F482091

General Info

Members Datasets Scaffolds Average Seq Length
817 359 1634 121

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11039336|Ga0111539_110393362
Length 133
Sequence MARVKRAVSSKKHRREILERAKGYYGNKSRSYRAANEQVMHSGQYAFRDRRARKGEFRRLWIQRINAGCRQHGMSYSRFIAGLHAAGIEVDRKVLADLAVTDPTAFAALVEAASTALDAEPEAKGTSSQEAPA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
192 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
200 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
205 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
206 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
207 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
208 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
339 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
348 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
349 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
350 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
351 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
352 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
353 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
354 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
355 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
356 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
357 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
358 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
359 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.84
Metatranscriptomes 2.69
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 9.18
Nodule 0
Rhizoplane 6.61
Rhizosphere 78.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_11039336 3300009094 Bacteria 952
2 JGI24735J21928_10223505 3300002067 Bacteria 547
3 Ga0006759J45824_1045204 3300003163 Bacteria 836
4 Ga0007410J51695_1042683 3300003574 Bacteria 587
5 Ga0032354_1060619 3300003693 Bacteria 599
6 Ga0055542_1012380 3300003762 Bacteria 1477
7 Ga0058860_11891024 3300004801 Bacteria 635
8 Ga0070676_10223078 3300005328 Bacteria 1246
9 Ga0070690_100036947 3300005330 Bacteria 3074
10 Ga0070690_101379218 3300005330 Bacteria 567
11 Ga0068869_100401736 3300005334 Bacteria 1127
12 Ga0070666_10698224 3300005335 Bacteria 744
13 Ga0068868_100221984 3300005338 Bacteria 1582
14 Ga0068868_100956193 3300005338 Bacteria 781
15 Ga0070660_100027811 3300005339 Bacteria 4224
16 Ga0070689_100192339 3300005340 Bacteria 1662
17 Ga0070687_100035663 3300005343 Bacteria 2472
18 Ga0070661_100222734 3300005344 Bacteria 1447
19 Ga0070661_100513992 3300005344 Bacteria 960
20 Ga0070668_101073740 3300005347 Bacteria 726
21 Ga0070668_101123571 3300005347 Bacteria 710
22 Ga0070668_101220901 3300005347 Bacteria 682
23 Ga0070669_100832015 3300005353 Bacteria 786
24 Ga0070675_100764577 3300005354 Bacteria 882
25 Ga0070671_100612135 3300005355 Bacteria 942
26 Ga0070674_100144558 3300005356 Bacteria 1789
27 Ga0070674_100552797 3300005356 Bacteria 966
28 Ga0070673_100646825 3300005364 Bacteria 967
29 Ga0070688_100164962 3300005365 Bacteria 1524
30 Ga0070659_100428165 3300005366 Bacteria 1120
31 Ga0070659_101851384 3300005366 Bacteria 541
32 Ga0070667_100299775 3300005367 Bacteria 1447
33 Ga0070667_100344978 3300005367 Bacteria 1347
34 Ga0070667_100669621 3300005367 Bacteria 959
35 Ga0070713_100749778 3300005436 Bacteria 934
36 Ga0070701_10974403 3300005438 Bacteria 590
37 Ga0070711_101338840 3300005439 Bacteria 622
38 Ga0070700_100713608 3300005441 Bacteria 799
39 Ga0070678_100125677 3300005456 Bacteria 2030
40 Ga0070678_100952948 3300005456 Bacteria 787
41 Ga0070678_101353050 3300005456 Bacteria 664
42 Ga0070678_101398753 3300005456 Bacteria 653
43 Ga0068867_100016622 3300005459 Bacteria 5225
44 Ga0068867_101630288 3300005459 Bacteria 603
45 Ga0070685_10069583 3300005466 Bacteria 2082
46 Ga0070685_10394399 3300005466 Bacteria 957
47 Ga0070685_10548384 3300005466 Bacteria 825
48 Ga0070706_101222626 3300005467 Bacteria 690
49 Ga0070707_100287456 3300005468 Bacteria 1598
50 Ga0070698_100001494 3300005471 Bacteria 25962
51 Ga0070684_101125333 3300005535 Bacteria 738
52 Ga0070672_101183380 3300005543 Bacteria 681
53 Ga0070686_100092096 3300005544 Bacteria 2029
54 Ga0070695_101354915 3300005545 Bacteria 589
55 Ga0070665_100258158 3300005548 Bacteria 1744
56 Ga0070665_100504883 3300005548 Bacteria 1221
57 Ga0070665_101710928 3300005548 Bacteria 636
58 Ga0068855_101642443 3300005563 Bacteria 657
59 Ga0068857_100021181 3300005577 Bacteria 5720
60 Ga0068857_101930271 3300005577 Bacteria 578
61 Ga0068854_100070101 3300005578 Bacteria 2562
62 Ga0068854_100168565 3300005578 Bacteria 1702
63 Ga0068856_100222844 3300005614 Bacteria 1901
64 Ga0068856_100865817 3300005614 Bacteria 923
65 Ga0068856_101323809 3300005614 Bacteria 735
66 Ga0070702_100037917 3300005615 Bacteria 2680
67 Ga0068852_100031004 3300005616 Bacteria 4406
68 Ga0068852_100447838 3300005616 Bacteria 1278
69 Ga0068852_102295392 3300005616 Bacteria 561
70 Ga0068859_100085058 3300005617 Bacteria 3208
71 Ga0068859_100410777 3300005617 Bacteria 1450
72 Ga0068859_100539722 3300005617 Bacteria 1261
73 Ga0068859_100734511 3300005617 Bacteria 1077
74 Ga0068864_101765345 3300005618 Bacteria 624
75 Ga0068861_100108728 3300005719 Bacteria 2218
76 Ga0068861_100817679 3300005719 Bacteria 876
77 Ga0068851_10000124 3300005834 Bacteria 41585
78 Ga0068863_100156964 3300005841 Bacteria 2178
79 Ga0068858_100034111 3300005842 Bacteria 4721
80 Ga0068858_100924813 3300005842 Bacteria 853
81 Ga0068858_101396805 3300005842 Bacteria 690
82 Ga0068858_102375455 3300005842 Bacteria 524
83 Ga0068860_100040814 3300005843 Bacteria 4434
84 Ga0068860_100070388 3300005843 Bacteria 3326
85 Ga0068860_100094907 3300005843 Bacteria 2843
86 Ga0068860_100278853 3300005843 Bacteria 1633
87 Ga0068862_100115053 3300005844 Bacteria 2365
88 Ga0081455_10144942 3300005937 Bacteria 1839
89 Ga0075365_10084336 3300006038 Bacteria 2156
90 Ga0075365_10125888 3300006038 Bacteria 1771
91 Ga0075365_10156275 3300006038 Bacteria 1587
92 Ga0075365_10207513 3300006038 Bacteria 1373
93 Ga0075365_10279835 3300006038 Bacteria 1174
94 Ga0075365_10540585 3300006038 Bacteria 824
95 Ga0075365_10570161 3300006038 Bacteria 801
96 Ga0075365_10834931 3300006038 Bacteria 650
97 Ga0075365_11002349 3300006038 Bacteria 589
98 Ga0075368_10040254 3300006042 Bacteria 1835
99 Ga0075368_10087016 3300006042 Bacteria 1275
100 Ga0075368_10258722 3300006042 Bacteria 745
101 Ga0075363_100138741 3300006048 Bacteria 1368
102 Ga0075363_100184499 3300006048 Bacteria 1188
103 Ga0075363_100597429 3300006048 Bacteria 661
104 Ga0075363_100876006 3300006048 Bacteria 549
105 Ga0075364_10019266 3300006051 Bacteria 4281
106 Ga0075364_10030892 3300006051 Bacteria 3440
107 Ga0075364_10038123 3300006051 Bacteria 3114
108 Ga0075364_10140782 3300006051 Bacteria 1622
109 Ga0075364_10188671 3300006051 Bacteria 1396
110 Ga0075364_10388778 3300006051 Bacteria 952
111 Ga0075364_10565606 3300006051 Bacteria 777
112 Ga0075364_10827174 3300006051 Bacteria 631
113 Ga0075364_11265062 3300006051 Bacteria 500
114 Ga0075432_10144141 3300006058 Bacteria 911
115 Ga0070715_10046403 3300006163 Bacteria 1847
116 Ga0070716_100384944 3300006173 Bacteria 1004
117 Ga0070712_101134754 3300006175 Bacteria 679
118 Ga0075367_10087401 3300006178 Bacteria 1893
119 Ga0075367_10270885 3300006178 Bacteria 1067
120 Ga0075367_10459896 3300006178 Bacteria 807
121 Ga0075369_10128214 3300006186 Bacteria 1152
122 Ga0075366_10119971 3300006195 Bacteria 1585
123 Ga0075366_10155328 3300006195 Bacteria 1386
124 Ga0097621_100576019 3300006237 Bacteria 1027
125 Ga0097621_100827471 3300006237 Bacteria 859
