ga0163163_10130388 | |||
| 1221 | Ga0163163_10185263 | |||
| 1222 | Ga0163163_10307647 | |||
| 1223 | Ga0163163_10582145 | |||
| 1224 | Ga0163163_10990175 | |||
| 1225 | Ga0163163_11162314 | |||
| 1226 | Ga0163163_12249792 | |||
| 1227 | Ga0157380_10010426 | |||
| 1228 | Ga0157380_10011038 | |||
| 1229 | Ga0157380_10013135 | |||
| 1230 | Ga0157380_10016677 | |||
| 1231 | Ga0157380_10042459 | |||
| 1232 | Ga0157380_10043819 | |||
| 1233 | Ga0157380_10498709 | |||
| 1234 | Ga0157380_10500792 | |||
| 1235 | Ga0157380_11585100 | |||
| 1236 | Ga0157377_10200541 | |||
| 1237 | Ga0157377_10257125 | |||
| 1238 | Ga0157377_10329206 | |||
| 1239 | Ga0157377_10490512 | |||
| 1240 | Ga0157377_10805215 | |||
| 1241 | Ga0157377_10964869 | |||
| 1242 | Ga0157377_11376831 | |||
| 1243 | Ga0157379_10231371 | |||
| 1244 | Ga0157379_10454870 | |||
| 1245 | Ga0157376_10902474 | |||
| 1246 | Ga0157376_11566296 | |||
| 1247 | Ga0182007_10258583 | |||
| 1248 | Ga0182005_1083091 | |||
| 1249 | Ga0213876_10000038 | |||
| 1250 | Ga0213876_10000382 | |||
| 1251 | Ga0207713_1161150 | |||
| 1252 | Ga0207653_10005271 | |||
| 1253 | Ga0207653_10272648 | |||
| 1254 | Ga0207710_10027307 | |||
| 1255 | Ga0207710_10232447 | |||
| 1256 | Ga0207647_10006732 | |||
| 1257 | Ga0207645_10054704 | |||
| 1258 | Ga0207645_10279542 | |||
| 1259 | Ga0207645_11189689 | |||
| 1260 | Ga0207643_10001020 | |||
| 1261 | Ga0207643_10493038 | |||
| 1262 | Ga0207684_10000079 | |||
| 1263 | Ga0207684_10069867 | |||
| 1264 | Ga0207684_10369919 | |||
| 1265 | Ga0207684_11257742 | |||
| 1266 | Ga0207654_10019329 | |||
| 1267 | Ga0207654_10714291 | |||
| 1268 | Ga0207707_10000008 | |||
| 1269 | Ga0207707_10000625 | |||
| 1270 | Ga0207707_10019384 | |||
| 1271 | Ga0207707_10285598 | |||
| 1272 | Ga0207707_10522810 | |||
| 1273 | Ga0207663_10574292 | |||
| 1274 | Ga0207660_10004225 | |||
| 1275 | Ga0207660_10063317 | |||
| 1276 | Ga0207660_10341254 | |||
| 1277 | Ga0207660_10527802 | |||
| 1278 | Ga0207660_10733539 | |||
| 1279 | Ga0207662_10002097 | |||
| 1280 | Ga0207657_10036482 | |||
| 1281 | Ga0207649_10626254 | |||
| 1282 | Ga0207652_10000085 | |||
| 1283 | Ga0207652_10019341 | |||
| 1284 | Ga0207652_10064650 | |||
| 1285 | Ga0207646_10081792 | |||
| 1286 | Ga0207646_10473391 | |||
| 1287 | Ga0207646_11463773 | |||
| 1288 | Ga0207681_10005287 | |||
| 1289 | Ga0207681_10015070 | |||
| 1290 | Ga0207681_10093415 | |||
| 1291 | Ga0207681_10531987 | |||
| 1292 | Ga0207694_10039562 | |||
| 1293 | Ga0207650_10035005 | |||
| 1294 | Ga0207650_11860713 | |||
| 1295 | Ga0207659_10145690 | |||
| 1296 | Ga0207659_10800326 | |||
| 1297 | Ga0207659_10937355 | |||
| 1298 | Ga0207687_10669870 | |||
