F482061

General Info

Members Datasets Scaffolds Average Seq Length
816 390 1632 251

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10134688|Ga0265314_101346881
Length 273
Sequence VTRYGILPLRELLKGPGSMSEFAMTRRWVAHFVLLAGSIMLVTFGGSAAGAEPRAVVELFTSQGCSSCPPADEVLGELARDPSLIVMSLPIDYWDYLGWKDTLALHGHSNRQRAYAGKRGDREVYTPQAVVNGGIQVLGSDKAAIEQAVSQSRKNAAALALPVKMSVSGDKLTVDVPPAKDANASGEIWLCPVTKSIPVAIGRGENSGHTITYTNVVRRWTKLGDWSGKAETFSVSLADLKAQPDVDAVVVVVQSGVASAPGTMLGASMIALP

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
126 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
127 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
236 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
237 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
238 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
239 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
240 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
362 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
383 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
389 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
390 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.37
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 5.39
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10134688 3300031711 Bacteria 1536
2 ARSoilYngRDRAFT_c00021 3300000042 Bacteria 23635
3 ARcpr5yngRDRAFT_c000027 3300000043 Bacteria 23992
4 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
5 ARCol0yngRDRAFT_1000041 3300000652 Bacteria 21726
6 JGI24747J21853_1000183 3300001978 Bacteria 3241
7 JGI24739J22299_10005787 3300001989 Bacteria 4682
8 JGI24737J22298_10001847 3300001990 Bacteria 7571
9 JGI24737J22298_10006747 3300001990 Bacteria 3902
10 JGI24750J21931_1000142 3300002070 Bacteria 11648
11 JGI24750J21931_1001110 3300002070 Bacteria 3476
12 JGI24748J21848_1000808 3300002074 Bacteria 3395
13 JGI24748J21848_1001711 3300002074 Bacteria 2434
14 JGI24738J21930_10000905 3300002075 Bacteria 8522
15 JGI24749J21850_1000294 3300002076 Bacteria 7674
16 JGI24033J26618_1016921 3300002155 Bacteria 909
17 JGI24034J26672_10006012 3300002239 Bacteria 1748
18 JGI24742J22300_10000099 3300002244 Bacteria 12894
19 JGI25405J52794_10013882 3300003911 Bacteria 1568
20 Ga0065716_1000040 3300005277 Bacteria 4354
21 Ga0065704_10004119 3300005289 Bacteria 6170
22 Ga0065712_10071076 3300005290 Bacteria 5501
23 Ga0065715_10008744 3300005293 Bacteria 3892
24 Ga0065715_10096350 3300005293 Bacteria 3895
25 Ga0065715_10132182 3300005293 Bacteria 1995
26 Ga0065707_10089334 3300005295 Bacteria 4399
27 Ga0070658_10014581 3300005327 Bacteria 6307
28 Ga0070658_10071567 3300005327 Bacteria 2840
29 Ga0070658_10079050 3300005327 Bacteria 2700
30 Ga0070676_10001608 3300005328 Bacteria 11482
31 Ga0070683_100011295 3300005329 Bacteria 7711
32 Ga0070683_100144457 3300005329 Bacteria 2254
33 Ga0070690_100010948 3300005330 Bacteria 5294
34 Ga0070690_100467979 3300005330 Bacteria 937
35 Ga0070670_100023266 3300005331 Bacteria 5333
36 Ga0070670_100125197 3300005331 Bacteria 2218
37 Ga0070670_100168164 3300005331 Bacteria 1901
38 Ga0070677_10000023 3300005333 Bacteria 44929
39 Ga0068869_100000506 3300005334 Bacteria 21724
40 Ga0070666_10006394 3300005335 Bacteria 7246
41 Ga0070666_10010969 3300005335 Bacteria 5678
42 Ga0070680_100044745 3300005336 Bacteria 3597
43 Ga0070680_100418244 3300005336 Bacteria 1143
44 Ga0070680_100479132 3300005336 Bacteria 1064
45 Ga0070682_100006324 3300005337 Bacteria 6647
46 Ga0070682_100053204 3300005337 Bacteria 2536
47 Ga0070682_100169834 3300005337 Bacteria 1514
48 Ga0070682_100517472 3300005337 Bacteria 928
49 Ga0068868_100001933 3300005338 Bacteria 14224
50 Ga0068868_100017336 3300005338 Bacteria 5363
51 Ga0070660_100002712 3300005339 Bacteria 12162
52 Ga0070660_100054043 3300005339 Bacteria 3099
53 Ga0070660_100220389 3300005339 Bacteria 1542
54 Ga0070689_100031082 3300005340 Bacteria 4057
55 Ga0070689_100044712 3300005340 Bacteria 3407
56 Ga0070689_100146616 3300005340 Bacteria 1901
57 Ga0070691_10000519 3300005341 Bacteria 14524
58 Ga0070691_10092803 3300005341 Bacteria 1490
59 Ga0070691_10107808 3300005341 Bacteria 1390
60 Ga0070687_100223559 3300005343 Bacteria 1154
61 Ga0070661_100000642 3300005344 Bacteria 25881
62 Ga0070661_100064609 3300005344 Bacteria 2689
63 Ga0070661_100113890 3300005344 Bacteria 2021
64 Ga0070692_10020265 3300005345 Bacteria 3223
65 Ga0070668_100006825 3300005347 Bacteria 8463
66 Ga0070669_100020361 3300005353 Bacteria 4738
67 Ga0070669_100191524 3300005353 Bacteria 1604
68 Ga0070675_100037370 3300005354 Bacteria 3955
69 Ga0070675_100054329 3300005354 Bacteria 3295
70 Ga0070675_100090998 3300005354 Bacteria 2555
71 Ga0070671_100025653 3300005355 Bacteria 4838
72 Ga0070671_100227252 3300005355 Bacteria 1583
73 Ga0070674_100076664 3300005356 Bacteria 2377
74 Ga0070673_100000278 3300005364 Bacteria 26473
75 Ga0070673_100014342 3300005364 Bacteria 5514
76 Ga0070688_100006105 3300005365 Bacteria 6404
77 Ga0070688_100020959 3300005365 Bacteria 3810
78 Ga0070688_100029178 3300005365 Bacteria 3301
79 Ga0070659_100045148 3300005366 Bacteria 3451
80 Ga0070659_100281817 3300005366 Bacteria 1383
81 Ga0070659_100428966 3300005366 Bacteria 1119
82 Ga0070667_100040188 3300005367 Bacteria 3922
83 Ga0070667_100171103 3300005367 Bacteria 1917
84 Ga0070703_10023920 3300005406 Bacteria 1801
85 Ga0070714_100293244 3300005435 Bacteria 1514
86 Ga0070713_100063418 3300005436 Bacteria 3098
87 Ga0070710_10026339 3300005437 Bacteria 3088
88 Ga0070710_10050238 3300005437 Bacteria 2337
89 Ga0070710_10082156 3300005437 Bacteria 1883
90 Ga0070710_10430115 3300005437 Bacteria 891
91 Ga0070701_10011763 3300005438 Bacteria 3927
92 Ga0070701_10037157 3300005438 Bacteria 2457
93 Ga0070711_100065094 3300005439 Bacteria 2548
94 Ga0070711_100079572 3300005439 Bacteria 2331
95 Ga0070705_100009695 3300005440 Bacteria 4796
96 Ga0070705_100137444 3300005440 Bacteria 1603
97 Ga0070700_100010776 3300005441 Bacteria 5052
98 Ga0070700_100021413 3300005441 Bacteria 3758
99 Ga0070694_100041610 3300005444 Bacteria 3066
100 Ga0070694_100042140 3300005444 Bacteria 3048
101 Ga0070708_100179517 3300005445 Bacteria 1978
102 Ga0070663_100015966 3300005455 Bacteria 4862
103 Ga0070663_100272296 3300005455 Bacteria 1346
104 Ga0070678_100004531 3300005456 Bacteria 7889
105 Ga0070678_100104117 3300005456 Bacteria 2206
106 Ga0070678_100164005 3300005456 Bacteria 1803
107 Ga0070662_100009569 3300005457 Bacteria 6341
108 Ga0070662_100039290 3300005457 Bacteria 3365
109 Ga0070681_10025370 3300005458 Bacteria 5962
110 Ga0070681_10065393 3300005458 Bacteria 3605
111 Ga0070681_10097886 3300005458 Bacteria 2880
112 Ga0070681_10172575 3300005458 Bacteria 2084
113 Ga0068867_100040790 3300005459 Bacteria 3390
114 Ga0070685_10030650 3300005466 Bacteria 2999
115 Ga0070698_100499050 3300005471 Bacteria 1155
116 Ga0074259_10038675 3300005507 Bacteria 1306
117 Ga0070699_100281154 3300005518 Bacteria 1490
118 Ga0070679_100033457 3300005530 Bacteria 5090
119 Ga0070679_100109068 3300005530 Bacteria 2754
120 Ga0070679_100158514 3300005530 Bacteria 2237
121 Ga0070679_100194793 3300005530 Bacteria 1994
122 Ga0070679_100390113 3300005530 Bacteria 1339
123 Ga0070684_100002161 3300005535 Bacteria 14516
124 Ga0070684_100134227 3300005535 Bacteria 2234
125 Ga0070684_100470560 3300005535 Bacteria 1162
126 Ga0068853_100066953 3300005539 Bacteria 3119
127 Ga0068853_100069902 3300005539 Bacteria 3055
128 Ga0070672_100006797 3300005543 Bacteria 7724
129 Ga0070686_100005470 3300005544 Bacteria 7033
130 Ga0070686_100110403 3300005544 Bacteria 1872
131 Ga0070686_100159719 3300005544 Bacteria 1586
132 Ga0070695_100012913 3300005545 Bacteria 5014
133 Ga0070696_100023870 3300005546 Bacteria 4155