126 Ga0097621_101185641 3300006237 Bacteria 719
127 Ga0075370_10298788 3300006353 Bacteria 957
128 Ga0068871_100133823 3300006358 Bacteria 2104
129 Ga0075428_100324504 3300006844 Bacteria 1654
130 Ga0075428_101702001 3300006844 Bacteria 658
131 Ga0075428_102459656 3300006844 Bacteria 534
132 Ga0075430_100457073 3300006846 Bacteria 1054
133 Ga0075434_100273678 3300006871 Bacteria 1708
134 Ga0075434_102542850 3300006871 Bacteria 513
135 Ga0075429_101158283 3300006880 Bacteria 675
136 Ga0068865_100268589 3300006881 Bacteria 1353
137 Ga0097620_100085058 3300006931 Bacteria 3208
138 Ga0097620_100410728 3300006931 Bacteria 1450
139 Ga0097620_100539700 3300006931 Bacteria 1261
140 Ga0097620_100734507 3300006931 Bacteria 1077
141 Ga0075435_101417947 3300007076 Bacteria 609
142 Ga0075435_101686520 3300007076 Bacteria 556
143 Ga0105244_10388806 3300009036 Bacteria 642
144 Ga0111539_10085598 3300009094 Bacteria 3704
145 Ga0111539_10880790 3300009094 Bacteria 1041
146 Ga0111539_11253304 3300009094 Bacteria 861
147 Ga0111539_12562022 3300009094 Bacteria 591
148 Ga0105245_10005233 3300009098 Bacteria 11399
149 Ga0105245_10078330 3300009098 Bacteria 3016
150 Ga0105245_11061066 3300009098 Bacteria 856
151 Ga0105245_11470462 3300009098 Bacteria 732
152 Ga0105247_10130555 3300009101 Bacteria 1637
153 Ga0105247_10307884 3300009101 Bacteria 1101
154 Ga0105247_10866152 3300009101 Bacteria 695
155 Ga0114129_11293662 3300009147 Bacteria 904
156 Ga0114129_13403629 3300009147 Bacteria 511
157 Ga0105243_10062882 3300009148 Bacteria 2973
158 Ga0105243_10822867 3300009148 Bacteria 917
159 Ga0105243_10952832 3300009148 Bacteria 857
160 Ga0105243_12930391 3300009148 Bacteria 517
161 Ga0105241_10000211 3300009174 Bacteria 43844
162 Ga0105241_10482388 3300009174 Bacteria 1102
163 Ga0105241_11762620 3300009174 Bacteria 603
164 Ga0105242_10137321 3300009176 Bacteria 2117
165 Ga0105242_13218287 3300009176 Bacteria 507
166 Ga0105248_10989264 3300009177 Bacteria 950
167 Ga0105248_11251656 3300009177 Bacteria 839
168 Ga0105248_11253876 3300009177 Bacteria 838
169 Ga0105237_10009306 3300009545 Bacteria 10524
170 Ga0105237_10073447 3300009545 Bacteria 3413
171 Ga0105238_10001857 3300009551 Bacteria 21165
172 Ga0105238_10419449 3300009551 Bacteria 1333
173 Ga0105238_10441729 3300009551 Bacteria 1297
174 Ga0105238_10887510 3300009551 Bacteria 910
175 Ga0105249_10036783 3300009553 Bacteria 4441
176 Ga0105249_10227571 3300009553 Bacteria 1838
177 Ga0105249_10969458 3300009553 Bacteria 918
178 Ga0105249_11946417 3300009553 Bacteria 660
179 Ga0105239_10043054 3300010375 Bacteria 4947
180 Ga0105239_10290312 3300010375 Bacteria 1842
181 Ga0105239_11677802 3300010375 Bacteria 735
182 Ga0105246_10381192 3300011119 Bacteria 1165
183 Ga0105246_10451864 3300011119 Bacteria 1080
184 Ga0105246_11073760 3300011119 Bacteria 733
185 Ga0157317_1019760 3300012475 Bacteria 591
186 Ga0157371_10849288 3300013102 Bacteria 690
187 Ga0157374_10423450 3300013296 Bacteria 1330
188 Ga0157374_10890878 3300013296 Bacteria 907
189 Ga0157374_10962546 3300013296 Bacteria 872
190 Ga0157378_10087840 3300013297 Bacteria 2820
191 Ga0157378_10359266 3300013297 Bacteria 1425
192 Ga0157378_10918469 3300013297 Bacteria 907
193 Ga0157378_11763034 3300013297 Bacteria 667
194 Ga0163162_10202231 3300013306 Bacteria 2115
195 Ga0163162_10520435 3300013306 Bacteria 1319
196 Ga0163162_10570896 3300013306 Bacteria 1258
197 Ga0163162_11184058 3300013306 Bacteria 867
198 Ga0163162_11823474 3300013306 Bacteria 696
199 Ga0157375_10428264 3300013308 Bacteria 1489
200 Ga0157375_10449426 3300013308 Bacteria 1454
201 Ga0157375_11520611 3300013308 Bacteria 790
202 Ga0157375_11900842 3300013308 Bacteria 706
203 Ga0163163_10042923 3300014325 Bacteria 4431
204 Ga0163163_10902269 3300014325 Bacteria 947
205 Ga0163163_11457266 3300014325 Bacteria 746
206 Ga0163163_11816609 3300014325 Bacteria 670
207 Ga0163163_12662145 3300014325 Bacteria 557
208 Ga0163163_13133547 3300014325 Bacteria 516
209 Ga0157380_10136736 3300014326 Bacteria 2099
210 Ga0157380_10690791 3300014326 Bacteria 1024
211 Ga0157380_10978466 3300014326 Bacteria 878
212 Ga0157380_11562600 3300014326 Bacteria 714
213 Ga0157380_11644451 3300014326 Bacteria 699
214 Ga0157380_11778478 3300014326 Bacteria 675
215 Ga0157380_11886077 3300014326 Bacteria 658
216 Ga0157380_12453491 3300014326 Bacteria 587
217 Ga0182008_10508726 3300014497 Bacteria 663
218 Ga0157377_10555738 3300014745 Bacteria 812
219 Ga0157377_10838929 3300014745 Bacteria 681
220 Ga0157377_10989237 3300014745 Bacteria 636
221 Ga0157379_10025736 3300014968 Bacteria 5230
222 Ga0157379_10259207 3300014968 Bacteria 1580
223 Ga0157379_10615647 3300014968 Bacteria 1014
224 Ga0157379_11165672 3300014968 Bacteria 740
225 Ga0157379_11452516 3300014968 Bacteria 666
226 Ga0157376_10258910 3300014969 Bacteria 1629
227 Ga0157376_10475926 3300014969 Bacteria 1223
228 Ga0157376_11222451 3300014969 Bacteria 780
229 Ga0157376_11991366 3300014969 Bacteria 618
230 Ga0163161_10263950 3300017792 Bacteria 1346
231 Ga0206352_11226467 3300020078 Bacteria 732
232 Ga0213876_10017209 3300021384 Bacteria 3816
233 Ga0224712_10040393 3300022467 Bacteria 1755
234 Ga0209148_1000830 3300025254 Bacteria 22075
235 Ga0207666_1013351 3300025271 Bacteria 1153
236 Ga0207697_10056277 3300025315 Bacteria 1632
237 Ga0207656_10000001 3300025321 Bacteria 1323684
238 Ga0207656_10000003 3300025321 Bacteria 771644
239 Ga0207688_10024151 3300025901 Bacteria 3332
240 Ga0207688_10915059 3300025901 Bacteria 555
241 Ga0207680_11343436 3300025903 Bacteria 508
242 Ga0207647_10002805 3300025904 Bacteria 13135
243 Ga0207647_10124027 3300025904 Bacteria 1521
244 Ga0207685_10003853 3300025905 Bacteria 3715
245 Ga0207705_10102074 3300025909 Bacteria 2111
246 Ga0207705_10156901 3300025909 Bacteria 1708
247 Ga0207684_11265434 3300025910 Bacteria 609
248 Ga0207654_10000003 3300025911 Bacteria 1030378
249 Ga0207654_10576901 3300025911 Bacteria 801
250 Ga0207695_10026107 3300025913 Bacteria 6524
251 Ga0207671_10000001 3300025914 Bacteria 1318881
252 Ga0207671_10083947 3300025914 Bacteria 2391
253 Ga0207662_10010398 3300025918 Bacteria 5138
254 Ga0207657_10038914 3300025919 Bacteria 4229
255 Ga0207657_10124954 3300025919 Bacteria 2114
256 Ga0207649_10258127 3300025920 Bacteria 1258
257 Ga0207646_10707835 3300025922 Bacteria 900
258 Ga0207681_10732558 3300025923 Bacteria 823
259 Ga0207694_10000039 3300025924 Bacteria 186164
260 Ga0207694_10871439 3300025924 Bacteria 761
261 Ga0207694_11063993 3300025924 Bacteria 685
262 Ga0207659_10414763 3300025926 Bacteria 1128
263 Ga0207659_11502299 3300025926 Bacteria 576
264 Ga0207687_10012797 3300025927 Bacteria 5483
265 Ga0207687_10627043 3300025927 Bacteria 908
266 Ga0207687_11602965 3300025927 Bacteria 559
267 Ga0207700_11752651 3300025928 Bacteria 547
268 Ga0207664_10151546 3300025929 Bacteria 1970
269 Ga0207644_10320057 3300025931 Bacteria 1254
270 Ga0207644_11481715 3300025931 Bacteria 570
271 Ga0207644_11601430 3300025931 Bacteria 546
272 Ga0207690_10154066 3300025932 Bacteria 1706
273 Ga0207686_10144552 3300025934 Bacteria 1648
274 Ga0207709_10672482 3300025935 Bacteria 826
275 Ga0207709_11422537 3300025935 Bacteria 574
276 Ga0207670_10131165 3300025936 Bacteria 1836
277 Ga0207670_11793823 3300025936 Bacteria 522
278 Ga0207669_10648612 3300025937 Bacteria 863
279 Ga0207669_11704037 3300025937 Bacteria 538
280 Ga0207704_10085006 3300025938 Bacteria 2058
281 Ga0207665_10112774 3300025939 Bacteria 1912
282 Ga0207691_10167744 3300025940 Bacteria 1923
283 Ga0207711_10632825 3300025941 Bacteria 998
284 Ga0207711_11369395 3300025941 Bacteria 650
