F482247

General Info

Members Datasets Scaffolds Average Seq Length
821 283 1642 138

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100070240|Ga0068869_1000702403
Length 158
Sequence MASRNCWRCYSQVKINAEMIDAEKALQPINQQGLDVRSTPRGEMDLFPLDTFAYEFPGREIKIDFEITEFTAICPFSDFPDFATIRLEYVPNERCVELKSLKLYINSFRQVKIFHEHVINIILEDFVRACDPLSVKLEGDFHVRGNIKTVVRAKYEKQ

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
190 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
191 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
196 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
221 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
222 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
223 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
224 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
225 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
226 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
227 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
234 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
235 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
236 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
237 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
238 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
239 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
240 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
241 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
242 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
243 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
244 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
245 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
247 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
248 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
249 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
250 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
251 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
252 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
253 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
254 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
255 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
261 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
262 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
263 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
264 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
265 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
266 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
267 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
268 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
269 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 3.05
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 28.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100070240 3300005334 Unclassified 2590
2 SwRhRL2b_contig_2960249 2162886007 Bacteria 1673
3 SwRhRL2b_contig_506745 2162886007 Bacteria 2823
4 LJNas_1010919 3300000546 Unclassified 968
5 ARCol0yngRDRAFT_1018397 3300000652 Unclassified 537
6 JGI24737J22298_10073067 3300001990 Bacteria 1023
7 Ga0065714_10002186 3300005288 Bacteria 191932
8 Ga0065704_10003229 3300005289 Bacteria 6476
9 Ga0065704_10014104 3300005289 Bacteria 1904
10 Ga0065704_10135561 3300005289 Bacteria 1574
11 Ga0065704_10221516 3300005289 Unclassified 1072
12 Ga0065704_10236155 3300005289 Bacteria 1028
13 Ga0065704_10242902 3300005289 Bacteria 1010
14 Ga0065704_10658491 3300005289 Unclassified 579
15 Ga0065712_10000113 3300005290 Bacteria 191931
16 Ga0065712_10088637 3300005290 Bacteria 2510
17 Ga0065712_10132261 3300005290 Bacteria 1535
18 Ga0065712_10283056 3300005290 Unclassified 889
19 Ga0065715_10006379 3300005293 Bacteria 3769
20 Ga0065715_10090024 3300005293 Bacteria 7832
21 Ga0065715_10091511 3300005293 Bacteria 5732
22 Ga0065715_10113127 3300005293 Bacteria 2502
23 Ga0065715_10116659 3300005293 Bacteria 2325
24 Ga0065715_10199839 3300005293 Bacteria 1366
25 Ga0065707_10001531 3300005295 Bacteria 6255
26 Ga0065707_10190229 3300005295 Bacteria 1319
27 Ga0065707_10201992 3300005295 Unclassified 1306
28 Ga0065707_10910515 3300005295 Bacteria 562
29 Ga0070676_10205841 3300005328 Bacteria 1292
30 Ga0070676_10379883 3300005328 Bacteria 978
31 Ga0070683_100128569 3300005329 Bacteria 2396
32 Ga0070683_100148445 3300005329 Bacteria 2223
33 Ga0070683_100881912 3300005329 Bacteria 858
34 Ga0070690_100004206 3300005330 Bacteria 7966
35 Ga0070690_100006228 3300005330 Bacteria 6770
36 Ga0070690_100284954 3300005330 Bacteria 1180
37 Ga0070670_100039706 3300005331 Bacteria 4047
38 Ga0070670_100135871 3300005331 Bacteria 2125
39 Ga0068869_100022495 3300005334 Bacteria 4345
40 Ga0068869_100199456 3300005334 Bacteria 1577
41 Ga0068869_100943592 3300005334 Unclassified 749
42 Ga0068869_101155523 3300005334 Bacteria 679
43 Ga0068869_102026881 3300005334 Unclassified 517
44 Ga0070666_10723579 3300005335 Unclassified 730
45 Ga0070680_100000139 3300005336 Bacteria 44398
46 Ga0070682_100000311 3300005337 Bacteria 33637
47 Ga0070682_100028715 3300005337 Bacteria 3346
48 Ga0068868_100504944 3300005338 Bacteria 1060
49 Ga0068868_100784204 3300005338 Unclassified 859
50 Ga0068868_101268905 3300005338 Bacteria 683
51 Ga0068868_102351445 3300005338 Unclassified 509
52 Ga0070660_100053049 3300005339 Bacteria 3127
53 Ga0070689_100368074 3300005340 Bacteria 1209
54 Ga0070689_101299471 3300005340 Bacteria 655
55 Ga0070691_10713700 3300005341 Unclassified 603
56 Ga0070687_100364939 3300005343 Unclassified 936
57 Ga0070687_100378001 3300005343 Bacteria 922
58 Ga0070661_100048060 3300005344 Bacteria 3123
59 Ga0070661_100065157 3300005344 Bacteria 2677
60 Ga0070661_100497970 3300005344 Unclassified 975
61 Ga0070692_10013410 3300005345 Bacteria 3820
62 Ga0070692_10036037 3300005345 Bacteria 2509
63 Ga0070692_10226697 3300005345 Bacteria 1107
64 Ga0070692_10537258 3300005345 Bacteria 764
65 Ga0070692_10914754 3300005345 Bacteria 607
66 Ga0070668_100018588 3300005347 Bacteria 5218
67 Ga0070668_100581261 3300005347 Bacteria 978
68 Ga0070669_100022866 3300005353 Bacteria 4472
69 Ga0070669_100038209 3300005353 Unclassified 3485
70 Ga0070669_100305950 3300005353 Unclassified 1280
71 Ga0070669_100775324 3300005353 Bacteria 814
72 Ga0070675_100547652 3300005354 Unclassified 1046
73 Ga0070671_100088184 3300005355 Bacteria 2596
74 Ga0070671_100121182 3300005355 Bacteria 2201
75 Ga0070671_100896014 3300005355 Bacteria 775
76 Ga0070671_101090580 3300005355 Bacteria 701
77 Ga0070674_100774679 3300005356 Unclassified 826
78 Ga0070673_100020213 3300005364 Unclassified 4799
79 Ga0070673_100135359 3300005364 Bacteria 2073
80 Ga0070659_100002723 3300005366 Bacteria 12570
81 Ga0070659_100649762 3300005366 Unclassified 909
82 Ga0070667_100823795 3300005367 Bacteria 862
83 Ga0070703_10386616 3300005406 Unclassified 606
84 Ga0070701_10031043 3300005438 Bacteria 2649
85 Ga0070701_10844120 3300005438 Unclassified 628
86 Ga0070705_100579965 3300005440 Bacteria 864
87 Ga0070705_100677847 3300005440 Unclassified 807
88 Ga0070700_100003151 3300005441 Bacteria 8474
89 Ga0070700_100026221 3300005441 Bacteria 3439
90 Ga0070700_100385318 3300005441 Bacteria 1050
91 Ga0070694_100064064 3300005444 Bacteria 2515
92 Ga0070694_100090462 3300005444 Bacteria 2146
93 Ga0070694_100109992 3300005444 Unclassified 1962
94 Ga0070694_100123725 3300005444 Bacteria 1859
95 Ga0070708_100157015 3300005445 Bacteria 2118
96 Ga0070708_100328812 3300005445 Bacteria 1440
97 Ga0070663_100366820 3300005455 Bacteria 1169
98 Ga0070663_100481179 3300005455 Unclassified 1028
99 Ga0070663_101085684 3300005455 Bacteria 699
100 Ga0070662_100212418 3300005457 Bacteria 1540
101 Ga0070662_101291897 3300005457 Bacteria 628
102 Ga0070662_101312664 3300005457 Bacteria 623
103 Ga0070662_101831042 3300005457 Unclassified 524
104 Ga0070681_10000350 3300005458 Bacteria 37194
105 Ga0070681_10003130 3300005458 Bacteria 15367
106 Ga0068867_100026995 3300005459 Bacteria 4125
107 Ga0068867_101296706 3300005459 Unclassified 672