134 Ga0070696_100075483 3300005546 Bacteria 2378
135 Ga0070693_100034019 3300005547 Bacteria 2817
136 Ga0070693_100103660 3300005547 Bacteria 1737
137 Ga0070665_100101455 3300005548 Bacteria 2882
138 Ga0070704_100028912 3300005549 Bacteria 3694
139 Ga0068855_100082175 3300005563 Bacteria 3734
140 Ga0068855_100348230 3300005563 Bacteria 1632
141 Ga0068855_100385345 3300005563 Bacteria 1538
142 Ga0068855_100503773 3300005563 Bacteria 1315
143 Ga0070664_100000846 3300005564 Bacteria 23623
144 Ga0070664_100505264 3300005564 Bacteria 1114
145 Ga0068857_100039702 3300005577 Bacteria 4170
146 Ga0068854_100009664 3300005578 Bacteria 6230
147 Ga0068854_100019255 3300005578 Bacteria 4596
148 Ga0068856_100084736 3300005614 Bacteria 3148
149 Ga0068856_100087666 3300005614 Bacteria 3094
150 Ga0068856_100091273 3300005614 Bacteria 3030
151 Ga0068856_100094639 3300005614 Bacteria 2974
152 Ga0068856_100199065 3300005614 Bacteria 2018
153 Ga0070702_100000331 3300005615 Bacteria 16452
154 Ga0070702_100057919 3300005615 Bacteria 2242
155 Ga0070702_100144241 3300005615 Bacteria 1520
156 Ga0068852_100004590 3300005616 Bacteria 9779
157 Ga0068852_100234492 3300005616 Bacteria 1751
158 Ga0068852_100400882 3300005616 Bacteria 1349
159 Ga0068859_100157875 3300005617 Bacteria 2346
160 Ga0068859_100256496 3300005617 Bacteria 1839
161 Ga0068859_100430755 3300005617 Bacteria 1415
162 Ga0068859_100472485 3300005617 Bacteria 1349
163 Ga0068864_100011552 3300005618 Bacteria 7294
164 Ga0068866_10000992 3300005718 Bacteria 12484
165 Ga0068861_100004265 3300005719 Bacteria 9581
166 Ga0068851_10124094 3300005834 Bacteria 1391
167 Ga0068870_10000696 3300005840 Bacteria 12871
168 Ga0068863_100046017 3300005841 Bacteria 4141
169 Ga0068858_100051515 3300005842 Bacteria 3808
170 Ga0068858_100416039 3300005842 Bacteria 1292
171 Ga0068860_100044954 3300005843 Bacteria 4209
172 Ga0068860_100050821 3300005843 Bacteria 3945
173 Ga0068860_100053916 3300005843 Bacteria 3822
174 Ga0068862_100011106 3300005844 Bacteria 7437
175 Ga0081455_10000002 3300005937 Bacteria 460472
176 Ga0081455_10017267 3300005937 Bacteria 6926
177 Ga0081455_10253823 3300005937 Bacteria 1284
178 Ga0070717_10025318 3300006028 Bacteria 4717
179 Ga0070717_10059178 3300006028 Bacteria 3169
180 Ga0075432_10014321 3300006058 Bacteria 2702
181 Ga0070716_100010729 3300006173 Bacteria 4603
182 Ga0070712_100184418 3300006175 Bacteria 1628
183 Ga0075367_10062201 3300006178 Bacteria 2229
184 Ga0097621_100001689 3300006237 Bacteria 15113
185 Ga0097621_100107776 3300006237 Bacteria 2351
186 Ga0097621_100364250 3300006237 Bacteria 1288
187 Ga0097621_100659715 3300006237 Bacteria 960
188 Ga0075370_10095841 3300006353 Bacteria 1714
189 Ga0068871_100000443 3300006358 Bacteria 28545
190 Ga0068871_100024238 3300006358 Bacteria 4702
191 Ga0075433_10259248 3300006852 Bacteria 1542
192 Ga0075433_10331600 3300006852 Bacteria 1345
193 Ga0075433_10331982 3300006852 Bacteria 1345
194 Ga0075433_10476520 3300006852 Bacteria 1100
195 Ga0075434_100009740 3300006871 Bacteria 8981
196 Ga0075434_100022246 3300006871 Bacteria 6175
197 Ga0075434_100031847 3300006871 Bacteria 5200
198 Ga0075434_100426462 3300006871 Bacteria 1347
199 Ga0075434_100489718 3300006871 Bacteria 1250
200 Ga0075434_100769425 3300006871 Bacteria 979
201 Ga0068865_100001680 3300006881 Bacteria 12959
202 Ga0068865_100277779 3300006881 Bacteria 1332
203 Ga0075436_100018122 3300006914 Bacteria 4822
204 Ga0097620_100157895 3300006931 Bacteria 2346
205 Ga0097620_100256477 3300006931 Bacteria 1839
206 Ga0097620_100430746 3300006931 Bacteria 1415
207 Ga0097620_100472461 3300006931 Bacteria 1349
208 Ga0075435_100059606 3300007076 Bacteria 3094
209 Ga0075435_100359752 3300007076 Bacteria 1248
210 Ga0105251_10053310 3300009011 Bacteria 1923
211 Ga0105244_10032811 3300009036 Bacteria 2744
212 Ga0105240_10195268 3300009093 Bacteria 2377
213 Ga0105240_10274731 3300009093 Bacteria 1939
214 Ga0111539_10005235 3300009094 Bacteria 16804
215 Ga0111539_10252290 3300009094 Bacteria 2054
216 Ga0111539_10256878 3300009094 Bacteria 2034
217 Ga0105245_10000460 3300009098 Bacteria 37264
218 Ga0105247_10020798 3300009101 Bacteria 3946
219 Ga0105247_10368519 3300009101 Bacteria 1015
220 Ga0114129_10001035 3300009147 Bacteria 36374
221 Ga0105243_10034038 3300009148 Bacteria 3942
222 Ga0105243_10137560 3300009148 Bacteria 2080
223 Ga0105243_10205262 3300009148 Bacteria 1731
224 Ga0105241_10008878 3300009174 Bacteria 7394
225 Ga0105241_10226074 3300009174 Bacteria 1576
226 Ga0105242_10001231 3300009176 Bacteria 20194
227 Ga0105242_10033075 3300009176 Bacteria 4139
228 Ga0105242_10722289 3300009176 Bacteria 977
229 Ga0105248_10009565 3300009177 Bacteria 10670
230 Ga0105248_10091610 3300009177 Bacteria 3423
231 Ga0105248_10205318 3300009177 Bacteria 2220
232 Ga0105237_10030366 3300009545 Bacteria 5489
233 Ga0105237_10369938 3300009545 Bacteria 1438
234 Ga0105237_10819977 3300009545 Bacteria 937
235 Ga0105238_10071931 3300009551 Bacteria 3455
236 Ga0105238_10208513 3300009551 Bacteria 1930
237 Ga0105238_10525338 3300009551 Bacteria 1186
238 Ga0105249_10037606 3300009553 Bacteria 4392
239 Ga0105249_10046689 3300009553 Bacteria 3942
240 Ga0105239_10235239 3300010375 Bacteria 2056
241 Ga0105239_10384740 3300010375 Bacteria 1586
242 Ga0105239_10426025 3300010375 Bacteria 1504
243 Ga0105246_10013513 3300011119 Bacteria 5120
244 Ga0105246_10543757 3300011119 Bacteria 994
245 Ga0157325_1001276 3300012485 Bacteria 1128
246 Ga0157335_1000256 3300012492 Bacteria 2297
247 Ga0157338_1003754 3300012515 Bacteria 1278
248 Ga0157371_10031292 3300013102 Bacteria 3833
249 Ga0157371_10040528 3300013102 Bacteria 3326
250 Ga0157371_10095437 3300013102 Bacteria 2108
251 Ga0157370_10233089 3300013104 Bacteria 1704
252 Ga0157369_10369730 3300013105 Bacteria 1488
253 Ga0157374_10003098 3300013296 Bacteria 13954
254 Ga0157378_10002912 3300013297 Bacteria 15232
255 Ga0157378_10190914 3300013297 Bacteria 1932
256 Ga0157378_10295152 3300013297 Bacteria 1567
257 Ga0163162_10001590 3300013306 Bacteria 21243
258 Ga0163162_10097939 3300013306 Bacteria 3022
259 Ga0157372_10084167 3300013307 Bacteria 3604
260 Ga0157372_10818115 3300013307 Bacteria 1082
261 Ga0157375_10007289 3300013308 Bacteria 9678
262 Ga0157375_10043245 3300013308 Bacteria 4367
263 Ga0157375_10353733 3300013308 Bacteria 1635
264 Ga0163163_10009244 3300014325 Bacteria 8791
265 Ga0163163_10010204 3300014325 Bacteria 8432
266 Ga0157380_10016411 3300014326 Bacteria 5462
267 Ga0157380_10171246 3300014326 Bacteria 1898
268 Ga0157377_10000342 3300014745 Bacteria 20734
269 Ga0157379_10044765 3300014968 Bacteria 3950
270 Ga0157379_10126761 3300014968 Bacteria 2297
271 Ga0157379_10304072 3300014968 Bacteria 1454
272 Ga0157376_10002255 3300014969 Bacteria 13007
273 Ga0157376_10408208 3300014969 Bacteria 1315
274 Ga0157376_10755106 3300014969 Bacteria 982
275 Ga0157376_10766477 3300014969 Bacteria 975
276 Ga0163161_10005528 3300017792 Bacteria 8755
277 Ga0163161_10204275 3300017792 Bacteria 1524
278 Ga0206356_11646989 3300020070 Bacteria 1124
279 Ga0206350_10150836 3300020080 Bacteria 779
280 Ga0206353_11202059 3300020082 Bacteria 1187
281 Ga0209233_1007607 3300025261 Bacteria 3417
282 Ga0207666_1000023 3300025271 Bacteria 37093
283 Ga0207666_1005505 3300025271 Bacteria 1619
284 Ga0207673_1000080 3300025290 Bacteria 8372
285 Ga0207697_10007068 3300025315 Bacteria 5027
286 Ga0207656_10025921 3300025321 Bacteria 2385
287 Ga0207655_1034352 3300025728 Bacteria 2281
288 Ga0207713_1079211 3300025735 Bacteria 1187
289 Ga0207653_10112319 3300025885 Bacteria 974
290 Ga0207682_10000011 3300025893 Bacteria 85533
291 Ga0207682_10085753 3300025893 Bacteria 1357