285 Ga0207689_10395450 3300025942 Bacteria 1152
286 Ga0207679_10136324 3300025945 Bacteria 1977
287 Ga0207667_10101515 3300025949 Bacteria 2967
288 Ga0207667_11517730 3300025949 Bacteria 641
289 Ga0207651_10436394 3300025960 Bacteria 1121
290 Ga0207651_10492906 3300025960 Bacteria 1058
291 Ga0207712_10235603 3300025961 Bacteria 1472
292 Ga0207668_10286291 3300025972 Bacteria 1354
293 Ga0207668_10801097 3300025972 Bacteria 834
294 Ga0207668_11008979 3300025972 Bacteria 744
295 Ga0207668_11636120 3300025972 Bacteria 581
296 Ga0207640_10735082 3300025981 Bacteria 849
297 Ga0207640_11359966 3300025981 Bacteria 635
298 Ga0207658_10399082 3300025986 Bacteria 1208
299 Ga0207658_10841752 3300025986 Bacteria 834
300 Ga0207658_11126937 3300025986 Bacteria 717
301 Ga0207658_12015513 3300025986 Bacteria 525
302 Ga0207677_11235712 3300026023 Bacteria 685
303 Ga0207677_11512487 3300026023 Bacteria 620
304 Ga0207703_10023605 3300026035 Bacteria 4834
305 Ga0207703_10732185 3300026035 Bacteria 941
306 Ga0207703_11184817 3300026035 Bacteria 734
307 Ga0207678_11119000 3300026067 Bacteria 697
308 Ga0207708_10060986 3300026075 Bacteria 2880
309 Ga0207702_10276719 3300026078 Bacteria 1585
310 Ga0207641_10348720 3300026088 Bacteria 1410
311 Ga0207641_10686188 3300026088 Bacteria 1008
312 Ga0207641_10756125 3300026088 Bacteria 960
313 Ga0207648_10001881 3300026089 Bacteria 22939
314 Ga0207648_10700121 3300026089 Bacteria 939
315 Ga0207674_10012133 3300026116 Bacteria 9646
316 Ga0207675_100108998 3300026118 Bacteria 2612
317 Ga0207675_100129152 3300026118 Bacteria 2396
318 Ga0207675_102132083 3300026118 Bacteria 577
319 Ga0207675_102639985 3300026118 Bacteria 511
320 Ga0207683_10117063 3300026121 Bacteria 2389
321 Ga0207683_10190810 3300026121 Bacteria 1860
322 Ga0207683_10292878 3300026121 Bacteria 1488
323 Ga0207683_10670941 3300026121 Bacteria 961
324 Ga0207683_11127833 3300026121 Bacteria 727
325 Ga0207683_11300064 3300026121 Bacteria 673
326 Ga0207698_10006949 3300026142 Bacteria 7081
327 Ga0207698_10025705 3300026142 Bacteria 4153
328 Ga0207698_11594042 3300026142 Bacteria 668
329 Ga0207698_11607555 3300026142 Bacteria 665
330 Ga0209813_10036844 3300027866 Bacteria 1471
331 Ga0209813_10158459 3300027866 Bacteria 815
332 Ga0209974_10109697 3300027876 Bacteria 970
333 Ga0207428_10812987 3300027907 Bacteria 664
334 Ga0268266_10384216 3300028379 Bacteria 1325
335 Ga0268266_11135718 3300028379 Bacteria 756
336 Ga0268265_10074500 3300028380 Bacteria 2656
337 Ga0268264_10013754 3300028381 Bacteria 6657
338 Ga0268264_10253172 3300028381 Bacteria 1637
339 Ga0268264_10303209 3300028381 Bacteria 1504
340 Ga0268264_10360349 3300028381 Bacteria 1387
341 Ga0268264_11151944 3300028381 Bacteria 784
342 Ga0265336_10090124 3300028666 Bacteria 914
343 Ga0307517_10246098 3300028786 Bacteria 1055
344 Ga0265338_10332200 3300028800 Bacteria 1097
345 Ga0307511_10255834 3300030521 Bacteria 836
346 Ga0265332_10132881 3300031238 Bacteria 1044
347 Ga0265327_10015167 3300031251 Bacteria 4992
348 Ga0265327_10262440 3300031251 Bacteria 767
349 Ga0316576_10016489 3300031727 Bacteria 4992
350 Ga0316576_10040102 3300031727 Bacteria 3364
351 Ga0307413_10109343 3300031824 Bacteria 1847
352 Ga0307410_10177680 3300031852 Bacteria 1609
353 Ga0307406_10356537 3300031901 Bacteria 1145
354 Ga0307406_11617326 3300031901 Bacteria 573
355 Ga0307407_10062203 3300031903 Bacteria 2185
356 Ga0307409_100073841 3300031995 Bacteria 2722
357 Ga0307409_101265183 3300031995 Bacteria 762
358 Ga0307409_102580193 3300031995 Bacteria 537
359 Ga0307416_100064441 3300032002 Bacteria 3006
360 Ga0307416_101438689 3300032002 Bacteria 795
361 Ga0307414_10062910 3300032004 Bacteria 2636
362 Ga0307411_10177273 3300032005 Bacteria 1614
363 Ga0307415_100018782 3300032126 Bacteria 4184
364 Ga0307415_101169261 3300032126 Bacteria 723
365 Ga0307415_102508661 3300032126 Bacteria 508
366 Ga0316586_1023161 3300033527 Bacteria 1036
367 Ga0316588_1041174 3300033528 Bacteria 1105
368 Ga0316596_1167585 3300033541 Bacteria 606
369 Ga0373928_0116483 3300035084 Bacteria 712
370 Ga0373939_0408981 3300035114 Bacteria 564
371 Ga0316574_0082309 3300035398 Bacteria 2045
372 Ga0316574_0089117 3300035398 Bacteria 1965
373 Ga0316574_1004733 3300035398 Bacteria 502
374 Ga0373931_0531833 3300035691 Bacteria 762
375 Ga0373937_0089966 3300036401 Bacteria 2843
376 Ga0373937_1133462 3300036401 Bacteria 731
377 Ga0316582_0888452 3300036647 Bacteria 610
378 Ga0395899_0115845 3300037312 Bacteria 1923
379 Ga0395900_0551420 3300037418 Bacteria 1097
380 Ga0400485_06262 3300038735 Bacteria 2633
381 Ga0400485_06361 3300038735 Bacteria 5598
382 Ga0400483_019575 3300039062 Bacteria 12255
383 Ga0400483_062577 3300039062 Bacteria 66463
384 Ga0400483_070374 3300039062 Bacteria 4276
385 Ga0400483_079933 3300039062 Bacteria 1210
386 Ga0400483_107240 3300039062 Bacteria 3042
387 Ga0400483_187753 3300039062 Bacteria 2230
388 Ga0400483_221805 3300039062 Bacteria 5716
389 Ga0400483_276618 3300039062 Bacteria 37892
390 Ga0436365_1462521 3300039437 Bacteria 553
391 Ga0436365_1835801 3300039437 Bacteria 3488
392 Ga0439461_0052532 3300041410 Bacteria 907
393 Ga0451791_0845433 3300041451 Bacteria 605
394 Ga0451791_1294454 3300041451 Bacteria 834
395 Ga0451791_1479030 3300041451 Bacteria 827
396 Ga0451793_0165890 3300041452 Bacteria 550
397 Ga0451793_0436023 3300041452 Bacteria 518
398 Ga0451797_1415934 3300041453 Bacteria 627
399 Ga0451802_1792939 3300041460 Bacteria 781
400 Ga0451805_110221 3300041461 Bacteria 912
401 Ga0451804_0056967 3300041463 Bacteria 708
402 Ga0451807_0176891 3300041486 Bacteria 800
403 Ga0451807_0798528 3300041486 Bacteria 686
404 Ga0451835_0245943 3300041492 Bacteria 551
405 Ga0451835_0601865 3300041492 Bacteria 605
406 Ga0451837_0262273 3300041494 Bacteria 724
407 Ga0451837_1683514 3300041494 Bacteria 594
408 Ga0451841_0363500 3300041498 Bacteria 627
409 Ga0451845_0505134 3300041501 Bacteria 554
410 Ga0451845_0968289 3300041501 Bacteria 656
411 Ga0451849_0543249 3300041505 Bacteria 646
412 Ga0451849_1071886 3300041505 Bacteria 609
413 Ga0451849_1472350 3300041505 Bacteria 573
414 Ga0451851_1254417 3300041507 Bacteria 581
415 Ga0451855_0318411 3300041511 Bacteria 537
416 Ga0451853_0477169 3300041512 Bacteria 903
417 Ga0451853_1444228 3300041512 Bacteria 762
418 Ga0451853_3988779 3300041512 Bacteria 582
419 Ga0439432_253575 3300042006 Bacteria 504
420 Ga0439434_0127790 3300042435 Bacteria 832
421 Ga0451577_0006335 3300042876 Bacteria 11831
422 Ga0466969_0162769 3300044656 Bacteria 1025
423 Ga0466969_0340132 3300044656 Bacteria 679
424 Ga0466965_0699771 3300044683 Bacteria 581
425 Ga0466966_0014201 3300044684 Bacteria 5272
426 Ga0466966_0861327 3300044684 Bacteria 546
427 Ga0466961_0102751 3300044693 Bacteria 1800
428 Ga0466961_0107906 3300044693 Bacteria 1752
429 Ga0466963_0304832 3300044694 Bacteria 1120
430 Ga0466963_1200209 3300044694 Bacteria 533
431 Ga0453684_0041182 3300044712 Bacteria 6254
432 Ga0466971_0253632 3300044719 Bacteria 838
433 Ga0466968_0180498 3300044735 Bacteria 981
434 Ga0466970_0005896 3300044765 Bacteria 6103
435 Ga0466970_0049842 3300044765 Bacteria 2233
436 Ga0466970_0152823 3300044765 Bacteria 1275
437 Ga0466959_0037954 3300045049 Bacteria 3560
438 Ga0451576_1195241 3300045051 Bacteria 794
439 Ga0466958_0574940 3300045836 Bacteria 732
440 Ga0466967_0071512 3300045976 Bacteria 3107
441 Ga0466967_0143596 3300045976 Bacteria 2225
442 Ga0466967_0158475 3300045976 Bacteria 2123
443 Ga0466967_0590264 3300045976 Bacteria 1096
444 Ga0495603_0663204 3300046455 Bacteria 597
445 Ga0495629_0098893 3300046459 Bacteria 2036