108 Ga0070706_100137332 3300005467 Bacteria 2282
109 Ga0070706_101796026 3300005467 Bacteria 557
110 Ga0070707_100161792 3300005468 Bacteria 2181
111 Ga0070707_100539982 3300005468 Unclassified 1128
112 Ga0070698_100012329 3300005471 Bacteria 9052
113 Ga0070698_100032837 3300005471 Bacteria 5376
114 Ga0070698_100570262 3300005471 Bacteria 1072
115 Ga0070699_100060650 3300005518 Bacteria 3278
116 Ga0070699_100156639 3300005518 Bacteria 2015
117 Ga0070699_100487087 3300005518 Bacteria 1119
118 Ga0070699_101079043 3300005518 Bacteria 737
119 Ga0070679_100000059 3300005530 Bacteria 81792
120 Ga0070679_100011688 3300005530 Bacteria 8370
121 Ga0070679_100117327 3300005530 Bacteria 2646
122 Ga0070679_100405576 3300005530 Bacteria 1309
123 Ga0070684_100113229 3300005535 Bacteria 2434
124 Ga0070684_101710759 3300005535 Unclassified 593
125 Ga0070697_100000042 3300005536 Bacteria 94533
126 Ga0070697_100004594 3300005536 Bacteria 10609
127 Ga0070697_100083361 3300005536 Bacteria 2637
128 Ga0070697_100097028 3300005536 Bacteria 2446
129 Ga0070697_100105843 3300005536 Bacteria 2340
130 Ga0070697_100108014 3300005536 Bacteria 2316
131 Ga0070697_100143262 3300005536 Bacteria 2011
132 Ga0070697_100150408 3300005536 Archaea 1962
133 Ga0070697_101437927 3300005536 Unclassified 616
134 Ga0070697_101547094 3300005536 Unclassified 593
135 Ga0068853_100011800 3300005539 Bacteria 7103
136 Ga0068853_100091583 3300005539 Bacteria 2674
137 Ga0068853_100099858 3300005539 Bacteria 2564
138 Ga0068853_100155987 3300005539 Unclassified 2057
139 Ga0068853_100196488 3300005539 Bacteria 1835
140 Ga0070672_100043297 3300005543 Bacteria 3470
141 Ga0070672_100236897 3300005543 Bacteria 1534
142 Ga0070672_100605049 3300005543 Unclassified 955
143 Ga0070686_100007940 3300005544 Bacteria 5934
144 Ga0070686_100145614 3300005544 Bacteria 1654
145 Ga0070695_100017748 3300005545 Bacteria 4318
146 Ga0070695_100054421 3300005545 Bacteria 2575
147 Ga0070695_101019183 3300005545 Bacteria 674
148 Ga0070696_100006190 3300005546 Bacteria 8001
149 Ga0070696_100021784 3300005546 Bacteria 4347
150 Ga0070696_100599474 3300005546 Bacteria 888
151 Ga0070693_100374224 3300005547 Bacteria 981
152 Ga0070693_100735523 3300005547 Bacteria 726
153 Ga0070704_100106415 3300005549 Bacteria 2125
154 Ga0070704_100165334 3300005549 Bacteria 1754
155 Ga0070704_100328183 3300005549 Bacteria 1284
156 Ga0070704_100343171 3300005549 Bacteria 1258
157 Ga0068855_102424576 3300005563 Unclassified 523
158 Ga0070664_100007058 3300005564 Bacteria 9065
159 Ga0070664_100066697 3300005564 Bacteria 3074
160 Ga0070664_100084001 3300005564 Bacteria 2748
161 Ga0070664_100258363 3300005564 Unclassified 1567
162 Ga0070664_100608461 3300005564 Unclassified 1014
163 Ga0070664_100787259 3300005564 Bacteria 889
164 Ga0070664_102071911 3300005564 Unclassified 540
165 Ga0068857_100008041 3300005577 Bacteria 9095
166 Ga0068857_100045462 3300005577 Bacteria 3896
167 Ga0068857_100676387 3300005577 Bacteria 979
168 Ga0068857_100855342 3300005577 Bacteria 870
169 Ga0068857_101013169 3300005577 Bacteria 800
170 Ga0068857_101212234 3300005577 Unclassified 731
171 Ga0068854_100120561 3300005578 Bacteria 1991
172 Ga0068854_100166988 3300005578 Bacteria 1709
173 Ga0068854_100261518 3300005578 Unclassified 1386
174 Ga0068854_100262248 3300005578 Bacteria 1384
175 Ga0068854_100954252 3300005578 Unclassified 757
176 Ga0068854_101830259 3300005578 Unclassified 557
177 Ga0068852_100105697 3300005616 Bacteria 2551
178 Ga0068852_100250766 3300005616 Unclassified 1696
179 Ga0068859_100027753 3300005617 Bacteria 5678
180 Ga0068859_100066720 3300005617 Bacteria 3633
181 Ga0068859_100067920 3300005617 Bacteria 3600
182 Ga0068859_100100077 3300005617 Bacteria 2954
183 Ga0068859_100642430 3300005617 Bacteria 1153
184 Ga0068859_100807562 3300005617 Unclassified 1025
185 Ga0068859_100995464 3300005617 Bacteria 921
186 Ga0068859_101133847 3300005617 Unclassified 861
187 Ga0068859_102840187 3300005617 Bacteria 531
188 Ga0068864_100137240 3300005618 Bacteria 2203
189 Ga0068864_100191905 3300005618 Bacteria 1873
190 Ga0068864_100227925 3300005618 Bacteria 1722
191 Ga0068864_100269135 3300005618 Bacteria 1587
192 Ga0068864_100355857 3300005618 Unclassified 1383
193 Ga0068864_100491831 3300005618 Bacteria 1179
194 Ga0068864_100640432 3300005618 Unclassified 1034
195 Ga0068864_101379924 3300005618 Bacteria 706
196 Ga0068864_102082327 3300005618 Unclassified 574
197 Ga0068864_102157428 3300005618 Bacteria 563
198 Ga0068866_10485909 3300005718 Unclassified 814
199 Ga0068861_100089279 3300005719 Bacteria 2429
200 Ga0068861_100538121 3300005719 Bacteria 1062
201 Ga0068861_101126157 3300005719 Bacteria 755
202 Ga0068851_10025098 3300005834 Bacteria 2922
203 Ga0068870_10553656 3300005840 Bacteria 775
204 Ga0068863_100074385 3300005841 Bacteria 3214
205 Ga0068863_100703930 3300005841 Unclassified 1004
206 Ga0068863_102117639 3300005841 Unclassified 572
207 Ga0068858_100076240 3300005842 Unclassified 3114
208 Ga0068858_100095575 3300005842 Unclassified 2769
209 Ga0068858_100224678 3300005842 Bacteria 1779
210 Ga0068858_100336760 3300005842 Unclassified 1443
211 Ga0068858_102038865 3300005842 Unclassified 567
212 Ga0068860_100020300 3300005843 Bacteria 6435
213 Ga0068860_100355662 3300005843 Bacteria 1442
214 Ga0068860_100830547 3300005843 Unclassified 938
215 Ga0068860_101222965 3300005843 Unclassified 771
216 Ga0068860_101604552 3300005843 Unclassified 672
217 Ga0068862_100030465 3300005844 Bacteria 4548
218 Ga0068862_100070490 3300005844 Bacteria 3018
219 Ga0068862_100347441 3300005844 Unclassified 1375
220 Ga0068862_100442215 3300005844 Unclassified 1224
221 Ga0068862_100624404 3300005844 Bacteria 1037
222 Ga0068862_102579522 3300005844 Unclassified 520
223 Ga0081539_10000360 3300005985 Bacteria 100156
224 Ga0081539_10000669 3300005985 Bacteria 68738
225 Ga0081539_10023171 3300005985 Bacteria 4075
226 Ga0081539_10106916 3300005985 Bacteria 1416
227 Ga0075432_10347193 3300006058 Bacteria 628
228 Ga0070716_100247363 3300006173 Bacteria 1213
229 Ga0068871_100447169 3300006358 Bacteria 1158
230 Ga0068871_100926947 3300006358 Unclassified 808
231 Ga0075428_100527335 3300006844 Bacteria 1263
232 Ga0075428_100550547 3300006844 Bacteria 1233
233 Ga0075428_100606264 3300006844 Bacteria 1169
234 Ga0075430_100206432 3300006846 Bacteria 1630
235 Ga0075431_100889934 3300006847 Bacteria 860
236 Ga0075433_10010620 3300006852 Bacteria 7403
237 Ga0075433_10029791 3300006852 Bacteria 4653
238 Ga0075433_10307695 3300006852 Bacteria 1403
239 Ga0075433_10418320 3300006852 Bacteria 1182
240 Ga0075433_10498032 3300006852 Unclassified 1072
241 Ga0075433_10996049 3300006852 Unclassified 730
242 Ga0075433_11505207 3300006852 Unclassified 581
243 Ga0075434_101910781 3300006871 Unclassified 599
244 Ga0075434_102423434 3300006871 Unclassified 527
245 Ga0075429_100620114 3300006880 Bacteria 948
246 Ga0068865_100987049 3300006881 Unclassified 737
247 Ga0075436_100022459 3300006914 Bacteria 4334
248 Ga0097620_100027755 3300006931 Bacteria 5678
249 Ga0097620_100066722 3300006931 Bacteria 3633
250 Ga0097620_100067920 3300006931 Bacteria 3600
251 Ga0097620_100100075 3300006931 Bacteria 2954
252 Ga0097620_100642387 3300006931 Bacteria 1153
253 Ga0097620_100807544 3300006931 Unclassified 1025
254 Ga0097620_100995489 3300006931 Bacteria 921
255 Ga0097620_101133796 3300006931 Unclassified 861
256 Ga0097620_102841429 3300006931 Bacteria 531
257 Ga0075435_100344134 3300007076 Bacteria 1278
258 Ga0075435_101740724 3300007076 Bacteria 547
259 Ga0105251_10036530 3300009011 Bacteria 2417
260 Ga0105250_10294458 3300009092 Bacteria 701
261 Ga0105250_10568687 3300009092 Unclassified 522
262 Ga0105250_10594666 3300009092 Unclassified 512
263 Ga0105240_10184648 3300009093 Bacteria 2457
264 Ga0105240_11186845 3300009093 Unclassified 809
265 Ga0111539_10013585 3300009094 Bacteria 10180
266 Ga0111539_10021005 3300009094 Bacteria 8039
267 Ga0111539_10121917 3300009094 Bacteria 3055
268 Ga0111539_10148585 3300009094 Bacteria 2743
269 Ga0111539_10503287 3300009094 Bacteria 1411