292 Ga0207682_10116199 3300025893 Bacteria 1182
293 Ga0207692_10001380 3300025898 Bacteria 9075
294 Ga0207692_10010398 3300025898 Bacteria 3920
295 Ga0207642_10000936 3300025899 Bacteria 9137
296 Ga0207642_10205994 3300025899 Bacteria 1090
297 Ga0207710_10007090 3300025900 Bacteria 4755
298 Ga0207710_10017453 3300025900 Bacteria 3044
299 Ga0207688_10000212 3300025901 Bacteria 25999
300 Ga0207680_10201934 3300025903 Bacteria 1355
301 Ga0207647_10014085 3300025904 Bacteria 5526
302 Ga0207647_10043046 3300025904 Bacteria 2828
303 Ga0207685_10089032 3300025905 Bacteria 1295
304 Ga0207699_10387363 3300025906 Bacteria 993
305 Ga0207645_10000788 3300025907 Bacteria 26477
306 Ga0207643_10000284 3300025908 Bacteria 35172
307 Ga0207705_10082630 3300025909 Bacteria 2343
308 Ga0207705_10170745 3300025909 Bacteria 1637
309 Ga0207654_10077215 3300025911 Bacteria 1996
310 Ga0207654_10099294 3300025911 Bacteria 1791
311 Ga0207707_10001938 3300025912 Bacteria 18823
312 Ga0207707_10034613 3300025912 Bacteria 4419
313 Ga0207707_10259244 3300025912 Bacteria 1509
314 Ga0207695_10051370 3300025913 Bacteria 4329
315 Ga0207671_10019417 3300025914 Bacteria 5196
316 Ga0207693_10031869 3300025915 Bacteria 4164
317 Ga0207693_10065935 3300025915 Bacteria 2835
318 Ga0207663_10005850 3300025916 Bacteria 6236
319 Ga0207663_10236652 3300025916 Bacteria 1337
320 Ga0207660_10002700 3300025917 Bacteria 11629
321 Ga0207660_10077798 3300025917 Bacteria 2429
322 Ga0207660_10140061 3300025917 Bacteria 1849
323 Ga0207660_10407188 3300025917 Bacteria 1096
324 Ga0207662_10027974 3300025918 Bacteria 3257
325 Ga0207662_10029533 3300025918 Bacteria 3177
326 Ga0207657_10016256 3300025919 Bacteria 7182
327 Ga0207657_10039620 3300025919 Bacteria 4185
328 Ga0207657_10049489 3300025919 Bacteria 3661
329 Ga0207657_10073209 3300025919 Bacteria 2896
330 Ga0207657_10104201 3300025919 Bacteria 2350
331 Ga0207657_10340329 3300025919 Bacteria 1184
332 Ga0207649_10000057 3300025920 Bacteria 102314
333 Ga0207649_10062252 3300025920 Bacteria 2352
334 Ga0207649_10085474 3300025920 Bacteria 2053
335 Ga0207649_10192483 3300025920 Bacteria 1435
336 Ga0207652_10014944 3300025921 Bacteria 6296
337 Ga0207652_10040322 3300025921 Bacteria 3965
338 Ga0207652_10066797 3300025921 Bacteria 3117
339 Ga0207652_10067249 3300025921 Bacteria 3107
340 Ga0207681_10000181 3300025923 Bacteria 51755
341 Ga0207681_10182307 3300025923 Bacteria 1600
342 Ga0207694_10020971 3300025924 Bacteria 4946
343 Ga0207694_10119491 3300025924 Bacteria 2103
344 Ga0207694_10119970 3300025924 Bacteria 2099
345 Ga0207694_10474284 3300025924 Bacteria 1046
346 Ga0207650_10001418 3300025925 Bacteria 17264
347 Ga0207650_10029858 3300025925 Bacteria 3922
348 Ga0207650_10368754 3300025925 Bacteria 1184
349 Ga0207659_10000028 3300025926 Bacteria 130804
350 Ga0207659_10105186 3300025926 Bacteria 2135
351 Ga0207659_10288783 3300025926 Bacteria 1343
352 Ga0207687_10000061 3300025927 Bacteria 84113
353 Ga0207687_10004282 3300025927 Bacteria 9534
354 Ga0207687_10314835 3300025927 Bacteria 1265
355 Ga0207700_10002284 3300025928 Bacteria 10999
356 Ga0207700_10002842 3300025928 Bacteria 9962
357 Ga0207700_10014813 3300025928 Bacteria 5121
358 Ga0207664_10068191 3300025929 Bacteria 2857
359 Ga0207644_10004970 3300025931 Bacteria 8672
360 Ga0207644_10043465 3300025931 Bacteria 3188
361 Ga0207690_10018421 3300025932 Bacteria 4282
362 Ga0207706_10008724 3300025933 Bacteria 9338
363 Ga0207706_10011033 3300025933 Bacteria 8236
364 Ga0207706_10074782 3300025933 Bacteria 2979
365 Ga0207686_10001777 3300025934 Bacteria 11991
366 Ga0207686_10113169 3300025934 Bacteria 1834
367 Ga0207686_10180828 3300025934 Bacteria 1495
368 Ga0207709_10000539 3300025935 Bacteria 32486
369 Ga0207709_10125584 3300025935 Bacteria 1740
370 Ga0207709_10175644 3300025935 Bacteria 1508
371 Ga0207709_10394278 3300025935 Bacteria 1057
372 Ga0207670_10030779 3300025936 Bacteria 3430
373 Ga0207669_10000290 3300025937 Bacteria 23055
374 Ga0207669_10142718 3300025937 Bacteria 1665
375 Ga0207669_10477019 3300025937 Bacteria 993
376 Ga0207704_10000767 3300025938 Bacteria 14133
377 Ga0207665_10001292 3300025939 Bacteria 16913
378 Ga0207665_10053272 3300025939 Bacteria 2727
379 Ga0207665_10099263 3300025939 Bacteria 2030
380 Ga0207665_10156925 3300025939 Bacteria 1634
381 Ga0207691_10015068 3300025940 Bacteria 7357
382 Ga0207691_10076580 3300025940 Bacteria 3015
383 Ga0207691_10311296 3300025940 Bacteria 1351
384 Ga0207711_10001580 3300025941 Bacteria 21028
385 Ga0207711_10004107 3300025941 Bacteria 12478
386 Ga0207689_10009011 3300025942 Bacteria 8641
387 Ga0207689_10044113 3300025942 Bacteria 3686
388 Ga0207661_10000215 3300025944 Bacteria 37435
389 Ga0207661_10688982 3300025944 Bacteria 940
390 Ga0207679_10000026 3300025945 Bacteria 200073
391 Ga0207679_10327054 3300025945 Bacteria 1329
392 Ga0207667_10013064 3300025949 Bacteria 9532
393 Ga0207667_10071139 3300025949 Bacteria 3618
394 Ga0207667_10137307 3300025949 Bacteria 2517
395 Ga0207667_10263796 3300025949 Bacteria 1761
396 Ga0207667_10279355 3300025949 Bacteria 1706
397 Ga0207667_10364414 3300025949 Bacteria 1474
398 Ga0207667_10580240 3300025949 Bacteria 1132
399 Ga0207651_10000173 3300025960 Bacteria 27970
400 Ga0207651_10053392 3300025960 Bacteria 2762
401 Ga0207712_10002375 3300025961 Bacteria 12203
402 Ga0207712_10041263 3300025961 Bacteria 3171
403 Ga0207712_10192976 3300025961 Bacteria 1609
404 Ga0207668_10000474 3300025972 Bacteria 25172
405 Ga0207668_10645472 3300025972 Bacteria 926
406 Ga0207640_10000711 3300025981 Bacteria 19295
407 Ga0207658_10001541 3300025986 Bacteria 17874
408 Ga0207658_10041830 3300025986 Bacteria 3320
409 Ga0207677_10001215 3300026023 Bacteria 13903
410 Ga0207677_10160283 3300026023 Bacteria 1747
411 Ga0207677_10241219 3300026023 Bacteria 1462
412 Ga0207703_10035422 3300026035 Bacteria 3967
413 Ga0207703_10055937 3300026035 Bacteria 3211
414 Ga0207703_10259169 3300026035 Bacteria 1571
415 Ga0207639_10047916 3300026041 Bacteria 3232
416 Ga0207678_10003797 3300026067 Bacteria 13581
417 Ga0207678_10033410 3300026067 Bacteria 4482
418 Ga0207678_10043676 3300026067 Bacteria 3878
419 Ga0207678_10071190 3300026067 Bacteria 2982
420 Ga0207708_10028909 3300026075 Bacteria 4198
421 Ga0207708_10033766 3300026075 Bacteria 3889
422 Ga0207708_10033935 3300026075 Bacteria 3880
423 Ga0207702_10068315 3300026078 Bacteria 3052
424 Ga0207702_10074986 3300026078 Bacteria 2921
425 Ga0207702_10482583 3300026078 Bacteria 1206
426 Ga0207702_10519568 3300026078 Bacteria 1162
427 Ga0207641_10004378 3300026088 Bacteria 12242
428 Ga0207648_10044632 3300026089 Bacteria 3889
429 Ga0207648_10103484 3300026089 Bacteria 2497
430 Ga0207676_10005845 3300026095 Bacteria 8692
431 Ga0207674_10019430 3300026116 Bacteria 7357
432 Ga0207674_10050566 3300026116 Bacteria 4245
433 Ga0207674_10103635 3300026116 Bacteria 2824
434 Ga0207675_100005898 3300026118 Bacteria 11692
435 Ga0207675_100074537 3300026118 Bacteria 3176
436 Ga0207683_10000034 3300026121 Bacteria 101817
437 Ga0207683_10017963 3300026121 Bacteria 6031
438 Ga0207683_10151755 3300026121 Bacteria 2091
439 Ga0207698_10013171 3300026142 Bacteria 5445
440 Ga0207698_10049402 3300026142 Bacteria 3201
441 Ga0209999_1026311 3300027543 Bacteria 1076
442 Ga0209971_1005758 3300027682 Bacteria 2934
443 Ga0209966_1001532 3300027695 Bacteria 4019
444 Ga0209998_10002856 3300027717 Bacteria 3879
445 Ga0209998_10003854 3300027717 Bacteria 3242
446 Ga0209974_10052714 3300027876 Bacteria 1369
447 Ga0209974_10065785 3300027876 Bacteria 1231
448 Ga0207428_10000352 3300027907 Bacteria 59444
449 Ga0207428_10001235 3300027907 Bacteria 27417
450 Ga0268266_10015219 3300028379 Bacteria 6606
451 Ga0268266_10155093 3300028379 Bacteria 2067