446 Ga0495629_0289639 3300046459 Bacteria 1123
447 Ga0495629_0777069 3300046459 Bacteria 633
448 Ga0495641_0018356 3300046461 Bacteria 3612
449 Ga0495641_0208684 3300046461 Bacteria 876
450 Ga0495653_0321710 3300046463 Bacteria 1002
451 Ga0495653_0392602 3300046463 Bacteria 884
452 Ga0495653_0486853 3300046463 Bacteria 771
453 Ga0495582_0685770 3300046473 Bacteria 593
454 Ga0495639_0430621 3300046475 Bacteria 669
455 Ga0495639_0586255 3300046475 Bacteria 573
456 Ga0495596_0196587 3300046500 Bacteria 784
457 Ga0495608_0315763 3300046511 Bacteria 966
458 Ga0495608_0606898 3300046511 Bacteria 656
459 Ga0495618_0198733 3300046514 Bacteria 1269
460 Ga0495630_0307197 3300046517 Bacteria 1212
461 Ga0495630_0877850 3300046517 Bacteria 683
462 Ga0495631_0433215 3300046518 Bacteria 560
463 Ga0495652_0048587 3300046529 Bacteria 3635
464 Ga0495652_0332181 3300046529 Bacteria 1095
465 Ga0495654_0037422 3300046530 Bacteria 2433
466 Ga0495640_0048523 3300046533 Bacteria 2934
467 Ga0495586_0332559 3300046535 Bacteria 872
468 Ga0495586_0600469 3300046535 Bacteria 636
469 Ga0495586_0693516 3300046535 Bacteria 588
470 Ga0495621_0017751 3300046539 Bacteria 2304
471 Ga0495645_0250051 3300046543 Bacteria 1179
472 Ga0495667_0039837 3300046559 Bacteria 3122
473 Ga0495667_0445502 3300046559 Bacteria 814
474 Ga0495634_0009563 3300046642 Bacteria 7145
475 Ga0495634_0442107 3300046642 Bacteria 768
476 Ga0495635_0658134 3300046663 Bacteria 681
477 Ga0495657_0590814 3300046675 Bacteria 643
478 Ga0495646_0138935 3300046680 Bacteria 1360
479 Ga0495647_0241948 3300046681 Bacteria 801
480 Ga0495658_0398852 3300046683 Bacteria 877
481 Ga0495613_0001489 3300046689 Bacteria 17842
482 Ga0495613_0229547 3300046689 Bacteria 1301
483 Ga0495613_0838511 3300046689 Bacteria 598
484 Ga0495613_1047823 3300046689 Bacteria 522
485 Ga0495670_0122944 3300046691 Bacteria 1349
486 Ga0495600_0257741 3300046809 Bacteria 1108
487 Ga0495636_0343330 3300047318 Bacteria 704
488 Ga0495676_0123982 3300047321 Bacteria 1875
489 Ga0495676_0492922 3300047321 Bacteria 805
490 Ga0495680_0111575 3300047322 Bacteria 2026
491 Ga0495680_0168994 3300047322 Bacteria 1584
492 Ga0495684_0183468 3300047471 Bacteria 1550
493 Ga0495614_0028322 3300048089 Bacteria 2414
494 Ga0495614_0092738 3300048089 Bacteria 1315
495 Ga0495626_0010963 3300048091 Bacteria 4813
496 Ga0496100_0656229 3300048903 Bacteria 817
497 Ga0496100_1064826 3300048903 Bacteria 637
498 Ga0496101_0051002 3300048904 Bacteria 2980
499 Ga0496101_0144897 3300048904 Bacteria 1813
500 Ga0496101_0744589 3300048904 Bacteria 773
501 Ga0496101_0774805 3300048904 Bacteria 757
502 Ga0496102_0266087 3300048905 Bacteria 1616
503 Ga0496102_0594256 3300048905 Bacteria 1030
504 Ga0496102_0629277 3300048905 Bacteria 996
505 Ga0496102_1649971 3300048905 Bacteria 559
506 Ga0496103_0014266 3300048906 Bacteria 4718
507 Ga0496103_0426836 3300048906 Bacteria 851
508 Ga0496103_0453571 3300048906 Bacteria 822
509 Ga0496104_0006572 3300048907 Bacteria 10228
510 Ga0496104_0310647 3300048907 Bacteria 1489
511 Ga0496104_0466156 3300048907 Bacteria 1175
512 Ga0496104_0771419 3300048907 Bacteria 868
513 Ga0496105_0060680 3300048908 Bacteria 3121
514 Ga0496107_0028019 3300048910 Bacteria 4003
515 Ga0496108_0079252 3300048911 Bacteria 2781
516 Ga0496108_0321852 3300048911 Bacteria 1348
517 Ga0496108_1397464 3300048911 Bacteria 586
518 Ga0496109_0021601 3300048912 Bacteria 5694
519 Ga0496109_0276262 3300048912 Bacteria 1583
520 Ga0496109_0852804 3300048912 Bacteria 849
521 Ga0496109_0893200 3300048912 Bacteria 826
522 Ga0496110_0018961 3300048913 Bacteria 5781
523 Ga0496110_0048212 3300048913 Bacteria 3734
524 Ga0496110_0056015 3300048913 Bacteria 3469
525 Ga0496110_0308186 3300048913 Bacteria 1442
526 Ga0496110_0372359 3300048913 Bacteria 1301
527 Ga0496111_0011191 3300048914 Bacteria 6039
528 Ga0496111_0193202 3300048914 Bacteria 1513
529 Ga0496111_0339021 3300048914 Bacteria 1113
530 Ga0496111_0557814 3300048914 Bacteria 841
531 Ga0496112_1243108 3300048915 Bacteria 661
532 Ga0496113_0150653 3300048916 Bacteria 1835
533 Ga0496113_0715887 3300048916 Bacteria 798
534 Ga0496114_0070310 3300048917 Bacteria 2939
535 Ga0496114_0196036 3300048917 Bacteria 1768
536 Ga0496114_0568446 3300048917 Bacteria 1001
537 Ga0496114_1673072 3300048917 Bacteria 524
538 Ga0496114_1796818 3300048917 Bacteria 501
539 Ga0496117_0002301 3300048920 Bacteria 24585
540 Ga0496117_0208161 3300048920 Bacteria 1099
541 Ga0496118_0000398 3300048921 Bacteria 73344
542 Ga0496120_0026316 3300048923 Bacteria 3594
543 Ga0496121_0285829 3300048924 Bacteria 1126
544 Ga0496122_0077501 3300048925 Bacteria 2333
545 Ga0496124_0000198 3300048927 Bacteria 119277
546 Ga0496124_0587174 3300048927 Bacteria 727
547 Ga0496126_0720862 3300048929 Bacteria 773
548 Ga0501306_031568 3300049127 Bacteria 789
549 Ga0501307_094394 3300049162 Bacteria 503
550 Ga0501317_008623 3300049533 Bacteria 1179
551 Ga0501317_090304 3300049533 Bacteria 541
552 Ga0501318_022032 3300049534 Bacteria 814
553 Ga0501321_049387 3300049537 Bacteria 612
554 Ga0501323_009786 3300049539 Bacteria 1134
555 Ga0501031_0078677 3300049568 Bacteria 2149
556 Ga0501031_0095908 3300049568 Bacteria 1935
557 Ga0501031_0168707 3300049568 Bacteria 1430
558 Ga0501031_0663727 3300049568 Bacteria 670
559 Ga0501031_0710764 3300049568 Bacteria 645
560 Ga0501031_0823011 3300049568 Bacteria 595
561 Ga0501032_0148041 3300049569 Bacteria 1545
562 Ga0501032_0365870 3300049569 Bacteria 928
563 Ga0501032_0816659 3300049569 Bacteria 588
564 Ga0501033_0040917 3300049570 Bacteria 3459
565 Ga0501033_0062501 3300049570 Bacteria 2742
566 Ga0501033_0413423 3300049570 Bacteria 940
567 Ga0501033_0417228 3300049570 Bacteria 935
568 Ga0501033_0752794 3300049570 Bacteria 661
569 Ga0501034_0017765 3300049571 Bacteria 7295
570 Ga0501034_0035215 3300049571 Bacteria 5076
571 Ga0501034_0206738 3300049571 Bacteria 1919
572 Ga0501034_0770542 3300049571 Bacteria 856
573 Ga0501036_0000223 3300049572 Bacteria 37983
574 Ga0501036_0058464 3300049572 Bacteria 3266
575 Ga0501036_0217596 3300049572 Bacteria 1604
576 Ga0501036_0294038 3300049572 Bacteria 1359
577 Ga0501037_0107394 3300049573 Bacteria 2011
578 Ga0501037_0138143 3300049573 Bacteria 1745
579 Ga0501037_0193470 3300049573 Bacteria 1440
580 Ga0501037_0557239 3300049573 Bacteria 773
581 Ga0501037_0727679 3300049573 Bacteria 659
582 Ga0501038_0124687 3300049574 Bacteria 2121
583 Ga0501038_0379603 3300049574 Bacteria 1096
584 Ga0501038_0380153 3300049574 Bacteria 1096
585 Ga0501038_0529934 3300049574 Bacteria 898
586 Ga0501038_0762502 3300049574 Bacteria 721
587 Ga0501038_1148030 3300049574 Bacteria 566
588 Ga0501039_0115292 3300049575 Bacteria 2103
589 Ga0501039_0133440 3300049575 Bacteria 1949
590 Ga0501039_0224369 3300049575 Bacteria 1477
591 Ga0501039_0232205 3300049575 Bacteria 1450
592 Ga0501039_0360436 3300049575 Bacteria 1142
593 Ga0501039_0576546 3300049575 Bacteria 882
594 Ga0501039_1174646 3300049575 Bacteria 594
595 Ga0501039_1215833 3300049575 Bacteria 582
596 Ga0501039_1320919 3300049575 Bacteria 556
597 Ga0501039_1363017 3300049575 Bacteria 546
598 Ga0501040_0086604 3300049576 Bacteria 2175
599 Ga0501040_0089968 3300049576 Bacteria 2133
600 Ga0501040_0146086 3300049576 Bacteria 1667
601 Ga0501040_0163278 3300049576 Bacteria 1575
602 Ga0501040_0362766 3300049576 Bacteria 1038
603 Ga0501040_0845796 3300049576 Bacteria 662
604 Ga0501040_0880884 3300049576 Bacteria 648
605 Ga0501041_0147283 3300049577 Bacteria 1469
606 Ga0501041_0506146 3300049577 Bacteria 768
607 Ga0501041_0975478 3300049577 Bacteria 545