270 Ga0111539_10941280 3300009094 Bacteria 1004
271 Ga0105245_10531346 3300009098 Bacteria 1196
272 Ga0105245_10586746 3300009098 Bacteria 1140
273 Ga0105245_10591486 3300009098 Bacteria 1135
274 Ga0105245_11010160 3300009098 Unclassified 876
275 Ga0105245_11219695 3300009098 Bacteria 800
276 Ga0105245_11908222 3300009098 Unclassified 647
277 Ga0105245_12079828 3300009098 Unclassified 621
278 Ga0105247_10033320 3300009101 Bacteria 3133
279 Ga0105247_10053337 3300009101 Bacteria 2494
280 Ga0105247_10346886 3300009101 Bacteria 1043
281 Ga0105247_10462574 3300009101 Bacteria 917
282 Ga0105247_10732357 3300009101 Unclassified 747
283 Ga0114129_10010635 3300009147 Bacteria 13125
284 Ga0114129_10040157 3300009147 Bacteria 6597
285 Ga0114129_10058175 3300009147 Bacteria 5407
286 Ga0114129_10159250 3300009147 Bacteria 3086
287 Ga0114129_10217853 3300009147 Bacteria 2577
288 Ga0114129_11275721 3300009147 Unclassified 911
289 Ga0114129_11622643 3300009147 Unclassified 791
290 Ga0114129_12490829 3300009147 Bacteria 619
291 Ga0105243_10178238 3300009148 Bacteria 1846
292 Ga0105243_10299256 3300009148 Bacteria 1457
293 Ga0105243_10304533 3300009148 Unclassified 1446
294 Ga0105243_10891143 3300009148 Unclassified 884
295 Ga0105243_10999260 3300009148 Unclassified 839
296 Ga0105243_11622419 3300009148 Bacteria 674
297 Ga0105243_11675285 3300009148 Unclassified 664
298 Ga0105243_11869345 3300009148 Unclassified 633
299 Ga0105241_10042588 3300009174 Bacteria 3436
300 Ga0105241_10076458 3300009174 Bacteria 2611
301 Ga0105241_10100176 3300009174 Bacteria 2302
302 Ga0105241_10117704 3300009174 Bacteria 2136
303 Ga0105241_10125607 3300009174 Bacteria 2071
304 Ga0105241_10418812 3300009174 Bacteria 1178
305 Ga0105241_10441112 3300009174 Unclassified 1150
306 Ga0105241_10534563 3300009174 Unclassified 1050
307 Ga0105241_10598481 3300009174 Unclassified 996
308 Ga0105241_11203129 3300009174 Bacteria 718
309 Ga0105241_12004356 3300009174 Unclassified 570
310 Ga0105242_10481578 3300009176 Bacteria 1176
311 Ga0105242_11267949 3300009176 Unclassified 759
312 Ga0105242_11792784 3300009176 Bacteria 652
313 Ga0105242_12467383 3300009176 Bacteria 568
314 Ga0105248_10014958 3300009177 Bacteria 8542
315 Ga0105248_10036451 3300009177 Bacteria 5500
316 Ga0105248_10252526 3300009177 Bacteria 1985
317 Ga0105248_10326581 3300009177 Bacteria 1728
318 Ga0105248_10457596 3300009177 Bacteria 1438
319 Ga0105248_10578169 3300009177 Bacteria 1267
320 Ga0105248_10843401 3300009177 Unclassified 1034
321 Ga0105248_10853842 3300009177 Bacteria 1028
322 Ga0105248_12010667 3300009177 Unclassified 657
323 Ga0105237_10002569 3300009545 Bacteria 22400
324 Ga0105237_10118731 3300009545 Bacteria 2638
325 Ga0105237_10225442 3300009545 Bacteria 1875
326 Ga0105237_11045318 3300009545 Unclassified 823
327 Ga0105238_10003652 3300009551 Bacteria 15343
328 Ga0105238_10098525 3300009551 Bacteria 2907
329 Ga0105238_10950729 3300009551 Bacteria 879
330 Ga0105238_11097746 3300009551 Unclassified 818
331 Ga0105249_10000044 3300009553 Bacteria 184637
332 Ga0105249_10054955 3300009553 Bacteria 3641
333 Ga0105249_10073041 3300009553 Bacteria 3172
334 Ga0105249_10125570 3300009553 Bacteria 2443
335 Ga0105249_10371159 3300009553 Bacteria 1454
336 Ga0105249_10673678 3300009553 Bacteria 1093
337 Ga0105249_11124974 3300009553 Unclassified 856
338 Ga0105249_11373681 3300009553 Unclassified 778
339 Ga0105239_11056135 3300010375 Bacteria 934
340 Ga0105239_11083431 3300010375 Unclassified 922
341 Ga0105239_11854106 3300010375 Unclassified 699
342 Ga0105246_10008236 3300011119 Bacteria 6403
343 Ga0105246_10834728 3300011119 Bacteria 821
344 Ga0105246_11935758 3300011119 Unclassified 567
345 Ga0157373_10006382 3300013100 Bacteria 8809
346 Ga0157373_10217554 3300013100 Bacteria 1347
347 Ga0157373_11085587 3300013100 Bacteria 600
348 Ga0157371_10196493 3300013102 Bacteria 1445
349 Ga0157371_10463508 3300013102 Bacteria 933
350 Ga0157371_10700721 3300013102 Unclassified 758
351 Ga0157370_10036799 3300013104 Bacteria 4748
352 Ga0157370_10263238 3300013104 Bacteria 1593
353 Ga0157370_10742048 3300013104 Bacteria 895
354 Ga0157370_11445740 3300013104 Unclassified 618
355 Ga0157374_10103556 3300013296 Bacteria 2731
356 Ga0157378_10012900 3300013297 Bacteria 7316
357 Ga0157378_10013580 3300013297 Bacteria 7123
358 Ga0157378_10061703 3300013297 Bacteria 3347
359 Ga0157378_10108122 3300013297 Bacteria 2546
360 Ga0157378_10374879 3300013297 Bacteria 1396
361 Ga0157378_10874665 3300013297 Bacteria 928
362 Ga0157378_10939479 3300013297 Unclassified 897
363 Ga0157378_11017971 3300013297 Unclassified 863
364 Ga0157378_11280265 3300013297 Unclassified 774
365 Ga0157378_11385326 3300013297 Unclassified 746
366 Ga0163162_10000025 3300013306 Bacteria 184648
367 Ga0163162_10020033 3300013306 Bacteria 6569
368 Ga0163162_10030465 3300013306 Bacteria 5345
369 Ga0163162_10074816 3300013306 Bacteria 3446
370 Ga0163162_10256605 3300013306 Bacteria 1880
371 Ga0163162_10262379 3300013306 Bacteria 1859
372 Ga0163162_10398506 3300013306 Bacteria 1509
373 Ga0163162_10431749 3300013306 Unclassified 1449
374 Ga0163162_10471956 3300013306 Bacteria 1386
375 Ga0163162_10546749 3300013306 Bacteria 1286
376 Ga0163162_10644056 3300013306 Unclassified 1184
377 Ga0163162_10669861 3300013306 Bacteria 1161
378 Ga0163162_11165683 3300013306 Unclassified 874
379 Ga0163162_11171402 3300013306 Unclassified 872
380 Ga0163162_11266202 3300013306 Bacteria 838
381 Ga0163162_11435939 3300013306 Unclassified 785
382 Ga0163162_11831855 3300013306 Bacteria 694
383 Ga0157372_10031443 3300013307 Bacteria 5812
384 Ga0157372_10249053 3300013307 Bacteria 2062
385 Ga0157372_10426977 3300013307 Bacteria 1545
386 Ga0157372_10859385 3300013307 Bacteria 1053
387 Ga0157375_10047618 3300013308 Bacteria 4189
388 Ga0157375_10069225 3300013308 Bacteria 3534
389 Ga0157375_10128693 3300013308 Unclassified 2650
390 Ga0157375_10532278 3300013308 Bacteria 1338
391 Ga0157375_10778616 3300013308 Bacteria 1106
392 Ga0157375_10959926 3300013308 Unclassified 996
393 Ga0157375_11154279 3300013308 Bacteria 908
394 Ga0157375_11552760 3300013308 Bacteria 782
395 Ga0157375_12363062 3300013308 Unclassified 634
396 Ga0157375_12902154 3300013308 Bacteria 573
397 Ga0163163_10000536 3300014325 Bacteria 33560
398 Ga0163163_10003037 3300014325 Bacteria 14218
399 Ga0163163_10130388 3300014325 Unclassified 2554
400 Ga0163163_10185263 3300014325 Unclassified 2129
401 Ga0163163_10307647 3300014325 Bacteria 1637
402 Ga0163163_10582145 3300014325 Bacteria 1182
403 Ga0163163_10990175 3300014325 Unclassified 904
404 Ga0163163_11162314 3300014325 Unclassified 834
405 Ga0163163_12249792 3300014325 Bacteria 604
406 Ga0157380_10010426 3300014326 Bacteria 6687
407 Ga0157380_10011038 3300014326 Bacteria 6516
408 Ga0157380_10013135 3300014326 Bacteria 6029
409 Ga0157380_10016677 3300014326 Bacteria 5422
410 Ga0157380_10042459 3300014326 Bacteria 3555
411 Ga0157380_10043819 3300014326 Bacteria 3504
412 Ga0157380_10498709 3300014326 Bacteria 1182
413 Ga0157380_10500792 3300014326 Bacteria 1180
414 Ga0157380_11585100 3300014326 Unclassified 710
415 Ga0157377_10200541 3300014745 Bacteria 1266
416 Ga0157377_10257125 3300014745 Bacteria 1135
417 Ga0157377_10329206 3300014745 Unclassified 1018
418 Ga0157377_10490512 3300014745 Bacteria 856
419 Ga0157377_10805215 3300014745 Unclassified 693
420 Ga0157377_10964869 3300014745 Unclassified 643
421 Ga0157377_11376831 3300014745 Unclassified 555
422 Ga0157379_10231371 3300014968 Unclassified 1675
423 Ga0157379_10454870 3300014968 Unclassified 1182
424 Ga0157376_10902474 3300014969 Bacteria 902
425 Ga0157376_11566296 3300014969 Bacteria 693
426 Ga0182007_10258583 3300015262 Unclassified 627
427 Ga0182005_1083091 3300015265 Bacteria 885
428 Ga0213876_10000038 3300021384 Bacteria 182431
429 Ga0213876_10000382 3300021384 Bacteria 37485
430 Ga0207713_1161150 3300025735 Unclassified 715
431 Ga0207653_10005271 3300025885 Bacteria 4040
432 Ga0207653_10272648 3300025885 Unclassified 652
433 Ga0207710_10027307 3300025900 Bacteria 2471