452 Ga0268265_10030643 3300028380 Bacteria 3876
453 Ga0268264_10001465 3300028381 Bacteria 22046
454 Ga0268264_10039996 3300028381 Bacteria 3874
455 Ga0265318_10096531 3300028577 Bacteria 1088
456 Ga0265338_10081650 3300028800 Bacteria 2710
457 Ga0265330_10021951 3300031235 Bacteria 2909
458 Ga0265325_10003668 3300031241 Bacteria 9941
459 Ga0265325_10005464 3300031241 Bacteria 7838
460 Ga0265340_10037662 3300031247 Bacteria 2395
461 Ga0265339_10122916 3300031249 Bacteria 1332
462 Ga0265339_10128477 3300031249 Bacteria 1298
463 Ga0265316_10167960 3300031344 Bacteria 1638
464 Ga0265316_10315356 3300031344 Bacteria 1137
465 Ga0265313_10000593 3300031595 Bacteria 37608
466 Ga0265313_10003067 3300031595 Bacteria 13857
467 Ga0265313_10035067 3300031595 Bacteria 2530
468 Ga0265313_10043776 3300031595 Bacteria 2189
469 Ga0265314_10001067 3300031711 Bacteria 31824
470 Ga0265314_10001306 3300031711 Bacteria 28247
471 Ga0265342_10001920 3300031712 Bacteria 18672
472 Ga0307415_100584524 3300032126 Bacteria 991
473 Ga0373930_0000032 3300034816 Bacteria 12363
474 Ga0373930_0013978 3300034816 Bacteria 1488
475 Ga0373930_0050245 3300034816 Bacteria 909
476 Ga0373948_0007262 3300034817 Bacteria 1858
477 Ga0373948_0022083 3300034817 Bacteria 1224
478 Ga0373958_0000563 3300034819 Bacteria 4604
479 Ga0373958_0027383 3300034819 Bacteria 1097
480 Ga0373938_0000059 3300034957 Bacteria 13979
481 Ga0373938_0007705 3300034957 Bacteria 1902
482 Ga0373928_0005957 3300035084 Bacteria 2335
483 Ga0373928_0006603 3300035084 Bacteria 2230
484 Ga0373929_0000906 3300035085 Bacteria 5766
485 Ga0373934_0004567 3300035086 Bacteria 5116
486 Ga0373934_0061012 3300035086 Bacteria 1502
487 Ga0373940_0001524 3300035088 Bacteria 4224
488 Ga0373940_0002821 3300035088 Bacteria 3452
489 Ga0373940_0004961 3300035088 Bacteria 2850
490 Ga0373944_0012306 3300035089 Bacteria 2355
491 Ga0373949_0002179 3300035090 Bacteria 5135
492 Ga0373949_0003628 3300035090 Bacteria 3626
493 Ga0373949_0046553 3300035090 Bacteria 1081
494 Ga0373951_0000417 3300035091 Bacteria 12488
495 Ga0373951_0002544 3300035091 Bacteria 4585
496 Ga0373951_0007733 3300035091 Bacteria 2438
497 Ga0373952_0002036 3300035092 Bacteria 3645
498 Ga0373952_0002480 3300035092 Bacteria 3327
499 Ga0373952_0029176 3300035092 Bacteria 1214
500 Ga0373923_0007731 3300035111 Bacteria 3798
501 Ga0373923_0126311 3300035111 Bacteria 1146
502 Ga0373923_0151242 3300035111 Unclassified 1054
503 Ga0373932_0000481 3300035112 Bacteria 12269
504 Ga0373932_0003379 3300035112 Bacteria 3848
505 Ga0373932_0085215 3300035112 Bacteria 1005
506 Ga0373936_0015348 3300035113 Bacteria 2935
507 Ga0373936_0123644 3300035113 Unclassified 1107
508 Ga0373939_0000910 3300035114 Bacteria 7345
509 Ga0373939_0010145 3300035114 Bacteria 2348
510 Ga0373939_0027689 3300035114 Bacteria 1607
511 Ga0373941_0000061 3300035115 Bacteria 16617
512 Ga0373941_0006528 3300035115 Bacteria 2815
513 Ga0373945_0011619 3300035116 Bacteria 2913
514 Ga0373945_0082798 3300035116 Bacteria 1232
515 Ga0373953_0019757 3300035117 Bacteria 2510
516 Ga0373954_0000946 3300035118 Bacteria 11331
517 Ga0373954_0146248 3300035118 Bacteria 1154
518 Ga0373956_0044477 3300035119 Bacteria 1979
519 Ga0373956_0076552 3300035119 Bacteria 1531
520 Ga0373956_0130780 3300035119 Bacteria 1175
521 Ga0373957_0019339 3300035120 Bacteria 2395
522 Ga0373960_0003014 3300035121 Bacteria 3803
523 Ga0373943_0006511 3300035170 Bacteria 5247
524 Ga0373946_0037031 3300035171 Bacteria 1981
525 Ga0373955_0000310 3300035172 Bacteria 20214
526 Ga0373955_0006203 3300035172 Bacteria 5438
527 Ga0373955_0006903 3300035172 Bacteria 5191
528 Ga0373955_0074482 3300035172 Bacteria 1905
529 Ga0373942_0001865 3300035207 Bacteria 5293
530 Ga0373942_0063051 3300035207 Bacteria 1066
531 Ga0373961_0003781 3300035241 Bacteria 3700
532 Ga0373962_0003224 3300035242 Bacteria 3917
533 Ga0373962_0010485 3300035242 Bacteria 2311
534 Ga0373962_0027156 3300035242 Bacteria 1547
535 Ga0373962_0037524 3300035242 Bacteria 1353
536 Ga0373924_0063703 3300035410 Bacteria 1546
537 Ga0373931_0000254 3300035691 Bacteria 22696
538 Ga0373931_0016265 3300035691 Bacteria 3659
539 Ga0373931_0045973 3300035691 Bacteria 2306
540 Ga0373931_0090243 3300035691 Bacteria 1706
541 Ga0373935_0052174 3300035692 Bacteria 2599
542 Ga0373935_0053371 3300035692 Bacteria 2571
543 Ga0373935_0085857 3300035692 Bacteria 2053
544 Ga0373927_0022396 3300035695 Bacteria 4139
545 Ga0373927_0249324 3300035695 Bacteria 1167
546 Ga0373933_0000315 3300035724 Bacteria 31397
547 Ga0373933_0001593 3300035724 Bacteria 13290
548 Ga0373933_0004896 3300035724 Bacteria 7308
549 Ga0373947_0001464 3300035725 Bacteria 14519
550 Ga0373947_0020384 3300035725 Bacteria 3827
551 Ga0373937_0002192 3300036401 Bacteria 16329
552 Ga0373937_0041506 3300036401 Bacteria 4196
553 Ga0373937_0043108 3300036401 Bacteria 4117
554 Ga0373937_0050476 3300036401 Bacteria 3810
555 Ga0373937_0057234 3300036401 Bacteria 3581
556 Ga0373925_0006528 3300037068 Bacteria 8577
557 Ga0395899_0012714 3300037312 Bacteria 6449
558 Ga0395899_0013258 3300037312 Bacteria 6308
559 Ga0395899_0077763 3300037312 Bacteria 2419
560 Ga0395900_0013190 3300037418 Bacteria 8447
561 Ga0395900_0024738 3300037418 Bacteria 6146
562 Ga0395900_0380036 3300037418 Bacteria 1380
563 Ga0395898_0033290 3300037466 Bacteria 5144
564 Ga0395898_0041623 3300037466 Bacteria 4537
565 Ga0395898_0060053 3300037466 Bacteria 3696
566 Ga0395901_0051442 3300038443 Bacteria 4283
567 Ga0395901_0076254 3300038443 Bacteria 3497
568 Ga0395901_0154121 3300038443 Bacteria 2413
569 Ga0395901_0209390 3300038443 Bacteria 2041
570 Ga0395901_0424428 3300038443 Bacteria 1363
571 Ga0436365_1593665 3300039437 Bacteria 1365
572 Ga0436363_0348116 3300039450 Bacteria 3809
573 Ga0439437_020357 3300042000 Bacteria 801
574 Ga0439448_0004238 3300042005 Bacteria 4042
575 Ga0451577_0040683 3300042876 Bacteria 4173
576 Ga0453683_0171827 3300044673 Bacteria 1373
577 Ga0466963_0012490 3300044694 Bacteria 5201
578 Ga0466963_0015340 3300044694 Bacteria 4741
579 Ga0451576_0035339 3300045051 Bacteria 5303
580 Ga0466967_0006619 3300045976 Bacteria 8234
581 Ga0495592_0001184 3300046454 Bacteria 18095
582 Ga0495592_0001796 3300046454 Bacteria 15099
583 Ga0495592_0097212 3300046454 Bacteria 2103
584 Ga0495592_0107404 3300046454 Bacteria 1980
585 Ga0495603_0240136 3300046455 Bacteria 1043
586 Ga0495629_0000062 3300046459 Bacteria 97169
587 Ga0495641_0138758 3300046461 Bacteria 1086
588 Ga0495641_0144393 3300046461 Unclassified 1063
589 Ga0495651_0000895 3300046462 Bacteria 23161
590 Ga0495651_0106749 3300046462 Bacteria 2075
591 Ga0495653_0000637 3300046463 Bacteria 26722
592 Ga0495653_0000987 3300046463 Bacteria 21890
593 Ga0495653_0071815 3300046463 Bacteria 2586
594 Ga0495580_0015491 3300046472 Bacteria 5748
595 Ga0495582_0014743 3300046473 Bacteria 4295
596 Ga0495582_0041761 3300046473 Bacteria 2527
597 Ga0495664_0022125 3300046477 Bacteria 3680
598 Ga0495584_0050530 3300046491 Bacteria 2094
599 Ga0495585_0000389 3300046492 Bacteria 42431
600 Ga0495594_0185325 3300046499 Bacteria 1185
601 Ga0495608_0000129 3300046511 Bacteria 53862
602 Ga0495608_0053608 3300046511 Bacteria 2668
603 Ga0495608_0084124 3300046511 Bacteria 2065
604 Ga0495618_0068397 3300046514 Bacteria 2258
605 Ga0495618_0090009 3300046514 Bacteria 1962
606 Ga0495618_0202978 3300046514 Unclassified 1254
607 Ga0495628_0001570 3300046516 Bacteria 20927
608 Ga0495628_0003849 3300046516 Bacteria 13361
609 Ga0495628_0054508 3300046516 Bacteria 3152
610 Ga0495630_0283602 3300046517 Bacteria 1265
611 Ga0495644_0000373 3300046523 Bacteria 20312
612 Ga0495666_0014224 3300046526 Bacteria 3965
613 Ga0495666_0067297 3300046526 Bacteria 1707