| 1299 | Ga0207687_10704882 | |||
| 1300 | Ga0207690_10759564 | |||
| 1301 | Ga0207706_10071081 | |||
| 1302 | Ga0207706_10232811 | |||
| 1303 | Ga0207706_10741628 | |||
| 1304 | Ga0207686_10240867 | |||
| 1305 | Ga0207686_10693494 | |||
| 1306 | Ga0207709_10012102 | |||
| 1307 | Ga0207709_10036298 | |||
| 1308 | Ga0207709_10338633 | |||
| 1309 | Ga0207709_11538947 | |||
| 1310 | Ga0207670_10000612 | |||
| 1311 | Ga0207670_10317808 | |||
| 1312 | Ga0207665_10006407 | |||
| 1313 | Ga0207691_10016850 | |||
| 1314 | Ga0207691_10989581 | |||
| 1315 | Ga0207711_10195267 | |||
| 1316 | Ga0207711_10243263 | |||
| 1317 | Ga0207711_11136585 | |||
| 1318 | Ga0207711_11539420 | |||
| 1319 | Ga0207689_10002487 | |||
| 1320 | Ga0207689_10060520 | |||
| 1321 | Ga0207689_10080098 | |||
| 1322 | Ga0207689_10435180 | |||
| 1323 | Ga0207689_10487973 | |||
| 1324 | Ga0207689_10691518 | |||
| 1325 | Ga0207689_10699618 | |||
| 1326 | Ga0207661_10214346 | |||
| 1327 | Ga0207661_10221428 | |||
| 1328 | Ga0207661_10492093 | |||
| 1329 | Ga0207679_10091246 | |||
| 1330 | Ga0207679_10122911 | |||
| 1331 | Ga0207679_10289507 | |||
| 1332 | Ga0207679_10601859 | |||
| 1333 | Ga0207679_12152186 | |||
| 1334 | Ga0207667_10678447 | |||
| 1335 | Ga0207667_11396031 | |||
| 1336 | Ga0207651_10009393 | |||
| 1337 | Ga0207651_10197068 | |||
| 1338 | Ga0207651_10366606 | |||
| 1339 | Ga0207651_11151075 | |||
| 1340 | Ga0207712_10000039 | |||
| 1341 | Ga0207712_10087095 | |||
| 1342 | Ga0207712_10112272 | |||
| 1343 | Ga0207712_10260332 | |||
| 1344 | Ga0207712_11012723 | |||
| 1345 | Ga0207712_11405778 | |||
| 1346 | Ga0207712_11805287 | |||
| 1347 | Ga0207668_10578738 | |||
| 1348 | Ga0207640_10037325 | |||
| 1349 | Ga0207640_10150136 | |||
| 1350 | Ga0207640_10220323 | |||
| 1351 | Ga0207640_10280287 | |||
| 1352 | Ga0207640_10317492 | |||
| 1353 | Ga0207640_10428810 | |||
| 1354 | Ga0207640_10444737 | |||
| 1355 | Ga0207640_11276040 | |||
| 1356 | Ga0207640_11873936 | |||
| 1357 | Ga0207677_10223620 | |||
| 1358 | Ga0207677_10778969 | |||
| 1359 | Ga0207703_10056982 | |||
| 1360 | Ga0207703_10222450 | |||
| 1361 | Ga0207703_10236283 | |||
| 1362 | Ga0207703_10492658 | |||
| 1363 | Ga0207639_10070106 | |||
| 1364 | Ga0207639_10181502 | |||
| 1365 | Ga0207639_10269224 | |||
| 1366 | Ga0207639_10835741 | |||
| 1367 | Ga0207639_11277871 | |||
| 1368 | Ga0207678_10236319 | |||
| 1369 | Ga0207678_10587345 | |||
| 1370 | Ga0207678_10728697 | |||
| 1371 | Ga0207708_10000453 | |||
| 1372 | Ga0207708_10117833 | |||
| 1373 | Ga0207708_10226247 | |||
| 1374 | Ga0207708_10232819 | |||
| 1375 | Ga0207702_10107763 | |||
| 1376 | Ga0207641_10020800 | |||
| 1377 | Ga0207641_12057094 | |||