434 Ga0207710_10232447 3300025900 Unclassified 918
435 Ga0207647_10006732 3300025904 Bacteria 8344
436 Ga0207645_10054704 3300025907 Unclassified 2549
437 Ga0207645_10279542 3300025907 Bacteria 1108
438 Ga0207645_11189689 3300025907 Unclassified 512
439 Ga0207643_10001020 3300025908 Bacteria 16618
440 Ga0207643_10493038 3300025908 Bacteria 783
441 Ga0207684_10000079 3300025910 Bacteria 179842
442 Ga0207684_10069867 3300025910 Unclassified 2985
443 Ga0207684_10369919 3300025910 Unclassified 1233
444 Ga0207684_11257742 3300025910 Bacteria 611
445 Ga0207654_10019329 3300025911 Bacteria 3594
446 Ga0207654_10714291 3300025911 Unclassified 720
447 Ga0207707_10000008 3300025912 Bacteria 330313
448 Ga0207707_10000625 3300025912 Bacteria 35059
449 Ga0207707_10019384 3300025912 Bacteria 5938
450 Ga0207707_10285598 3300025912 Unclassified 1428
451 Ga0207707_10522810 3300025912 Bacteria 1010
452 Ga0207663_10574292 3300025916 Unclassified 884
453 Ga0207660_10004225 3300025917 Bacteria 9357
454 Ga0207660_10063317 3300025917 Bacteria 2666
455 Ga0207660_10341254 3300025917 Unclassified 1199
456 Ga0207660_10527802 3300025917 Unclassified 959
457 Ga0207660_10733539 3300025917 Unclassified 806
458 Ga0207662_10002097 3300025918 Bacteria 9907
459 Ga0207657_10036482 3300025919 Bacteria 4400
460 Ga0207649_10626254 3300025920 Unclassified 829
461 Ga0207652_10000085 3300025921 Bacteria 101176
462 Ga0207652_10019341 3300025921 Bacteria 5600
463 Ga0207652_10064650 3300025921 Unclassified 3165
464 Ga0207646_10081792 3300025922 Bacteria 2888
465 Ga0207646_10473391 3300025922 Unclassified 1130
466 Ga0207646_11463773 3300025922 Bacteria 592
467 Ga0207681_10005287 3300025923 Bacteria 7932
468 Ga0207681_10015070 3300025923 Unclassified 4819
469 Ga0207681_10093415 3300025923 Bacteria 2153
470 Ga0207681_10531987 3300025923 Bacteria 966
471 Ga0207694_10039562 3300025924 Bacteria 3629
472 Ga0207650_10035005 3300025925 Bacteria 3644
473 Ga0207650_11860713 3300025925 Unclassified 509
474 Ga0207659_10145690 3300025926 Bacteria 1844
475 Ga0207659_10800326 3300025926 Unclassified 810
476 Ga0207659_10937355 3300025926 Unclassified 745
477 Ga0207687_10669870 3300025927 Bacteria 879
478 Ga0207687_10704882 3300025927 Unclassified 857
479 Ga0207690_10759564 3300025932 Unclassified 800
480 Ga0207706_10071081 3300025933 Bacteria 3060
481 Ga0207706_10232811 3300025933 Bacteria 1611
482 Ga0207706_10741628 3300025933 Unclassified 837
483 Ga0207686_10240867 3300025934 Bacteria 1316
484 Ga0207686_10693494 3300025934 Unclassified 809
485 Ga0207709_10012102 3300025935 Bacteria 4756
486 Ga0207709_10036298 3300025935 Bacteria 2920
487 Ga0207709_10338633 3300025935 Bacteria 1131
488 Ga0207709_11538947 3300025935 Unclassified 552
489 Ga0207670_10000612 3300025936 Bacteria 19296
490 Ga0207670_10317808 3300025936 Bacteria 1224
491 Ga0207665_10006407 3300025939 Bacteria 7809
492 Ga0207691_10016850 3300025940 Bacteria 6933
493 Ga0207691_10989581 3300025940 Unclassified 702
494 Ga0207711_10195267 3300025941 Bacteria 1846
495 Ga0207711_10243263 3300025941 Bacteria 1650
496 Ga0207711_11136585 3300025941 Bacteria 722
497 Ga0207711_11539420 3300025941 Unclassified 608
498 Ga0207689_10002487 3300025942 Bacteria 17116
499 Ga0207689_10060520 3300025942 Bacteria 3114
500 Ga0207689_10080098 3300025942 Bacteria 2684
501 Ga0207689_10435180 3300025942 Bacteria 1095
502 Ga0207689_10487973 3300025942 Bacteria 1032
503 Ga0207689_10691518 3300025942 Unclassified 860
504 Ga0207689_10699618 3300025942 Unclassified 855
505 Ga0207661_10214346 3300025944 Bacteria 1699
506 Ga0207661_10221428 3300025944 Bacteria 1673
507 Ga0207661_10492093 3300025944 Bacteria 1120
508 Ga0207679_10091246 3300025945 Bacteria 2357
509 Ga0207679_10122911 3300025945 Bacteria 2069
510 Ga0207679_10289507 3300025945 Bacteria 1408
511 Ga0207679_10601859 3300025945 Bacteria 991
512 Ga0207679_12152186 3300025945 Unclassified 506
513 Ga0207667_10678447 3300025949 Unclassified 1034
514 Ga0207667_11396031 3300025949 Unclassified 674
515 Ga0207651_10009393 3300025960 Bacteria 5351
516 Ga0207651_10197068 3300025960 Bacteria 1611
517 Ga0207651_10366606 3300025960 Bacteria 1217
518 Ga0207651_11151075 3300025960 Unclassified 696
519 Ga0207712_10000039 3300025961 Bacteria 182548
520 Ga0207712_10087095 3300025961 Unclassified 2290
521 Ga0207712_10112272 3300025961 Bacteria 2046
522 Ga0207712_10260332 3300025961 Bacteria 1407
523 Ga0207712_11012723 3300025961 Unclassified 737
524 Ga0207712_11405778 3300025961 Bacteria 624
525 Ga0207712_11805287 3300025961 Unclassified 548
526 Ga0207668_10578738 3300025972 Bacteria 976
527 Ga0207640_10037325 3300025981 Unclassified 3056
528 Ga0207640_10150136 3300025981 Bacteria 1711
529 Ga0207640_10220323 3300025981 Bacteria 1452
530 Ga0207640_10280287 3300025981 Bacteria 1309
531 Ga0207640_10317492 3300025981 Bacteria 1239
532 Ga0207640_10428810 3300025981 Bacteria 1084
533 Ga0207640_10444737 3300025981 Unclassified 1067
534 Ga0207640_11276040 3300025981 Unclassified 655
535 Ga0207640_11873936 3300025981 Bacteria 542
536 Ga0207677_10223620 3300026023 Bacteria 1511
537 Ga0207677_10778969 3300026023 Unclassified 855
538 Ga0207703_10056982 3300026035 Unclassified 3184
539 Ga0207703_10222450 3300026035 Unclassified 1688
540 Ga0207703_10236283 3300026035 Bacteria 1641
541 Ga0207703_10492658 3300026035 Unclassified 1149
542 Ga0207639_10070106 3300026041 Bacteria 2737
543 Ga0207639_10181502 3300026041 Bacteria 1790
544 Ga0207639_10269224 3300026041 Bacteria 1493
545 Ga0207639_10835741 3300026041 Unclassified 859
546 Ga0207639_11277871 3300026041 Unclassified 689
547 Ga0207678_10236319 3300026067 Bacteria 1565
548 Ga0207678_10587345 3300026067 Bacteria 976
549 Ga0207678_10728697 3300026067 Bacteria 873
550 Ga0207708_10000453 3300026075 Bacteria 31845
551 Ga0207708_10117833 3300026075 Bacteria 2067
552 Ga0207708_10226247 3300026075 Unclassified 1500
553 Ga0207708_10232819 3300026075 Bacteria 1479
554 Ga0207702_10107763 3300026078 Bacteria 2471
555 Ga0207641_10020800 3300026088 Bacteria 5393
556 Ga0207641_12057094 3300026088 Unclassified 572
557 Ga0207648_10008493 3300026089 Bacteria 9937
558 Ga0207648_10019939 3300026089 Bacteria 6051
559 Ga0207648_10072685 3300026089 Bacteria 2997
560 Ga0207648_10356406 3300026089 Bacteria 1319
561 Ga0207648_11833986 3300026089 Unclassified 568
562 Ga0207676_10397530 3300026095 Bacteria 1287
563 Ga0207676_10487510 3300026095 Unclassified 1168
564 Ga0207676_10516851 3300026095 Unclassified 1136
565 Ga0207676_10627430 3300026095 Bacteria 1035
566 Ga0207676_11338247 3300026095 Bacteria 711
567 Ga0207676_11608775 3300026095 Unclassified 647
568 Ga0207676_11793688 3300026095 Unclassified 612
569 Ga0207674_10004760 3300026116 Bacteria 16272
570 Ga0207674_10106999 3300026116 Bacteria 2774
571 Ga0207674_10543446 3300026116 Unclassified 1122
572 Ga0207674_11278101 3300026116 Bacteria 703
573 Ga0207675_100079194 3300026118 Bacteria 3079
574 Ga0207675_100208533 3300026118 Unclassified 1879
575 Ga0207675_100667862 3300026118 Bacteria 1046
576 Ga0207675_100909220 3300026118 Unclassified 897
577 Ga0207683_10821099 3300026121 Unclassified 863
578 Ga0207683_10908669 3300026121 Bacteria 817
579 Ga0207698_10023978 3300026142 Bacteria 4273
580 Ga0207698_10164225 3300026142 Bacteria 1946
581 Ga0207698_10686965 3300026142 Unclassified 1017
582 Ga0207698_11511429 3300026142 Unclassified 687
583 Ga0207428_10013006 3300027907 Bacteria 7289
584 Ga0268265_10039144 3300028380 Bacteria 3492
585 Ga0268265_10110805 3300028380 Bacteria 2240
586 Ga0268265_10159633 3300028380 Bacteria 1913
587 Ga0268265_10626216 3300028380 Unclassified 1031
588 Ga0268265_10977545 3300028380 Unclassified 835
589 Ga0268265_12442708 3300028380 Unclassified 529
590 Ga0268264_10010363 3300028381 Bacteria 7709
591 Ga0268264_10257119 3300028381 Bacteria 1625
592 Ga0268264_10335979 3300028381 Bacteria 1433
593 Ga0268264_10502083 3300028381 Bacteria 1183
594 Ga0268264_11206250 3300028381 Bacteria 766
595 Ga0316180_1060416 3300030736 Bacteria 691
596 Ga0307513_10036448 3300031456 Bacteria 5486