614 Ga0495652_0006346 3300046529 Bacteria 11012
615 Ga0495652_0023216 3300046529 Bacteria 5499
616 Ga0495652_0029622 3300046529 Bacteria 4808
617 Ga0495652_0160951 3300046529 Bacteria 1743
618 Ga0495640_0069130 3300046533 Bacteria 2375
619 Ga0495586_0028713 3300046535 Bacteria 2976
620 Ga0495587_0000354 3300046536 Bacteria 32868
621 Ga0495587_0033990 3300046536 Bacteria 3076
622 Ga0495587_0060705 3300046536 Bacteria 2216
623 Ga0495609_0131542 3300046538 Bacteria 1071
624 Ga0495645_0000800 3300046543 Bacteria 21568
625 Ga0495645_0001074 3300046543 Bacteria 18551
626 Ga0495622_0009728 3300046557 Bacteria 4445
627 Ga0495633_0079134 3300046558 Bacteria 1530
628 Ga0495667_0000688 3300046559 Bacteria 21611
629 Ga0495667_0004405 3300046559 Bacteria 9495
630 Ga0495667_0064720 3300046559 Bacteria 2391
631 Ga0495667_0071961 3300046559 Bacteria 2254
632 Ga0495656_0002695 3300046615 Bacteria 5931
633 Ga0495634_0055595 3300046642 Bacteria 2646
634 Ga0495634_0122780 3300046642 Bacteria 1662
635 Ga0495611_0021301 3300046648 Bacteria 2799
636 Ga0495635_0004643 3300046663 Bacteria 9532
637 Ga0495635_0101930 3300046663 Bacteria 1962
638 Ga0495635_0105930 3300046663 Bacteria 1921
639 Ga0495659_0001141 3300046664 Bacteria 9240
640 Ga0495588_0046859 3300046674 Bacteria 2218
641 Ga0495657_0001374 3300046675 Bacteria 21110
642 Ga0495657_0006975 3300046675 Bacteria 8764
643 Ga0495599_0000294 3300046678 Bacteria 30376
644 Ga0495599_0053017 3300046678 Bacteria 2541
645 Ga0495599_0212578 3300046678 Bacteria 1185
646 Ga0495623_0000055 3300046679 Bacteria 69548
647 Ga0495623_0161150 3300046679 Bacteria 1318
648 Ga0495646_0000749 3300046680 Bacteria 18095
649 Ga0495646_0043427 3300046680 Bacteria 2752
650 Ga0495658_0000109 3300046683 Bacteria 43760
651 Ga0495658_0024037 3300046683 Bacteria 3240
652 Ga0495658_0053622 3300046683 Bacteria 2291
653 Ga0495613_0011807 3300046689 Bacteria 6488
654 Ga0495613_0022888 3300046689 Bacteria 4656
655 Ga0495613_0032646 3300046689 Bacteria 3868
656 Ga0495613_0212440 3300046689 Unclassified 1360
657 Ga0495624_0035822 3300046690 Bacteria 3202
658 Ga0495670_0000106 3300046691 Bacteria 37100
659 Ga0495600_0000293 3300046809 Bacteria 26819
660 Ga0495600_0028696 3300046809 Bacteria 3601
661 Ga0495600_0078916 3300046809 Bacteria 2150
662 Ga0495600_0305306 3300046809 Bacteria 1003
663 Ga0495581_0022521 3300047315 Bacteria 3651
664 Ga0495581_0030496 3300047315 Bacteria 3124
665 Ga0495604_0001560 3300047317 Bacteria 18862
666 Ga0495604_0186071 3300047317 Bacteria 1450
667 Ga0495674_0025464 3300047319 Bacteria 5424
668 Ga0495674_0179538 3300047319 Bacteria 1763
669 Ga0495674_0488969 3300047319 Unclassified 985
670 Ga0495680_0001199 3300047322 Bacteria 28457
671 Ga0495680_0008145 3300047322 Bacteria 9553
672 Ga0495680_0022216 3300047322 Bacteria 5293
673 Ga0495675_0000190 3300047444 Bacteria 44968
674 Ga0495675_0039148 3300047444 Bacteria 3019
675 Ga0495675_0218449 3300047444 Bacteria 1154
676 Ga0495684_0011505 3300047471 Bacteria 6837
677 Ga0495684_0041734 3300047471 Bacteria 3515
678 Ga0495593_0002106 3300047673 Bacteria 11900
679 Ga0495593_0075554 3300047673 Bacteria 1747
680 Ga0495602_0000445 3300048088 Bacteria 38896
681 Ga0495602_0014374 3300048088 Bacteria 8039
682 Ga0495602_0385598 3300048088 Bacteria 1003
683 Ga0496100_0032013 3300048903 Bacteria 3274
684 Ga0496101_0000756 3300048904 Bacteria 19156
685 Ga0496101_0019129 3300048904 Bacteria 4669
686 Ga0496101_0067968 3300048904 Bacteria 2603
687 Ga0496102_0004000 3300048905 Bacteria 12481
688 Ga0496102_0540816 3300048905 Bacteria 1087
689 Ga0496103_0006985 3300048906 Bacteria 6736
690 Ga0496103_0196113 3300048906 Bacteria 1298
691 Ga0496104_0000685 3300048907 Bacteria 29134
692 Ga0496104_0015809 3300048907 Bacteria 6846
693 Ga0496104_0060331 3300048907 Bacteria 3593
694 Ga0496105_0004285 3300048908 Bacteria 10738
695 Ga0496105_0092490 3300048908 Bacteria 2497
696 Ga0496105_0369736 3300048908 Bacteria 1142
697 Ga0496106_0010947 3300048909 Bacteria 6705
698 Ga0496106_0021154 3300048909 Bacteria 4829
699 Ga0496107_0005476 3300048910 Bacteria 8685
700 Ga0496107_0029171 3300048910 Bacteria 3924
701 Ga0496107_0427669 3300048910 Bacteria 984
702 Ga0496108_0074017 3300048911 Bacteria 2875
703 Ga0496108_0121189 3300048911 Bacteria 2243
704 Ga0496109_0002526 3300048912 Bacteria 15338
705 Ga0496109_0028446 3300048912 Bacteria 4998
706 Ga0496109_0030528 3300048912 Bacteria 4830
707 Ga0496109_0038031 3300048912 Bacteria 4350
708 Ga0496109_0952044 3300048912 Bacteria 796
709 Ga0496110_0009931 3300048913 Bacteria 7717
710 Ga0496110_0049928 3300048913 Bacteria 3672
711 Ga0496110_0191294 3300048913 Bacteria 1858
712 Ga0496110_0326538 3300048913 Bacteria 1397
713 Ga0496111_0027751 3300048914 Bacteria 4008
714 Ga0496112_0006875 3300048915 Bacteria 10029
715 Ga0496112_0046350 3300048915 Bacteria 4263
716 Ga0496112_0108890 3300048915 Bacteria 2741
717 Ga0496113_0000137 3300048916 Bacteria 31613
718 Ga0496113_0097337 3300048916 Bacteria 2276
719 Ga0496113_0561874 3300048916 Bacteria 915
720 Ga0496114_0016680 3300048917 Bacteria 5923
721 Ga0496114_0075437 3300048917 Bacteria 2840
722 Ga0496115_0003065 3300048918 Bacteria 12001
723 Ga0496115_0039879 3300048918 Bacteria 3731
724 Ga0496115_0040488 3300048918 Bacteria 3704
725 Ga0496115_0155469 3300048918 Bacteria 1889
726 Ga0496115_0550150 3300048918 Bacteria 922
727 Ga0501032_0390914 3300049569 Bacteria 894
728 Ga0501033_0023648 3300049570 Bacteria 4634
729 Ga0501034_0064045 3300049571 Bacteria 3690
730 Ga0501034_0331110 3300049571 Bacteria 1454
731 Ga0501036_0451936 3300049572 Bacteria 1070
732 Ga0501038_0201670 3300049574 Bacteria 1596
733 Ga0501046_0065049 3300049580 Bacteria 2846
734 Ga0501047_0035029 3300049581 Bacteria 4848
735 Ga0501047_0125838 3300049581 Bacteria 2443
736 Ga0501047_0166119 3300049581 Bacteria 2077
737 Ga0501047_0230901 3300049581 Bacteria 1704
738 Ga0501047_0441403 3300049581 Bacteria 1131
739 Ga0501047_0453581 3300049581 Bacteria 1111
740 Ga0501048_0289584 3300049582 Bacteria 1165
741 Ga0501067_0021814 3300049583 Bacteria 3543
742 Ga0501067_0110570 3300049583 Bacteria 1528
743 Ga0501068_0045547 3300049584 Bacteria 2643
744 Ga0501069_0047576 3300049585 Bacteria 2381
745 Ga0501069_0109864 3300049585 Bacteria 1569
746 Ga0501069_0249844 3300049585 Bacteria 1034
747 Ga0501070_0013417 3300049586 Bacteria 6907
748 Ga0501070_0020871 3300049586 Bacteria 5495
749 Ga0501070_0220771 3300049586 Bacteria 1554
750 Ga0501072_0003460 3300049588 Bacteria 11898
751 Ga0501072_0229118 3300049588 Bacteria 1480
752 Ga0501073_0347849 3300049589 Bacteria 1023
753 Ga0501080_0031660 3300049742 Bacteria 4929
754 Ga0501080_0260791 3300049742 Bacteria 1579
755 Ga0501080_0273486 3300049742 Bacteria 1537
756 Ga0501081_0025971 3300049743 Bacteria 3946
757 Ga0501083_0207380 3300049744 Bacteria 1278
758 Ga0501035_0000197 3300049822 Bacteria 73618
759 Ga0501035_0083151 3300049822 Bacteria 2825
760 Ga0501044_0293002 3300049823 Bacteria 1558
761 Ga0501044_0498112 3300049823 Bacteria 1120
762 nmdc:mga06z11_175027_c1 3300050494 Bacteria 1234
763 nmdc:mga06z11_39001_c1 3300050494 Bacteria 2362
764 nmdc:mga05p37_4690_c1 3300050507 Bacteria 15966
765 nmdc:mga06r32_140652_c1 3300050510 Bacteria 2389
766 nmdc:mga08y16_10015_c1 3300050511 Bacteria 9948
767 nmdc:mga08y16_388110_c1 3300050511 Bacteria 1431
768 nmdc:mga0n895_113453_c1 3300050512 Bacteria 2728
769 nmdc:mga0n895_11694_c1 3300050512 Bacteria 7844
770 nmdc:mga0n895_121876_c1 3300050512 Bacteria 2629
771 nmdc:mga0n895_276858_c1 3300050512 Bacteria 1702
772 nmdc:mga0n895_468015_c1 3300050512 Bacteria 1272
773 nmdc:mga0n895_5683_c1 3300050512 Bacteria 10456
774 nmdc:mga0rr50_179543_c1 3300050513 Bacteria 1730
775 nmdc:mga0rr50_343212_c1 3300050513 Bacteria 1255