| 1378 | Ga0207648_10008493 | |||
| 1379 | Ga0207648_10019939 | |||
| 1380 | Ga0207648_10072685 | |||
| 1381 | Ga0207648_10356406 | |||
| 1382 | Ga0207648_11833986 | |||
| 1383 | Ga0207676_10397530 | |||
| 1384 | Ga0207676_10487510 | |||
| 1385 | Ga0207676_10516851 | |||
| 1386 | Ga0207676_10627430 | |||
| 1387 | Ga0207676_11338247 | |||
| 1388 | Ga0207676_11608775 | |||
| 1389 | Ga0207676_11793688 | |||
| 1390 | Ga0207674_10004760 | |||
| 1391 | Ga0207674_10106999 | |||
| 1392 | Ga0207674_10543446 | |||
| 1393 | Ga0207674_11278101 | |||
| 1394 | Ga0207675_100079194 | |||
| 1395 | Ga0207675_100208533 | |||
| 1396 | Ga0207675_100667862 | |||
| 1397 | Ga0207675_100909220 | |||
| 1398 | Ga0207683_10821099 | |||
| 1399 | Ga0207683_10908669 | |||
| 1400 | Ga0207698_10023978 | |||
| 1401 | Ga0207698_10164225 | |||
| 1402 | Ga0207698_10686965 | |||
| 1403 | Ga0207698_11511429 | |||
| 1404 | Ga0207428_10013006 | |||
| 1405 | Ga0268265_10039144 | |||
| 1406 | Ga0268265_10110805 | |||
| 1407 | Ga0268265_10159633 | |||
| 1408 | Ga0268265_10626216 | |||
| 1409 | Ga0268265_10977545 | |||
| 1410 | Ga0268265_12442708 | |||
| 1411 | Ga0268264_10010363 | |||
| 1412 | Ga0268264_10257119 | |||
| 1413 | Ga0268264_10335979 | |||
| 1414 | Ga0268264_10502083 | |||
| 1415 | Ga0268264_11206250 | |||
| 1416 | Ga0316180_1060416 | |||
| 1417 | Ga0307513_10036448 | |||
| 1418 | Ga0307513_10795491 | |||
| 1419 | Ga0307408_100198268 | |||
| 1420 | Ga0307408_100262976 | |||
| 1421 | Ga0307413_10797560 | |||
| 1422 | Ga0307413_10923806 | |||
| 1423 | Ga0307410_10039082 | |||
| 1424 | Ga0307410_10123014 | |||
| 1425 | Ga0307406_10017239 | |||
| 1426 | Ga0307406_10066075 | |||
| 1427 | Ga0307406_10620696 | |||
| 1428 | Ga0307412_10309737 | |||
| 1429 | Ga0307412_10593732 | |||
| 1430 | Ga0307409_100450472 | |||
| 1431 | Ga0307409_100730753 | |||
| 1432 | Ga0307409_101790592 | |||
| 1433 | Ga0307416_100066307 | |||
| 1434 | Ga0307416_100083639 | |||
| 1435 | Ga0307416_101317985 | |||
| 1436 | Ga0307416_101339156 | |||
| 1437 | Ga0307414_10229667 | |||
| 1438 | Ga0307414_10391608 | |||
| 1439 | Ga0307411_10492418 | |||
| 1440 | Ga0307411_10618941 | |||
| 1441 | Ga0307411_10941043 | |||
| 1442 | Ga0307415_100044648 | |||
| 1443 | Ga0307415_100075964 | |||
| 1444 | Ga0307415_100082632 | |||
| 1445 | Ga0307415_100518796 | |||
| 1446 | Ga0307415_100724678 | |||
| 1447 | Ga0307415_101363643 | |||
| 1448 | Ga0307415_101828435 | |||
| 1449 | Ga0373960_0219733 | |||
| 1450 | Ga0395899_0727196 | |||
| 1451 | Ga0395900_0109634 | |||
| 1452 | Ga0395900_0565523 | |||
| 1453 | Ga0395900_0597261 | |||
| 1454 | Ga0395898_0093773 | |||
| 1455 | Ga0395905_0044236 | |||