608 Ga0501042_0003829 3300049578 Bacteria 9514
609 Ga0501042_0009238 3300049578 Bacteria 6560
610 Ga0501042_0061495 3300049578 Bacteria 2683
611 Ga0501042_0131331 3300049578 Bacteria 1805
612 Ga0501042_0205320 3300049578 Bacteria 1421
613 Ga0501042_0232394 3300049578 Bacteria 1330
614 Ga0501042_0241742 3300049578 Bacteria 1303
615 Ga0501042_0247480 3300049578 Bacteria 1286
616 Ga0501042_0265203 3300049578 Bacteria 1240
617 Ga0501043_0003898 3300049579 Bacteria 12246
618 Ga0501043_0122507 3300049579 Bacteria 2040
619 Ga0501043_0605646 3300049579 Bacteria 809
620 Ga0501043_0706670 3300049579 Bacteria 736
621 Ga0501043_1135123 3300049579 Bacteria 551
622 Ga0501046_0253700 3300049580 Bacteria 1294
623 Ga0501046_0681063 3300049580 Bacteria 725
624 Ga0501046_0689941 3300049580 Bacteria 720
625 Ga0501046_1195543 3300049580 Bacteria 522
626 Ga0501047_0010508 3300049581 Bacteria 8758
627 Ga0501047_0014681 3300049581 Bacteria 7453
628 Ga0501047_0066449 3300049581 Bacteria 3476
629 Ga0501047_0171928 3300049581 Bacteria 2035
630 Ga0501047_0441416 3300049581 Bacteria 1131
631 Ga0501048_0005452 3300049582 Bacteria 9676
632 Ga0501048_0067535 3300049582 Bacteria 2527
633 Ga0501048_0100252 3300049582 Bacteria 2043
634 Ga0501048_0293468 3300049582 Bacteria 1156
635 Ga0501048_0329511 3300049582 Bacteria 1088
636 Ga0501048_0671801 3300049582 Bacteria 744
637 Ga0501048_0749760 3300049582 Bacteria 701
638 Ga0501048_0835747 3300049582 Bacteria 662
639 Ga0501048_1219584 3300049582 Bacteria 541
640 Ga0501048_1366180 3300049582 Bacteria 509
641 Ga0501067_0138218 3300049583 Bacteria 1356
642 Ga0501068_0272892 3300049584 Bacteria 1080
643 Ga0501068_0548944 3300049584 Bacteria 751
644 Ga0501068_0670415 3300049584 Bacteria 677
645 Ga0501069_0000038 3300049585 Bacteria 82519
646 Ga0501069_0141962 3300049585 Bacteria 1378
647 Ga0501069_0765725 3300049585 Bacteria 584
648 Ga0501070_0000008 3300049586 Bacteria 199963
649 Ga0501071_0006588 3300049587 Bacteria 7543
650 Ga0501071_0038309 3300049587 Bacteria 3426
651 Ga0501071_0063678 3300049587 Bacteria 2674
652 Ga0501071_0073250 3300049587 Bacteria 2498
653 Ga0501071_0094162 3300049587 Bacteria 2203
654 Ga0501071_0238632 3300049587 Bacteria 1370
655 Ga0501071_0304080 3300049587 Bacteria 1209
656 Ga0501071_0974088 3300049587 Bacteria 655
657 Ga0501072_0015618 3300049588 Bacteria 5820
658 Ga0501072_0077106 3300049588 Bacteria 2638
659 Ga0501072_0196397 3300049588 Bacteria 1609
660 Ga0501072_0226447 3300049588 Bacteria 1490
661 Ga0501072_0321276 3300049588 Bacteria 1230
662 Ga0501072_0456963 3300049588 Bacteria 1011
663 Ga0501072_1256724 3300049588 Bacteria 574
664 Ga0501073_0009467 3300049589 Bacteria 7192
665 Ga0501073_0745104 3300049589 Bacteria 676
666 Ga0501073_1278719 3300049589 Bacteria 503
667 Ga0501074_0025039 3300049590 Bacteria 4335
668 Ga0501074_0045420 3300049590 Bacteria 3179
669 Ga0501074_0089392 3300049590 Bacteria 2206
670 Ga0501074_0139799 3300049590 Bacteria 1732
671 Ga0501074_0394819 3300049590 Bacteria 981
672 Ga0501074_0459661 3300049590 Bacteria 902
673 Ga0501074_0662781 3300049590 Bacteria 737
674 Ga0501075_0017990 3300049591 Bacteria 5108
675 Ga0501075_0056123 3300049591 Bacteria 2965
676 Ga0501075_0082384 3300049591 Bacteria 2437
677 Ga0501075_1214737 3300049591 Bacteria 572
678 Ga0501076_0025897 3300049592 Bacteria 4541
679 Ga0501076_0036298 3300049592 Bacteria 3862
680 Ga0501076_0111372 3300049592 Bacteria 2212
681 Ga0501076_0164835 3300049592 Bacteria 1806
682 Ga0501076_0477159 3300049592 Bacteria 1028
683 Ga0501076_0595383 3300049592 Bacteria 912
684 Ga0501076_0603588 3300049592 Bacteria 905
685 Ga0501077_0049133 3300049593 Bacteria 2681
686 Ga0501077_0092340 3300049593 Bacteria 1918
687 Ga0501077_0230710 3300049593 Bacteria 1177
688 Ga0501077_0292214 3300049593 Bacteria 1038
689 Ga0501077_0310981 3300049593 Bacteria 1004
690 Ga0501077_0313853 3300049593 Bacteria 999
691 Ga0501077_0321267 3300049593 Bacteria 987
692 Ga0501077_0465953 3300049593 Bacteria 809
693 Ga0501077_0541008 3300049593 Bacteria 747
694 Ga0501079_0126176 3300049741 Bacteria 1991
695 Ga0501079_0142462 3300049741 Bacteria 1867
696 Ga0501079_0292298 3300049741 Bacteria 1274
697 Ga0501079_0320496 3300049741 Bacteria 1213
698 Ga0501079_1111386 3300049741 Bacteria 623
699 Ga0501080_0226881 3300049742 Bacteria 1708
700 Ga0501080_0418059 3300049742 Bacteria 1205
701 Ga0501080_0586244 3300049742 Bacteria 991
702 Ga0501080_0786235 3300049742 Bacteria 835
703 Ga0501081_0094466 3300049743 Bacteria 2107
704 Ga0501081_0160374 3300049743 Bacteria 1620
705 Ga0501081_1354961 3300049743 Bacteria 540
706 Ga0501083_0000056 3300049744 Bacteria 82115
707 Ga0501083_0023147 3300049744 Bacteria 4310
708 Ga0501083_0121157 3300049744 Bacteria 1716
709 Ga0501083_0602576 3300049744 Bacteria 715
710 Ga0501083_0749349 3300049744 Bacteria 635
711 Ga0501035_0138500 3300049822 Bacteria 2117
712 Ga0501035_0207076 3300049822 Bacteria 1680
713 Ga0501035_0420581 3300049822 Bacteria 1109
714 Ga0501035_0470405 3300049822 Bacteria 1038
715 Ga0501044_0025919 3300049823 Bacteria 6214
716 Ga0501044_0472342 3300049823 Bacteria 1158
717 Ga0501044_0787565 3300049823 Bacteria 831
718 Ga0501044_0817604 3300049823 Bacteria 810
719 Ga0501044_0888674 3300049823 Bacteria 766
720 Ga0501044_1005726 3300049823 Bacteria 705
721 Ga0501044_1198583 3300049823 Bacteria 627
722 Ga0501045_0012381 3300049824 Bacteria 6009
723 Ga0501045_0069254 3300049824 Bacteria 2593
724 Ga0501045_0111985 3300049824 Bacteria 2024
725 Ga0501045_0122361 3300049824 Bacteria 1932
726 Ga0501045_0246641 3300049824 Bacteria 1329
727 Ga0501045_0328713 3300049824 Bacteria 1138
728 Ga0501045_0382400 3300049824 Bacteria 1048
729 Ga0501045_0849822 3300049824 Bacteria 671
730 Ga0501045_1039593 3300049824 Bacteria 600
731 nmdc:mga03n38_245938_c1 3300050490 Bacteria 943
732 nmdc:mga03n38_511575_c1 3300050490 Bacteria 675
733 nmdc:mga00v17_149218_c1 3300050491 Bacteria 1502
734 nmdc:mga00v17_172939_c1 3300050491 Bacteria 1393
735 nmdc:mga00v17_263640_c1 3300050491 Bacteria 1118
736 nmdc:mga00v17_340115_c1 3300050491 Bacteria 976
737 nmdc:mga00v17_378384_c1 3300050491 Bacteria 920
738 nmdc:mga00v17_4837_c1 3300050491 Bacteria 7055
739 nmdc:mga00v17_522206_c1 3300050491 Bacteria 769
740 nmdc:mga00v17_560605_c1 3300050491 Bacteria 738
741 nmdc:mga00v17_627148_c1 3300050491 Bacteria 692
742 nmdc:mga00v17_723362_c1 3300050491 Bacteria 637
743 nmdc:mga00v17_727043_c1 3300050491 Bacteria 635
744 nmdc:mga00v17_73579_c1 3300050491 Bacteria 2122
745 nmdc:mga0yw44_147579_c1 3300050492 Bacteria 1532
746 nmdc:mga0yw44_196920_c1 3300050492 Bacteria 1330
747 nmdc:mga0yw44_19952_c1 3300050492 Bacteria 3709
748 nmdc:mga0yw44_383417_c1 3300050492 Bacteria 949
749 nmdc:mga0yw44_65147_c1 3300050492 Bacteria 2245
750 nmdc:mga0yw44_68041_c1 3300050492 Bacteria 2202
751 nmdc:mga0yw44_735969_c1 3300050492 Bacteria 670
752 nmdc:mga0yw44_906276_c1 3300050492 Bacteria 598
753 nmdc:mga0k408_267632_c1 3300050493 Bacteria 1020
754 nmdc:mga0k408_597611_c1 3300050493 Bacteria 651
755 nmdc:mga06z11_167781_c1 3300050494 Bacteria 1259
756 nmdc:mga06z11_18130_c2 3300050494 Bacteria 2558
757 nmdc:mga06z11_900198_c1 3300050494 Bacteria 539
758 nmdc:mga04h51_353649_c1 3300050495 Bacteria 608
759 nmdc:mga07m45_400231_c1 3300050496 Bacteria 797
760 nmdc:mga07m45_412001_c1 3300050496 Bacteria 784
761 nmdc:mga0qj67_665993_c1 3300050509 Bacteria 830
762 nmdc:mga08y16_1132125_c1 3300050511 Bacteria 756
763 nmdc:mga08y16_1394663_c1 3300050511 Bacteria 664
764 nmdc:mga08y16_224681_c1 3300050511 Bacteria 1943
765 nmdc:mga08y16_387756_c1 3300050511 Bacteria 1431