776 nmdc:mga0rr50_662502_c1 3300050513 Bacteria 891
777 nmdc:mga08x19_57206_c1 3300050514 Bacteria 2519
778 nmdc:mga0a205_10392_c1 3300050515 Bacteria 4379
779 nmdc:mga0a205_192201_c1 3300050515 Bacteria 1933
780 nmdc:mga0a205_451806_c1 3300050515 Bacteria 1145
781 nmdc:mga0a205_91285_c1 3300050515 Bacteria 2943
782 nmdc:mga0a205_94732_c1 3300050515 Bacteria 2884
783 Ga0495601_0000186 3300053077 Bacteria 33078
784 Ga0495601_0000677 3300053077 Bacteria 18186
785 Ga0495601_0000798 3300053077 Bacteria 17006
786 Ga0495601_0007765 3300053077 Bacteria 6306
787 Ga0495601_0106269 3300053077 Bacteria 1815
788 Ga0495601_0118982 3300053077 Bacteria 1714
789 Ga0495601_0396637 3300053077 Bacteria 895
790 Ga0495612_0000089 3300053078 Bacteria 40250
791 Ga0495612_0005230 3300053078 Bacteria 5360
792 Ga0495612_0015483 3300053078 Bacteria 3058
793 Ga0495612_0056680 3300053078 Bacteria 1617
794 Ga0495612_0066028 3300053078 Bacteria 1503
795 Ga0495595_0000369 3300053084 Bacteria 17095
796 Ga0495595_0001358 3300053084 Bacteria 9498
797 Ga0495595_0001658 3300053084 Bacteria 8706
798 Ga0495595_0019005 3300053084 Bacteria 2976
799 Ga0495595_0024087 3300053084 Bacteria 2685
800 Ga0495619_0000052 3300053085 Bacteria 98882
801 Ga0495619_0000078 3300053085 Bacteria 72749
802 Ga0495619_0001549 3300053085 Bacteria 15135
803 Ga0495619_0004672 3300053085 Bacteria 8727
804 Ga0495619_0007321 3300053085 Bacteria 6991
805 Ga0495619_0068037 3300053085 Bacteria 2378
806 Ga0495619_0161147 3300053085 Bacteria 1549
807 Ga0495619_0350195 3300053085 Bacteria 1022
808 Ga0500643_012394 3300053087 Bacteria 3054
809 Ga0500644_0000852 3300053088 Bacteria 10154
810 Ga0500651_0004341 3300053093 Bacteria 7926
811 Ga0500595_000001 3300053119 Bacteria 1088438
812 Ga0500616_0000001 3300053153 Bacteria 1986011
813 Ga0501084_0056208 3300054114 Bacteria 3292
814 Ga0530510_0358373 3300061734 Bacteria 1096
815 2643758242 2643221547 Bacteria 4740017
816 2837682085 2837678835 Bacteria 5252418
817 Ga0265314_10134688
818 ARSoilYngRDRAFT_c00021
819 ARcpr5yngRDRAFT_c000027
820 ARSoilOldRDRAFT_c000004
821 ARCol0yngRDRAFT_1000041
822 JGI24747J21853_1000183
823 JGI24739J22299_10005787
824 JGI24737J22298_10001847
825 JGI24737J22298_10006747
826 JGI24750J21931_1000142
827 JGI24750J21931_1001110
828 JGI24748J21848_1000808
829 JGI24748J21848_1001711
830 JGI24738J21930_10000905
831 JGI24749J21850_1000294
832 JGI24033J26618_1016921
833 JGI24034J26672_10006012
834 JGI24742J22300_10000099
835 JGI25405J52794_10013882
836 Ga0065716_1000040
837 Ga0065704_10004119
838 Ga0065712_10071076
839 Ga0065715_10008744
840 Ga0065715_10096350
841 Ga0065715_10132182
842 Ga0065707_10089334
843 Ga0070658_10014581
844 Ga0070658_10071567
845 Ga0070658_10079050
846 Ga0070676_10001608
847 Ga0070683_100011295
848 Ga0070683_100144457
849 Ga0070690_100010948
850 Ga0070690_100467979
851 Ga0070670_100023266
852 Ga0070670_100125197
853 Ga0070670_100168164
854 Ga0070677_10000023
855 Ga0068869_100000506
856 Ga0070666_10006394
857 Ga0070666_10010969
858 Ga0070680_100044745
859 Ga0070680_100418244
860 Ga0070680_100479132
861 Ga0070682_100006324
862 Ga0070682_100053204
863 Ga0070682_100169834
864 Ga0070682_100517472
865 Ga0068868_100001933
866 Ga0068868_100017336
867 Ga0070660_100002712
868 Ga0070660_100054043
869 Ga0070660_100220389
870 Ga0070689_100031082
871 Ga0070689_100044712
872 Ga0070689_100146616
873 Ga0070691_10000519
874 Ga0070691_10092803
875 Ga0070691_10107808
876 Ga0070687_100223559
877 Ga0070661_100000642
878 Ga0070661_100064609
879 Ga0070661_100113890
880 Ga0070692_10020265
881 Ga0070668_100006825
882 Ga0070669_100020361
883 Ga0070669_100191524
884 Ga0070675_100037370
885 Ga0070675_100054329
886 Ga0070675_100090998
887 Ga0070671_100025653
888 Ga0070671_100227252
889 Ga0070674_100076664
890 Ga0070673_100000278
891 Ga0070673_100014342
892 Ga0070688_100006105
893 Ga0070688_100020959
894 Ga0070688_100029178
895 Ga0070659_100045148
896 Ga0070659_100281817
897 Ga0070659_100428966
898 Ga0070667_100040188
899 Ga0070667_100171103
900 Ga0070703_10023920
901 Ga0070714_100293244
902 Ga0070713_100063418
903 Ga0070710_10026339
904 Ga0070710_10050238
905 Ga0070710_10082156
906 Ga0070710_10430115
907 Ga0070701_10011763
908 Ga0070701_10037157
909 Ga0070711_100065094
910 Ga0070711_100079572
911 Ga0070705_100009695
912 Ga0070705_100137444
913 Ga0070700_100010776
914 Ga0070700_100021413
915 Ga0070694_100041610
916 Ga0070694_100042140
917 Ga0070708_100179517
918 Ga0070663_100015966
919 Ga0070663_100272296
920 Ga0070678_100004531
921 Ga0070678_100104117
922 Ga0070678_100164005
923 Ga0070662_100009569
924 Ga0070662_100039290
925 Ga0070681_10025370
926 Ga0070681_10065393
927 Ga0070681_10097886
928 Ga0070681_10172575
929 Ga0068867_100040790
930 Ga0070685_10030650
931 Ga0070698_100499050
932 Ga0074259_10038675
933 Ga0070699_100281154
934 Ga0070679_100033457
935 Ga0070679_100109068
936 Ga0070679_100158514
937 Ga0070679_100194793
938 Ga0070679_100390113
939 Ga0070684_100002161
940 Ga0070684_100134227
941 Ga0070684_100470560
942 Ga0068853_100066953
943 Ga0068853_100069902
944 Ga0070672_100006797
945 Ga0070686_100005470
946 Ga0070686_100110403
947 Ga0070686_100159719
948 Ga0070695_100012913
949 Ga0070696_100023870
950 Ga0070696_100075483
951 Ga0070693_100034019
952 Ga0070693_100103660
953 Ga0070665_100101455
954 Ga0070704_100028912
955 Ga0068855_100082175
956 Ga0068855_100348230
957 Ga0068855_100385345
958 Ga0068855_100503773
959 Ga0070664_100000846
960 Ga0070664_100505264
961 Ga0068857_100039702
962 Ga0068854_100009664
963 Ga0068854_100019255
964 Ga0068856_100084736
965 Ga0068856_100087666
966 Ga0068856_100091273
967 Ga0068856_100094639
968 Ga0068856_100199065
969 Ga0070702_100000331
970 Ga0070702_100057919
971 Ga0070702_100144241
972 Ga0068852_100004590
973 Ga0068852_100234492
974 Ga0068852_100400882
975 Ga0068859_100157875
976 Ga0068859_100256496
977 Ga0068859_100430755
978 Ga0068859_100472485
979 Ga0068864_100011552
980 Ga0068866_10000992
981 Ga0068861_100004265
982 Ga0068851_10124094
983 Ga0068870_10000696
984 Ga0068863_100046017
985 Ga0068858_100051515
986 Ga0068858_100416039
987 Ga0068860_100044954
988 Ga0068860_100050821
989 Ga0068860_100053916
990 Ga0068862_100011106
991 Ga0081455_10000002
992 Ga0081455_10017267
993 Ga0081455_10253823
994 Ga0070717_10025318
995 Ga0070717_10059178
996 Ga0075432_10014321
997 Ga0070716_100010729
998 Ga0070712_100184418
999 Ga0075367_10062201
1000 Ga0097621_100001689
1001 Ga0097621_100107776
1002 Ga0097621_100364250
1003 Ga0097621_100659715
1004 Ga0075370_10095841
1005 Ga0068871_100000443
1006 Ga0068871_100024238
1007 Ga0075433_10259248
1008 Ga0075433_10331600
1009 Ga0075433_10331982
1010 Ga0075433_10476520
1011 Ga0075434_100009740
1012 Ga0075434_100022246
1013 Ga0075434_100031847
1014 Ga0075434_100426462
1015 Ga0075434_100489718
1016 Ga0075434_100769425
1017 Ga0068865_100001680
1018 Ga0068865_100277779
1019 Ga0075436_100018122
1020 Ga0097620_100157895
1021 Ga0097620_100256477
1022 Ga0097620_100430746
1023 Ga0097620_100472461
1024 Ga0075435_100059606
1025 Ga0075435_100359752
1026 Ga0105251_10053310
1027 Ga0105244_10032811
1028 Ga0105240_10195268
1029 Ga0105240_10274731
1030 Ga0111539_10005235
1031 Ga0111539_10252290
1032 Ga0111539_10256878
1033 Ga0105245_10000460
1034 Ga0105247_10020798
1035 Ga0105247_10368519
1036 Ga0114129_10001035
1037 Ga0105243_10034038
1038 Ga0105243_10137560
1039 Ga0105243_10205262
1040 Ga0105241_10008878
1041 Ga0105241_10226074
1042 Ga0105242_10001231
1043 Ga0105242_10033075
1044 Ga0105242_10722289
1045 Ga0105248_10009565
1046 Ga0105248_10091610
1047 Ga0105248_10205318
1048 Ga0105237_10030366
1049 Ga0105237_10369938
1050 Ga0105237_10819977
1051 Ga0105238_10071931
1052 Ga0105238_10208513