| 1456 | Ga0395905_0083065 | |||
| 1457 | Ga0395905_0368276 | |||
| 1458 | Ga0395905_0537571 | |||
| 1459 | Ga0395905_0605021 | |||
| 1460 | Ga0436364_0048479 | |||
| 1461 | Ga0242419_003074 | |||
| 1462 | Ga0242422_02143 | |||
| 1463 | Ga0242420_014254 | |||
| 1464 | Ga0242420_045253 | |||
| 1465 | Ga0436365_0038900 | |||
| 1466 | Ga0436365_0364607 | |||
| 1467 | Ga0436365_1023949 | |||
| 1468 | Ga0436365_1250677 | |||
| 1469 | Ga0439455_0004976 | |||
| 1470 | Ga0439462_0047576 | |||
| 1471 | Ga0450891_029762 | |||
| 1472 | Ga0450892_009122 | |||
| 1473 | Ga0439446_0010887 | |||
| 1474 | Ga0439458_0005074 | |||
| 1475 | Ga0439460_0225032 | |||
| 1476 | Ga0451577_1440035 | |||
| 1477 | Ga0451576_0084913 | |||
| 1478 | Ga0451576_2490482 | |||
| 1479 | Ga0495632_0012789 | |||
| 1480 | Ga0495663_0000154 | |||
| 1481 | Ga0495598_0000097 | |||
| 1482 | Ga0495621_0007621 | |||
| 1483 | Ga0495621_0059858 | |||
| 1484 | Ga0495668_0002181 | |||
| 1485 | Ga0495636_0013894 | |||
| 1486 | Ga0495672_0009111 | |||
| 1487 | Ga0496102_0043354 | |||
| 1488 | Ga0496104_0428974 | |||
| 1489 | Ga0496106_0064870 | |||
| 1490 | Ga0496106_0312845 | |||
| 1491 | Ga0496106_1271378 | |||
| 1492 | Ga0496108_0035963 | |||
| 1493 | Ga0496108_0068538 | |||
| 1494 | Ga0496108_0310238 | |||
| 1495 | Ga0496109_0478359 | |||
| 1496 | Ga0496109_0617799 | |||
| 1497 | Ga0496109_1295324 | |||
| 1498 | Ga0496110_0335820 | |||
| 1499 | Ga0496110_0395939 | |||
| 1500 | Ga0496110_1108607 | |||
| 1501 | Ga0496111_0171929 | |||
| 1502 | Ga0496111_0761794 | |||
| 1503 | Ga0496112_0094713 | |||
| 1504 | Ga0496112_0216301 | |||
| 1505 | Ga0496112_0291879 | |||
| 1506 | Ga0496112_0313505 | |||
| 1507 | Ga0496112_0398625 | |||
| 1508 | Ga0496112_0462957 | |||
| 1509 | Ga0496112_0651954 | |||
| 1510 | Ga0496113_0041685 | |||
| 1511 | Ga0496113_1306865 | |||
| 1512 | Ga0501290_036537 | |||
| 1513 | Ga0501291_000902 | |||
| 1514 | Ga0501291_003351 | |||
| 1515 | Ga0501292_012772 | |||
| 1516 | Ga0501292_017081 | |||
| 1517 | Ga0501294_020325 | |||
| 1518 | Ga0501295_030452 | |||
| 1519 | Ga0501296_000889 | |||
| 1520 | Ga0501296_028906 | |||
| 1521 | Ga0501297_003155 | |||
| 1522 | Ga0501297_007613 | |||
| 1523 | Ga0501297_009658 | |||
| 1524 | Ga0501298_009025 | |||
| 1525 | Ga0501298_025440 | |||
| 1526 | Ga0501298_172193 | |||
| 1527 | Ga0501299_000266 | |||
| 1528 | Ga0501299_034091 | |||
| 1529 | Ga0501303_010150 | |||
| 1530 | Ga0501040_1244272 | |||
| 1531 | Ga0501074_1168046 | |||
| 1532 | Ga0501075_0289107 | |||
| 1533 | Ga0501075_0499060 | |||
| 1534 | Ga0501076_0280168 | |||
| 1535 | Ga0501077_0327870 | |||
| 1536 | Ga0501198_018537 | |||
| 1537 | Ga0501198_055381 | |||