597 Ga0307513_10795491 3300031456 Bacteria 651
598 Ga0307408_100198268 3300031548 Bacteria 1623
599 Ga0307408_100262976 3300031548 Bacteria 1429
600 Ga0307413_10797560 3300031824 Bacteria 793
601 Ga0307413_10923806 3300031824 Unclassified 743
602 Ga0307410_10039082 3300031852 Bacteria 3113
603 Ga0307410_10123014 3300031852 Bacteria 1895
604 Ga0307406_10017239 3300031901 Bacteria 4205
605 Ga0307406_10066075 3300031901 Bacteria 2353
606 Ga0307406_10620696 3300031901 Bacteria 894
607 Ga0307412_10309737 3300031911 Bacteria 1251
608 Ga0307412_10593732 3300031911 Unclassified 937
609 Ga0307409_100450472 3300031995 Bacteria 1242
610 Ga0307409_100730753 3300031995 Bacteria 992
611 Ga0307409_101790592 3300031995 Bacteria 643
612 Ga0307416_100066307 3300032002 Bacteria 2972
613 Ga0307416_100083639 3300032002 Unclassified 2709
614 Ga0307416_101317985 3300032002 Unclassified 828
615 Ga0307416_101339156 3300032002 Bacteria 822
616 Ga0307414_10229667 3300032004 Bacteria 1529
617 Ga0307414_10391608 3300032004 Bacteria 1204
618 Ga0307411_10492418 3300032005 Bacteria 1035
619 Ga0307411_10618941 3300032005 Bacteria 933
620 Ga0307411_10941043 3300032005 Bacteria 770
621 Ga0307415_100044648 3300032126 Bacteria 2964
622 Ga0307415_100075964 3300032126 Unclassified 2380
623 Ga0307415_100082632 3300032126 Bacteria 2299
624 Ga0307415_100518796 3300032126 Bacteria 1045
625 Ga0307415_100724678 3300032126 Unclassified 900
626 Ga0307415_101363643 3300032126 Unclassified 674
627 Ga0307415_101828435 3300032126 Bacteria 588
628 Ga0373960_0219733 3300035121 Bacteria 679
629 Ga0395899_0727196 3300037312 Bacteria 620
630 Ga0395900_0109634 3300037418 Bacteria 2836
631 Ga0395900_0565523 3300037418 Bacteria 1080
632 Ga0395900_0597261 3300037418 Bacteria 1045
633 Ga0395898_0093773 3300037466 Bacteria 2885
634 Ga0395905_0044236 3300037471 Bacteria 4179
635 Ga0395905_0083065 3300037471 Unclassified 3001
636 Ga0395905_0368276 3300037471 Bacteria 1330
637 Ga0395905_0537571 3300037471 Unclassified 1070
638 Ga0395905_0605021 3300037471 Unclassified 998
639 Ga0436364_0048479 3300037853 Unclassified 2687
640 Ga0242419_003074 3300038698 Bacteria 1115
641 Ga0242422_02143 3300038699 Bacteria 1344
642 Ga0242420_014254 3300038996 Bacteria 1362
643 Ga0242420_045253 3300038996 Unclassified 849
644 Ga0436365_0038900 3300039437 Bacteria 45987
645 Ga0436365_0364607 3300039437 Bacteria 5238
646 Ga0436365_1023949 3300039437 Bacteria 126686
647 Ga0436365_1250677 3300039437 Bacteria 5329
648 Ga0439455_0004976 3300042012 Bacteria 2671
649 Ga0439462_0047576 3300042015 Bacteria 1150
650 Ga0450891_029762 3300042129 Unclassified 562
651 Ga0450892_009122 3300042130 Bacteria 856
652 Ga0439446_0010887 3300042156 Bacteria 2459
653 Ga0439458_0005074 3300042157 Bacteria 2974
654 Ga0439460_0225032 3300042461 Unclassified 644
655 Ga0451577_1440035 3300042876 Unclassified 610
656 Ga0451576_0084913 3300045051 Bacteria 3293
657 Ga0451576_2490482 3300045051 Unclassified 529
658 Ga0495632_0012789 3300046519 Bacteria 4817
659 Ga0495663_0000154 3300046525 Bacteria 27993
660 Ga0495598_0000097 3300046537 Bacteria 14240
661 Ga0495621_0007621 3300046539 Bacteria 3212
662 Ga0495621_0059858 3300046539 Bacteria 1380
663 Ga0495668_0002181 3300046616 Bacteria 16758
664 Ga0495636_0013894 3300047318 Bacteria 3199
665 Ga0495672_0009111 3300047320 Bacteria 7237
666 Ga0496102_0043354 3300048905 Bacteria 4079
667 Ga0496104_0428974 3300048907 Bacteria 1234
668 Ga0496106_0064870 3300048909 Bacteria 2779
669 Ga0496106_0312845 3300048909 Unclassified 1260
670 Ga0496106_1271378 3300048909 Unclassified 572
671 Ga0496108_0035963 3300048911 Bacteria 4119
672 Ga0496108_0068538 3300048911 Bacteria 2993
673 Ga0496108_0310238 3300048911 Bacteria 1375
674 Ga0496109_0478359 3300048912 Bacteria 1176
675 Ga0496109_0617799 3300048912 Unclassified 1020
676 Ga0496109_1295324 3300048912 Unclassified 665
677 Ga0496110_0335820 3300048913 Bacteria 1377
678 Ga0496110_0395939 3300048913 Bacteria 1259
679 Ga0496110_1108607 3300048913 Unclassified 700
680 Ga0496111_0171929 3300048914 Bacteria 1610
681 Ga0496111_0761794 3300048914 Unclassified 702
682 Ga0496112_0094713 3300048915 Bacteria 2957
683 Ga0496112_0216301 3300048915 Bacteria 1873
684 Ga0496112_0291879 3300048915 Bacteria 1577
685 Ga0496112_0313505 3300048915 Bacteria 1514
686 Ga0496112_0398625 3300048915 Bacteria 1316
687 Ga0496112_0462957 3300048915 Bacteria 1205
688 Ga0496112_0651954 3300048915 Unclassified 982
689 Ga0496113_0041685 3300048916 Bacteria 3389
690 Ga0496113_1306865 3300048916 Unclassified 564
691 Ga0501290_036537 3300049513 Bacteria 722
692 Ga0501291_000902 3300049514 Bacteria 3402
693 Ga0501291_003351 3300049514 Bacteria 1988
694 Ga0501292_012772 3300049515 Bacteria 1285
695 Ga0501292_017081 3300049515 Bacteria 1145
696 Ga0501294_020325 3300049517 Unclassified 716
697 Ga0501295_030452 3300049518 Bacteria 1061
698 Ga0501296_000889 3300049519 Bacteria 2937
699 Ga0501296_028906 3300049519 Bacteria 739
700 Ga0501297_003155 3300049520 Bacteria 1627
701 Ga0501297_007613 3300049520 Bacteria 1181
702 Ga0501297_009658 3300049520 Bacteria 1082
703 Ga0501298_009025 3300049521 Bacteria 1687
704 Ga0501298_025440 3300049521 Bacteria 1133
705 Ga0501298_172193 3300049521 Unclassified 539
706 Ga0501299_000266 3300049522 Bacteria 5989
707 Ga0501299_034091 3300049522 Bacteria 995
708 Ga0501303_010150 3300049526 Bacteria 878
709 Ga0501040_1244272 3300049576 Unclassified 540
710 Ga0501074_1168046 3300049590 Unclassified 540
711 Ga0501075_0289107 3300049591 Bacteria 1249
712 Ga0501075_0499060 3300049591 Bacteria 928
713 Ga0501076_0280168 3300049592 Bacteria 1366
714 Ga0501077_0327870 3300049593 Unclassified 976
715 Ga0501198_018537 3300049649 Unclassified 1090
716 Ga0501198_055381 3300049649 Bacteria 715
717 Ga0501206_005472 3300049653 Bacteria 1635
718 Ga0501206_007691 3300049653 Bacteria 1416
719 Ga0501207_012015 3300049654 Bacteria 1297
720 Ga0501207_052627 3300049654 Bacteria 730
721 Ga0501209_153637 3300049656 Bacteria 694
722 Ga0501216_001967 3300049660 Bacteria 2853
723 Ga0501216_038956 3300049660 Bacteria 902
724 Ga0501217_002116 3300049661 Bacteria 3853
725 Ga0501217_075116 3300049661 Bacteria 926
726 Ga0501223_029092 3300049663 Bacteria 1075
727 Ga0501224_009439 3300049664 Bacteria 1428
728 Ga0501224_017715 3300049664 Bacteria 1059
729 Ga0501224_034156 3300049664 Bacteria 763
730 Ga0501227_050169 3300049665 Bacteria 1051
731 Ga0501228_036249 3300049666 Unclassified 625
732 Ga0501233_034280 3300049668 Unclassified 1164
733 Ga0501233_046455 3300049668 Bacteria 1039
734 Ga0501233_128059 3300049668 Bacteria 691
735 Ga0501233_238654 3300049668 Unclassified 543
736 Ga0501235_007600 3300049669 Bacteria 2361
737 Ga0501235_007777 3300049669 Bacteria 2337
738 Ga0501235_017269 3300049669 Bacteria 1596
739 Ga0501242_069914 3300049674 Bacteria 548
740 Ga0501249_116115 3300049679 Bacteria 650
741 Ga0501251_076557 3300049681 Bacteria 580
742 Ga0501252_064134 3300049682 Bacteria 580
743 Ga0501253_002201 3300049683 Bacteria 2159
744 Ga0501253_123468 3300049683 Unclassified 629
745 Ga0501255_021692 3300049684 Bacteria 836
746 Ga0501256_001192 3300049685 Bacteria 1870
747 Ga0501257_045656 3300049686 Bacteria 1084
748 Ga0501257_130161 3300049686 Bacteria 680
749 Ga0501259_059756 3300049688 Bacteria 794
750 Ga0501260_019011 3300049689 Bacteria 735
751 Ga0501261_117993 3300049690 Bacteria 522
752 Ga0501225_0008790 3300049705 Bacteria 2892
753 Ga0501225_0017183 3300049705 Bacteria 2008
754 Ga0501225_0087361 3300049705 Bacteria 900
755 Ga0501225_0106943 3300049705 Unclassified 822
756 Ga0501225_0302669 3300049705 Bacteria 541
757 Ga0501234_034108 3300049707 Bacteria 825
758 Ga0501079_0384125 3300049741 Bacteria 1101
759 Ga0501079_0473001 3300049741 Bacteria 985
760 Ga0501080_0905148 3300049742 Bacteria 769
761 Ga0501232_027800 3300049757 Bacteria 769
762 Ga0501266_010515 3300049763 Bacteria 1179
763 Ga0501266_035854 3300049763 Bacteria 723
764 Ga0501268_007817 3300049765 Bacteria 1604
765 Ga0501268_056610 3300049765 Bacteria 769