766 nmdc:mga0n895_152962_c1 3300050512 Bacteria 2337
767 nmdc:mga0n895_1714569_c1 3300050512 Bacteria 590
768 nmdc:mga0n895_910679_c1 3300050512 Bacteria 864
769 Ga0495601_0738153 3300053077 Bacteria 627
770 Ga0495595_0315510 3300053084 Bacteria 787
771 Ga0495619_0100603 3300053085 Bacteria 1967
772 Ga0495619_0546426 3300053085 Bacteria 795
773 Ga0495619_0770324 3300053085 Bacteria 652
774 Ga0500651_0000647 3300053093 Bacteria 17374
775 Ga0500566_0408176 3300053094 Bacteria 606
776 Ga0500641_0034698 3300053096 Bacteria 2009
777 Ga0500628_061715 3300053129 Bacteria 917
778 Ga0500568_0000124 3300053139 Bacteria 68924
779 Ga0500568_0043443 3300053139 Bacteria 1796
780 Ga0500616_0001103 3300053153 Bacteria 27941
781 Ga0500620_000139 3300053155 Bacteria 14617
782 Ga0500636_0172452 3300053177 Bacteria 1169
783 Ga0501084_0045842 3300054114 Bacteria 3660
784 Ga0501084_0085745 3300054114 Bacteria 2644
785 Ga0501084_0241990 3300054114 Bacteria 1523
786 Ga0501084_0620194 3300054114 Bacteria 913
787 Ga0587070_138886 3300059491 Bacteria 598
788 Ga0587082_064438 3300059504 Bacteria 730
789 Ga0587101_059799 3300059623 Bacteria 678
790 Ga0587128_063274 3300059630 Bacteria 704
791 Ga0587079_188345 3300059647 Bacteria 556
792 Ga0501082_0040716 3300060353 Bacteria 4007
793 Ga0501082_0082984 3300060353 Bacteria 2765
794 Ga0501082_0227020 3300060353 Bacteria 1625
795 Ga0501082_0321004 3300060353 Bacteria 1349
796 Ga0501082_0553690 3300060353 Bacteria 1006
797 Ga0501082_0859111 3300060353 Bacteria 794
798 Ga0501082_1712035 3300060353 Bacteria 549
799 Ga0530510_0012558 3300061734 Bacteria 5953
800 Ga0530510_0014569 3300061734 Bacteria 5547
801 Ga0530510_0034009 3300061734 Bacteria 3671
802 Ga0530510_0187892 3300061734 Bacteria 1533
803 Ga0530510_0509611 3300061734 Bacteria 912
804 Ga0530510_1207952 3300061734 Bacteria 580
805 Ga0530510_1408175 3300061734 Bacteria 535
806 2753303416 2751185788 Bacteria 4541048
807 2904431492 2904430863 Bacteria 3486923
808 2904504818 2904501621 Bacteria 3401437
809 2908676365 2908674828 Bacteria 3382763
810 2909077251 2909074476 Bacteria 3436050
811 2919042116 2919039151 Bacteria 3391018
812 2919046171 2919042368 Bacteria 3905917
813 2928106977 2928104781 Bacteria 3877447
814 2928503239 2928500415 Bacteria 3384541
815 2984551720 2984551494 Bacteria 3877562
816 3003002192 3002998708 Bacteria 11715108
817 8053947897 8053945823 Bacteria 8962862
818 Ga0111539_11039336
819 JGI24735J21928_10223505
820 Ga0006759J45824_1045204
821 Ga0007410J51695_1042683
822 Ga0032354_1060619
823 Ga0055542_1012380
824 Ga0058860_11891024
825 Ga0070676_10223078
826 Ga0070690_100036947
827 Ga0070690_101379218
828 Ga0068869_100401736
829 Ga0070666_10698224
830 Ga0068868_100221984
831 Ga0068868_100956193
832 Ga0070660_100027811
833 Ga0070689_100192339
834 Ga0070687_100035663
835 Ga0070661_100222734
836 Ga0070661_100513992
837 Ga0070668_101073740
838 Ga0070668_101123571
839 Ga0070668_101220901
840 Ga0070669_100832015
841 Ga0070675_100764577
842 Ga0070671_100612135
843 Ga0070674_100144558
844 Ga0070674_100552797
845 Ga0070673_100646825
846 Ga0070688_100164962
847 Ga0070659_100428165
848 Ga0070659_101851384
849 Ga0070667_100299775
850 Ga0070667_100344978
851 Ga0070667_100669621
852 Ga0070713_100749778
853 Ga0070701_10974403
854 Ga0070711_101338840
855 Ga0070700_100713608
856 Ga0070678_100125677
857 Ga0070678_100952948
858 Ga0070678_101353050
859 Ga0070678_101398753
860 Ga0068867_100016622
861 Ga0068867_101630288
862 Ga0070685_10069583
863 Ga0070685_10394399
864 Ga0070685_10548384
865 Ga0070706_101222626
866 Ga0070707_100287456
867 Ga0070698_100001494
868 Ga0070684_101125333
869 Ga0070672_101183380
870 Ga0070686_100092096
871 Ga0070695_101354915
872 Ga0070665_100258158
873 Ga0070665_100504883
874 Ga0070665_101710928
875 Ga0068855_101642443
876 Ga0068857_100021181
877 Ga0068857_101930271
878 Ga0068854_100070101
879 Ga0068854_100168565
880 Ga0068856_100222844
881 Ga0068856_100865817
882 Ga0068856_101323809
883 Ga0070702_100037917
884 Ga0068852_100031004
885 Ga0068852_100447838
886 Ga0068852_102295392
887 Ga0068859_100085058
888 Ga0068859_100410777
889 Ga0068859_100539722
890 Ga0068859_100734511
891 Ga0068864_101765345
892 Ga0068861_100108728
893 Ga0068861_100817679
894 Ga0068851_10000124
895 Ga0068863_100156964
896 Ga0068858_100034111
897 Ga0068858_100924813
898 Ga0068858_101396805
899 Ga0068858_102375455
900 Ga0068860_100040814
901 Ga0068860_100070388
902 Ga0068860_100094907
903 Ga0068860_100278853
904 Ga0068862_100115053
905 Ga0081455_10144942
906 Ga0075365_10084336
907 Ga0075365_10125888
908 Ga0075365_10156275
909 Ga0075365_10207513
910 Ga0075365_10279835
911 Ga0075365_10540585
912 Ga0075365_10570161
913 Ga0075365_10834931
914 Ga0075365_11002349
915 Ga0075368_10040254
916 Ga0075368_10087016
917 Ga0075368_10258722
918 Ga0075363_100138741
919 Ga0075363_100184499
920 Ga0075363_100597429
921 Ga0075363_100876006
922 Ga0075364_10019266
923 Ga0075364_10030892
924 Ga0075364_10038123
925 Ga0075364_10140782
926 Ga0075364_10188671
927 Ga0075364_10388778
928 Ga0075364_10565606
929 Ga0075364_10827174
930 Ga0075364_11265062
931 Ga0075432_10144141
932 Ga0070715_10046403
933 Ga0070716_100384944
934 Ga0070712_101134754
935 Ga0075367_10087401
936 Ga0075367_10270885
937 Ga0075367_10459896
938 Ga0075369_10128214
939 Ga0075366_10119971
940 Ga0075366_10155328
941 Ga0097621_100576019
942 Ga0097621_100827471
943 Ga0097621_101185641
944 Ga0075370_10298788
945 Ga0068871_100133823
946 Ga0075428_100324504
947 Ga0075428_101702001
948 Ga0075428_102459656
949 Ga0075430_100457073
950 Ga0075434_100273678
951 Ga0075434_102542850
952 Ga0075429_101158283
953 Ga0068865_100268589
954 Ga0097620_100085058
955 Ga0097620_100410728
956 Ga0097620_100539700
957 Ga0097620_100734507
958 Ga0075435_101417947
959 Ga0075435_101686520
960 Ga0105244_10388806
961 Ga0111539_10085598
962 Ga0111539_10880790
963 Ga0111539_11253304
964 Ga0111539_12562022
965 Ga0105245_10005233
966 Ga0105245_10078330
967 Ga0105245_11061066
968 Ga0105245_11470462
969 Ga0105247_10130555
970 Ga0105247_10307884
971 Ga0105247_10866152
972 Ga0114129_11293662
973 Ga0114129_13403629
974 Ga0105243_10062882
975 Ga0105243_10822867
976 Ga0105243_10952832
977 Ga0105243_12930391
978 Ga0105241_10000211
979 Ga0105241_10482388
980 Ga0105241_11762620
981 Ga0105242_10137321
982 Ga0105242_13218287
983 Ga0105248_10989264
984 Ga0105248_11251656
985 Ga0105248_11253876
986 Ga0105237_10009306
987 Ga0105237_10073447
988 Ga0105238_10001857
989 Ga0105238_10419449
990 Ga0105238_10441729
991 Ga0105238_10887510
992 Ga0105249_10036783
993 Ga0105249_10227571
994 Ga0105249_10969458
995 Ga0105249_11946417
996 Ga0105239_10043054
997 Ga0105239_10290312
998 Ga0105239_11677802
999 Ga0105246_10381192
1000 Ga0105246_10451864
1001 Ga0105246_11073760
1002 Ga0157317_1019760
1003 Ga0157371_10849288
1004 Ga0157374_10423450
1005 Ga0157374_10890878
1006 Ga0157374_10962546
1007 Ga0157378_10087840
1008 Ga0157378_10359266
1009 Ga0157378_10918469
1010 Ga0157378_11763034
1011 Ga0163162_10202231
1012 Ga0163162_10520435
1013 Ga0163162_10570896
1014 Ga0163162_11184058
1015 Ga0163162_11823474
1016 Ga0157375_10428264
1017 Ga0157375_10449426
1018 Ga0157375_11520611
1019 Ga0157375_11900842
1020 Ga0163163_10042923
1021 Ga0163163_10902269
1022 Ga0163163_11457266
1023 Ga0163163_11816609
1024 Ga0163163_12662145
1025 Ga0163163_13133547
1026 Ga0157380_10136736
1027 Ga0157380_10690791
1028 Ga0157380_10978466
1029 Ga0157380_11562600
1030 Ga0157380_11644451
1031 Ga0157380_11778478
1032 Ga0157380_11886077
1033 Ga0157380_12453491
1034 Ga0182008_10508726
1035 Ga0157377_10555738
1036 Ga0157377_10838929
1037 Ga0157377_10989237
1038 Ga0157379_10025736
1039 Ga0157379_10259207
1040 Ga0157379_10615647
1041 Ga0157379_11165672
1042 Ga0157379_11452516
1043 Ga0157376_10258910
1044 Ga0157376_10475926
1045 Ga0157376_11222451
1046 Ga0157376_11991366
1047 Ga0163161_10263950
1048 Ga0206352_11226467
1049 Ga0213876_10017209
1050 Ga0224712_10040393
1051 Ga0209148_1000830
1052 Ga0207666_1013351
1053 Ga0207697_10056277
1054 Ga0207656_10000001
1055 Ga0207656_10000003
1056 Ga0207688_10024151
1057 Ga0207688_10915059
1058 Ga0207680_11343436
1059 Ga0207647_10002805
1060 Ga0207647_10124027
1061 Ga0207685_10003853
1062 Ga0207705_10102074
1063 Ga0207705_10156901
1064 Ga0207684_11265434
1065 Ga0207654_10000003
1066 Ga0207654_10576901
1067 Ga0207695_10026107
1068 Ga0207671_10000001
1069 Ga0207671_10083947
1070 Ga0207662_10010398
1071 Ga0207657_10038914
1072 Ga0207657_10124954
1073 Ga0207649_10258127
1074 Ga0207646_10707835
1075 Ga0207681_10732558
1076 Ga0207694_10000039
1077 Ga0207694_10871439
1078 Ga0207694_11063993
1079 Ga0207659_10414763
1080 Ga0207659_11502299
1081 Ga0207687_10012797
1082 Ga0207687_10627043
1083 Ga0207687_11602965
1084 Ga0207700_11752651
1085 Ga0207664_10151546
1086 Ga0207644_10320057
1087 Ga0207644_11481715
1088 Ga0207644_11601430
1089 Ga0207690_10154066
1090 Ga0207686_10144552
1091 Ga0207709_10672482
1092 Ga0207709_11422537
1093 Ga0207670_10131165
1094 Ga0207670_11793823
1095 Ga0207669_10648612
1096 Ga0207669_11704037
1097 Ga0207704_10085006
1098 Ga0207665_10112774
1099 Ga0207691_10167744
1100 Ga0207711_10632825
1101 Ga0207711_11369395
1102 Ga0207689_10395450
1103 Ga0207679_10136324
1104 Ga0207667_10101515
1105 Ga0207667_11517730
1106 Ga0207651_10436394
1107 Ga0207651_10492906
1108 Ga0207712_10235603
1109 Ga0207668_10286291
1110 Ga0207668_10801097
1111 Ga0207668_11008979
1112 Ga0207668_11636120
1113 Ga0207640_10735082
1114 Ga0207640_11359966
1115 Ga0207658_10399082
1116 Ga0207658_10841752
1117 Ga0207658_11126937
1118 Ga0207658_12015513
1119 Ga0207677_11235712
1120 Ga0207677_11512487
1121 Ga0207703_10023605
1122 Ga0207703_10732185
1123 Ga0207703_11184817
1124 Ga0207678_11119000
1125 Ga0207708_10060986
1126 Ga0207702_10276719
1127 Ga0207641_10348720
1128 Ga0207641_10686188
1129 Ga0207641_10756125
1130 Ga0207648_10001881
1131 Ga0207648_10700121
1132 Ga0207674_10012133
1133 Ga0207675_100108998
1134 Ga0207675_100129152
1135 Ga0207675_102132083
1136 Ga0207675_102639985
1137 Ga0207683_10117063
1138 Ga0207683_10190810
1139 Ga0207683_10292878
1140 Ga0207683_10670941
1141 Ga0207683_11127833
1142 Ga0207683_11300064
1143 Ga0207698_10006949
1144 Ga0207698_10025705
1145 Ga0207698_11594042
1146 Ga0207698_11607555
1147 Ga0209813_10036844
1148 Ga0209813_10158459
1149 Ga0209974_10109697
1150 Ga0207428_10812987
1151 Ga0268266_10384216
1152 Ga0268266_11135718
1153 Ga0268265_10074500
1154 Ga0268264_10013754
1155 Ga0268264_10253172
1156 Ga0268264_10303209
1157 Ga0268264_10360349
1158 Ga0268264_11151944
1159 Ga0265336_10090124
1160 Ga0307517_10246098
1161 Ga0265338_10332200
1162 Ga0307511_10255834
1163 Ga0265332_10132881
1164 Ga0265327_10015167
1165 Ga0265327_10262440
1166 Ga0316576_10016489
1167 Ga0316576_10040102
1168 Ga0307413_10109343
1169 Ga0307410_10177680
1170 Ga0307406_10356537
1171 Ga0307406_11617326
1172 Ga0307407_10062203
1173 Ga0307409_100073841
1174 Ga0307409_101265183
1175 Ga0307409_102580193
1176 Ga0307416_100064441
1177 Ga0307416_101438689
1178 Ga0307414_10062910
1179 Ga0307411_10177273
1180 Ga0307415_100018782
1181 Ga0307415_101169261
1182 Ga0307415_102508661
1183 Ga0316586_1023161
1184 Ga0316588_1041174
1185 Ga0316596_1167585
1186 Ga0373928_0116483
1187 Ga0373939_0408981
1188 Ga0316574_0082309
1189 Ga0316574_0089117
1190 Ga0316574_1004733
1191 Ga0373931_0531833
1192 Ga0373937_0089966
1193 Ga0373937_1133462
1194 Ga0316582_0888452
1195 Ga0395899_0115845
1196 Ga0395900_0551420
1197 Ga0400485_06262
1198 Ga0400485_06361
1199 Ga0400483_019575
1200 Ga0400483_062577
1201 Ga0400483_070374
1202 Ga0400483_079933
1203 Ga0400483_107240
1204 Ga0400483_187753
1205 Ga0400483_221805
1206 Ga0400483_276618
1207 Ga0436365_1462521
1208 Ga0436365_1835801
1209 Ga0439461_0052532
1210 Ga0451791_0845433
1211 Ga0451791_1294454
1212 Ga0451791_1479030
1213 Ga0451793_0165890
1214 Ga0451793_0436023
1215 Ga0451797_1415934
1216 Ga0451802_1792939
1217 Ga0451805_110221
1218 Ga0451804_0056967
1219 Ga0451807_0176891
1220 Ga0451807_0798528
1221 Ga0451835_0245943
1222 Ga0451835_0601865
1223 Ga0451837_0262273
1224 Ga0451837_1683514
1225 Ga0451841_0363500
1226 Ga0451845_0505134
1227 Ga0451845_0968289
1228 Ga0451849_0543249
1229 Ga0451849_1071886
1230 Ga0451849_1472350
1231 Ga0451851_1254417
1232 Ga0451855_0318411
1233 Ga0451853_0477169
1234 Ga0451853_1444228
1235 Ga0451853_3988779
1236 Ga0439432_253575
1237 Ga0439434_0127790
1238 Ga0451577_0006335
1239 Ga0466969_0162769
1240 Ga0466969_0340132
1241 Ga0466965_0699771
1242 Ga0466966_0014201
1243 Ga0466966_0861327
1244 Ga0466961_0102751
1245 Ga0466961_0107906
1246 Ga0466963_0304832
1247 Ga0466963_1200209
1248 Ga0453684_0041182
1249 Ga0466971_0253632
1250 Ga0466968_0180498
1251 Ga0466970_0005896
1252 Ga0466970_0049842
1253 Ga0466970_0152823
1254 Ga0466959_0037954
1255 Ga0451576_1195241
1256 Ga0466958_0574940
1257 Ga0466967_0071512
1258 Ga0466967_0143596
1259 Ga0466967_0158475
1260 Ga0466967_0590264
1261 Ga0495603_0663204
1262 Ga0495629_0098893
1263 Ga0495629_0289639
1264 Ga0495629_0777069
1265 Ga0495641_0018356
1266 Ga0495641_0208684
1267 Ga0495653_0321710
1268 Ga0495653_0392602
1269 Ga0495653_0486853
1270 Ga0495582_0685770
1271 Ga0495639_0430621
1272 Ga0495639_0586255
1273 Ga0495596_0196587
1274 Ga0495608_0315763
1275 Ga0495608_0606898
1276 Ga0495618_0198733
1277 Ga0495630_0307197
1278 Ga0495630_0877850
1279 Ga0495631_0433215
1280 Ga0495652_0048587
1281 Ga0495652_0332181
1282 Ga0495654_0037422
1283 Ga0495640_0048523
1284 Ga0495586_0332559
1285 Ga0495586_0600469
1286 Ga0495586_0693516
1287 Ga0495621_0017751
1288 Ga0495645_0250051
1289 Ga0495667_0039837
1290 Ga0495667_0445502
1291 Ga0495634_0009563
1292 Ga0495634_0442107
1293 Ga0495635_0658134
1294 Ga0495657_0590814
1295 Ga0495646_0138935
1296 Ga0495647_0241948
1297 Ga0495658_0398852
1298 Ga0495613_0001489
1299 Ga0495613_0229547
1300 Ga0495613_0838511
1301 Ga0495613_1047823
1302 Ga0495670_0122944
1303 Ga0495600_0257741
1304 Ga0495636_0343330
1305 Ga0495676_0123982
1306 Ga0495676_0492922
1307 Ga0495680_0111575
1308 Ga0495680_0168994
1309 Ga0495684_0183468
1310 Ga0495614_0028322
1311 Ga0495614_0092738
1312 Ga0495626_0010963
1313 Ga0496100_0656229
1314 Ga0496100_1064826
1315 Ga0496101_0051002
1316 Ga0496101_0144897
1317 Ga0496101_0744589
1318 Ga0496101_0774805
1319 Ga0496102_0266087
1320 Ga0496102_0594256
1321 Ga0496102_0629277
1322 Ga0496102_1649971
1323 Ga0496103_0014266
1324 Ga0496103_0426836
1325 Ga0496103_0453571
1326 Ga0496104_0006572
1327 Ga0496104_0310647
1328 Ga0496104_0466156
1329 Ga0496104_0771419
1330 Ga0496105_0060680
1331 Ga0496107_0028019
1332 Ga0496108_0079252
1333 Ga0496108_0321852
1334 Ga0496108_1397464
1335 Ga0496109_0021601
1336 Ga0496109_0276262
1337 Ga0496109_0852804
1338 Ga0496109_0893200
1339 Ga0496110_0018961
1340 Ga0496110_0048212
1341 Ga0496110_0056015
1342 Ga0496110_0308186
1343 Ga0496110_0372359
1344 Ga0496111_0011191
1345 Ga0496111_0193202
1346 Ga0496111_0339021
1347 Ga0496111_0557814
1348 Ga0496112_1243108
1349 Ga0496113_0150653
1350 Ga0496113_0715887
1351 Ga0496114_0070310
1352 Ga0496114_0196036
1353 Ga0496114_0568446
1354 Ga0496114_1673072
1355 Ga0496114_1796818
1356 Ga0496117_0002301
1357 Ga0496117_0208161
1358 Ga0496118_0000398
1359 Ga0496120_0026316
1360 Ga0496121_0285829
1361 Ga0496122_0077501
1362 Ga0496124_0000198
1363 Ga0496124_0587174
1364 Ga0496126_0720862
1365 Ga0501306_031568
1366 Ga0501307_094394
1367 Ga0501317_008623
1368 Ga0501317_090304
1369 Ga0501318_022032
1370 Ga0501321_049387
1371 Ga0501323_009786
1372 Ga0501031_0078677
1373 Ga0501031_0095908
1374 Ga0501031_0168707
1375 Ga0501031_0663727
1376 Ga0501031_0710764
1377 Ga0501031_0823011
1378 Ga0501032_0148041
1379 Ga0501032_0365870
1380 Ga0501032_0816659
1381 Ga0501033_0040917
1382 Ga0501033_0062501
1383 Ga0501033_0413423
1384 Ga0501033_0417228
1385 Ga0501033_0752794
1386 Ga0501034_0017765
1387 Ga0501034_0035215
1388 Ga0501034_0206738
1389 Ga0501034_0770542
1390 Ga0501036_0000223
1391 Ga0501036_0058464
1392 Ga0501036_0217596
1393 Ga0501036_0294038
1394 Ga0501037_0107394
1395 Ga0501037_0138143
1396 Ga0501037_0193470
1397 Ga0501037_0557239
1398 Ga0501037_0727679
1399 Ga0501038_0124687
1400 Ga0501038_0379603
1401 Ga0501038_0380153
1402 Ga0501038_0529934
1403 Ga0501038_0762502
1404 Ga0501038_1148030
1405 Ga0501039_0115292
1406 Ga0501039_0133440
1407 Ga0501039_0224369
1408 Ga0501039_0232205
1409 Ga0501039_0360436
1410 Ga0501039_0576546
1411 Ga0501039_1174646
1412 Ga0501039_1215833
1413 Ga0501039_1320919
1414 Ga0501039_1363017
1415 Ga0501040_0086604
1416 Ga0501040_0089968
1417 Ga0501040_0146086
1418 Ga0501040_0163278
1419 Ga0501040_0362766
1420 Ga0501040_0845796
1421 Ga0501040_0880884
1422 Ga0501041_0147283
1423 Ga0501041_0506146
1424 Ga0501041_0975478
1425 Ga0501042_0003829
1426 Ga0501042_0009238
1427 Ga0501042_0061495
1428 Ga0501042_0131331
1429 Ga0501042_0205320
1430 Ga0501042_0232394
1431 Ga0501042_0241742
1432 Ga0501042_0247480
1433 Ga0501042_0265203
1434 Ga0501043_0003898
1435 Ga0501043_0122507
1436 Ga0501043_0605646
1437 Ga0501043_0706670
1438 Ga0501043_1135123
1439 Ga0501046_0253700
1440 Ga0501046_0681063
1441 Ga0501046_0689941
1442 Ga0501046_1195543
1443 Ga0501047_0010508
1444 Ga0501047_0014681
1445 Ga0501047_0066449
1446 Ga0501047_0171928
1447 Ga0501047_0441416
1448 Ga0501048_0005452
1449 Ga0501048_0067535
1450 Ga0501048_0100252
1451 Ga0501048_0293468
1452 Ga0501048_0329511
1453 Ga0501048_0671801
1454 Ga0501048_0749760
1455 Ga0501048_0835747
1456 Ga0501048_1219584
1457 Ga0501048_1366180
1458 Ga0501067_0138218
1459 Ga0501068_0272892
1460 Ga0501068_0548944
1461 Ga0501068_0670415
1462 Ga0501069_0000038
1463 Ga0501069_0141962
1464 Ga0501069_0765725
1465 Ga0501070_0000008
1466 Ga0501071_0006588
1467 Ga0501071_0038309
1468 Ga0501071_0063678
1469 Ga0501071_0073250
1470 Ga0501071_0094162
1471 Ga0501071_0238632
1472 Ga0501071_0304080
1473 Ga0501071_0974088
1474 Ga0501072_0015618
1475 Ga0501072_0077106
1476 Ga0501072_0196397
1477 Ga0501072_0226447
1478 Ga0501072_0321276
1479 Ga0501072_0456963
1480 Ga0501072_1256724
1481 Ga0501073_0009467
1482 Ga0501073_0745104
1483 Ga0501073_1278719
1484 Ga0501074_0025039
1485 Ga0501074_0045420
1486 Ga0501074_0089392
1487 Ga0501074_0139799
1488 Ga0501074_0394819
1489 Ga0501074_0459661
1490 Ga0501074_0662781
1491 Ga0501075_0017990
1492 Ga0501075_0056123
1493 Ga0501075_0082384
1494 Ga0501075_1214737
1495 Ga0501076_0025897
1496 Ga0501076_0036298
1497 Ga0501076_0111372
1498 Ga0501076_0164835
1499 Ga0501076_0477159
1500 Ga0501076_0595383
1501 Ga0501076_0603588
1502 Ga0501077_0049133
1503 Ga0501077_0092340
1504 Ga0501077_0230710
1505 Ga0501077_0292214
1506 Ga0501077_0310981
1507 Ga0501077_0313853
1508 Ga0501077_0321267
1509 Ga0501077_0465953
1510 Ga0501077_0541008
1511 Ga0501079_0126176
1512 Ga0501079_0142462
1513 Ga0501079_0292298
1514 Ga0501079_0320496
1515 Ga0501079_1111386
1516 Ga0501080_0226881
1517 Ga0501080_0418059
1518 Ga0501080_0586244
1519 Ga0501080_0786235
1520 Ga0501081_0094466
1521 Ga0501081_0160374
1522 Ga0501081_1354961
1523 Ga0501083_0000056
1524 Ga0501083_0023147
1525 Ga0501083_0121157
1526 Ga0501083_0602576
1527 Ga0501083_0749349
1528 Ga0501035_0138500
1529 Ga0501035_0207076
1530 Ga0501035_0420581
1531 Ga0501035_0470405
1532 Ga0501044_0025919
1533 Ga0501044_0472342
1534 Ga0501044_0787565
1535 Ga0501044_0817604
1536 Ga0501044_0888674
1537 Ga0501044_1005726
1538 Ga0501044_1198583
1539 Ga0501045_0012381
1540 Ga0501045_0069254
1541 Ga0501045_0111985
1542 Ga0501045_0122361
1543 Ga0501045_0246641
1544 Ga0501045_0328713
1545 Ga0501045_0382400
1546 Ga0501045_0849822
1547 Ga0501045_1039593
1548 nmdc:mga03n38_245938_c1
1549 nmdc:mga03n38_511575_c1
1550 nmdc:mga00v17_149218_c1
1551 nmdc:mga00v17_172939_c1
1552 nmdc:mga00v17_263640_c1
1553 nmdc:mga00v17_340115_c1
1554 nmdc:mga00v17_378384_c1
1555 nmdc:mga00v17_4837_c1
1556 nmdc:mga00v17_522206_c1
1557 nmdc:mga00v17_560605_c1
1558 nmdc:mga00v17_627148_c1
1559 nmdc:mga00v17_723362_c1
1560 nmdc:mga00v17_727043_c1
1561 nmdc:mga00v17_73579_c1
1562 nmdc:mga0yw44_147579_c1
1563 nmdc:mga0yw44_196920_c1
1564 nmdc:mga0yw44_19952_c1
1565 nmdc:mga0yw44_383417_c1
1566 nmdc:mga0yw44_65147_c1
1567 nmdc:mga0yw44_68041_c1
1568 nmdc:mga0yw44_735969_c1
1569 nmdc:mga0yw44_906276_c1
1570 nmdc:mga0k408_267632_c1
1571 nmdc:mga0k408_597611_c1
1572 nmdc:mga06z11_167781_c1
1573 nmdc:mga06z11_18130_c2
1574 nmdc:mga06z11_900198_c1
1575 nmdc:mga04h51_353649_c1
1576 nmdc:mga07m45_400231_c1
1577 nmdc:mga07m45_412001_c1
1578 nmdc:mga0qj67_665993_c1
1579 nmdc:mga08y16_1132125_c1
1580 nmdc:mga08y16_1394663_c1
1581 nmdc:mga08y16_224681_c1
1582 nmdc:mga08y16_387756_c1
1583 nmdc:mga0n895_152962_c1
1584 nmdc:mga0n895_1714569_c1
1585 nmdc:mga0n895_910679_c1
1586 Ga0495601_0738153
1587 Ga0495595_0315510
1588 Ga0495619_0100603
1589 Ga0495619_0546426
1590 Ga0495619_0770324
1591 Ga0500651_0000647
1592 Ga0500566_0408176
1593 Ga0500641_0034698
1594 Ga0500628_061715
1595 Ga0500568_0000124
1596 Ga0500568_0043443
1597 Ga0500616_0001103
1598 Ga0500620_000139
1599 Ga0500636_0172452
1600 Ga0501084_0045842
1601 Ga0501084_0085745
1602 Ga0501084_0241990
1603 Ga0501084_0620194
1604 Ga0587070_138886
1605 Ga0587082_064438
1606 Ga0587101_059799
1607 Ga0587128_063274
1608 Ga0587079_188345
1609 Ga0501082_0040716
1610 Ga0501082_0082984
1611 Ga0501082_0227020
1612 Ga0501082_0321004
1613 Ga0501082_0553690
1614 Ga0501082_0859111
1615 Ga0501082_1712035
1616 Ga0530510_0012558
1617 Ga0530510_0014569
1618 Ga0530510_0034009
1619 Ga0530510_0187892
1620 Ga0530510_0509611
1621 Ga0530510_1207952
1622 Ga0530510_1408175
1623 2753303416
1624 2904431492
1625 2904504818
1626 2908676365
1627 2909077251
1628 2919042116
1629 2919046171
1630 2928106977
1631 2928503239
1632 2984551720
1633 3003002192
1634 8053947897

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8767 61 117
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8691 51 117
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.847 51 117
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.826 61 117
6xyw-assembly1.cif.gz_Aq structure of the plant mitochondrial ribosome 0.743 17 117
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9295 53 120 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9038 53 120 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8978 58 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8767 61 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.826 61 117 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.011 61 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6EM08-F1-model_v4 deleted 1.007 57 115
AF-A0A659UR08-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.006 56 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7X7PKE9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.005 60 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2D8YKH1-F1-model_v4 deleted 1.003 58 117

Map