| 1538 | Ga0501206_005472 | |||
| 1539 | Ga0501206_007691 | |||
| 1540 | Ga0501207_012015 | |||
| 1541 | Ga0501207_052627 | |||
| 1542 | Ga0501209_153637 | |||
| 1543 | Ga0501216_001967 | |||
| 1544 | Ga0501216_038956 | |||
| 1545 | Ga0501217_002116 | |||
| 1546 | Ga0501217_075116 | |||
| 1547 | Ga0501223_029092 | |||
| 1548 | Ga0501224_009439 | |||
| 1549 | Ga0501224_017715 | |||
| 1550 | Ga0501224_034156 | |||
| 1551 | Ga0501227_050169 | |||
| 1552 | Ga0501228_036249 | |||
| 1553 | Ga0501233_034280 | |||
| 1554 | Ga0501233_046455 | |||
| 1555 | Ga0501233_128059 | |||
| 1556 | Ga0501233_238654 | |||
| 1557 | Ga0501235_007600 | |||
| 1558 | Ga0501235_007777 | |||
| 1559 | Ga0501235_017269 | |||
| 1560 | Ga0501242_069914 | |||
| 1561 | Ga0501249_116115 | |||
| 1562 | Ga0501251_076557 | |||
| 1563 | Ga0501252_064134 | |||
| 1564 | Ga0501253_002201 | |||
| 1565 | Ga0501253_123468 | |||
| 1566 | Ga0501255_021692 | |||
| 1567 | Ga0501256_001192 | |||
| 1568 | Ga0501257_045656 | |||
| 1569 | Ga0501257_130161 | |||
| 1570 | Ga0501259_059756 | |||
| 1571 | Ga0501260_019011 | |||
| 1572 | Ga0501261_117993 | |||
| 1573 | Ga0501225_0008790 | |||
| 1574 | Ga0501225_0017183 | |||
| 1575 | Ga0501225_0087361 | |||
| 1576 | Ga0501225_0106943 | |||
| 1577 | Ga0501225_0302669 | |||
| 1578 | Ga0501234_034108 | |||
| 1579 | Ga0501079_0384125 | |||
| 1580 | Ga0501079_0473001 | |||
| 1581 | Ga0501080_0905148 | |||
| 1582 | Ga0501232_027800 | |||
| 1583 | Ga0501266_010515 | |||
| 1584 | Ga0501266_035854 | |||
| 1585 | Ga0501268_007817 | |||
| 1586 | Ga0501268_056610 | |||
| 1587 | Ga0501270_028364 | |||
| 1588 | Ga0501271_001898 | |||
| 1589 | Ga0501272_059912 | |||
| 1590 | Ga0501273_004341 | |||
| 1591 | Ga0501273_020274 | |||
| 1592 | Ga0501274_033886 | |||
| 1593 | Ga0501278_002852 | |||
| 1594 | Ga0501283_002122 | |||
| 1595 | Ga0501283_032526 | |||
| 1596 | Ga0501283_102953 | |||
| 1597 | Ga0501045_0737918 | |||
| 1598 | Ga0501212_058390 | |||
| 1599 | Ga0501212_062125 | |||
| 1600 | Ga0501212_069719 | |||
| 1601 | nmdc:mga05p37_105816_c1 | |||
| 1602 | nmdc:mga05p37_1064724_c1 | |||
| 1603 | nmdc:mga05p37_130170_c1 | |||
| 1604 | nmdc:mga05p37_131323_c1 | |||
| 1605 | nmdc:mga05p37_285564_c1 | |||
| 1606 | nmdc:mga05p37_286538_c1 | |||
| 1607 | nmdc:mga05p37_342735_c1 | |||
| 1608 | nmdc:mga09592_525857_c1 | |||
| 1609 | nmdc:mga09592_552199_c1 | |||
| 1610 | nmdc:mga0qj67_206819_c1 | |||
| 1611 | nmdc:mga0qj67_40669_c1 | |||
| 1612 | nmdc:mga0qj67_80966_c1 | |||
| 1613 | nmdc:mga06r32_168110_c1 | |||
| 1614 | nmdc:mga06r32_344617_c1 | |||
| 1615 | nmdc:mga06r32_74883_c1 | |||
| 1616 | nmdc:mga06r32_773379_c1 | |||
| 1617 | nmdc:mga08y16_115681_c1 | |||