766 Ga0501270_028364 3300049767 Bacteria 907
767 Ga0501271_001898 3300049768 Bacteria 1821
768 Ga0501272_059912 3300049769 Bacteria 542
769 Ga0501273_004341 3300049770 Bacteria 1553
770 Ga0501273_020274 3300049770 Bacteria 896
771 Ga0501274_033886 3300049771 Unclassified 588
772 Ga0501278_002852 3300049774 Bacteria 1215
773 Ga0501283_002122 3300049779 Bacteria 2570
774 Ga0501283_032526 3300049779 Bacteria 880
775 Ga0501283_102953 3300049779 Bacteria 558
776 Ga0501045_0737918 3300049824 Unclassified 726
777 Ga0501212_058390 3300049851 Bacteria 664
778 Ga0501212_062125 3300049851 Bacteria 648
779 Ga0501212_069719 3300049851 Unclassified 621
780 nmdc:mga05p37_105816_c1 3300050507 Unclassified 3461
781 nmdc:mga05p37_1064724_c1 3300050507 Unclassified 851
782 nmdc:mga05p37_130170_c1 3300050507 Bacteria 3087
783 nmdc:mga05p37_131323_c1 3300050507 Unclassified 3073
784 nmdc:mga05p37_285564_c1 3300050507 Unclassified 1966
785 nmdc:mga05p37_286538_c1 3300050507 Unclassified 1962
786 nmdc:mga05p37_342735_c1 3300050507 Bacteria 1762
787 nmdc:mga09592_525857_c1 3300050508 Unclassified 1017
788 nmdc:mga09592_552199_c1 3300050508 Unclassified 989
789 nmdc:mga0qj67_206819_c1 3300050509 Unclassified 1594
790 nmdc:mga0qj67_40669_c1 3300050509 Bacteria 3654
791 nmdc:mga0qj67_80966_c1 3300050509 Bacteria 2603
792 nmdc:mga06r32_168110_c1 3300050510 Bacteria 2176
793 nmdc:mga06r32_344617_c1 3300050510 Bacteria 1474
794 nmdc:mga06r32_74883_c1 3300050510 Bacteria 3283
795 nmdc:mga06r32_773379_c1 3300050510 Unclassified 922
796 nmdc:mga08y16_115681_c1 3300050511 Bacteria 2792
797 nmdc:mga08y16_137556_c1 3300050511 Bacteria 2539
798 nmdc:mga08y16_211007_c1 3300050511 Bacteria 2011
799 nmdc:mga08y16_230438_c1 3300050511 Bacteria 1916
800 nmdc:mga08y16_48820_c1 3300050511 Bacteria 4429
801 nmdc:mga08y16_613952_c1 3300050511 Unclassified 1095
802 nmdc:mga08y16_9954_c1 3300050511 Bacteria 9981
803 nmdc:mga0n895_214655_c1 3300050512 Bacteria 1954
804 nmdc:mga0n895_345427_c1 3300050512 Bacteria 1507
805 nmdc:mga0rr50_1560043_c1 3300050513 Bacteria 558
806 nmdc:mga0rr50_98618_c1 3300050513 Bacteria 2290
807 nmdc:mga08x19_30832_c1 3300050514 Bacteria 3370
808 nmdc:mga0a205_136783_c1 3300050515 Bacteria 2351
809 nmdc:mga0a205_1427747_c1 3300050515 Unclassified 540
810 nmdc:mga0a205_258363_c1 3300050515 Bacteria 1620
811 nmdc:mga0a205_382591_c1 3300050515 Bacteria 1272
812 nmdc:mga0a205_38526_c1 3300050515 Bacteria 4599
813 nmdc:mga0a205_409206_c1 3300050515 Bacteria 1220
814 nmdc:mga0a205_504450_c1 3300050515 Bacteria 1067
815 nmdc:mga0a205_58119_c1 3300050515 Bacteria 3735
816 nmdc:mga0a205_62630_c1 3300050515 Bacteria 3594
817 nmdc:mga0a205_903092_c1 3300050515 Unclassified 730
818 nmdc:mga0a205_936177_c1 3300050515 Bacteria 713
819 Ga0500577_0001033 3300053142 Bacteria 7187
820 Ga0501082_0977178 3300060353 Unclassified 740
821 Ga0530510_0889905 3300061734 Bacteria 680
822 Ga0068869_100070240
823 SwRhRL2b_contig_2960249
824 SwRhRL2b_contig_506745
825 LJNas_1010919
826 ARCol0yngRDRAFT_1018397
827 JGI24737J22298_10073067
828 Ga0065714_10002186
829 Ga0065704_10003229
830 Ga0065704_10014104
831 Ga0065704_10135561
832 Ga0065704_10221516
833 Ga0065704_10236155
834 Ga0065704_10242902
835 Ga0065704_10658491
836 Ga0065712_10000113
837 Ga0065712_10088637
838 Ga0065712_10132261
839 Ga0065712_10283056
840 Ga0065715_10006379
841 Ga0065715_10090024
842 Ga0065715_10091511
843 Ga0065715_10113127
844 Ga0065715_10116659
845 Ga0065715_10199839
846 Ga0065707_10001531
847 Ga0065707_10190229
848 Ga0065707_10201992
849 Ga0065707_10910515
850 Ga0070676_10205841
851 Ga0070676_10379883
852 Ga0070683_100128569
853 Ga0070683_100148445
854 Ga0070683_100881912
855 Ga0070690_100004206
856 Ga0070690_100006228
857 Ga0070690_100284954
858 Ga0070670_100039706
859 Ga0070670_100135871
860 Ga0068869_100022495
861 Ga0068869_100199456
862 Ga0068869_100943592
863 Ga0068869_101155523
864 Ga0068869_102026881
865 Ga0070666_10723579
866 Ga0070680_100000139
867 Ga0070682_100000311
868 Ga0070682_100028715
869 Ga0068868_100504944
870 Ga0068868_100784204
871 Ga0068868_101268905
872 Ga0068868_102351445
873 Ga0070660_100053049
874 Ga0070689_100368074
875 Ga0070689_101299471
876 Ga0070691_10713700
877 Ga0070687_100364939
878 Ga0070687_100378001
879 Ga0070661_100048060
880 Ga0070661_100065157
881 Ga0070661_100497970
882 Ga0070692_10013410
883 Ga0070692_10036037
884 Ga0070692_10226697
885 Ga0070692_10537258
886 Ga0070692_10914754
887 Ga0070668_100018588
888 Ga0070668_100581261
889 Ga0070669_100022866
890 Ga0070669_100038209
891 Ga0070669_100305950
892 Ga0070669_100775324
893 Ga0070675_100547652
894 Ga0070671_100088184
895 Ga0070671_100121182
896 Ga0070671_100896014
897 Ga0070671_101090580
898 Ga0070674_100774679
899 Ga0070673_100020213
900 Ga0070673_100135359
901 Ga0070659_100002723
902 Ga0070659_100649762
903 Ga0070667_100823795
904 Ga0070703_10386616
905 Ga0070701_10031043
906 Ga0070701_10844120
907 Ga0070705_100579965
908 Ga0070705_100677847
909 Ga0070700_100003151
910 Ga0070700_100026221
911 Ga0070700_100385318
912 Ga0070694_100064064
913 Ga0070694_100090462
914 Ga0070694_100109992
915 Ga0070694_100123725
916 Ga0070708_100157015
917 Ga0070708_100328812
918 Ga0070663_100366820
919 Ga0070663_100481179
920 Ga0070663_101085684
921 Ga0070662_100212418
922 Ga0070662_101291897
923 Ga0070662_101312664
924 Ga0070662_101831042
925 Ga0070681_10000350
926 Ga0070681_10003130
927 Ga0068867_100026995
928 Ga0068867_101296706
929 Ga0070706_100137332
930 Ga0070706_101796026
931 Ga0070707_100161792
932 Ga0070707_100539982
933 Ga0070698_100012329
934 Ga0070698_100032837
935 Ga0070698_100570262
936 Ga0070699_100060650
937 Ga0070699_100156639
938 Ga0070699_100487087
939 Ga0070699_101079043
940 Ga0070679_100000059
941 Ga0070679_100011688
942 Ga0070679_100117327
943 Ga0070679_100405576
944 Ga0070684_100113229
945 Ga0070684_101710759
946 Ga0070697_100000042
947 Ga0070697_100004594
948 Ga0070697_100083361
949 Ga0070697_100097028
950 Ga0070697_100105843
951 Ga0070697_100108014
952 Ga0070697_100143262
953 Ga0070697_100150408
954 Ga0070697_101437927
955 Ga0070697_101547094
956 Ga0068853_100011800
957 Ga0068853_100091583
958 Ga0068853_100099858
959 Ga0068853_100155987
960 Ga0068853_100196488
961 Ga0070672_100043297
962 Ga0070672_100236897
963 Ga0070672_100605049
964 Ga0070686_100007940
965 Ga0070686_100145614
966 Ga0070695_100017748
967 Ga0070695_100054421
968 Ga0070695_101019183
969 Ga0070696_100006190
970 Ga0070696_100021784
971 Ga0070696_100599474
972 Ga0070693_100374224
973 Ga0070693_100735523
974 Ga0070704_100106415
975 Ga0070704_100165334
976 Ga0070704_100328183
977 Ga0070704_100343171
978 Ga0068855_102424576
979 Ga0070664_100007058
980 Ga0070664_100066697
981 Ga0070664_100084001
982 Ga0070664_100258363
983 Ga0070664_100608461
984 Ga0070664_100787259
985 Ga0070664_102071911
986 Ga0068857_100008041
987 Ga0068857_100045462
988 Ga0068857_100676387
989 Ga0068857_100855342
990 Ga0068857_101013169
991 Ga0068857_101212234
992 Ga0068854_100120561
993 Ga0068854_100166988
994 Ga0068854_100261518
995 Ga0068854_100262248
996 Ga0068854_100954252
997 Ga0068854_101830259
998 Ga0068852_100105697
999 Ga0068852_100250766
1000 Ga0068859_100027753
1001 Ga0068859_100066720
1002 Ga0068859_100067920
1003 Ga0068859_100100077
1004 Ga0068859_100642430
1005 Ga0068859_100807562
1006 Ga0068859_100995464
1007 Ga0068859_101133847
1008 Ga0068859_102840187
1009 Ga0068864_100137240
1010 Ga0068864_100191905
1011 Ga0068864_100227925
1012 Ga0068864_100269135
1013 Ga0068864_100355857
1014 Ga0068864_100491831
1015 Ga0068864_100640432
1016 Ga0068864_101379924
1017 Ga0068864_102082327
1018 Ga0068864_102157428
1019 Ga0068866_10485909
1020 Ga0068861_100089279
1021 Ga0068861_100538121
1022 Ga0068861_101126157
1023 Ga0068851_10025098
1024 Ga0068870_10553656
1025 Ga0068863_100074385
1026 Ga0068863_100703930
1027 Ga0068863_102117639
1028 Ga0068858_100076240
1029 Ga0068858_100095575
1030 Ga0068858_100224678
1031 Ga0068858_100336760
1032 Ga0068858_102038865
1033 Ga0068860_100020300
1034 Ga0068860_100355662
1035 Ga0068860_100830547
1036 Ga0068860_101222965
1037 Ga0068860_101604552
1038 Ga0068862_100030465
1039 Ga0068862_100070490
1040 Ga0068862_100347441
1041 Ga0068862_100442215
1042 Ga0068862_100624404
1043 Ga0068862_102579522
1044 Ga0081539_10000360
1045 Ga0081539_10000669
1046 Ga0081539_10023171
1047 Ga0081539_10106916
1048 Ga0075432_10347193
1049 Ga0070716_100247363
1050 Ga0068871_100447169
1051 Ga0068871_100926947
1052 Ga0075428_100527335
1053 Ga0075428_100550547
1054 Ga0075428_100606264
1055 Ga0075430_100206432
1056 Ga0075431_100889934
1057 Ga0075433_10010620
1058 Ga0075433_10029791
1059 Ga0075433_10307695
1060 Ga0075433_10418320
1061 Ga0075433_10498032
1062 Ga0075433_10996049
1063 Ga0075433_11505207
1064 Ga0075434_101910781
1065 Ga0075434_102423434
1066 Ga0075429_100620114
1067 Ga0068865_100987049
1068 Ga0075436_100022459
1069 Ga0097620_100027755
1070 Ga0097620_100066722
1071 Ga0097620_100067920
1072 Ga0097620_100100075
1073 Ga0097620_100642387
1074 Ga0097620_100807544
1075 Ga0097620_100995489
1076 Ga0097620_101133796
1077 Ga0097620_102841429
1078 Ga0075435_100344134
1079 Ga0075435_101740724
1080 Ga0105251_10036530
1081 Ga0105250_10294458
1082 Ga0105250_10568687
1083 Ga0105250_10594666
1084 Ga0105240_10184648
1085 Ga0105240_11186845
1086 Ga0111539_10013585
1087 Ga0111539_10021005
1088 Ga0111539_10121917
1089 Ga0111539_10148585
1090 Ga0111539_10503287
1091 Ga0111539_10941280
1092 Ga0105245_10531346
1093 Ga0105245_10586746
1094 Ga0105245_10591486
1095 Ga0105245_11010160
1096 Ga0105245_11219695
1097 Ga0105245_11908222
1098 Ga0105245_12079828
1099 Ga0105247_10033320
1100 Ga0105247_10053337
1101 Ga0105247_10346886
1102 Ga0105247_10462574
1103 Ga0105247_10732357
1104 Ga0114129_10010635
1105 Ga0114129_10040157
1106 Ga0114129_10058175
1107 Ga0114129_10159250
1108 Ga0114129_10217853
1109 Ga0114129_11275721
1110 Ga0114129_11622643
1111 Ga0114129_12490829
1112 Ga0105243_10178238
1113 Ga0105243_10299256
1114 Ga0105243_10304533
1115 Ga0105243_10891143
1116 Ga0105243_10999260
1117 Ga0105243_11622419
1118 Ga0105243_11675285
1119 Ga0105243_11869345
1120 Ga0105241_10042588
1121 Ga0105241_10076458
1122 Ga0105241_10100176
1123 Ga0105241_10117704
1124 Ga0105241_10125607
1125 Ga0105241_10418812
1126 Ga0105241_10441112
1127 Ga0105241_10534563
1128 Ga0105241_10598481
1129 Ga0105241_11203129
1130 Ga0105241_12004356
1131 Ga0105242_10481578
1132 Ga0105242_11267949
1133 Ga0105242_11792784
1134 Ga0105242_12467383
1135 Ga0105248_10014958
1136 Ga0105248_10036451
1137 Ga0105248_10252526
1138 Ga0105248_10326581
1139 Ga0105248_10457596
1140 Ga0105248_10578169
1141 Ga0105248_10843401
1142 Ga0105248_10853842
1143 Ga0105248_12010667
1144 Ga0105237_10002569
1145 Ga0105237_10118731
1146 Ga0105237_10225442
1147 Ga0105237_11045318
1148 Ga0105238_10003652
1149 Ga0105238_10098525
1150 Ga0105238_10950729
1151 Ga0105238_11097746
1152 Ga0105249_10000044
1153 Ga0105249_10054955
1154 Ga0105249_10073041
1155 Ga0105249_10125570
1156 Ga0105249_10371159
1157 Ga0105249_10673678
1158 Ga0105249_11124974
1159 Ga0105249_11373681
1160 Ga0105239_11056135
1161 Ga0105239_11083431
1162 Ga0105239_11854106
1163 Ga0105246_10008236
1164 Ga0105246_10834728
1165 Ga0105246_11935758
1166 Ga0157373_10006382
1167 Ga0157373_10217554
1168 Ga0157373_11085587
1169 Ga0157371_10196493
1170 Ga0157371_10463508
1171 Ga0157371_10700721
1172 Ga0157370_10036799
1173 Ga0157370_10263238
1174 Ga0157370_10742048
1175 Ga0157370_11445740
1176 Ga0157374_10103556
1177 Ga0157378_10012900
1178 Ga0157378_10013580
1179 Ga0157378_10061703
1180 Ga0157378_10108122
1181 Ga0157378_10374879
1182 Ga0157378_10874665
1183 Ga0157378_10939479
1184 Ga0157378_11017971
1185 Ga0157378_11280265
1186 Ga0157378_11385326
1187 Ga0163162_10000025
1188 Ga0163162_10020033
1189 Ga0163162_10030465
1190 Ga0163162_10074816
1191 Ga0163162_10256605
1192 Ga0163162_10262379
1193 Ga0163162_10398506
1194 Ga0163162_10431749
1195 Ga0163162_10471956
1196 Ga0163162_10546749
1197 Ga0163162_10644056
1198 Ga0163162_10669861
1199 Ga0163162_11165683
1200 Ga0163162_11171402
1201 Ga0163162_11266202
1202 Ga0163162_11435939
1203 Ga0163162_11831855
1204 Ga0157372_10031443
1205 Ga0157372_10249053
1206 Ga0157372_10426977
1207 Ga0157372_10859385
1208 Ga0157375_10047618
1209 Ga0157375_10069225
1210 Ga0157375_10128693
1211 Ga0157375_10532278
1212 Ga0157375_10778616
1213 Ga0157375_10959926
1214 Ga0157375_11154279
1215 Ga0157375_11552760
1216 Ga0157375_12363062
1217 Ga0157375_12902154
1218 Ga0163163_10000536
1219 Ga0163163_10003037
1220 Ga0163163_10130388
1221 Ga0163163_10185263
1222 Ga0163163_10307647
1223 Ga0163163_10582145
1224 Ga0163163_10990175
1225 Ga0163163_11162314
1226 Ga0163163_12249792
1227 Ga0157380_10010426
1228 Ga0157380_10011038
1229 Ga0157380_10013135
1230 Ga0157380_10016677
1231 Ga0157380_10042459
1232 Ga0157380_10043819
1233 Ga0157380_10498709
1234 Ga0157380_10500792
1235 Ga0157380_11585100
1236 Ga0157377_10200541
1237 Ga0157377_10257125
1238 Ga0157377_10329206
1239 Ga0157377_10490512
1240 Ga0157377_10805215
1241 Ga0157377_10964869
1242 Ga0157377_11376831
1243 Ga0157379_10231371
1244 Ga0157379_10454870
1245 Ga0157376_10902474
1246 Ga0157376_11566296
1247 Ga0182007_10258583
1248 Ga0182005_1083091
1249 Ga0213876_10000038
1250 Ga0213876_10000382
1251 Ga0207713_1161150
1252 Ga0207653_10005271
1253 Ga0207653_10272648
1254 Ga0207710_10027307
1255 Ga0207710_10232447
1256 Ga0207647_10006732
1257 Ga0207645_10054704
1258 Ga0207645_10279542
1259 Ga0207645_11189689
1260 Ga0207643_10001020
1261 Ga0207643_10493038
1262 Ga0207684_10000079
1263 Ga0207684_10069867
1264 Ga0207684_10369919
1265 Ga0207684_11257742
1266 Ga0207654_10019329
1267 Ga0207654_10714291
1268 Ga0207707_10000008
1269 Ga0207707_10000625
1270 Ga0207707_10019384
1271 Ga0207707_10285598
1272 Ga0207707_10522810
1273 Ga0207663_10574292
1274 Ga0207660_10004225
1275 Ga0207660_10063317
1276 Ga0207660_10341254
1277 Ga0207660_10527802
1278 Ga0207660_10733539
1279 Ga0207662_10002097
1280 Ga0207657_10036482
1281 Ga0207649_10626254
1282 Ga0207652_10000085
1283 Ga0207652_10019341
1284 Ga0207652_10064650
1285 Ga0207646_10081792
1286 Ga0207646_10473391
1287 Ga0207646_11463773
1288 Ga0207681_10005287
1289 Ga0207681_10015070
1290 Ga0207681_10093415
1291 Ga0207681_10531987
1292 Ga0207694_10039562
1293 Ga0207650_10035005
1294 Ga0207650_11860713
1295 Ga0207659_10145690
1296 Ga0207659_10800326
1297 Ga0207659_10937355
1298 Ga0207687_10669870
1299 Ga0207687_10704882
1300 Ga0207690_10759564
1301 Ga0207706_10071081
1302 Ga0207706_10232811
1303 Ga0207706_10741628
1304 Ga0207686_10240867
1305 Ga0207686_10693494
1306 Ga0207709_10012102
1307 Ga0207709_10036298
1308 Ga0207709_10338633
1309 Ga0207709_11538947
1310 Ga0207670_10000612
1311 Ga0207670_10317808
1312 Ga0207665_10006407
1313 Ga0207691_10016850
1314 Ga0207691_10989581
1315 Ga0207711_10195267
1316 Ga0207711_10243263
1317 Ga0207711_11136585
1318 Ga0207711_11539420
1319 Ga0207689_10002487
1320 Ga0207689_10060520
1321 Ga0207689_10080098
1322 Ga0207689_10435180
1323 Ga0207689_10487973
1324 Ga0207689_10691518
1325 Ga0207689_10699618
1326 Ga0207661_10214346
1327 Ga0207661_10221428
1328 Ga0207661_10492093
1329 Ga0207679_10091246
1330 Ga0207679_10122911
1331 Ga0207679_10289507
1332 Ga0207679_10601859
1333 Ga0207679_12152186
1334 Ga0207667_10678447
1335 Ga0207667_11396031
1336 Ga0207651_10009393
1337 Ga0207651_10197068
1338 Ga0207651_10366606
1339 Ga0207651_11151075
1340 Ga0207712_10000039
1341 Ga0207712_10087095
1342 Ga0207712_10112272
1343 Ga0207712_10260332
1344 Ga0207712_11012723
1345 Ga0207712_11405778
1346 Ga0207712_11805287
1347 Ga0207668_10578738
1348 Ga0207640_10037325
1349 Ga0207640_10150136
1350 Ga0207640_10220323
1351 Ga0207640_10280287
1352 Ga0207640_10317492
1353 Ga0207640_10428810
1354 Ga0207640_10444737
1355 Ga0207640_11276040
1356 Ga0207640_11873936
1357 Ga0207677_10223620
1358 Ga0207677_10778969
1359 Ga0207703_10056982
1360 Ga0207703_10222450
1361 Ga0207703_10236283
1362 Ga0207703_10492658
1363 Ga0207639_10070106
1364 Ga0207639_10181502
1365 Ga0207639_10269224
1366 Ga0207639_10835741
1367 Ga0207639_11277871
1368 Ga0207678_10236319
1369 Ga0207678_10587345
1370 Ga0207678_10728697
1371 Ga0207708_10000453
1372 Ga0207708_10117833
1373 Ga0207708_10226247
1374 Ga0207708_10232819
1375 Ga0207702_10107763
1376 Ga0207641_10020800
1377 Ga0207641_12057094
1378 Ga0207648_10008493
1379 Ga0207648_10019939
1380 Ga0207648_10072685
1381 Ga0207648_10356406
1382 Ga0207648_11833986
1383 Ga0207676_10397530
1384 Ga0207676_10487510
1385 Ga0207676_10516851
1386 Ga0207676_10627430
1387 Ga0207676_11338247
1388 Ga0207676_11608775
1389 Ga0207676_11793688
1390 Ga0207674_10004760
1391 Ga0207674_10106999
1392 Ga0207674_10543446
1393 Ga0207674_11278101
1394 Ga0207675_100079194
1395 Ga0207675_100208533
1396 Ga0207675_100667862
1397 Ga0207675_100909220
1398 Ga0207683_10821099
1399 Ga0207683_10908669
1400 Ga0207698_10023978
1401 Ga0207698_10164225
1402 Ga0207698_10686965
1403 Ga0207698_11511429
1404 Ga0207428_10013006
1405 Ga0268265_10039144
1406 Ga0268265_10110805
1407 Ga0268265_10159633
1408 Ga0268265_10626216
1409 Ga0268265_10977545
1410 Ga0268265_12442708
1411 Ga0268264_10010363
1412 Ga0268264_10257119
1413 Ga0268264_10335979
1414 Ga0268264_10502083
1415 Ga0268264_11206250
1416 Ga0316180_1060416
1417 Ga0307513_10036448
1418 Ga0307513_10795491
1419 Ga0307408_100198268
1420 Ga0307408_100262976
1421 Ga0307413_10797560
1422 Ga0307413_10923806
1423 Ga0307410_10039082
1424 Ga0307410_10123014
1425 Ga0307406_10017239
1426 Ga0307406_10066075
1427 Ga0307406_10620696
1428 Ga0307412_10309737
1429 Ga0307412_10593732
1430 Ga0307409_100450472
1431 Ga0307409_100730753
1432 Ga0307409_101790592
1433 Ga0307416_100066307
1434 Ga0307416_100083639
1435 Ga0307416_101317985
1436 Ga0307416_101339156
1437 Ga0307414_10229667
1438 Ga0307414_10391608
1439 Ga0307411_10492418
1440 Ga0307411_10618941
1441 Ga0307411_10941043
1442 Ga0307415_100044648
1443 Ga0307415_100075964
1444 Ga0307415_100082632
1445 Ga0307415_100518796
1446 Ga0307415_100724678
1447 Ga0307415_101363643
1448 Ga0307415_101828435
1449 Ga0373960_0219733
1450 Ga0395899_0727196
1451 Ga0395900_0109634
1452 Ga0395900_0565523
1453 Ga0395900_0597261
1454 Ga0395898_0093773
1455 Ga0395905_0044236
1456 Ga0395905_0083065
1457 Ga0395905_0368276
1458 Ga0395905_0537571
1459 Ga0395905_0605021
1460 Ga0436364_0048479
1461 Ga0242419_003074
1462 Ga0242422_02143
1463 Ga0242420_014254
1464 Ga0242420_045253
1465 Ga0436365_0038900
1466 Ga0436365_0364607
1467 Ga0436365_1023949
1468 Ga0436365_1250677
1469 Ga0439455_0004976
1470 Ga0439462_0047576
1471 Ga0450891_029762
1472 Ga0450892_009122
1473 Ga0439446_0010887
1474 Ga0439458_0005074
1475 Ga0439460_0225032
1476 Ga0451577_1440035
1477 Ga0451576_0084913
1478 Ga0451576_2490482
1479 Ga0495632_0012789
1480 Ga0495663_0000154
1481 Ga0495598_0000097
1482 Ga0495621_0007621
1483 Ga0495621_0059858
1484 Ga0495668_0002181
1485 Ga0495636_0013894
1486 Ga0495672_0009111
1487 Ga0496102_0043354
1488 Ga0496104_0428974
1489 Ga0496106_0064870
1490 Ga0496106_0312845
1491 Ga0496106_1271378
1492 Ga0496108_0035963
1493 Ga0496108_0068538
1494 Ga0496108_0310238
1495 Ga0496109_0478359
1496 Ga0496109_0617799
1497 Ga0496109_1295324
1498 Ga0496110_0335820
1499 Ga0496110_0395939
1500 Ga0496110_1108607
1501 Ga0496111_0171929
1502 Ga0496111_0761794
1503 Ga0496112_0094713
1504 Ga0496112_0216301
1505 Ga0496112_0291879
1506 Ga0496112_0313505
1507 Ga0496112_0398625
1508 Ga0496112_0462957
1509 Ga0496112_0651954
1510 Ga0496113_0041685
1511 Ga0496113_1306865
1512 Ga0501290_036537
1513 Ga0501291_000902
1514 Ga0501291_003351
1515 Ga0501292_012772
1516 Ga0501292_017081
1517 Ga0501294_020325
1518 Ga0501295_030452
1519 Ga0501296_000889
1520 Ga0501296_028906
1521 Ga0501297_003155
1522 Ga0501297_007613
1523 Ga0501297_009658
1524 Ga0501298_009025
1525 Ga0501298_025440
1526 Ga0501298_172193
1527 Ga0501299_000266
1528 Ga0501299_034091
1529 Ga0501303_010150
1530 Ga0501040_1244272
1531 Ga0501074_1168046
1532 Ga0501075_0289107
1533 Ga0501075_0499060
1534 Ga0501076_0280168
1535 Ga0501077_0327870
1536 Ga0501198_018537
1537 Ga0501198_055381
1538 Ga0501206_005472
1539 Ga0501206_007691
1540 Ga0501207_012015
1541 Ga0501207_052627
1542 Ga0501209_153637
1543 Ga0501216_001967
1544 Ga0501216_038956
1545 Ga0501217_002116
1546 Ga0501217_075116
1547 Ga0501223_029092
1548 Ga0501224_009439
1549 Ga0501224_017715
1550 Ga0501224_034156
1551 Ga0501227_050169
1552 Ga0501228_036249
1553 Ga0501233_034280
1554 Ga0501233_046455
1555 Ga0501233_128059
1556 Ga0501233_238654
1557 Ga0501235_007600
1558 Ga0501235_007777
1559 Ga0501235_017269
1560 Ga0501242_069914
1561 Ga0501249_116115
1562 Ga0501251_076557
1563 Ga0501252_064134
1564 Ga0501253_002201
1565 Ga0501253_123468
1566 Ga0501255_021692
1567 Ga0501256_001192
1568 Ga0501257_045656
1569 Ga0501257_130161
1570 Ga0501259_059756
1571 Ga0501260_019011
1572 Ga0501261_117993
1573 Ga0501225_0008790
1574 Ga0501225_0017183
1575 Ga0501225_0087361
1576 Ga0501225_0106943
1577 Ga0501225_0302669
1578 Ga0501234_034108
1579 Ga0501079_0384125
1580 Ga0501079_0473001
1581 Ga0501080_0905148
1582 Ga0501232_027800
1583 Ga0501266_010515
1584 Ga0501266_035854
1585 Ga0501268_007817
1586 Ga0501268_056610
1587 Ga0501270_028364
1588 Ga0501271_001898
1589 Ga0501272_059912
1590 Ga0501273_004341
1591 Ga0501273_020274
1592 Ga0501274_033886
1593 Ga0501278_002852
1594 Ga0501283_002122
1595 Ga0501283_032526
1596 Ga0501283_102953
1597 Ga0501045_0737918
1598 Ga0501212_058390
1599 Ga0501212_062125
1600 Ga0501212_069719
1601 nmdc:mga05p37_105816_c1
1602 nmdc:mga05p37_1064724_c1
1603 nmdc:mga05p37_130170_c1
1604 nmdc:mga05p37_131323_c1
1605 nmdc:mga05p37_285564_c1
1606 nmdc:mga05p37_286538_c1
1607 nmdc:mga05p37_342735_c1
1608 nmdc:mga09592_525857_c1
1609 nmdc:mga09592_552199_c1
1610 nmdc:mga0qj67_206819_c1
1611 nmdc:mga0qj67_40669_c1
1612 nmdc:mga0qj67_80966_c1
1613 nmdc:mga06r32_168110_c1
1614 nmdc:mga06r32_344617_c1
1615 nmdc:mga06r32_74883_c1
1616 nmdc:mga06r32_773379_c1
1617 nmdc:mga08y16_115681_c1
1618 nmdc:mga08y16_137556_c1
1619 nmdc:mga08y16_211007_c1
1620 nmdc:mga08y16_230438_c1
1621 nmdc:mga08y16_48820_c1
1622 nmdc:mga08y16_613952_c1
1623 nmdc:mga08y16_9954_c1
1624 nmdc:mga0n895_214655_c1
1625 nmdc:mga0n895_345427_c1
1626 nmdc:mga0rr50_1560043_c1
1627 nmdc:mga0rr50_98618_c1
1628 nmdc:mga08x19_30832_c1
1629 nmdc:mga0a205_136783_c1
1630 nmdc:mga0a205_1427747_c1
1631 nmdc:mga0a205_258363_c1
1632 nmdc:mga0a205_382591_c1
1633 nmdc:mga0a205_38526_c1
1634 nmdc:mga0a205_409206_c1
1635 nmdc:mga0a205_504450_c1
1636 nmdc:mga0a205_58119_c1
1637 nmdc:mga0a205_62630_c1
1638 nmdc:mga0a205_903092_c1
1639 nmdc:mga0a205_936177_c1
1640 Ga0500577_0001033
1641 Ga0501082_0977178
1642 Ga0530510_0889905

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

80

158

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.958 24 136
4fgc-assembly1.cif.gz_A-2 crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 0.9484 24 136
4ghm-assembly1.cif.gz_B crystal structure of the h233a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq0 0.9308 36 132
3rzp-assembly1.cif.gz_B crystal structure of the c194a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq1 0.9266 36 132
3bp1-assembly1.cif.gz_D crystal structure of putative 7-cyano-7-deazaguanine reductase quef from vibrio cholerae o1 biovar eltor 0.9237 35 132
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9058 12 136 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8925 36 136 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8888 28 136 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8566 29 131 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8563 34 134 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A136JNA5-F1-model_v4 deleted 0.9899 23 136
AF-A0A7Y4X8E6-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9894 23 135 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A2V8S7V8-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9893 23 136 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A7T9JDT0-F1-model_v4 deleted 0.985 3 136
AF-A0A3M2D921-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.985 23 136 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Map