1053 Ga0105238_10525338
1054 Ga0105249_10037606
1055 Ga0105249_10046689
1056 Ga0105239_10235239
1057 Ga0105239_10384740
1058 Ga0105239_10426025
1059 Ga0105246_10013513
1060 Ga0105246_10543757
1061 Ga0157325_1001276
1062 Ga0157335_1000256
1063 Ga0157338_1003754
1064 Ga0157371_10031292
1065 Ga0157371_10040528
1066 Ga0157371_10095437
1067 Ga0157370_10233089
1068 Ga0157369_10369730
1069 Ga0157374_10003098
1070 Ga0157378_10002912
1071 Ga0157378_10190914
1072 Ga0157378_10295152
1073 Ga0163162_10001590
1074 Ga0163162_10097939
1075 Ga0157372_10084167
1076 Ga0157372_10818115
1077 Ga0157375_10007289
1078 Ga0157375_10043245
1079 Ga0157375_10353733
1080 Ga0163163_10009244
1081 Ga0163163_10010204
1082 Ga0157380_10016411
1083 Ga0157380_10171246
1084 Ga0157377_10000342
1085 Ga0157379_10044765
1086 Ga0157379_10126761
1087 Ga0157379_10304072
1088 Ga0157376_10002255
1089 Ga0157376_10408208
1090 Ga0157376_10755106
1091 Ga0157376_10766477
1092 Ga0163161_10005528
1093 Ga0163161_10204275
1094 Ga0206356_11646989
1095 Ga0206350_10150836
1096 Ga0206353_11202059
1097 Ga0209233_1007607
1098 Ga0207666_1000023
1099 Ga0207666_1005505
1100 Ga0207673_1000080
1101 Ga0207697_10007068
1102 Ga0207656_10025921
1103 Ga0207655_1034352
1104 Ga0207713_1079211
1105 Ga0207653_10112319
1106 Ga0207682_10000011
1107 Ga0207682_10085753
1108 Ga0207682_10116199
1109 Ga0207692_10001380
1110 Ga0207692_10010398
1111 Ga0207642_10000936
1112 Ga0207642_10205994
1113 Ga0207710_10007090
1114 Ga0207710_10017453
1115 Ga0207688_10000212
1116 Ga0207680_10201934
1117 Ga0207647_10014085
1118 Ga0207647_10043046
1119 Ga0207685_10089032
1120 Ga0207699_10387363
1121 Ga0207645_10000788
1122 Ga0207643_10000284
1123 Ga0207705_10082630
1124 Ga0207705_10170745
1125 Ga0207654_10077215
1126 Ga0207654_10099294
1127 Ga0207707_10001938
1128 Ga0207707_10034613
1129 Ga0207707_10259244
1130 Ga0207695_10051370
1131 Ga0207671_10019417
1132 Ga0207693_10031869
1133 Ga0207693_10065935
1134 Ga0207663_10005850
1135 Ga0207663_10236652
1136 Ga0207660_10002700
1137 Ga0207660_10077798
1138 Ga0207660_10140061
1139 Ga0207660_10407188
1140 Ga0207662_10027974
1141 Ga0207662_10029533
1142 Ga0207657_10016256
1143 Ga0207657_10039620
1144 Ga0207657_10049489
1145 Ga0207657_10073209
1146 Ga0207657_10104201
1147 Ga0207657_10340329
1148 Ga0207649_10000057
1149 Ga0207649_10062252
1150 Ga0207649_10085474
1151 Ga0207649_10192483
1152 Ga0207652_10014944
1153 Ga0207652_10040322
1154 Ga0207652_10066797
1155 Ga0207652_10067249
1156 Ga0207681_10000181
1157 Ga0207681_10182307
1158 Ga0207694_10020971
1159 Ga0207694_10119491
1160 Ga0207694_10119970
1161 Ga0207694_10474284
1162 Ga0207650_10001418
1163 Ga0207650_10029858
1164 Ga0207650_10368754
1165 Ga0207659_10000028
1166 Ga0207659_10105186
1167 Ga0207659_10288783
1168 Ga0207687_10000061
1169 Ga0207687_10004282
1170 Ga0207687_10314835
1171 Ga0207700_10002284
1172 Ga0207700_10002842
1173 Ga0207700_10014813
1174 Ga0207664_10068191
1175 Ga0207644_10004970
1176 Ga0207644_10043465
1177 Ga0207690_10018421
1178 Ga0207706_10008724
1179 Ga0207706_10011033
1180 Ga0207706_10074782
1181 Ga0207686_10001777
1182 Ga0207686_10113169
1183 Ga0207686_10180828
1184 Ga0207709_10000539
1185 Ga0207709_10125584
1186 Ga0207709_10175644
1187 Ga0207709_10394278
1188 Ga0207670_10030779
1189 Ga0207669_10000290
1190 Ga0207669_10142718
1191 Ga0207669_10477019
1192 Ga0207704_10000767
1193 Ga0207665_10001292
1194 Ga0207665_10053272
1195 Ga0207665_10099263
1196 Ga0207665_10156925
1197 Ga0207691_10015068
1198 Ga0207691_10076580
1199 Ga0207691_10311296
1200 Ga0207711_10001580
1201 Ga0207711_10004107
1202 Ga0207689_10009011
1203 Ga0207689_10044113
1204 Ga0207661_10000215
1205 Ga0207661_10688982
1206 Ga0207679_10000026
1207 Ga0207679_10327054
1208 Ga0207667_10013064
1209 Ga0207667_10071139
1210 Ga0207667_10137307
1211 Ga0207667_10263796
1212 Ga0207667_10279355
1213 Ga0207667_10364414
1214 Ga0207667_10580240
1215 Ga0207651_10000173
1216 Ga0207651_10053392
1217 Ga0207712_10002375
1218 Ga0207712_10041263
1219 Ga0207712_10192976
1220 Ga0207668_10000474
1221 Ga0207668_10645472
1222 Ga0207640_10000711
1223 Ga0207658_10001541
1224 Ga0207658_10041830
1225 Ga0207677_10001215
1226 Ga0207677_10160283
1227 Ga0207677_10241219
1228 Ga0207703_10035422
1229 Ga0207703_10055937
1230 Ga0207703_10259169
1231 Ga0207639_10047916
1232 Ga0207678_10003797
1233 Ga0207678_10033410
1234 Ga0207678_10043676
1235 Ga0207678_10071190
1236 Ga0207708_10028909
1237 Ga0207708_10033766
1238 Ga0207708_10033935
1239 Ga0207702_10068315
1240 Ga0207702_10074986
1241 Ga0207702_10482583
1242 Ga0207702_10519568
1243 Ga0207641_10004378
1244 Ga0207648_10044632
1245 Ga0207648_10103484
1246 Ga0207676_10005845
1247 Ga0207674_10019430
1248 Ga0207674_10050566
1249 Ga0207674_10103635
1250 Ga0207675_100005898
1251 Ga0207675_100074537
1252 Ga0207683_10000034
1253 Ga0207683_10017963
1254 Ga0207683_10151755
1255 Ga0207698_10013171
1256 Ga0207698_10049402
1257 Ga0209999_1026311
1258 Ga0209971_1005758
1259 Ga0209966_1001532
1260 Ga0209998_10002856
1261 Ga0209998_10003854
1262 Ga0209974_10052714
1263 Ga0209974_10065785
1264 Ga0207428_10000352
1265 Ga0207428_10001235
1266 Ga0268266_10015219
1267 Ga0268266_10155093
1268 Ga0268265_10030643
1269 Ga0268264_10001465
1270 Ga0268264_10039996
1271 Ga0265318_10096531
1272 Ga0265338_10081650
1273 Ga0265330_10021951
1274 Ga0265325_10003668
1275 Ga0265325_10005464
1276 Ga0265340_10037662
1277 Ga0265339_10122916
1278 Ga0265339_10128477
1279 Ga0265316_10167960
1280 Ga0265316_10315356
1281 Ga0265313_10000593
1282 Ga0265313_10003067
1283 Ga0265313_10035067
1284 Ga0265313_10043776
1285 Ga0265314_10001067
1286 Ga0265314_10001306
1287 Ga0265342_10001920
1288 Ga0307415_100584524
1289 Ga0373930_0000032
1290 Ga0373930_0013978
1291 Ga0373930_0050245
1292 Ga0373948_0007262
1293 Ga0373948_0022083
1294 Ga0373958_0000563
1295 Ga0373958_0027383
1296 Ga0373938_0000059
1297 Ga0373938_0007705
1298 Ga0373928_0005957
1299 Ga0373928_0006603
1300 Ga0373929_0000906
1301 Ga0373934_0004567
1302 Ga0373934_0061012
1303 Ga0373940_0001524
1304 Ga0373940_0002821
1305 Ga0373940_0004961
1306 Ga0373944_0012306
1307 Ga0373949_0002179
1308 Ga0373949_0003628
1309 Ga0373949_0046553
1310 Ga0373951_0000417
1311 Ga0373951_0002544
1312 Ga0373951_0007733
1313 Ga0373952_0002036
1314 Ga0373952_0002480
1315 Ga0373952_0029176
1316 Ga0373923_0007731
1317 Ga0373923_0126311
1318 Ga0373923_0151242
1319 Ga0373932_0000481
1320 Ga0373932_0003379
1321 Ga0373932_0085215
1322 Ga0373936_0015348
1323 Ga0373936_0123644
1324 Ga0373939_0000910
1325 Ga0373939_0010145
1326 Ga0373939_0027689
1327 Ga0373941_0000061
1328 Ga0373941_0006528
1329 Ga0373945_0011619
1330 Ga0373945_0082798
1331 Ga0373953_0019757
1332 Ga0373954_0000946
1333 Ga0373954_0146248
1334 Ga0373956_0044477
1335 Ga0373956_0076552
1336 Ga0373956_0130780
1337 Ga0373957_0019339
1338 Ga0373960_0003014
1339 Ga0373943_0006511
1340 Ga0373946_0037031
1341 Ga0373955_0000310
1342 Ga0373955_0006203
1343 Ga0373955_0006903
1344 Ga0373955_0074482
1345 Ga0373942_0001865
1346 Ga0373942_0063051
1347 Ga0373961_0003781
1348 Ga0373962_0003224
1349 Ga0373962_0010485
1350 Ga0373962_0027156
1351 Ga0373962_0037524
1352 Ga0373924_0063703
1353 Ga0373931_0000254
1354 Ga0373931_0016265
1355 Ga0373931_0045973
1356 Ga0373931_0090243
1357 Ga0373935_0052174
1358 Ga0373935_0053371
1359 Ga0373935_0085857
1360 Ga0373927_0022396
1361 Ga0373927_0249324
1362 Ga0373933_0000315
1363 Ga0373933_0001593
1364 Ga0373933_0004896
1365 Ga0373947_0001464
1366 Ga0373947_0020384
1367 Ga0373937_0002192
1368 Ga0373937_0041506
1369 Ga0373937_0043108
1370 Ga0373937_0050476
1371 Ga0373937_0057234
1372 Ga0373925_0006528
1373 Ga0395899_0012714
1374 Ga0395899_0013258
1375 Ga0395899_0077763
1376 Ga0395900_0013190
1377 Ga0395900_0024738
1378 Ga0395900_0380036
1379 Ga0395898_0033290
1380 Ga0395898_0041623
1381 Ga0395898_0060053
1382 Ga0395901_0051442
1383 Ga0395901_0076254
1384 Ga0395901_0154121
1385 Ga0395901_0209390
1386 Ga0395901_0424428
1387 Ga0436365_1593665
1388 Ga0436363_0348116
1389 Ga0439437_020357
1390 Ga0439448_0004238
1391 Ga0451577_0040683
1392 Ga0453683_0171827
1393 Ga0466963_0012490
1394 Ga0466963_0015340
1395 Ga0451576_0035339
1396 Ga0466967_0006619
1397 Ga0495592_0001184
1398 Ga0495592_0001796
1399 Ga0495592_0097212
1400 Ga0495592_0107404
1401 Ga0495603_0240136
1402 Ga0495629_0000062
1403 Ga0495641_0138758
1404 Ga0495641_0144393
1405 Ga0495651_0000895
1406 Ga0495651_0106749
1407 Ga0495653_0000637
1408 Ga0495653_0000987
1409 Ga0495653_0071815
1410 Ga0495580_0015491
1411 Ga0495582_0014743
1412 Ga0495582_0041761
1413 Ga0495664_0022125
1414 Ga0495584_0050530
1415 Ga0495585_0000389
1416 Ga0495594_0185325
1417 Ga0495608_0000129
1418 Ga0495608_0053608
1419 Ga0495608_0084124
1420 Ga0495618_0068397
1421 Ga0495618_0090009
1422 Ga0495618_0202978
1423 Ga0495628_0001570
1424 Ga0495628_0003849
1425 Ga0495628_0054508
1426 Ga0495630_0283602
1427 Ga0495644_0000373
1428 Ga0495666_0014224
1429 Ga0495666_0067297
1430 Ga0495652_0006346
1431 Ga0495652_0023216
1432 Ga0495652_0029622
1433 Ga0495652_0160951
1434 Ga0495640_0069130
1435 Ga0495586_0028713
1436 Ga0495587_0000354
1437 Ga0495587_0033990
1438 Ga0495587_0060705
1439 Ga0495609_0131542
1440 Ga0495645_0000800
1441 Ga0495645_0001074
1442 Ga0495622_0009728
1443 Ga0495633_0079134
1444 Ga0495667_0000688
1445 Ga0495667_0004405
1446 Ga0495667_0064720
1447 Ga0495667_0071961
1448 Ga0495656_0002695
1449 Ga0495634_0055595
1450 Ga0495634_0122780
1451 Ga0495611_0021301
1452 Ga0495635_0004643
1453 Ga0495635_0101930
1454 Ga0495635_0105930
1455 Ga0495659_0001141
1456 Ga0495588_0046859
1457 Ga0495657_0001374
1458 Ga0495657_0006975
1459 Ga0495599_0000294
1460 Ga0495599_0053017
1461 Ga0495599_0212578
1462 Ga0495623_0000055
1463 Ga0495623_0161150
1464 Ga0495646_0000749
1465 Ga0495646_0043427
1466 Ga0495658_0000109
1467 Ga0495658_0024037
1468 Ga0495658_0053622
1469 Ga0495613_0011807
1470 Ga0495613_0022888
1471 Ga0495613_0032646
1472 Ga0495613_0212440
1473 Ga0495624_0035822
1474 Ga0495670_0000106
1475 Ga0495600_0000293
1476 Ga0495600_0028696
1477 Ga0495600_0078916
1478 Ga0495600_0305306
1479 Ga0495581_0022521
1480 Ga0495581_0030496
1481 Ga0495604_0001560
1482 Ga0495604_0186071
1483 Ga0495674_0025464
1484 Ga0495674_0179538
1485 Ga0495674_0488969
1486 Ga0495680_0001199
1487 Ga0495680_0008145
1488 Ga0495680_0022216
1489 Ga0495675_0000190
1490 Ga0495675_0039148
1491 Ga0495675_0218449
1492 Ga0495684_0011505
1493 Ga0495684_0041734
1494 Ga0495593_0002106
1495 Ga0495593_0075554
1496 Ga0495602_0000445
1497 Ga0495602_0014374
1498 Ga0495602_0385598
1499 Ga0496100_0032013
1500 Ga0496101_0000756
1501 Ga0496101_0019129
1502 Ga0496101_0067968
1503 Ga0496102_0004000
1504 Ga0496102_0540816
1505 Ga0496103_0006985
1506 Ga0496103_0196113
1507 Ga0496104_0000685
1508 Ga0496104_0015809
1509 Ga0496104_0060331
1510 Ga0496105_0004285
1511 Ga0496105_0092490
1512 Ga0496105_0369736
1513 Ga0496106_0010947
1514 Ga0496106_0021154
1515 Ga0496107_0005476
1516 Ga0496107_0029171
1517 Ga0496107_0427669
1518 Ga0496108_0074017
1519 Ga0496108_0121189
1520 Ga0496109_0002526
1521 Ga0496109_0028446
1522 Ga0496109_0030528
1523 Ga0496109_0038031
1524 Ga0496109_0952044
1525 Ga0496110_0009931
1526 Ga0496110_0049928
1527 Ga0496110_0191294
1528 Ga0496110_0326538
1529 Ga0496111_0027751
1530 Ga0496112_0006875
1531 Ga0496112_0046350
1532 Ga0496112_0108890
1533 Ga0496113_0000137
1534 Ga0496113_0097337
1535 Ga0496113_0561874
1536 Ga0496114_0016680
1537 Ga0496114_0075437
1538 Ga0496115_0003065
1539 Ga0496115_0039879
1540 Ga0496115_0040488
1541 Ga0496115_0155469
1542 Ga0496115_0550150
1543 Ga0501032_0390914
1544 Ga0501033_0023648
1545 Ga0501034_0064045
1546 Ga0501034_0331110
1547 Ga0501036_0451936
1548 Ga0501038_0201670
1549 Ga0501046_0065049
1550 Ga0501047_0035029
1551 Ga0501047_0125838
1552 Ga0501047_0166119
1553 Ga0501047_0230901
1554 Ga0501047_0441403
1555 Ga0501047_0453581
1556 Ga0501048_0289584
1557 Ga0501067_0021814
1558 Ga0501067_0110570
1559 Ga0501068_0045547
1560 Ga0501069_0047576
1561 Ga0501069_0109864
1562 Ga0501069_0249844
1563 Ga0501070_0013417
1564 Ga0501070_0020871
1565 Ga0501070_0220771
1566 Ga0501072_0003460
1567 Ga0501072_0229118
1568 Ga0501073_0347849
1569 Ga0501080_0031660
1570 Ga0501080_0260791
1571 Ga0501080_0273486
1572 Ga0501081_0025971
1573 Ga0501083_0207380
1574 Ga0501035_0000197
1575 Ga0501035_0083151
1576 Ga0501044_0293002
1577 Ga0501044_0498112
1578 nmdc:mga06z11_175027_c1
1579 nmdc:mga06z11_39001_c1
1580 nmdc:mga05p37_4690_c1
1581 nmdc:mga06r32_140652_c1
1582 nmdc:mga08y16_10015_c1
1583 nmdc:mga08y16_388110_c1
1584 nmdc:mga0n895_113453_c1
1585 nmdc:mga0n895_11694_c1
1586 nmdc:mga0n895_121876_c1
1587 nmdc:mga0n895_276858_c1
1588 nmdc:mga0n895_468015_c1
1589 nmdc:mga0n895_5683_c1
1590 nmdc:mga0rr50_179543_c1
1591 nmdc:mga0rr50_343212_c1
1592 nmdc:mga0rr50_662502_c1
1593 nmdc:mga08x19_57206_c1
1594 nmdc:mga0a205_10392_c1
1595 nmdc:mga0a205_192201_c1
1596 nmdc:mga0a205_451806_c1
1597 nmdc:mga0a205_91285_c1
1598 nmdc:mga0a205_94732_c1
1599 Ga0495601_0000186
1600 Ga0495601_0000677
1601 Ga0495601_0000798
1602 Ga0495601_0007765
1603 Ga0495601_0106269
1604 Ga0495601_0118982
1605 Ga0495601_0396637
1606 Ga0495612_0000089
1607 Ga0495612_0005230
1608 Ga0495612_0015483
1609 Ga0495612_0056680
1610 Ga0495612_0066028
1611 Ga0495595_0000369
1612 Ga0495595_0001358
1613 Ga0495595_0001658
1614 Ga0495595_0019005
1615 Ga0495595_0024087
1616 Ga0495619_0000052
1617 Ga0495619_0000078
1618 Ga0495619_0001549
1619 Ga0495619_0004672
1620 Ga0495619_0007321
1621 Ga0495619_0068037
1622 Ga0495619_0161147
1623 Ga0495619_0350195
1624 Ga0500643_012394
1625 Ga0500644_0000852
1626 Ga0500651_0004341
1627 Ga0500595_000001
1628 Ga0500616_0000001
1629 Ga0501084_0056208
1630 Ga0530510_0358373
1631 2643758242
1632 2837682085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06764

DUF1223

Protein of unknown function (DUF1223)

56

254

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2axo-assembly1.cif.gz_A-2 x-ray crystal structure of protein agr_c_4864 from agrobacterium tumefaciens. northeast structural genomics consortium target atr35. 0.8896 24 254
2axo-assembly1.cif.gz_A-2 x-ray crystal structure of protein agr_c_4864 from agrobacterium tumefaciens. northeast structural genomics consortium target atr35. 0.8595 24 254
5hfi-assembly1.cif.gz_A cytosolic disulfide reductase dsbm from pseudomonas aeruginosa with gsh 0.8393 28 65
2he3-assembly1.cif.gz_A crystal structure of the selenocysteine to cysteine mutant of human glutathionine peroxidase 2 (gpx2) 0.8224 24 63
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.8219 28 64
ID Description Score Start End Superfamily
af_A0A0R0IK93_122_399_3.40.50.12370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.884 28 63 3.40.50.12370
5hfiA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8393 28 65 3.40.30.10
2he3A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8224 24 63 3.40.30.10
af_Q2FV89_2_105_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7884 25 62 3.40.30.10
af_Q2QP53_62_146_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7688 27 103 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537MAF0-F1-model_v4 DUF1223 domain-containing protein 0.9473 17 247
AF-A0A257AUI7-F1-model_v4 DUF1223 domain-containing protein 0.9467 29 126
AF-A0A327K3K6-F1-model_v4 DUF1223 domain-containing protein 0.9408 17 247
AF-A0A7T9INI7-F1-model_v4 deleted 0.9386 28 248
AF-A0A537MAF0-F1-model_v4 DUF1223 domain-containing protein 0.9353 17 247

Map