| 1618 | nmdc:mga08y16_137556_c1 | |||
| 1619 | nmdc:mga08y16_211007_c1 | |||
| 1620 | nmdc:mga08y16_230438_c1 | |||
| 1621 | nmdc:mga08y16_48820_c1 | |||
| 1622 | nmdc:mga08y16_613952_c1 | |||
| 1623 | nmdc:mga08y16_9954_c1 | |||
| 1624 | nmdc:mga0n895_214655_c1 | |||
| 1625 | nmdc:mga0n895_345427_c1 | |||
| 1626 | nmdc:mga0rr50_1560043_c1 | |||
| 1627 | nmdc:mga0rr50_98618_c1 | |||
| 1628 | nmdc:mga08x19_30832_c1 | |||
| 1629 | nmdc:mga0a205_136783_c1 | |||
| 1630 | nmdc:mga0a205_1427747_c1 | |||
| 1631 | nmdc:mga0a205_258363_c1 | |||
| 1632 | nmdc:mga0a205_382591_c1 | |||
| 1633 | nmdc:mga0a205_38526_c1 | |||
| 1634 | nmdc:mga0a205_409206_c1 | |||
| 1635 | nmdc:mga0a205_504450_c1 | |||
| 1636 | nmdc:mga0a205_58119_c1 | |||
| 1637 | nmdc:mga0a205_62630_c1 | |||
| 1638 | nmdc:mga0a205_903092_c1 | |||
| 1639 | nmdc:mga0a205_936177_c1 | |||
| 1640 | Ga0500577_0001033 | |||
| 1641 | Ga0501082_0977178 | |||
| 1642 | Ga0530510_0889905 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f8b-assembly1.cif.gz_B-2 | crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef | 0.958 | 24 | 136 |
| 4fgc-assembly1.cif.gz_A-2 | crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 | 0.9484 | 24 | 136 |
| 4ghm-assembly1.cif.gz_B | crystal structure of the h233a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq0 | 0.9308 | 36 | 132 |
| 3rzp-assembly1.cif.gz_B | crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 | 0.9266 | 36 | 132 |
| 3bp1-assembly1.cif.gz_D | crystal structure of putative 7-cyano-7-deazaguanine reductase quef from vibrio cholerae o1 biovar eltor | 0.9237 | 35 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G081_22_166_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9058 | 12 | 136 | 3.30.1130.10 |
| 3rzpD02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8925 | 36 | 136 | 3.30.1130.10 |
| af_Q8I5H7_254_381_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8888 | 28 | 136 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8566 | 29 | 131 | 3.30.1130.10 |
| 4uqfA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8563 | 34 | 134 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A136JNA5-F1-model_v4 | deleted | 0.9899 | 23 | 136 |
|
| AF-A0A7Y4X8E6-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9894 | 23 | 135 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A2V8S7V8-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9893 | 23 | 136 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A7T9JDT0-F1-model_v4 | deleted | 0.985 | 3 | 136 |
|
| AF-A0A3M2D921-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.985 | 23 | 136 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |