F481921
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 813 | 278 | 1626 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100039826|Ga0070660_1000398263 |
| Length | 181 |
| Sequence | MTGASGRRLDGARQEAEAAARPAPERDIVFVEIPSGSRNKYEYDEELGGIVLDRRLFTAMTYPADYGYVEGTLAEDGDPLDALVLVADPTFPGCRIRVRPIGVFHMTDEKGPDEKLLCVPRGDPSFERIRDIHDVQAELRDEIEHFFQRYKDLEPTKRTETRGWGNRAEAAAILDQARGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 70 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 111 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 120 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 131 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 134 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 144 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 160 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 161 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 169 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 170 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.86 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 12.18 |
| Rhizosphere | 87.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_100039826 | 3300005339 | Bacteria | 3573 |
| 2 | Ga0070658_10045538 | 3300005327 | Bacteria | 3547 |
| 3 | Ga0070683_100066482 | 3300005329 | Bacteria | 3358 |
| 4 | Ga0070683_100092752 | 3300005329 | Bacteria | 2837 |
| 5 | Ga0070683_100557118 | 3300005329 | Bacteria | 1096 |
| 6 | Ga0070680_100421615 | 3300005336 | Bacteria | 1138 |
| 7 | Ga0070680_100529090 | 3300005336 | Bacteria | 1010 |
| 8 | Ga0070680_100620463 | 3300005336 | Bacteria | 928 |
| 9 | Ga0070680_101122090 | 3300005336 | Bacteria | 680 |
| 10 | Ga0070680_101309800 | 3300005336 | Bacteria | 627 |
| 11 | Ga0070682_100106410 | 3300005337 | Bacteria | 1861 |
| 12 | Ga0070682_100272630 | 3300005337 | Bacteria | 1230 |
| 13 | Ga0070682_100447258 | 3300005337 | Bacteria | 989 |
| 14 | Ga0068868_100872761 | 3300005338 | Bacteria | 816 |
| 15 | Ga0070660_100031706 | 3300005339 | Bacteria | 3971 |
| 16 | Ga0070660_100067943 | 3300005339 | Bacteria | 2777 |
| 17 | Ga0070692_10188836 | 3300005345 | Bacteria | 1199 |
| 18 | Ga0070671_100131709 | 3300005355 | Bacteria | 2106 |
| 19 | Ga0070673_100591945 | 3300005364 | Bacteria | 1011 |
| 20 | Ga0070659_100091493 | 3300005366 | Bacteria | 2438 |
| 21 | Ga0070659_100316048 | 3300005366 | Bacteria | 1305 |
| 22 | Ga0070659_101049806 | 3300005366 | Bacteria | 717 |
| 23 | Ga0070703_10140973 | 3300005406 | Bacteria | 896 |
| 24 | Ga0070709_10038114 | 3300005434 | Bacteria | 2941 |
| 25 | Ga0070709_10224645 | 3300005434 | Bacteria | 1341 |
| 26 | Ga0070714_100018231 | 3300005435 | Bacteria | 5698 |
| 27 | Ga0070714_100025910 | 3300005435 | Bacteria | 4842 |
| 28 | Ga0070714_100030618 | 3300005435 | Bacteria | 4482 |
| 29 | Ga0070714_100093245 | 3300005435 | Bacteria | 2640 |
| 30 | Ga0070714_100098224 | 3300005435 | Bacteria | 2576 |
| 31 | Ga0070714_100174706 | 3300005435 | Bacteria | 1951 |
| 32 | Ga0070714_100206589 | 3300005435 | Bacteria | 1798 |
| 33 | Ga0070714_100286647 | 3300005435 | Bacteria | 1531 |
| 34 | Ga0070714_100410947 | 3300005435 | Bacteria | 1281 |
| 35 | Ga0070714_100619134 | 3300005435 | Bacteria | 1041 |
| 36 | Ga0070714_100948010 | 3300005435 | Bacteria | 836 |
| 37 | Ga0070714_100949792 | 3300005435 | Bacteria | 836 |
| 38 | Ga0070713_100063176 | 3300005436 | Bacteria | 3103 |
| 39 | Ga0070713_100138202 | 3300005436 | Bacteria | 2155 |
| 40 | Ga0070713_100708867 | 3300005436 | Bacteria | 961 |
| 41 | Ga0070710_10033586 | 3300005437 | Bacteria | 2787 |
| 42 | Ga0070711_100071367 | 3300005439 | Bacteria | 2447 |
| 43 | Ga0070711_100090981 | 3300005439 | Bacteria | 2198 |
| 44 | Ga0070711_100108827 | 3300005439 | Bacteria | 2031 |
| 45 | Ga0070711_100571807 | 3300005439 | Bacteria | 940 |
| 46 | Ga0070705_100236051 | 3300005440 | Bacteria | 1275 |
| 47 | Ga0070694_100696291 | 3300005444 | Bacteria | 826 |
| 48 | Ga0070663_100559569 | 3300005455 | Bacteria | 957 |
| 49 | Ga0070681_10042959 | 3300005458 | Bacteria | 4529 |
| 50 | Ga0070681_10307237 | 3300005458 | Bacteria | 1495 |
| 51 | Ga0070681_10932960 | 3300005458 | Bacteria | 787 |
| 52 | Ga0070706_100227577 | 3300005467 | Bacteria | 1741 |
| 53 | Ga0070706_100579955 | 3300005467 | Bacteria | 1043 |
| 54 | Ga0070706_101355557 | 3300005467 | Bacteria | 652 |
| 55 | Ga0070707_100000814 | 3300005468 | Bacteria | 30885 |
| 56 | Ga0070707_100266587 | 3300005468 | Bacteria | 1666 |
| 57 | Ga0070707_100732724 | 3300005468 | Bacteria | 952 |
| 58 | Ga0070698_100060836 | 3300005471 | Bacteria | 3810 |
| 59 | Ga0070698_100101845 | 3300005471 | Bacteria | 2843 |
| 60 | Ga0070698_100185725 | 3300005471 | Bacteria | 2017 |
| 61 | Ga0070698_100905576 | 3300005471 | Bacteria | 828 |
| 62 | Ga0070679_100216639 | 3300005530 | Bacteria | 1877 |
| 63 | Ga0070679_100397138 | 3300005530 | Bacteria | 1325 |
| 64 | Ga0070679_100674243 | 3300005530 | Bacteria | 976 |
| 65 | Ga0070684_100200655 | 3300005535 | Bacteria | 1817 |
| 66 | Ga0070684_100211483 | 3300005535 | Bacteria | 1768 |
| 67 | Ga0070684_100219206 | 3300005535 | Bacteria | 1736 |
| 68 | Ga0068853_100796351 | 3300005539 | Bacteria | 905 |
| 69 | Ga0070686_100746166 | 3300005544 | Bacteria | 785 |
| 70 | Ga0070695_100000149 | 3300005545 | Bacteria | 32802 |
| 71 | Ga0070693_100495497 | 3300005547 | Bacteria | 866 |
| 72 | Ga0070693_100537312 | 3300005547 | Bacteria | 835 |
| 73 | Ga0068855_100165474 | 3300005563 | Bacteria | 2507 |
| 74 | Ga0070664_100052462 | 3300005564 | Bacteria | 3454 |
| 75 | Ga0070664_100834301 | 3300005564 | Bacteria | 863 |
| 76 | Ga0070664_101404715 | 3300005564 | Bacteria | 660 |
| 77 | Ga0068854_101188823 | 3300005578 | Bacteria | 683 |
| 78 | Ga0068856_100281881 | 3300005614 | Bacteria | 1678 |
| 79 | Ga0070702_100166230 | 3300005615 | Bacteria | 1431 |
| 80 | Ga0068863_100416885 | 3300005841 | Bacteria | 1315 |
| 81 | Ga0081455_10029961 | 3300005937 | Bacteria | 4953 |
| 82 | Ga0081538_10018231 | 3300005981 | Bacteria | 5285 |
| 83 | Ga0081539_10039064 | 3300005985 | Bacteria | 2806 |
| 84 | Ga0070717_10003115 | 3300006028 | Bacteria | 11833 |
| 85 | Ga0070717_10027205 | 3300006028 | Bacteria | 4569 |
| 86 | Ga0070717_10045902 | 3300006028 | Bacteria | 3573 |
| 87 | Ga0070717_10132999 | 3300006028 | Bacteria | 2141 |
| 88 | Ga0070717_10250133 | 3300006028 | Bacteria | 1566 |
| 89 | Ga0070717_10293748 | 3300006028 | Bacteria | 1443 |
| 90 | Ga0070717_10341878 | 3300006028 | Bacteria | 1336 |
| 91 | Ga0070717_11123554 | 3300006028 | Bacteria | 716 |
| 92 | Ga0070715_10008026 | 3300006163 | Bacteria | 3661 |
| 93 | Ga0070716_100403345 | 3300006173 | Bacteria | 984 |
| 94 | Ga0070716_100662570 | 3300006173 | Bacteria | 793 |
| 95 | Ga0070712_100010683 | 3300006175 | Bacteria | 5798 |
| 96 | Ga0070712_100014423 | 3300006175 | Bacteria | 5071 |
| 97 | Ga0070712_100097891 | 3300006175 | Bacteria | 2163 |
| 98 | Ga0070712_100227059 | 3300006175 | Bacteria | 1481 |
| 99 | Ga0070712_100573905 | 3300006175 | Bacteria | 952 |
| 100 | Ga0070712_100656031 | 3300006175 | Bacteria | 892 |
| 101 | Ga0070712_100665559 | 3300006175 | Bacteria | 885 |
| 102 | Ga0068871_100097740 | 3300006358 | Bacteria | 2455 |
| 103 | Ga0075433_10002218 | 3300006852 | Bacteria | 14736 |
| 104 | Ga0075434_100004529 | 3300006871 | Bacteria | 12546 |
| 105 | Ga0075434_100166217 | 3300006871 | Bacteria | 2226 |
| 106 | Ga0075434_101223710 | 3300006871 | Bacteria | 763 |
| 107 | Ga0075436_100036479 | 3300006914 | Bacteria | 3393 |
| 108 | Ga0075436_100208580 | 3300006914 | Bacteria | 1385 |
| 109 | Ga0075435_100001215 | 3300007076 | Bacteria | 16497 |
| 110 | Ga0075435_100924763 | 3300007076 | Bacteria | 761 |
| 111 | Ga0099794_10519253 | 3300007265 | Bacteria | 628 |
| 112 | Ga0099795_10299419 | 3300007788 | Bacteria | 707 |
| 113 | Ga0105240_10042548 | 3300009093 | Bacteria | 5788 |
| 114 | Ga0105240_10185136 | 3300009093 | Bacteria | 2454 |
| 115 | Ga0105240_10344675 | 3300009093 | Bacteria | 1691 |
| 116 | Ga0105240_10792754 | 3300009093 | Bacteria | 1027 |
| 117 | Ga0105245_10127491 | 3300009098 | Bacteria | 2384 |
| 118 | Ga0105245_10387474 | 3300009098 | Bacteria | 1393 |
| 119 | Ga0105245_10529727 | 3300009098 | Bacteria | 1198 |
| 120 | Ga0114129_11779930 | 3300009147 | Bacteria | 750 |
| 121 | Ga0114129_12827941 | 3300009147 | Bacteria | 576 |
| 122 | Ga0105241_10344932 | 3300009174 | Bacteria | 1291 |
| 123 | Ga0105237_10031287 | 3300009545 | Bacteria | 5397 |
| 124 | Ga0105237_10790853 | 3300009545 | Bacteria | 955 |
| 125 | Ga0105238_10105544 | 3300009551 | Bacteria | 2799 |
| 126 | Ga0105239_10678259 | 3300010375 | Bacteria | 1178 |
| 127 | Ga0105246_10340412 | 3300011119 | Bacteria | 1226 |
| 128 | Ga0157370_10214609 | 3300013104 | Bacteria | 1783 |
| 129 | Ga0157370_10353741 | 3300013104 | Bacteria | 1354 |
| 130 | Ga0157370_11078887 | 3300013104 | Bacteria | 726 |
| 131 | Ga0157374_10057432 | 3300013296 | Bacteria | 3635 |
| 132 | Ga0157374_11496574 | 3300013296 | Bacteria | 698 |
| 133 | Ga0157372_10092253 | 3300013307 | Bacteria | 3445 |
| 134 | Ga0157372_10624913 | 3300013307 | Bacteria | 1255 |
| 135 | Ga0157372_10640704 | 3300013307 | Bacteria | 1238 |
| 136 | Ga0163163_11665306 | 3300014325 | Bacteria | 699 |
| 137 | Ga0182008_10001795 | 3300014497 | Bacteria | 14028 |
| 138 | Ga0182008_10068350 | 3300014497 | Bacteria | 1748 |
| 139 | Ga0182008_10128084 | 3300014497 | Bacteria | 1265 |
| 140 | Ga0182008_10164168 | 3300014497 | Bacteria | 1119 |
| 141 | Ga0157379_10387798 | 3300014968 | Bacteria | 1282 |
| 142 | Ga0157379_11485375 | 3300014968 | Bacteria | 659 |
| 143 | Ga0157376_10109092 | 3300014969 | Bacteria | 2433 |
| 144 | Ga0182006_1011741 | 3300015261 | Bacteria | 3845 |
| 145 | Ga0182007_10025642 | 3300015262 | Bacteria | 2051 |
| 146 | Ga0197907_11191444 | 3300020069 | Bacteria | 1003 |
| 147 | Ga0206356_10385487 | 3300020070 | Bacteria | 1105 |
| 148 | Ga0206356_11241244 | 3300020070 | Bacteria | 930 |
| 149 | Ga0206355_1630123 | 3300020076 | Bacteria | 999 |
| 150 | Ga0206354_11533000 | 3300020081 | Bacteria | 1643 |
| 151 | Ga0206353_10912262 | 3300020082 | Bacteria | 2756 |
| 152 | Ga0207692_10053165 | 3300025898 | Bacteria | 2061 |
| 153 | Ga0207692_10178020 | 3300025898 | Bacteria | 1237 |
| 154 | Ga0207685_10140368 | 3300025905 | Bacteria | 1083 |
| 155 | Ga0207699_10037232 | 3300025906 | Bacteria | 2780 |
| 156 | Ga0207699_10056606 | 3300025906 | Bacteria | 2338 |
| 157 | Ga0207699_10116215 | 3300025906 | Bacteria | 1722 |
| 158 | Ga0207705_10463466 | 3300025909 | Bacteria | 983 |
| 159 | Ga0207684_10166138 | 3300025910 | Bacteria | 1901 |
| 160 | Ga0207684_10444092 | 3300025910 | Bacteria | 1114 |
| 161 | Ga0207707_10174747 | 3300025912 | Bacteria | 1876 |
| 162 | Ga0207707_10253924 | 3300025912 | Bacteria | 1527 |
| 163 | Ga0207707_10255674 | 3300025912 | Bacteria | 1521 |
| 164 | Ga0207707_10463458 | 3300025912 | Bacteria | 1083 |
| 165 | Ga0207707_10756528 | 3300025912 | Bacteria | 812 |
| 166 | Ga0207695_10042294 | 3300025913 | Bacteria | 4868 |
| 167 | Ga0207671_10222594 | 3300025914 | Bacteria | 1479 |
| 168 | Ga0207671_10853475 | 3300025914 | Bacteria | 721 |
| 169 | Ga0207693_10001062 | 3300025915 | Bacteria | 24573 |
| 170 | Ga0207693_10005926 | 3300025915 | Bacteria | 10137 |
| 171 | Ga0207693_10034002 | 3300025915 | Bacteria | 4022 |
| 172 | Ga0207693_10037141 | 3300025915 | Bacteria | 3839 |
| 173 | Ga0207693_10037735 | 3300025915 | Bacteria | 3808 |
| 174 | Ga0207693_10368208 | 3300025915 | Bacteria | 1124 |
| 175 | Ga0207663_10082973 | 3300025916 | Bacteria | 2104 |
| 176 | Ga0207663_10486052 | 3300025916 | Bacteria | 957 |
| 177 | Ga0207660_10015474 | 3300025917 | Bacteria | 5037 |
| 178 | Ga0207660_10022880 | 3300025917 | Bacteria | 4214 |
| 179 | Ga0207660_10186193 | 3300025917 | Bacteria | 1615 |
| 180 | Ga0207660_10432438 | 3300025917 | Bacteria | 1063 |
| 181 | Ga0207660_10443846 | 3300025917 | Bacteria | 1049 |
| 182 | Ga0207660_10542189 | 3300025917 | Bacteria | 946 |
| 183 | Ga0207660_10650063 | 3300025917 | Bacteria | 860 |
| 184 | Ga0207657_10003090 | 3300025919 | Bacteria | 17809 |
| 185 | Ga0207657_10005360 | 3300025919 | Bacteria | 13431 |
| 186 | Ga0207657_10061924 | 3300025919 | Bacteria | 3205 |
| 187 | Ga0207649_10174875 | 3300025920 | Bacteria | 1498 |
| 188 | Ga0207652_10008528 | 3300025921 | Bacteria | 8250 |
| 189 | Ga0207652_10106964 | 3300025921 | Bacteria | 2477 |
| 190 | Ga0207652_10222074 | 3300025921 | Bacteria | 1702 |
| 191 | Ga0207652_10387508 | 3300025921 | Bacteria | 1261 |
| 192 | Ga0207646_10000371 | 3300025922 | Bacteria | 59994 |
| 193 | Ga0207646_10190459 | 3300025922 | Bacteria | 1852 |
| 194 | Ga0207646_10787292 | 3300025922 | Bacteria | 847 |
| 195 | Ga0207687_10113269 | 3300025927 | Bacteria | 2017 |
| 196 | Ga0207687_10406744 | 3300025927 | Bacteria | 1120 |
| 197 | Ga0207687_10590311 | 3300025927 | Bacteria | 935 |
| 198 | Ga0207700_10010831 | 3300025928 | Bacteria | 5784 |
| 199 | Ga0207700_10013264 | 3300025928 | Bacteria | 5354 |
| 200 | Ga0207700_10047873 | 3300025928 | Bacteria | 3172 |
| 201 | Ga0207700_10113275 | 3300025928 | Bacteria | 2187 |
| 202 | Ga0207700_11386988 | 3300025928 | Bacteria | 625 |
| 203 | Ga0207664_10002612 | 3300025929 | Bacteria | 11927 |
| 204 | Ga0207664_10005182 | 3300025929 | Bacteria | 8884 |
| 205 | Ga0207664_10006068 | 3300025929 | Bacteria | 8275 |
| 206 | Ga0207664_10019307 | 3300025929 | Bacteria | 5035 |
| 207 | Ga0207664_10041646 | 3300025929 | Bacteria | 3579 |
| 208 | Ga0207664_10075996 | 3300025929 | Bacteria | 2717 |
| 209 | Ga0207664_10116817 | 3300025929 | Bacteria | 2226 |
| 210 | Ga0207664_10156131 | 3300025929 | Bacteria | 1943 |
| 211 | Ga0207664_10526712 | 3300025929 | Bacteria | 1059 |
| 212 | Ga0207664_10670004 | 3300025929 | Bacteria | 933 |
| 213 | Ga0207664_10956448 | 3300025929 | Bacteria | 768 |
| 214 | Ga0207664_11375193 | 3300025929 | Bacteria | 626 |
| 215 | Ga0207644_10129000 | 3300025931 | Bacteria | 1934 |
| 216 | Ga0207690_10172838 | 3300025932 | Bacteria | 1620 |
| 217 | Ga0207706_11485373 | 3300025933 | Bacteria | 553 |
| 218 | Ga0207686_11030300 | 3300025934 | Bacteria | 669 |
| 219 | Ga0207665_10009583 | 3300025939 | Bacteria | 6360 |
| 220 | Ga0207665_10304628 | 3300025939 | Bacteria | 1192 |
| 221 | Ga0207711_10087061 | 3300025941 | Bacteria | 2740 |
| 222 | Ga0207711_10812571 | 3300025941 | Bacteria | 871 |
| 223 | Ga0207661_10009335 | 3300025944 | Bacteria | 7030 |
| 224 | Ga0207661_10031369 | 3300025944 | Bacteria | 4105 |
| 225 | Ga0207679_10825208 | 3300025945 | Bacteria | 846 |
| 226 | Ga0207679_10980062 | 3300025945 | Bacteria | 775 |
| 227 | Ga0207667_10379313 | 3300025949 | Bacteria | 1441 |
| 228 | Ga0207667_10786635 | 3300025949 | Bacteria | 949 |
| 229 | Ga0207651_10437930 | 3300025960 | Bacteria | 1119 |
| 230 | Ga0207677_10126154 | 3300026023 | Bacteria | 1935 |
| 231 | Ga0207639_10367458 | 3300026041 | Bacteria | 1289 |
| 232 | Ga0207678_10692229 | 3300026067 | Bacteria | 897 |
| 233 | Ga0207702_10665104 | 3300026078 | Bacteria | 1025 |
| 234 | Ga0207674_10641420 | 3300026116 | Bacteria | 1026 |
| 235 | Ga0207674_11231526 | 3300026116 | Bacteria | 718 |
| 236 | Ga0207683_10306789 | 3300026121 | Bacteria | 1453 |
| 237 | Ga0265337_1025817 | 3300028556 | Bacteria | 1786 |
| 238 | Ga0265337_1047853 | 3300028556 | Bacteria | 1211 |
| 239 | Ga0265337_1115290 | 3300028556 | Bacteria | 729 |
| 240 | Ga0265319_1001437 | 3300028563 | Bacteria | 14225 |
| 241 | Ga0265319_1002094 | 3300028563 | Bacteria | 11181 |
| 242 | Ga0265319_1045781 | 3300028563 | Bacteria | 1461 |
| 243 | Ga0265334_10000322 | 3300028573 | Bacteria | 26260 |
| 244 | Ga0265334_10014510 | 3300028573 | Bacteria | 3282 |
| 245 | Ga0265334_10039042 | 3300028573 | Bacteria | 1864 |
| 246 | Ga0265334_10105650 | 3300028573 | Bacteria | 1016 |
| 247 | Ga0265334_10206784 | 3300028573 | Bacteria | 681 |
| 248 | Ga0265318_10000777 | 3300028577 | Bacteria | 21161 |
| 249 | Ga0265318_10001871 | 3300028577 | Bacteria | 11838 |
| 250 | Ga0265318_10022386 | 3300028577 | Bacteria | 2527 |
| 251 | Ga0265318_10057607 | 3300028577 | Bacteria | 1452 |
| 252 | Ga0265323_10158224 | 3300028653 | Bacteria | 723 |
| 253 | Ga0265322_10003220 | 3300028654 | Bacteria | 4956 |
| 254 | Ga0265322_10018523 | 3300028654 | Bacteria | 2001 |
| 255 | Ga0265336_10019934 | 3300028666 | Bacteria | 2158 |
| 256 | Ga0265336_10022144 | 3300028666 | Bacteria | 2024 |
| 257 | Ga0265336_10022883 | 3300028666 | Bacteria | 1986 |
| 258 | Ga0265336_10081943 | 3300028666 | Bacteria | 962 |
| 259 | Ga0265338_10001558 | 3300028800 | Bacteria | 37008 |
| 260 | Ga0265338_10003330 | 3300028800 | Bacteria | 22715 |
| 261 | Ga0265338_10010797 | 3300028800 | Bacteria | 10646 |
| 262 | Ga0265338_10022905 | 3300028800 | Bacteria | 6445 |
| 263 | Ga0265338_10038047 | 3300028800 | Bacteria | 4566 |
| 264 | Ga0265338_10042934 | 3300028800 | Bacteria | 4202 |
| 265 | Ga0265338_10050446 | 3300028800 | Bacteria | 3761 |
| 266 | Ga0265338_10123686 | 3300028800 | Bacteria | 2057 |
| 267 | Ga0265338_10296528 | 3300028800 | Bacteria | 1176 |
| 268 | Ga0265338_10346889 | 3300028800 | Bacteria | 1068 |
| 269 | Ga0265338_10418006 | 3300028800 | Bacteria | 953 |
| 270 | Ga0265338_10566293 | 3300028800 | Bacteria | 794 |
| 271 | Ga0265324_10038750 | 3300029957 | Bacteria | 1652 |
| 272 | Ga0265330_10003034 | 3300031235 | Bacteria | 8912 |
| 273 | Ga0265332_10006572 | 3300031238 | Bacteria | 5272 |
| 274 | Ga0265332_10040678 | 3300031238 | Bacteria | 2012 |
| 275 | Ga0265332_10067215 | 3300031238 | Bacteria | 1528 |
| 276 | Ga0265328_10004790 | 3300031239 | Bacteria | 5842 |
| 277 | Ga0265320_10010060 | 3300031240 | Bacteria | 5655 |
| 278 | Ga0265320_10156081 | 3300031240 | Bacteria | 1029 |
| 279 | Ga0265325_10011495 | 3300031241 | Bacteria | 5084 |
| 280 | Ga0265329_10012118 | 3300031242 | Bacteria | 3111 |
| 281 | Ga0265329_10014888 | 3300031242 | Bacteria | 2733 |
| 282 | Ga0265340_10008992 | 3300031247 | Bacteria | 5379 |
| 283 | Ga0265339_10007646 | 3300031249 | Bacteria | 6959 |
| 284 | Ga0265339_10063634 | 3300031249 | Bacteria | 1981 |
| 285 | Ga0265331_10002581 | 3300031250 | Bacteria | 12179 |
| 286 | Ga0265327_10004211 | 3300031251 | Bacteria | 12930 |
| 287 | Ga0265327_10011702 | 3300031251 | Bacteria | 6012 |
| 288 | Ga0265327_10019485 | 3300031251 | Bacteria | 4167 |
| 289 | Ga0265327_10030362 | 3300031251 | Bacteria | 3057 |
| 290 | Ga0265316_10021439 | 3300031344 | Bacteria | 5471 |
| 291 | Ga0265316_10035212 | 3300031344 | Bacteria | 4059 |
| 292 | Ga0265316_10129396 | 3300031344 | Bacteria | 1902 |
| 293 | Ga0265316_10526001 | 3300031344 | Bacteria | 843 |
| 294 | Ga0265313_10014033 | 3300031595 | Bacteria | 4768 |
| 295 | Ga0265313_10039165 | 3300031595 | Bacteria | 2353 |
| 296 | Ga0265314_10002715 | 3300031711 | Bacteria | 17709 |
| 297 | Ga0265314_10002854 | 3300031711 | Bacteria | 17188 |
| 298 | Ga0265314_10012282 | 3300031711 | Bacteria | 6999 |
| 299 | Ga0265314_10605537 | 3300031711 | Bacteria | 564 |
| 300 | Ga0265342_10022888 | 3300031712 | Bacteria | 3964 |
| 301 | Ga0265342_10133581 | 3300031712 | Bacteria | 1388 |
| 302 | Ga0307416_101979602 | 3300032002 | Bacteria | 685 |
| 303 | Ga0373926_0001730 | 3300035083 | Bacteria | 6766 |
| 304 | Ga0373934_0131391 | 3300035086 | Bacteria | 1021 |
| 305 | Ga0373944_0076961 | 3300035089 | Bacteria | 1096 |
| 306 | Ga0373939_0385355 | 3300035114 | Bacteria | 578 |
| 307 | Ga0373945_0009591 | 3300035116 | Bacteria | 3174 |
| 308 | Ga0373953_0243102 | 3300035117 | Bacteria | 782 |
| 309 | Ga0373956_0087820 | 3300035119 | Bacteria | 1432 |
| 310 | Ga0373960_0213247 | 3300035121 | Bacteria | 688 |
| 311 | Ga0373943_0010263 | 3300035170 | Bacteria | 4201 |
| 312 | Ga0373943_0278027 | 3300035170 | Bacteria | 946 |
| 313 | Ga0373946_0005228 | 3300035171 | Bacteria | 4679 |
| 314 | Ga0373946_0171042 | 3300035171 | Bacteria | 1026 |
| 315 | Ga0373955_0109091 | 3300035172 | Bacteria | 1599 |
| 316 | Ga0373924_0044323 | 3300035410 | Bacteria | 1828 |
| 317 | Ga0373935_1000151 | 3300035692 | Bacteria | 621 |
| 318 | Ga0373927_0072272 | 3300035695 | Bacteria | 2232 |
| 319 | Ga0373933_0011994 | 3300035724 | Bacteria | 4785 |
| 320 | Ga0373933_0051532 | 3300035724 | Bacteria | 2461 |
| 321 | Ga0373947_0001416 | 3300035725 | Bacteria | 14762 |
| 322 | Ga0373947_0169073 | 3300035725 | Bacteria | 1417 |
| 323 | Ga0373937_0000107 | 3300036401 | Bacteria | 79333 |
| 324 | Ga0373937_0080282 | 3300036401 | Bacteria | 3016 |
| 325 | Ga0373937_1087621 | 3300036401 | Bacteria | 748 |
| 326 | Ga0373925_0002933 | 3300037068 | Bacteria | 13456 |
| 327 | Ga0373925_0027280 | 3300037068 | Bacteria | 4182 |
| 328 | Ga0373925_1199471 | 3300037068 | Bacteria | 624 |
| 329 | Ga0395899_0022279 | 3300037312 | Bacteria | 4804 |
| 330 | Ga0395899_0050399 | 3300037312 | Bacteria | 3091 |
| 331 | Ga0395899_0321031 | 3300037312 | Bacteria | 1043 |
| 332 | Ga0395900_0020034 | 3300037418 | Bacteria | 6821 |
| 333 | Ga0395900_0227265 | 3300037418 | Bacteria | 1878 |
| 334 | Ga0395900_0435716 | 3300037418 | Bacteria | 1269 |
| 335 | Ga0395898_0015736 | 3300037466 | Bacteria | 7752 |
| 336 | Ga0395898_0269289 | 3300037466 | Bacteria | 1624 |
| 337 | Ga0395898_0516537 | 3300037466 | Bacteria | 1136 |
| 338 | Ga0395898_0934190 | 3300037466 | Bacteria | 805 |
| 339 | Ga0395905_0254138 | 3300037471 | Bacteria | 1641 |
| 340 | Ga0395901_0026380 | 3300038443 | Bacteria | 5965 |
| 341 | Ga0395901_0240217 | 3300038443 | Bacteria | 1889 |
| 342 | Ga0395901_0563869 | 3300038443 | Bacteria | 1153 |
| 343 | Ga0395901_1160466 | 3300038443 | Bacteria | 740 |
| 344 | Ga0395901_1502049 | 3300038443 | Bacteria | 630 |
| 345 | Ga0242420_017143 | 3300038996 | Bacteria | 1266 |
| 346 | Ga0436365_1011248 | 3300039437 | Bacteria | 634 |
| 347 | Ga0436365_1769238 | 3300039437 | Bacteria | 1055 |
| 348 | Ga0436360_0046971 | 3300039438 | Bacteria | 971 |
| 349 | Ga0436360_1255991 | 3300039438 | Bacteria | 1142 |
| 350 | Ga0436363_0806935 | 3300039450 | Bacteria | 2598 |
| 351 | Ga0451802_0842925 | 3300041460 | Bacteria | 786 |
| 352 | Ga0451806_200625 | 3300041462 | Bacteria | 602 |
| 353 | Ga0451837_1489392 | 3300041494 | Bacteria | 989 |
| 354 | Ga0439448_0061214 | 3300042005 | Bacteria | 1245 |
| 355 | Ga0466969_0009447 | 3300044656 | Bacteria | 5169 |
| 356 | Ga0466969_0043825 | 3300044656 | Bacteria | 2228 |
| 357 | Ga0466969_0052035 | 3300044656 | Bacteria | 2013 |
| 358 | Ga0466972_0019202 | 3300044658 | Bacteria | 3419 |
| 359 | Ga0466965_0034119 | 3300044683 | Bacteria | 2489 |
| 360 | Ga0466965_0038315 | 3300044683 | Bacteria | 2355 |
| 361 | Ga0466965_0038453 | 3300044683 | Bacteria | 2350 |
| 362 | Ga0466965_0180889 | 3300044683 | Bacteria | 1112 |
| 363 | Ga0466966_0006701 | 3300044684 | Bacteria | 7630 |
| 364 | Ga0466966_0070060 | 3300044684 | Bacteria | 2199 |
| 365 | Ga0466966_0141385 | 3300044684 | Bacteria | 1470 |
| 366 | Ga0466966_0152915 | 3300044684 | Bacteria | 1406 |
| 367 | Ga0466961_0007633 | 3300044693 | Bacteria | 6888 |
| 368 | Ga0466961_0008126 | 3300044693 | Bacteria | 6681 |
| 369 | Ga0466961_0018550 | 3300044693 | Bacteria | 4477 |
| 370 | Ga0466961_0096731 | 3300044693 | Bacteria | 1862 |
| 371 | Ga0466961_0121773 | 3300044693 | Bacteria | 1637 |
| 372 | Ga0466961_0123269 | 3300044693 | Bacteria | 1626 |
| 373 | Ga0466961_0620079 | 3300044693 | Bacteria | 650 |
| 374 | Ga0466963_0000057 | 3300044694 | Bacteria | 37536 |
| 375 | Ga0466963_0000527 | 3300044694 | Bacteria | 17925 |
| 376 | Ga0466963_0003947 | 3300044694 | Bacteria | 8578 |
| 377 | Ga0466963_0004728 | 3300044694 | Bacteria | 7949 |
| 378 | Ga0466963_0007933 | 3300044694 | Bacteria | 6355 |
| 379 | Ga0466963_0009286 | 3300044694 | Bacteria | 5922 |
| 380 | Ga0466963_0013669 | 3300044694 | Bacteria | 4991 |
| 381 | Ga0466963_0017334 | 3300044694 | Bacteria | 4489 |
| 382 | Ga0466963_0017542 | 3300044694 | Bacteria | 4463 |
| 383 | Ga0466963_0018413 | 3300044694 | Bacteria | 4366 |
| 384 | Ga0466963_0026714 | 3300044694 | Bacteria | 3693 |
| 385 | Ga0466963_0029485 | 3300044694 | Bacteria | 3533 |
| 386 | Ga0466963_0040091 | 3300044694 | Bacteria | 3069 |
| 387 | Ga0466963_0095442 | 3300044694 | Bacteria | 2030 |
| 388 | Ga0466963_0116808 | 3300044694 | Bacteria | 1834 |
| 389 | Ga0466963_0337077 | 3300044694 | Bacteria | 1062 |
| 390 | Ga0466963_0492341 | 3300044694 | Bacteria | 865 |
| 391 | Ga0466963_0592088 | 3300044694 | Bacteria | 783 |
| 392 | Ga0466963_0686707 | 3300044694 | Bacteria | 722 |
| 393 | Ga0466963_0770870 | 3300044694 | Bacteria | 678 |
| 394 | Ga0466963_1057333 | 3300044694 | Bacteria | 571 |
| 395 | Ga0466964_0008224 | 3300044706 | Bacteria | 3913 |
| 396 | Ga0466964_0010942 | 3300044706 | Bacteria | 3428 |
| 397 | Ga0466964_0013368 | 3300044706 | Bacteria | 3114 |
| 398 | Ga0466964_0024896 | 3300044706 | Bacteria | 2334 |
| 399 | Ga0466964_0042128 | 3300044706 | Bacteria | 1849 |
| 400 | Ga0466964_0071027 | 3300044706 | Bacteria | 1472 |
| 401 | Ga0466964_0074626 | 3300044706 | Bacteria | 1442 |
| 402 | Ga0466964_0088080 | 3300044706 | Bacteria | 1346 |
| 403 | Ga0466964_0352728 | 3300044706 | Bacteria | 756 |
| 404 | Ga0453684_0731438 | 3300044712 | Bacteria | 1073 |
| 405 | Ga0466971_0014919 | 3300044719 | Bacteria | 3419 |
| 406 | Ga0466971_0020350 | 3300044719 | Bacteria | 2950 |
| 407 | Ga0466971_0045365 | 3300044719 | Bacteria | 1974 |
| 408 | Ga0466971_0065257 | 3300044719 | Bacteria | 1649 |
| 409 | Ga0466971_0250713 | 3300044719 | Bacteria | 843 |
| 410 | Ga0466971_0250869 | 3300044719 | Bacteria | 843 |
| 411 | Ga0466968_0001402 | 3300044735 | Bacteria | 8629 |
| 412 | Ga0466968_0006127 | 3300044735 | Bacteria | 4519 |
| 413 | Ga0466968_0051406 | 3300044735 | Bacteria | 1760 |
| 414 | Ga0466968_0100027 | 3300044735 | Bacteria | 1293 |
| 415 | Ga0466968_0128509 | 3300044735 | Bacteria | 1151 |
| 416 | Ga0466968_0214418 | 3300044735 | Bacteria | 905 |
| 417 | Ga0466968_0264726 | 3300044735 | Bacteria | 819 |
| 418 | Ga0466970_0126133 | 3300044765 | Bacteria | 1404 |
| 419 | Ga0466957_0008317 | 3300044842 | Bacteria | 5899 |
| 420 | Ga0466957_0018047 | 3300044842 | Bacteria | 4139 |
| 421 | Ga0466957_0023055 | 3300044842 | Bacteria | 3676 |
| 422 | Ga0466957_0072432 | 3300044842 | Bacteria | 2133 |
| 423 | Ga0466957_0096315 | 3300044842 | Bacteria | 1859 |
| 424 | Ga0466957_0172739 | 3300044842 | Bacteria | 1408 |
| 425 | Ga0466957_0183205 | 3300044842 | Bacteria | 1368 |
| 426 | Ga0466957_0229118 | 3300044842 | Bacteria | 1229 |
| 427 | Ga0466957_0229996 | 3300044842 | Bacteria | 1227 |
| 428 | Ga0466957_0240073 | 3300044842 | Bacteria | 1202 |
| 429 | Ga0466960_0001710 | 3300044901 | Bacteria | 8050 |
| 430 | Ga0466960_0618723 | 3300044901 | Bacteria | 644 |
| 431 | Ga0466959_0001356 | 3300045049 | Bacteria | 14942 |
| 432 | Ga0466959_0004959 | 3300045049 | Bacteria | 9021 |
| 433 | Ga0466959_0009317 | 3300045049 | Bacteria | 6977 |
| 434 | Ga0466959_0058033 | 3300045049 | Bacteria | 2820 |
| 435 | Ga0466959_0214262 | 3300045049 | Bacteria | 1337 |
| 436 | Ga0466959_0270444 | 3300045049 | Bacteria | 1168 |
| 437 | Ga0466959_0371559 | 3300045049 | Bacteria | 974 |
| 438 | Ga0466958_0001025 | 3300045836 | Bacteria | 12733 |
| 439 | Ga0466958_0001146 | 3300045836 | Bacteria | 12275 |
| 440 | Ga0466958_0009781 | 3300045836 | Bacteria | 5350 |
| 441 | Ga0466958_0013833 | 3300045836 | Bacteria | 4601 |
| 442 | Ga0466958_0037624 | 3300045836 | Bacteria | 2899 |
| 443 | Ga0466958_0062716 | 3300045836 | Bacteria | 2266 |
| 444 | Ga0466958_0073253 | 3300045836 | Bacteria | 2098 |
| 445 | Ga0466958_0085834 | 3300045836 | Bacteria | 1942 |
| 446 | Ga0466958_0147012 | 3300045836 | Bacteria | 1485 |
| 447 | Ga0466958_0402963 | 3300045836 | Bacteria | 883 |
| 448 | Ga0466958_0680610 | 3300045836 | Bacteria | 670 |
| 449 | Ga0466967_0000056 | 3300045976 | Bacteria | 40207 |
| 450 | Ga0466967_0000275 | 3300045976 | Bacteria | 22739 |
| 451 | Ga0466967_0003136 | 3300045976 | Bacteria | 10643 |
| 452 | Ga0466967_0006078 | 3300045976 | Bacteria | 8490 |
| 453 | Ga0466967_0006421 | 3300045976 | Bacteria | 8316 |
| 454 | Ga0466967_0008508 | 3300045976 | Bacteria | 7530 |
| 455 | Ga0466967_0012270 | 3300045976 | Bacteria | 6544 |
| 456 | Ga0466967_0029506 | 3300045976 | Bacteria | 4591 |
| 457 | Ga0466967_0029631 | 3300045976 | Bacteria | 4583 |
| 458 | Ga0466967_0037570 | 3300045976 | Bacteria | 4145 |
| 459 | Ga0466967_0056787 | 3300045976 | Bacteria | 3453 |
| 460 | Ga0466967_0077107 | 3300045976 | Bacteria | 2999 |
| 461 | Ga0466967_0078361 | 3300045976 | Bacteria | 2976 |
| 462 | Ga0466967_0084754 | 3300045976 | Bacteria | 2868 |
| 463 | Ga0466967_0087330 | 3300045976 | Bacteria | 2827 |
| 464 | Ga0466967_0088687 | 3300045976 | Bacteria | 2807 |
| 465 | Ga0466967_0097755 | 3300045976 | Bacteria | 2680 |
| 466 | Ga0466967_0100685 | 3300045976 | Bacteria | 2640 |
| 467 | Ga0466967_0107350 | 3300045976 | Bacteria | 2560 |
| 468 | Ga0466967_0108126 | 3300045976 | Bacteria | 2551 |
| 469 | Ga0466967_0141696 | 3300045976 | Bacteria | 2239 |
| 470 | Ga0466967_0160268 | 3300045976 | Bacteria | 2111 |
| 471 | Ga0466967_0271203 | 3300045976 | Bacteria | 1626 |
| 472 | Ga0466967_0340789 | 3300045976 | Bacteria | 1450 |
| 473 | Ga0466967_0548994 | 3300045976 | Bacteria | 1137 |
| 474 | Ga0466967_0744966 | 3300045976 | Bacteria | 971 |
| 475 | Ga0466967_1090489 | 3300045976 | Bacteria | 795 |
| 476 | Ga0466967_1275330 | 3300045976 | Bacteria | 732 |
| 477 | Ga0495592_0000089 | 3300046454 | Bacteria | 80990 |
| 478 | Ga0495592_0005653 | 3300046454 | Bacteria | 9244 |
| 479 | Ga0495592_0083093 | 3300046454 | Bacteria | 2313 |
| 480 | Ga0495592_0092810 | 3300046454 | Bacteria | 2163 |
| 481 | Ga0495592_0190407 | 3300046454 | Bacteria | 1391 |
| 482 | Ga0495592_0323260 | 3300046454 | Bacteria | 996 |
| 483 | Ga0495592_0396756 | 3300046454 | Bacteria | 875 |
| 484 | Ga0495603_0027575 | 3300046455 | Bacteria | 3427 |
| 485 | Ga0495603_0474835 | 3300046455 | Bacteria | 716 |
| 486 | Ga0495603_0524590 | 3300046455 | Bacteria | 678 |
| 487 | Ga0495629_0006218 | 3300046459 | Bacteria | 8863 |
| 488 | Ga0495629_0011797 | 3300046459 | Bacteria | 6340 |
| 489 | Ga0495629_0072471 | 3300046459 | Bacteria | 2404 |
| 490 | Ga0495629_0540121 | 3300046459 | Bacteria | 783 |
| 491 | Ga0495641_0006546 | 3300046461 | Bacteria | 7522 |
| 492 | Ga0495651_0000057 | 3300046462 | Bacteria | 82943 |
| 493 | Ga0495651_0005467 | 3300046462 | Bacteria | 9693 |
| 494 | Ga0495653_0001230 | 3300046463 | Bacteria | 19892 |
| 495 | Ga0495653_0035741 | 3300046463 | Bacteria | 3918 |
| 496 | Ga0495653_0046763 | 3300046463 | Bacteria | 3350 |
| 497 | Ga0495653_0066105 | 3300046463 | Bacteria | 2720 |
| 498 | Ga0495653_0191403 | 3300046463 | Bacteria | 1395 |
| 499 | Ga0495653_0313317 | 3300046463 | Bacteria | 1019 |
| 500 | Ga0495653_0370746 | 3300046463 | Bacteria | 916 |
| 501 | Ga0495580_0200348 | 3300046472 | Bacteria | 1375 |
| 502 | Ga0495582_0000977 | 3300046473 | Bacteria | 15988 |
| 503 | Ga0495582_0037853 | 3300046473 | Bacteria | 2653 |
| 504 | Ga0495582_0080557 | 3300046473 | Bacteria | 1808 |
| 505 | Ga0495582_0533008 | 3300046473 | Bacteria | 679 |
| 506 | Ga0495605_0104762 | 3300046474 | Bacteria | 1296 |
| 507 | Ga0495639_0001810 | 3300046475 | Bacteria | 9484 |
| 508 | Ga0495662_0010855 | 3300046476 | Bacteria | 4455 |
| 509 | Ga0495662_0045651 | 3300046476 | Bacteria | 2115 |
| 510 | Ga0495664_0008845 | 3300046477 | Bacteria | 5626 |
| 511 | Ga0495664_0025216 | 3300046477 | Bacteria | 3461 |
| 512 | Ga0495664_0028290 | 3300046477 | Bacteria | 3273 |
| 513 | Ga0495664_0204033 | 3300046477 | Bacteria | 1198 |
| 514 | Ga0495584_0042356 | 3300046491 | Bacteria | 2298 |
| 515 | Ga0495594_0518353 | 3300046499 | Bacteria | 677 |
| 516 | Ga0495607_0056818 | 3300046501 | Bacteria | 2245 |
| 517 | Ga0495608_0003052 | 3300046511 | Bacteria | 11963 |
| 518 | Ga0495608_0008254 | 3300046511 | Bacteria | 7312 |
| 519 | Ga0495608_0113502 | 3300046511 | Bacteria | 1741 |
| 520 | Ga0495608_0157220 | 3300046511 | Bacteria | 1446 |
| 521 | Ga0495608_0185479 | 3300046511 | Bacteria | 1315 |
| 522 | Ga0495618_0000704 | 3300046514 | Bacteria | 23313 |
| 523 | Ga0495618_0001958 | 3300046514 | Bacteria | 13508 |
| 524 | Ga0495618_0073852 | 3300046514 | Bacteria | 2171 |
| 525 | Ga0495618_0132904 | 3300046514 | Bacteria | 1592 |
| 526 | Ga0495618_0279650 | 3300046514 | Bacteria | 1041 |
| 527 | Ga0495628_0000066 | 3300046516 | Bacteria | 85699 |
| 528 | Ga0495628_0488691 | 3300046516 | Bacteria | 890 |
| 529 | Ga0495628_0838094 | 3300046516 | Bacteria | 641 |
| 530 | Ga0495630_0019278 | 3300046517 | Bacteria | 5013 |
| 531 | Ga0495630_0126627 | 3300046517 | Bacteria | 1939 |
| 532 | Ga0495630_0150519 | 3300046517 | Bacteria | 1770 |
| 533 | Ga0495630_0196785 | 3300046517 | Bacteria | 1538 |
| 534 | Ga0495630_1003340 | 3300046517 | Bacteria | 634 |
| 535 | Ga0495644_0007196 | 3300046523 | Bacteria | 4301 |
| 536 | Ga0495666_0003264 | 3300046526 | Bacteria | 8182 |
| 537 | Ga0495642_0125223 | 3300046528 | Bacteria | 1104 |
| 538 | Ga0495652_0000118 | 3300046529 | Bacteria | 85706 |
| 539 | Ga0495652_0073633 | 3300046529 | Bacteria | 2843 |
| 540 | Ga0495652_0193225 | 3300046529 | Bacteria | 1551 |
| 541 | Ga0495652_0220290 | 3300046529 | Bacteria | 1426 |
| 542 | Ga0495652_0311818 | 3300046529 | Bacteria | 1140 |
| 543 | Ga0495652_0379707 | 3300046529 | Bacteria | 1005 |
| 544 | Ga0495652_0466731 | 3300046529 | Bacteria | 881 |
| 545 | Ga0495665_0001987 | 3300046531 | Bacteria | 11055 |
| 546 | Ga0495640_0011180 | 3300046533 | Bacteria | 6910 |
| 547 | Ga0495640_0150655 | 3300046533 | Bacteria | 1494 |
| 548 | Ga0495640_0223329 | 3300046533 | Bacteria | 1187 |
| 549 | Ga0495640_0405445 | 3300046533 | Bacteria | 837 |
| 550 | Ga0495586_0000945 | 3300046535 | Bacteria | 16490 |
| 551 | Ga0495586_0332638 | 3300046535 | Bacteria | 871 |
| 552 | Ga0495586_0338538 | 3300046535 | Bacteria | 863 |
| 553 | Ga0495587_0000096 | 3300046536 | Bacteria | 68520 |
| 554 | Ga0495609_0069071 | 3300046538 | Bacteria | 1554 |
| 555 | Ga0495645_0000052 | 3300046543 | Bacteria | 86470 |
| 556 | Ga0495645_0145751 | 3300046543 | Bacteria | 1649 |
| 557 | Ga0495645_0366972 | 3300046543 | Bacteria | 924 |
| 558 | Ga0495667_0018248 | 3300046559 | Bacteria | 4740 |
| 559 | Ga0495667_0105864 | 3300046559 | Bacteria | 1818 |
| 560 | Ga0495667_0147452 | 3300046559 | Bacteria | 1515 |
| 561 | Ga0495667_0517969 | 3300046559 | Bacteria | 746 |
| 562 | Ga0495656_0004080 | 3300046615 | Bacteria | 4974 |
| 563 | Ga0495668_0194460 | 3300046616 | Bacteria | 1111 |
| 564 | Ga0495634_0001811 | 3300046642 | Bacteria | 18452 |
| 565 | Ga0495634_0030883 | 3300046642 | Bacteria | 3694 |
| 566 | Ga0495634_0063568 | 3300046642 | Bacteria | 2449 |
| 567 | Ga0495634_0067743 | 3300046642 | Bacteria | 2360 |
| 568 | Ga0495634_0107755 | 3300046642 | Bacteria | 1794 |
| 569 | Ga0495634_0125891 | 3300046642 | Bacteria | 1637 |
| 570 | Ga0495635_0004402 | 3300046663 | Bacteria | 9759 |
| 571 | Ga0495635_0015339 | 3300046663 | Bacteria | 5360 |
| 572 | Ga0495635_0030883 | 3300046663 | Bacteria | 3721 |
| 573 | Ga0495635_0067187 | 3300046663 | Bacteria | 2459 |
| 574 | Ga0495635_0119012 | 3300046663 | Bacteria | 1802 |
| 575 | Ga0495635_0327504 | 3300046663 | Bacteria | 1025 |
| 576 | Ga0495659_0025575 | 3300046664 | Bacteria | 2022 |
| 577 | Ga0495657_0005062 | 3300046675 | Bacteria | 10475 |
| 578 | Ga0495657_0010578 | 3300046675 | Bacteria | 6936 |
| 579 | Ga0495657_0785570 | 3300046675 | Bacteria | 545 |
| 580 | Ga0495599_0000046 | 3300046678 | Bacteria | 85727 |
| 581 | Ga0495599_0091066 | 3300046678 | Bacteria | 1903 |
| 582 | Ga0495599_0279208 | 3300046678 | Bacteria | 1012 |
| 583 | Ga0495623_0000061 | 3300046679 | Bacteria | 67279 |
| 584 | Ga0495623_0029504 | 3300046679 | Bacteria | 3530 |
| 585 | Ga0495646_0025683 | 3300046680 | Bacteria | 3704 |
| 586 | Ga0495646_0055265 | 3300046680 | Bacteria | 2385 |
| 587 | Ga0495647_0000107 | 3300046681 | Bacteria | 20741 |
| 588 | Ga0495647_0035609 | 3300046681 | Bacteria | 1870 |
| 589 | Ga0495647_0093842 | 3300046681 | Bacteria | 1234 |
| 590 | Ga0495658_0000454 | 3300046683 | Bacteria | 22724 |
| 591 | Ga0495658_0046184 | 3300046683 | Bacteria | 2448 |
| 592 | Ga0495658_0074012 | 3300046683 | Bacteria | 1984 |
| 593 | Ga0495658_0089786 | 3300046683 | Bacteria | 1818 |
| 594 | Ga0495658_0680857 | 3300046683 | Bacteria | 659 |
| 595 | Ga0495613_0025540 | 3300046689 | Bacteria | 4401 |
| 596 | Ga0495613_0045307 | 3300046689 | Bacteria | 3253 |
| 597 | Ga0495613_0075876 | 3300046689 | Bacteria | 2447 |
| 598 | Ga0495613_0133947 | 3300046689 | Bacteria | 1774 |
| 599 | Ga0495613_0403726 | 3300046689 | Bacteria | 932 |
| 600 | Ga0495613_0742330 | 3300046689 | Bacteria | 644 |
| 601 | Ga0495624_0016848 | 3300046690 | Bacteria | 4917 |
| 602 | Ga0495624_0117073 | 3300046690 | Bacteria | 1637 |
| 603 | Ga0495624_0291307 | 3300046690 | Bacteria | 985 |
| 604 | Ga0495589_0159050 | 3300046794 | Bacteria | 1076 |
| 605 | Ga0495600_0001336 | 3300046809 | Bacteria | 13586 |
| 606 | Ga0495600_0013896 | 3300046809 | Bacteria | 5072 |
| 607 | Ga0495581_0007758 | 3300047315 | Bacteria | 6211 |
| 608 | Ga0495581_0126407 | 3300047315 | Bacteria | 1489 |
| 609 | Ga0495581_0214593 | 3300047315 | Bacteria | 1125 |
| 610 | Ga0495581_0676470 | 3300047315 | Bacteria | 596 |
| 611 | Ga0495604_0000075 | 3300047317 | Bacteria | 85370 |
| 612 | Ga0495604_0578204 | 3300047317 | Bacteria | 722 |
| 613 | Ga0495636_0152320 | 3300047318 | Bacteria | 1038 |
| 614 | Ga0495674_0063540 | 3300047319 | Bacteria | 3211 |
| 615 | Ga0495674_0267859 | 3300047319 | Bacteria | 1402 |
| 616 | Ga0495674_0419462 | 3300047319 | Bacteria | 1078 |
| 617 | Ga0495674_0428931 | 3300047319 | Bacteria | 1064 |
| 618 | Ga0495674_0432197 | 3300047319 | Bacteria | 1059 |
| 619 | Ga0495674_0614162 | 3300047319 | Bacteria | 860 |
| 620 | Ga0495674_0689271 | 3300047319 | Bacteria | 803 |
| 621 | Ga0495676_0047898 | 3300047321 | Bacteria | 3451 |
| 622 | Ga0495676_0200468 | 3300047321 | Bacteria | 1387 |
| 623 | Ga0495676_0325116 | 3300047321 | Bacteria | 1032 |
| 624 | Ga0495680_0001905 | 3300047322 | Bacteria | 21903 |
| 625 | Ga0495680_0002544 | 3300047322 | Bacteria | 18608 |
| 626 | Ga0495680_0016393 | 3300047322 | Bacteria | 6368 |
| 627 | Ga0495680_0044311 | 3300047322 | Bacteria | 3518 |
| 628 | Ga0495680_0081018 | 3300047322 | Bacteria | 2451 |
| 629 | Ga0495680_0103142 | 3300047322 | Bacteria | 2123 |
| 630 | Ga0495680_0260162 | 3300047322 | Bacteria | 1227 |
| 631 | Ga0495680_0297385 | 3300047322 | Bacteria | 1134 |
| 632 | Ga0495680_0492070 | 3300047322 | Bacteria | 834 |
| 633 | Ga0495680_0795700 | 3300047322 | Bacteria | 618 |
| 634 | Ga0495683_0121968 | 3300047323 | Bacteria | 1236 |
| 635 | Ga0495675_0000089 | 3300047444 | Bacteria | 64853 |
| 636 | Ga0495684_0014578 | 3300047471 | Bacteria | 6049 |
| 637 | Ga0495684_0022792 | 3300047471 | Bacteria | 4815 |
| 638 | Ga0495684_0022972 | 3300047471 | Bacteria | 4797 |
| 639 | Ga0495684_0083722 | 3300047471 | Bacteria | 2419 |
| 640 | Ga0495684_0157003 | 3300047471 | Bacteria | 1699 |
| 641 | Ga0495684_0166186 | 3300047471 | Bacteria | 1643 |
| 642 | Ga0495684_0303738 | 3300047471 | Bacteria | 1145 |
| 643 | Ga0495684_0421754 | 3300047471 | Bacteria | 933 |
| 644 | Ga0495593_0009490 | 3300047673 | Bacteria | 5644 |
| 645 | Ga0495593_0137910 | 3300047673 | Bacteria | 1236 |
| 646 | Ga0495602_0000140 | 3300048088 | Bacteria | 68037 |
| 647 | Ga0495602_0253708 | 3300048088 | Bacteria | 1309 |
| 648 | Ga0495602_0869064 | 3300048088 | Bacteria | 602 |
| 649 | Ga0495614_0000135 | 3300048089 | Bacteria | 26206 |
| 650 | Ga0495614_0482979 | 3300048089 | Bacteria | 588 |
| 651 | Ga0496100_0001805 | 3300048903 | Bacteria | 10688 |
| 652 | Ga0496100_0213690 | 3300048903 | Bacteria | 1412 |
| 653 | Ga0496100_0716123 | 3300048903 | Bacteria | 781 |
| 654 | Ga0496100_0830828 | 3300048903 | Bacteria | 724 |
| 655 | Ga0496101_0001944 | 3300048904 | Bacteria | 12514 |
| 656 | Ga0496101_0193215 | 3300048904 | Bacteria | 1571 |
| 657 | Ga0496101_0206442 | 3300048904 | Bacteria | 1520 |
| 658 | Ga0496101_0232880 | 3300048904 | Bacteria | 1432 |
| 659 | Ga0496101_0252079 | 3300048904 | Bacteria | 1375 |
| 660 | Ga0496102_0008411 | 3300048905 | Bacteria | 8842 |
| 661 | Ga0496102_0022283 | 3300048905 | Bacteria | 5612 |
| 662 | Ga0496102_0184595 | 3300048905 | Bacteria | 1965 |
| 663 | Ga0496102_0671386 | 3300048905 | Bacteria | 959 |
| 664 | Ga0496102_1288656 | 3300048905 | Bacteria | 650 |
| 665 | Ga0496103_0011323 | 3300048906 | Bacteria | 5282 |
| 666 | Ga0496103_0018531 | 3300048906 | Bacteria | 4176 |
| 667 | Ga0496103_0059585 | 3300048906 | Bacteria | 2372 |
| 668 | Ga0496103_0551867 | 3300048906 | Bacteria | 735 |
| 669 | Ga0496104_0001424 | 3300048907 | Bacteria | 20702 |
| 670 | Ga0496104_0009711 | 3300048907 | Bacteria | 8577 |
| 671 | Ga0496104_0053560 | 3300048907 | Bacteria | 3812 |
| 672 | Ga0496104_0252889 | 3300048907 | Bacteria | 1675 |
| 673 | Ga0496104_0303961 | 3300048907 | Bacteria | 1507 |
| 674 | Ga0496104_0492011 | 3300048907 | Bacteria | 1138 |
| 675 | Ga0496104_0745256 | 3300048907 | Bacteria | 887 |
| 676 | Ga0496104_0779977 | 3300048907 | Bacteria | 862 |
| 677 | Ga0496104_0847089 | 3300048907 | Bacteria | 820 |
| 678 | Ga0496105_0000765 | 3300048908 | Bacteria | 21841 |
| 679 | Ga0496105_0002165 | 3300048908 | Bacteria | 14221 |
| 680 | Ga0496105_0003798 | 3300048908 | Bacteria | 11266 |
| 681 | Ga0496105_0036071 | 3300048908 | Bacteria | 4072 |
| 682 | Ga0496105_0089046 | 3300048908 | Bacteria | 2549 |
| 683 | Ga0496105_0099484 | 3300048908 | Bacteria | 2402 |
| 684 | Ga0496105_0288336 | 3300048908 | Bacteria | 1322 |
| 685 | Ga0496105_0475175 | 3300048908 | Bacteria | 984 |
| 686 | Ga0496106_0003008 | 3300048909 | Bacteria | 12559 |
| 687 | Ga0496106_0005023 | 3300048909 | Bacteria | 9789 |
| 688 | Ga0496106_0103820 | 3300048909 | Bacteria | 2206 |
| 689 | Ga0496106_0264716 | 3300048909 | Bacteria | 1376 |
| 690 | Ga0496106_0415196 | 3300048909 | Bacteria | 1082 |
| 691 | Ga0496106_1152504 | 3300048909 | Bacteria | 606 |
| 692 | Ga0496107_0003297 | 3300048910 | Bacteria | 10776 |
| 693 | Ga0496107_0088792 | 3300048910 | Bacteria | 2256 |
| 694 | Ga0496107_0139749 | 3300048910 | Bacteria | 1790 |
| 695 | Ga0496107_0140698 | 3300048910 | Bacteria | 1783 |
| 696 | Ga0496107_0236058 | 3300048910 | Bacteria | 1361 |
| 697 | Ga0496108_0004521 | 3300048911 | Bacteria | 11205 |
| 698 | Ga0496108_0009937 | 3300048911 | Bacteria | 7715 |
| 699 | Ga0496108_0046118 | 3300048911 | Bacteria | 3641 |
| 700 | Ga0496108_0059349 | 3300048911 | Bacteria | 3217 |
| 701 | Ga0496108_0059467 | 3300048911 | Bacteria | 3213 |
| 702 | Ga0496108_0285148 | 3300048911 | Bacteria | 1438 |
| 703 | Ga0496108_0361910 | 3300048911 | Bacteria | 1266 |
| 704 | Ga0496109_0003541 | 3300048912 | Bacteria | 13033 |
| 705 | Ga0496109_0006743 | 3300048912 | Bacteria | 9669 |
| 706 | Ga0496109_0031982 | 3300048912 | Bacteria | 4727 |
| 707 | Ga0496109_0109276 | 3300048912 | Bacteria | 2570 |
| 708 | Ga0496109_0116743 | 3300048912 | Bacteria | 2484 |
| 709 | Ga0496109_0149421 | 3300048912 | Bacteria | 2187 |
| 710 | Ga0496109_0236768 | 3300048912 | Bacteria | 1717 |
| 711 | Ga0496109_0352218 | 3300048912 | Bacteria | 1391 |
| 712 | Ga0496109_0494139 | 3300048912 | Bacteria | 1155 |
| 713 | Ga0496110_0015015 | 3300048913 | Bacteria | 6440 |
| 714 | Ga0496110_0096085 | 3300048913 | Bacteria | 2655 |
| 715 | Ga0496110_0661928 | 3300048913 | Bacteria | 944 |
| 716 | Ga0496111_0034025 | 3300048914 | Bacteria | 3637 |
| 717 | Ga0496111_0212807 | 3300048914 | Bacteria | 1436 |
| 718 | Ga0496111_0217197 | 3300048914 | Bacteria | 1420 |
| 719 | Ga0496111_0412944 | 3300048914 | Bacteria | 997 |
| 720 | Ga0496112_0010992 | 3300048915 | Bacteria | 8246 |
| 721 | Ga0496112_0054122 | 3300048915 | Bacteria | 3942 |
| 722 | Ga0496112_0056912 | 3300048915 | Bacteria | 3849 |
| 723 | Ga0496112_0063687 | 3300048915 | Bacteria | 3637 |
| 724 | Ga0496112_0066735 | 3300048915 | Bacteria | 3550 |
| 725 | Ga0496112_0116888 | 3300048915 | Bacteria | 2637 |
| 726 | Ga0496112_0224474 | 3300048915 | Bacteria | 1834 |
| 727 | Ga0496112_0299139 | 3300048915 | Bacteria | 1555 |
| 728 | Ga0496112_0599310 | 3300048915 | Bacteria | 1034 |
| 729 | Ga0496113_0015444 | 3300048916 | Bacteria | 5248 |
| 730 | Ga0496113_0028114 | 3300048916 | Bacteria | 4041 |
| 731 | Ga0496113_0036075 | 3300048916 | Bacteria | 3621 |
| 732 | Ga0496113_0051869 | 3300048916 | Bacteria | 3062 |
| 733 | Ga0496113_0079934 | 3300048916 | Bacteria | 2503 |
| 734 | Ga0496113_0143987 | 3300048916 | Bacteria | 1877 |
| 735 | Ga0496113_0483595 | 3300048916 | Bacteria | 994 |
| 736 | Ga0496113_0755024 | 3300048916 | Bacteria | 774 |
| 737 | Ga0496114_0000844 | 3300048917 | Bacteria | 22955 |
| 738 | Ga0496114_0052624 | 3300048917 | Bacteria | 3392 |
| 739 | Ga0496114_0137163 | 3300048917 | Bacteria | 2116 |
| 740 | Ga0496114_0223399 | 3300048917 | Bacteria | 1653 |
| 741 | Ga0496114_1503970 | 3300048917 | Bacteria | 561 |
| 742 | Ga0496115_0001153 | 3300048918 | Bacteria | 19100 |
| 743 | Ga0496115_0020332 | 3300048918 | Bacteria | 5121 |
| 744 | Ga0496115_0055198 | 3300048918 | Bacteria | 3191 |
| 745 | Ga0496115_0215174 | 3300048918 | Bacteria | 1586 |
| 746 | Ga0496115_0290384 | 3300048918 | Bacteria | 1341 |
| 747 | Ga0496115_0403162 | 3300048918 | Bacteria | 1109 |
| 748 | Ga0501034_0061520 | 3300049571 | Bacteria | 3770 |
| 749 | Ga0501041_0199559 | 3300049577 | Bacteria | 1254 |
| 750 | Ga0501042_1058657 | 3300049578 | Bacteria | 591 |
| 751 | Ga0501067_0003917 | 3300049583 | Bacteria | 8218 |
| 752 | Ga0501067_0036583 | 3300049583 | Bacteria | 2725 |
| 753 | Ga0501067_0086741 | 3300049583 | Bacteria | 1737 |
| 754 | Ga0501067_0128212 | 3300049583 | Bacteria | 1412 |
| 755 | Ga0501068_0345516 | 3300049584 | Bacteria | 956 |
| 756 | Ga0501069_0040482 | 3300049585 | Bacteria | 2576 |
| 757 | Ga0501069_0061290 | 3300049585 | Bacteria | 2100 |
| 758 | Ga0501070_0000846 | 3300049586 | Bacteria | 27787 |
| 759 | Ga0501070_0007998 | 3300049586 | Bacteria | 8954 |
| 760 | Ga0501072_0013409 | 3300049588 | Bacteria | 6273 |
| 761 | Ga0501073_0014910 | 3300049589 | Bacteria | 5640 |
| 762 | Ga0501075_0149873 | 3300049591 | Bacteria | 1778 |
| 763 | Ga0501076_0500054 | 3300049592 | Bacteria | 1002 |
| 764 | Ga0501077_0075165 | 3300049593 | Bacteria | 2139 |
| 765 | Ga0501080_0003102 | 3300049742 | Bacteria | 14670 |
| 766 | Ga0501080_0086338 | 3300049742 | Bacteria | 2915 |
| 767 | Ga0501080_0169360 | 3300049742 | Bacteria | 2015 |
| 768 | Ga0501080_0906894 | 3300049742 | Bacteria | 768 |
| 769 | Ga0501083_0001195 | 3300049744 | Bacteria | 17537 |
| 770 | Ga0501083_1029732 | 3300049744 | Bacteria | 536 |
| 771 | nmdc:mga05p37_1439215_c1 | 3300050507 | Bacteria | 691 |
| 772 | nmdc:mga05p37_1907499_c1 | 3300050507 | Bacteria | 567 |
| 773 | nmdc:mga0n895_1326125_c1 | 3300050512 | Bacteria | 690 |
| 774 | nmdc:mga0n895_1767257_c1 | 3300050512 | Bacteria | 580 |
| 775 | nmdc:mga0n895_25599_c1 | 3300050512 | Bacteria | 5577 |
| 776 | nmdc:mga0n895_32658_c1 | 3300050512 | Bacteria | 4997 |
| 777 | nmdc:mga0rr50_1148738_c1 | 3300050513 | Bacteria | 660 |
| 778 | nmdc:mga0rr50_585477_c1 | 3300050513 | Bacteria | 951 |
| 779 | nmdc:mga0rr50_73513_c1 | 3300050513 | Bacteria | 2614 |
| 780 | nmdc:mga08x19_224889_c1 | 3300050514 | Bacteria | 1290 |
| 781 | nmdc:mga08x19_30947_c1 | 3300050514 | Bacteria | 3363 |
| 782 | nmdc:mga0a205_2322_c1 | 3300050515 | Bacteria | 16780 |
| 783 | nmdc:mga0a205_845987_c1 | 3300050515 | Bacteria | 762 |
| 784 | Ga0495601_0000273 | 3300053077 | Bacteria | 28075 |
| 785 | Ga0495601_0001986 | 3300053077 | Bacteria | 11451 |
| 786 | Ga0495601_0018928 | 3300053077 | Bacteria | 4195 |
| 787 | Ga0495601_0019554 | 3300053077 | Bacteria | 4131 |
| 788 | Ga0495601_0056822 | 3300053077 | Bacteria | 2478 |
| 789 | Ga0495601_0224826 | 3300053077 | Bacteria | 1226 |
| 790 | Ga0495601_0443379 | 3300053077 | Bacteria | 840 |
| 791 | Ga0495612_0005978 | 3300053078 | Bacteria | 5013 |
| 792 | Ga0495612_0034013 | 3300053078 | Bacteria | 2063 |
| 793 | Ga0495612_0528515 | 3300053078 | Bacteria | 542 |
| 794 | Ga0495595_0005215 | 3300053084 | Bacteria | 5249 |
| 795 | Ga0495595_0492803 | 3300053084 | Bacteria | 624 |
| 796 | Ga0495619_0000618 | 3300053085 | Bacteria | 23510 |
| 797 | Ga0495619_0010339 | 3300053085 | Bacteria | 5872 |
| 798 | Ga0495619_0012143 | 3300053085 | Bacteria | 5424 |
| 799 | Ga0495619_0015708 | 3300053085 | Bacteria | 4793 |
| 800 | Ga0500566_0059912 | 3300053094 | Bacteria | 2157 |
| 801 | Ga0501084_0196321 | 3300054114 | Bacteria | 1703 |
| 802 | Ga0587076_125614 | 3300059645 | Bacteria | 599 |
| 803 | Ga0501082_1626581 | 3300060353 | Bacteria | 564 |
| 804 | Ga0466962_0005959 | 3300061719 | Bacteria | 5855 |
| 805 | Ga0466962_0030625 | 3300061719 | Bacteria | 2577 |
| 806 | Ga0466962_0047525 | 3300061719 | Bacteria | 2051 |
| 807 | Ga0466962_0057328 | 3300061719 | Bacteria | 1859 |
| 808 | Ga0466962_0085665 | 3300061719 | Bacteria | 1508 |
| 809 | Ga0466962_0135781 | 3300061719 | Bacteria | 1190 |
| 810 | Ga0466962_0174194 | 3300061719 | Bacteria | 1048 |
| 811 | Ga0466962_0245387 | 3300061719 | Bacteria | 879 |
| 812 | Ga0530510_0339030 | 3300061734 | Bacteria | 1128 |
| 813 | Ga0530510_0444491 | 3300061734 | Bacteria | 980 |
| 814 | Ga0070660_100039826 | |||
| 815 | Ga0070658_10045538 | |||
| 816 | Ga0070683_100066482 | |||
| 817 | Ga0070683_100092752 | |||
| 818 | Ga0070683_100557118 | |||
| 819 | Ga0070680_100421615 | |||
| 820 | Ga0070680_100529090 | |||
| 821 | Ga0070680_100620463 | |||
| 822 | Ga0070680_101122090 | |||
| 823 | Ga0070680_101309800 | |||
| 824 | Ga0070682_100106410 | |||
| 825 | Ga0070682_100272630 | |||
| 826 | Ga0070682_100447258 | |||
| 827 | Ga0068868_100872761 | |||
| 828 | Ga0070660_100031706 | |||
| 829 | Ga0070660_100067943 | |||
| 830 | Ga0070692_10188836 | |||
| 831 | Ga0070671_100131709 | |||
| 832 | Ga0070673_100591945 | |||
| 833 | Ga0070659_100091493 | |||
| 834 | Ga0070659_100316048 | |||
| 835 | Ga0070659_101049806 | |||
| 836 | Ga0070703_10140973 | |||
| 837 | Ga0070709_10038114 | |||
| 838 | Ga0070709_10224645 | |||
| 839 | Ga0070714_100018231 | |||
| 840 | Ga0070714_100025910 | |||
| 841 | Ga0070714_100030618 | |||
| 842 | Ga0070714_100093245 | |||
| 843 | Ga0070714_100098224 | |||
| 844 | Ga0070714_100174706 | |||
| 845 | Ga0070714_100206589 | |||
| 846 | Ga0070714_100286647 | |||
| 847 | Ga0070714_100410947 | |||
| 848 | Ga0070714_100619134 | |||
| 849 | Ga0070714_100948010 | |||
| 850 | Ga0070714_100949792 | |||
| 851 | Ga0070713_100063176 | |||
| 852 | Ga0070713_100138202 | |||
| 853 | Ga0070713_100708867 | |||
| 854 | Ga0070710_10033586 | |||
| 855 | Ga0070711_100071367 | |||
| 856 | Ga0070711_100090981 | |||
| 857 | Ga0070711_100108827 | |||
| 858 | Ga0070711_100571807 | |||
| 859 | Ga0070705_100236051 | |||
| 860 | Ga0070694_100696291 | |||
| 861 | Ga0070663_100559569 | |||
| 862 | Ga0070681_10042959 | |||
| 863 | Ga0070681_10307237 | |||
| 864 | Ga0070681_10932960 | |||
| 865 | Ga0070706_100227577 | |||
| 866 | Ga0070706_100579955 | |||
| 867 | Ga0070706_101355557 | |||
| 868 | Ga0070707_100000814 | |||
| 869 | Ga0070707_100266587 | |||
| 870 | Ga0070707_100732724 | |||
| 871 | Ga0070698_100060836 | |||
| 872 | Ga0070698_100101845 | |||
| 873 | Ga0070698_100185725 | |||
| 874 | Ga0070698_100905576 | |||
| 875 | Ga0070679_100216639 | |||
| 876 | Ga0070679_100397138 | |||
| 877 | Ga0070679_100674243 | |||
| 878 | Ga0070684_100200655 | |||
| 879 | Ga0070684_100211483 | |||
| 880 | Ga0070684_100219206 | |||
| 881 | Ga0068853_100796351 | |||
| 882 | Ga0070686_100746166 | |||
| 883 | Ga0070695_100000149 | |||
| 884 | Ga0070693_100495497 | |||
| 885 | Ga0070693_100537312 | |||
| 886 | Ga0068855_100165474 | |||
| 887 | Ga0070664_100052462 | |||
| 888 | Ga0070664_100834301 | |||
| 889 | Ga0070664_101404715 | |||
| 890 | Ga0068854_101188823 | |||
| 891 | Ga0068856_100281881 | |||
| 892 | Ga0070702_100166230 | |||
| 893 | Ga0068863_100416885 | |||
| 894 | Ga0081455_10029961 | |||
| 895 | Ga0081538_10018231 | |||
| 896 | Ga0081539_10039064 | |||
| 897 | Ga0070717_10003115 | |||
| 898 | Ga0070717_10027205 | |||
| 899 | Ga0070717_10045902 | |||
| 900 | Ga0070717_10132999 | |||
| 901 | Ga0070717_10250133 | |||
| 902 | Ga0070717_10293748 | |||
| 903 | Ga0070717_10341878 | |||
| 904 | Ga0070717_11123554 | |||
| 905 | Ga0070715_10008026 | |||
| 906 | Ga0070716_100403345 | |||
| 907 | Ga0070716_100662570 | |||
| 908 | Ga0070712_100010683 | |||
| 909 | Ga0070712_100014423 | |||
| 910 | Ga0070712_100097891 | |||
| 911 | Ga0070712_100227059 | |||
| 912 | Ga0070712_100573905 | |||
| 913 | Ga0070712_100656031 | |||
| 914 | Ga0070712_100665559 | |||
| 915 | Ga0068871_100097740 | |||
| 916 | Ga0075433_10002218 | |||
| 917 | Ga0075434_100004529 | |||
| 918 | Ga0075434_100166217 | |||
| 919 | Ga0075434_101223710 | |||
| 920 | Ga0075436_100036479 | |||
| 921 | Ga0075436_100208580 | |||
| 922 | Ga0075435_100001215 | |||
| 923 | Ga0075435_100924763 | |||
| 924 | Ga0099794_10519253 | |||
| 925 | Ga0099795_10299419 | |||
| 926 | Ga0105240_10042548 | |||
| 927 | Ga0105240_10185136 | |||
| 928 | Ga0105240_10344675 | |||
| 929 | Ga0105240_10792754 | |||
| 930 | Ga0105245_10127491 | |||
| 931 | Ga0105245_10387474 | |||
| 932 | Ga0105245_10529727 | |||
| 933 | Ga0114129_11779930 | |||
| 934 | Ga0114129_12827941 | |||
| 935 | Ga0105241_10344932 | |||
| 936 | Ga0105237_10031287 | |||
| 937 | Ga0105237_10790853 | |||
| 938 | Ga0105238_10105544 | |||
| 939 | Ga0105239_10678259 | |||
| 940 | Ga0105246_10340412 | |||
| 941 | Ga0157370_10214609 | |||
| 942 | Ga0157370_10353741 | |||
| 943 | Ga0157370_11078887 | |||
| 944 | Ga0157374_10057432 | |||
| 945 | Ga0157374_11496574 | |||
| 946 | Ga0157372_10092253 | |||
| 947 | Ga0157372_10624913 | |||
| 948 | Ga0157372_10640704 | |||
| 949 | Ga0163163_11665306 | |||
| 950 | Ga0182008_10001795 | |||
| 951 | Ga0182008_10068350 | |||
| 952 | Ga0182008_10128084 | |||
| 953 | Ga0182008_10164168 | |||
| 954 | Ga0157379_10387798 | |||
| 955 | Ga0157379_11485375 | |||
| 956 | Ga0157376_10109092 | |||
| 957 | Ga0182006_1011741 | |||
| 958 | Ga0182007_10025642 | |||
| 959 | Ga0197907_11191444 | |||
| 960 | Ga0206356_10385487 | |||
| 961 | Ga0206356_11241244 | |||
| 962 | Ga0206355_1630123 | |||
| 963 | Ga0206354_11533000 | |||
| 964 | Ga0206353_10912262 | |||
| 965 | Ga0207692_10053165 | |||
| 966 | Ga0207692_10178020 | |||
| 967 | Ga0207685_10140368 | |||
| 968 | Ga0207699_10037232 | |||
| 969 | Ga0207699_10056606 | |||
| 970 | Ga0207699_10116215 | |||
| 971 | Ga0207705_10463466 | |||
| 972 | Ga0207684_10166138 | |||
| 973 | Ga0207684_10444092 | |||
| 974 | Ga0207707_10174747 | |||
| 975 | Ga0207707_10253924 | |||
| 976 | Ga0207707_10255674 | |||
| 977 | Ga0207707_10463458 | |||
| 978 | Ga0207707_10756528 | |||
| 979 | Ga0207695_10042294 | |||
| 980 | Ga0207671_10222594 | |||
| 981 | Ga0207671_10853475 | |||
| 982 | Ga0207693_10001062 | |||
| 983 | Ga0207693_10005926 | |||
| 984 | Ga0207693_10034002 | |||
| 985 | Ga0207693_10037141 | |||
| 986 | Ga0207693_10037735 | |||
| 987 | Ga0207693_10368208 | |||
| 988 | Ga0207663_10082973 | |||
| 989 | Ga0207663_10486052 | |||
| 990 | Ga0207660_10015474 | |||
| 991 | Ga0207660_10022880 | |||
| 992 | Ga0207660_10186193 | |||
| 993 | Ga0207660_10432438 | |||
| 994 | Ga0207660_10443846 | |||
| 995 | Ga0207660_10542189 | |||
| 996 | Ga0207660_10650063 | |||
| 997 | Ga0207657_10003090 | |||
| 998 | Ga0207657_10005360 | |||
| 999 | Ga0207657_10061924 | |||
| 1000 | Ga0207649_10174875 | |||
| 1001 | Ga0207652_10008528 | |||
| 1002 | Ga0207652_10106964 | |||
| 1003 | Ga0207652_10222074 | |||
| 1004 | Ga0207652_10387508 | |||
| 1005 | Ga0207646_10000371 | |||
| 1006 | Ga0207646_10190459 | |||
| 1007 | Ga0207646_10787292 | |||
| 1008 | Ga0207687_10113269 | |||
| 1009 | Ga0207687_10406744 | |||
| 1010 | Ga0207687_10590311 | |||
| 1011 | Ga0207700_10010831 | |||
| 1012 | Ga0207700_10013264 | |||
| 1013 | Ga0207700_10047873 | |||
| 1014 | Ga0207700_10113275 | |||
| 1015 | Ga0207700_11386988 | |||
| 1016 | Ga0207664_10002612 | |||
| 1017 | Ga0207664_10005182 | |||
| 1018 | Ga0207664_10006068 | |||
| 1019 | Ga0207664_10019307 | |||
| 1020 | Ga0207664_10041646 | |||
| 1021 | Ga0207664_10075996 | |||
| 1022 | Ga0207664_10116817 | |||
| 1023 | Ga0207664_10156131 | |||
| 1024 | Ga0207664_10526712 | |||
| 1025 | Ga0207664_10670004 | |||
| 1026 | Ga0207664_10956448 | |||
| 1027 | Ga0207664_11375193 | |||
| 1028 | Ga0207644_10129000 | |||
| 1029 | Ga0207690_10172838 | |||
| 1030 | Ga0207706_11485373 | |||
| 1031 | Ga0207686_11030300 | |||
| 1032 | Ga0207665_10009583 | |||
| 1033 | Ga0207665_10304628 | |||
| 1034 | Ga0207711_10087061 | |||
| 1035 | Ga0207711_10812571 | |||
| 1036 | Ga0207661_10009335 | |||
| 1037 | Ga0207661_10031369 | |||
| 1038 | Ga0207679_10825208 | |||
| 1039 | Ga0207679_10980062 | |||
| 1040 | Ga0207667_10379313 | |||
| 1041 | Ga0207667_10786635 | |||
| 1042 | Ga0207651_10437930 | |||
| 1043 | Ga0207677_10126154 | |||
| 1044 | Ga0207639_10367458 | |||
| 1045 | Ga0207678_10692229 | |||
| 1046 | Ga0207702_10665104 | |||
| 1047 | Ga0207674_10641420 | |||
| 1048 | Ga0207674_11231526 | |||
| 1049 | Ga0207683_10306789 | |||
| 1050 | Ga0265337_1025817 | |||
| 1051 | Ga0265337_1047853 | |||
| 1052 | Ga0265337_1115290 | |||
| 1053 | Ga0265319_1001437 | |||
| 1054 | Ga0265319_1002094 | |||
| 1055 | Ga0265319_1045781 | |||
| 1056 | Ga0265334_10000322 | |||
| 1057 | Ga0265334_10014510 | |||
| 1058 | Ga0265334_10039042 | |||
| 1059 | Ga0265334_10105650 | |||
| 1060 | Ga0265334_10206784 | |||
| 1061 | Ga0265318_10000777 | |||
| 1062 | Ga0265318_10001871 | |||
| 1063 | Ga0265318_10022386 | |||
| 1064 | Ga0265318_10057607 | |||
| 1065 | Ga0265323_10158224 | |||
| 1066 | Ga0265322_10003220 | |||
| 1067 | Ga0265322_10018523 | |||
| 1068 | Ga0265336_10019934 | |||
| 1069 | Ga0265336_10022144 | |||
| 1070 | Ga0265336_10022883 | |||
| 1071 | Ga0265336_10081943 | |||
| 1072 | Ga0265338_10001558 | |||
| 1073 | Ga0265338_10003330 | |||
| 1074 | Ga0265338_10010797 | |||
| 1075 | Ga0265338_10022905 | |||
| 1076 | Ga0265338_10038047 | |||
| 1077 | Ga0265338_10042934 | |||
| 1078 | Ga0265338_10050446 | |||
| 1079 | Ga0265338_10123686 | |||
| 1080 | Ga0265338_10296528 | |||
| 1081 | Ga0265338_10346889 | |||
| 1082 | Ga0265338_10418006 | |||
| 1083 | Ga0265338_10566293 | |||
| 1084 | Ga0265324_10038750 | |||
| 1085 | Ga0265330_10003034 | |||
| 1086 | Ga0265332_10006572 | |||
| 1087 | Ga0265332_10040678 | |||
| 1088 | Ga0265332_10067215 | |||
| 1089 | Ga0265328_10004790 | |||
| 1090 | Ga0265320_10010060 | |||
| 1091 | Ga0265320_10156081 | |||
| 1092 | Ga0265325_10011495 | |||
| 1093 | Ga0265329_10012118 | |||
| 1094 | Ga0265329_10014888 | |||
| 1095 | Ga0265340_10008992 | |||
| 1096 | Ga0265339_10007646 | |||
| 1097 | Ga0265339_10063634 | |||
| 1098 | Ga0265331_10002581 | |||
| 1099 | Ga0265327_10004211 | |||
| 1100 | Ga0265327_10011702 | |||
| 1101 | Ga0265327_10019485 | |||
| 1102 | Ga0265327_10030362 | |||
| 1103 | Ga0265316_10021439 | |||
| 1104 | Ga0265316_10035212 | |||
| 1105 | Ga0265316_10129396 | |||
| 1106 | Ga0265316_10526001 | |||
| 1107 | Ga0265313_10014033 | |||
| 1108 | Ga0265313_10039165 | |||
| 1109 | Ga0265314_10002715 | |||
| 1110 | Ga0265314_10002854 | |||
| 1111 | Ga0265314_10012282 | |||
| 1112 | Ga0265314_10605537 | |||
| 1113 | Ga0265342_10022888 | |||
| 1114 | Ga0265342_10133581 | |||
| 1115 | Ga0307416_101979602 | |||
| 1116 | Ga0373926_0001730 | |||
| 1117 | Ga0373934_0131391 | |||
| 1118 | Ga0373944_0076961 | |||
| 1119 | Ga0373939_0385355 | |||
| 1120 | Ga0373945_0009591 | |||
| 1121 | Ga0373953_0243102 | |||
| 1122 | Ga0373956_0087820 | |||
| 1123 | Ga0373960_0213247 | |||
| 1124 | Ga0373943_0010263 | |||
| 1125 | Ga0373943_0278027 | |||
| 1126 | Ga0373946_0005228 | |||
| 1127 | Ga0373946_0171042 | |||
| 1128 | Ga0373955_0109091 | |||
| 1129 | Ga0373924_0044323 | |||
| 1130 | Ga0373935_1000151 | |||
| 1131 | Ga0373927_0072272 | |||
| 1132 | Ga0373933_0011994 | |||
| 1133 | Ga0373933_0051532 | |||
| 1134 | Ga0373947_0001416 | |||
| 1135 | Ga0373947_0169073 | |||
| 1136 | Ga0373937_0000107 | |||
| 1137 | Ga0373937_0080282 | |||
| 1138 | Ga0373937_1087621 | |||
| 1139 | Ga0373925_0002933 | |||
| 1140 | Ga0373925_0027280 | |||
| 1141 | Ga0373925_1199471 | |||
| 1142 | Ga0395899_0022279 | |||
| 1143 | Ga0395899_0050399 | |||
| 1144 | Ga0395899_0321031 | |||
| 1145 | Ga0395900_0020034 | |||
| 1146 | Ga0395900_0227265 | |||
| 1147 | Ga0395900_0435716 | |||
| 1148 | Ga0395898_0015736 | |||
| 1149 | Ga0395898_0269289 | |||
| 1150 | Ga0395898_0516537 | |||
| 1151 | Ga0395898_0934190 | |||
| 1152 | Ga0395905_0254138 | |||
| 1153 | Ga0395901_0026380 | |||
| 1154 | Ga0395901_0240217 | |||
| 1155 | Ga0395901_0563869 | |||
| 1156 | Ga0395901_1160466 | |||
| 1157 | Ga0395901_1502049 | |||
| 1158 | Ga0242420_017143 | |||
| 1159 | Ga0436365_1011248 | |||
| 1160 | Ga0436365_1769238 | |||
| 1161 | Ga0436360_0046971 | |||
| 1162 | Ga0436360_1255991 | |||
| 1163 | Ga0436363_0806935 | |||
| 1164 | Ga0451802_0842925 | |||
| 1165 | Ga0451806_200625 | |||
| 1166 | Ga0451837_1489392 | |||
| 1167 | Ga0439448_0061214 | |||
| 1168 | Ga0466969_0009447 | |||
| 1169 | Ga0466969_0043825 | |||
| 1170 | Ga0466969_0052035 | |||
| 1171 | Ga0466972_0019202 | |||
| 1172 | Ga0466965_0034119 | |||
| 1173 | Ga0466965_0038315 | |||
| 1174 | Ga0466965_0038453 | |||
| 1175 | Ga0466965_0180889 | |||
| 1176 | Ga0466966_0006701 | |||
| 1177 | Ga0466966_0070060 | |||
| 1178 | Ga0466966_0141385 | |||
| 1179 | Ga0466966_0152915 | |||
| 1180 | Ga0466961_0007633 | |||
| 1181 | Ga0466961_0008126 | |||
| 1182 | Ga0466961_0018550 | |||
| 1183 | Ga0466961_0096731 | |||
| 1184 | Ga0466961_0121773 | |||
| 1185 | Ga0466961_0123269 | |||
| 1186 | Ga0466961_0620079 | |||
| 1187 | Ga0466963_0000057 | |||
| 1188 | Ga0466963_0000527 | |||
| 1189 | Ga0466963_0003947 | |||
| 1190 | Ga0466963_0004728 | |||
| 1191 | Ga0466963_0007933 | |||
| 1192 | Ga0466963_0009286 | |||
| 1193 | Ga0466963_0013669 | |||
| 1194 | Ga0466963_0017334 | |||
| 1195 | Ga0466963_0017542 | |||
| 1196 | Ga0466963_0018413 | |||
| 1197 | Ga0466963_0026714 | |||
| 1198 | Ga0466963_0029485 | |||
| 1199 | Ga0466963_0040091 | |||
| 1200 | Ga0466963_0095442 | |||
| 1201 | Ga0466963_0116808 | |||
| 1202 | Ga0466963_0337077 | |||
| 1203 | Ga0466963_0492341 | |||
| 1204 | Ga0466963_0592088 | |||
| 1205 | Ga0466963_0686707 | |||
| 1206 | Ga0466963_0770870 | |||
| 1207 | Ga0466963_1057333 | |||
| 1208 | Ga0466964_0008224 | |||
| 1209 | Ga0466964_0010942 | |||
| 1210 | Ga0466964_0013368 | |||
| 1211 | Ga0466964_0024896 | |||
| 1212 | Ga0466964_0042128 | |||
| 1213 | Ga0466964_0071027 | |||
| 1214 | Ga0466964_0074626 | |||
| 1215 | Ga0466964_0088080 | |||
| 1216 | Ga0466964_0352728 | |||
| 1217 | Ga0453684_0731438 | |||
| 1218 | Ga0466971_0014919 | |||
| 1219 | Ga0466971_0020350 | |||
| 1220 | Ga0466971_0045365 | |||
| 1221 | Ga0466971_0065257 | |||
| 1222 | Ga0466971_0250713 | |||
| 1223 | Ga0466971_0250869 | |||
| 1224 | Ga0466968_0001402 | |||
| 1225 | Ga0466968_0006127 | |||
| 1226 | Ga0466968_0051406 | |||
| 1227 | Ga0466968_0100027 | |||
| 1228 | Ga0466968_0128509 | |||
| 1229 | Ga0466968_0214418 | |||
| 1230 | Ga0466968_0264726 | |||
| 1231 | Ga0466970_0126133 | |||
| 1232 | Ga0466957_0008317 | |||
| 1233 | Ga0466957_0018047 | |||
| 1234 | Ga0466957_0023055 | |||
| 1235 | Ga0466957_0072432 | |||
| 1236 | Ga0466957_0096315 | |||
| 1237 | Ga0466957_0172739 | |||
| 1238 | Ga0466957_0183205 | |||
| 1239 | Ga0466957_0229118 | |||
| 1240 | Ga0466957_0229996 | |||
| 1241 | Ga0466957_0240073 | |||
| 1242 | Ga0466960_0001710 | |||
| 1243 | Ga0466960_0618723 | |||
| 1244 | Ga0466959_0001356 | |||
| 1245 | Ga0466959_0004959 | |||
| 1246 | Ga0466959_0009317 | |||
| 1247 | Ga0466959_0058033 | |||
| 1248 | Ga0466959_0214262 | |||
| 1249 | Ga0466959_0270444 | |||
| 1250 | Ga0466959_0371559 | |||
| 1251 | Ga0466958_0001025 | |||
| 1252 | Ga0466958_0001146 | |||
| 1253 | Ga0466958_0009781 | |||
| 1254 | Ga0466958_0013833 | |||
| 1255 | Ga0466958_0037624 | |||
| 1256 | Ga0466958_0062716 | |||
| 1257 | Ga0466958_0073253 | |||
| 1258 | Ga0466958_0085834 | |||
| 1259 | Ga0466958_0147012 | |||
| 1260 | Ga0466958_0402963 | |||
| 1261 | Ga0466958_0680610 | |||
| 1262 | Ga0466967_0000056 | |||
| 1263 | Ga0466967_0000275 | |||
| 1264 | Ga0466967_0003136 | |||
| 1265 | Ga0466967_0006078 | |||
| 1266 | Ga0466967_0006421 | |||
| 1267 | Ga0466967_0008508 | |||
| 1268 | Ga0466967_0012270 | |||
| 1269 | Ga0466967_0029506 | |||
| 1270 | Ga0466967_0029631 | |||
| 1271 | Ga0466967_0037570 | |||
| 1272 | Ga0466967_0056787 | |||
| 1273 | Ga0466967_0077107 | |||
| 1274 | Ga0466967_0078361 | |||
| 1275 | Ga0466967_0084754 | |||
| 1276 | Ga0466967_0087330 | |||
| 1277 | Ga0466967_0088687 | |||
| 1278 | Ga0466967_0097755 | |||
| 1279 | Ga0466967_0100685 | |||
| 1280 | Ga0466967_0107350 | |||
| 1281 | Ga0466967_0108126 | |||
| 1282 | Ga0466967_0141696 | |||
| 1283 | Ga0466967_0160268 | |||
| 1284 | Ga0466967_0271203 | |||
| 1285 | Ga0466967_0340789 | |||
| 1286 | Ga0466967_0548994 | |||
| 1287 | Ga0466967_0744966 | |||
| 1288 | Ga0466967_1090489 | |||
| 1289 | Ga0466967_1275330 | |||
| 1290 | Ga0495592_0000089 | |||
| 1291 | Ga0495592_0005653 | |||
| 1292 | Ga0495592_0083093 | |||
| 1293 | Ga0495592_0092810 | |||
| 1294 | Ga0495592_0190407 | |||
| 1295 | Ga0495592_0323260 | |||
| 1296 | Ga0495592_0396756 | |||
| 1297 | Ga0495603_0027575 | |||
| 1298 | Ga0495603_0474835 | |||
| 1299 | Ga0495603_0524590 | |||
| 1300 | Ga0495629_0006218 | |||
| 1301 | Ga0495629_0011797 | |||
| 1302 | Ga0495629_0072471 | |||
| 1303 | Ga0495629_0540121 | |||
| 1304 | Ga0495641_0006546 | |||
| 1305 | Ga0495651_0000057 | |||
| 1306 | Ga0495651_0005467 | |||
| 1307 | Ga0495653_0001230 | |||
| 1308 | Ga0495653_0035741 | |||
| 1309 | Ga0495653_0046763 | |||
| 1310 | Ga0495653_0066105 | |||
| 1311 | Ga0495653_0191403 | |||
| 1312 | Ga0495653_0313317 | |||
| 1313 | Ga0495653_0370746 | |||
| 1314 | Ga0495580_0200348 | |||
| 1315 | Ga0495582_0000977 | |||
| 1316 | Ga0495582_0037853 | |||
| 1317 | Ga0495582_0080557 | |||
| 1318 | Ga0495582_0533008 | |||
| 1319 | Ga0495605_0104762 | |||
| 1320 | Ga0495639_0001810 | |||
| 1321 | Ga0495662_0010855 | |||
| 1322 | Ga0495662_0045651 | |||
| 1323 | Ga0495664_0008845 | |||
| 1324 | Ga0495664_0025216 | |||
| 1325 | Ga0495664_0028290 | |||
| 1326 | Ga0495664_0204033 | |||
| 1327 | Ga0495584_0042356 | |||
| 1328 | Ga0495594_0518353 | |||
| 1329 | Ga0495607_0056818 | |||
| 1330 | Ga0495608_0003052 | |||
| 1331 | Ga0495608_0008254 | |||
| 1332 | Ga0495608_0113502 | |||
| 1333 | Ga0495608_0157220 | |||
| 1334 | Ga0495608_0185479 | |||
| 1335 | Ga0495618_0000704 | |||
| 1336 | Ga0495618_0001958 | |||
| 1337 | Ga0495618_0073852 | |||
| 1338 | Ga0495618_0132904 | |||
| 1339 | Ga0495618_0279650 | |||
| 1340 | Ga0495628_0000066 | |||
| 1341 | Ga0495628_0488691 | |||
| 1342 | Ga0495628_0838094 | |||
| 1343 | Ga0495630_0019278 | |||
| 1344 | Ga0495630_0126627 | |||
| 1345 | Ga0495630_0150519 | |||
| 1346 | Ga0495630_0196785 | |||
| 1347 | Ga0495630_1003340 | |||
| 1348 | Ga0495644_0007196 | |||
| 1349 | Ga0495666_0003264 | |||
| 1350 | Ga0495642_0125223 | |||
| 1351 | Ga0495652_0000118 | |||
| 1352 | Ga0495652_0073633 | |||
| 1353 | Ga0495652_0193225 | |||
| 1354 | Ga0495652_0220290 | |||
| 1355 | Ga0495652_0311818 | |||
| 1356 | Ga0495652_0379707 | |||
| 1357 | Ga0495652_0466731 | |||
| 1358 | Ga0495665_0001987 | |||
| 1359 | Ga0495640_0011180 | |||
| 1360 | Ga0495640_0150655 | |||
| 1361 | Ga0495640_0223329 | |||
| 1362 | Ga0495640_0405445 | |||
| 1363 | Ga0495586_0000945 | |||
| 1364 | Ga0495586_0332638 | |||
| 1365 | Ga0495586_0338538 | |||
| 1366 | Ga0495587_0000096 | |||
| 1367 | Ga0495609_0069071 | |||
| 1368 | Ga0495645_0000052 | |||
| 1369 | Ga0495645_0145751 | |||
| 1370 | Ga0495645_0366972 | |||
| 1371 | Ga0495667_0018248 | |||
| 1372 | Ga0495667_0105864 | |||
| 1373 | Ga0495667_0147452 | |||
| 1374 | Ga0495667_0517969 | |||
| 1375 | Ga0495656_0004080 | |||
| 1376 | Ga0495668_0194460 | |||
| 1377 | Ga0495634_0001811 | |||
| 1378 | Ga0495634_0030883 | |||
| 1379 | Ga0495634_0063568 | |||
| 1380 | Ga0495634_0067743 | |||
| 1381 | Ga0495634_0107755 | |||
| 1382 | Ga0495634_0125891 | |||
| 1383 | Ga0495635_0004402 | |||
| 1384 | Ga0495635_0015339 | |||
| 1385 | Ga0495635_0030883 | |||
| 1386 | Ga0495635_0067187 | |||
| 1387 | Ga0495635_0119012 | |||
| 1388 | Ga0495635_0327504 | |||
| 1389 | Ga0495659_0025575 | |||
| 1390 | Ga0495657_0005062 | |||
| 1391 | Ga0495657_0010578 | |||
| 1392 | Ga0495657_0785570 | |||
| 1393 | Ga0495599_0000046 | |||
| 1394 | Ga0495599_0091066 | |||
| 1395 | Ga0495599_0279208 | |||
| 1396 | Ga0495623_0000061 | |||
| 1397 | Ga0495623_0029504 | |||
| 1398 | Ga0495646_0025683 | |||
| 1399 | Ga0495646_0055265 | |||
| 1400 | Ga0495647_0000107 | |||
| 1401 | Ga0495647_0035609 | |||
| 1402 | Ga0495647_0093842 | |||
| 1403 | Ga0495658_0000454 | |||
| 1404 | Ga0495658_0046184 | |||
| 1405 | Ga0495658_0074012 | |||
| 1406 | Ga0495658_0089786 | |||
| 1407 | Ga0495658_0680857 | |||
| 1408 | Ga0495613_0025540 | |||
| 1409 | Ga0495613_0045307 | |||
| 1410 | Ga0495613_0075876 | |||
| 1411 | Ga0495613_0133947 | |||
| 1412 | Ga0495613_0403726 | |||
| 1413 | Ga0495613_0742330 | |||
| 1414 | Ga0495624_0016848 | |||
| 1415 | Ga0495624_0117073 | |||
| 1416 | Ga0495624_0291307 | |||
| 1417 | Ga0495589_0159050 | |||
| 1418 | Ga0495600_0001336 | |||
| 1419 | Ga0495600_0013896 | |||
| 1420 | Ga0495581_0007758 | |||
| 1421 | Ga0495581_0126407 | |||
| 1422 | Ga0495581_0214593 | |||
| 1423 | Ga0495581_0676470 | |||
| 1424 | Ga0495604_0000075 | |||
| 1425 | Ga0495604_0578204 | |||
| 1426 | Ga0495636_0152320 | |||
| 1427 | Ga0495674_0063540 | |||
| 1428 | Ga0495674_0267859 | |||
| 1429 | Ga0495674_0419462 | |||
| 1430 | Ga0495674_0428931 | |||
| 1431 | Ga0495674_0432197 | |||
| 1432 | Ga0495674_0614162 | |||
| 1433 | Ga0495674_0689271 | |||
| 1434 | Ga0495676_0047898 | |||
| 1435 | Ga0495676_0200468 | |||
| 1436 | Ga0495676_0325116 | |||
| 1437 | Ga0495680_0001905 | |||
| 1438 | Ga0495680_0002544 | |||
| 1439 | Ga0495680_0016393 | |||
| 1440 | Ga0495680_0044311 | |||
| 1441 | Ga0495680_0081018 | |||
| 1442 | Ga0495680_0103142 | |||
| 1443 | Ga0495680_0260162 | |||
| 1444 | Ga0495680_0297385 | |||
| 1445 | Ga0495680_0492070 | |||
| 1446 | Ga0495680_0795700 | |||
| 1447 | Ga0495683_0121968 | |||
| 1448 | Ga0495675_0000089 | |||
| 1449 | Ga0495684_0014578 | |||
| 1450 | Ga0495684_0022792 | |||
| 1451 | Ga0495684_0022972 | |||
| 1452 | Ga0495684_0083722 | |||
| 1453 | Ga0495684_0157003 | |||
| 1454 | Ga0495684_0166186 | |||
| 1455 | Ga0495684_0303738 | |||
| 1456 | Ga0495684_0421754 | |||
| 1457 | Ga0495593_0009490 | |||
| 1458 | Ga0495593_0137910 | |||
| 1459 | Ga0495602_0000140 | |||
| 1460 | Ga0495602_0253708 | |||
| 1461 | Ga0495602_0869064 | |||
| 1462 | Ga0495614_0000135 | |||
| 1463 | Ga0495614_0482979 | |||
| 1464 | Ga0496100_0001805 | |||
| 1465 | Ga0496100_0213690 | |||
| 1466 | Ga0496100_0716123 | |||
| 1467 | Ga0496100_0830828 | |||
| 1468 | Ga0496101_0001944 | |||
| 1469 | Ga0496101_0193215 | |||
| 1470 | Ga0496101_0206442 | |||
| 1471 | Ga0496101_0232880 | |||
| 1472 | Ga0496101_0252079 | |||
| 1473 | Ga0496102_0008411 | |||
| 1474 | Ga0496102_0022283 | |||
| 1475 | Ga0496102_0184595 | |||
| 1476 | Ga0496102_0671386 | |||
| 1477 | Ga0496102_1288656 | |||
| 1478 | Ga0496103_0011323 | |||
| 1479 | Ga0496103_0018531 | |||
| 1480 | Ga0496103_0059585 | |||
| 1481 | Ga0496103_0551867 | |||
| 1482 | Ga0496104_0001424 | |||
| 1483 | Ga0496104_0009711 | |||
| 1484 | Ga0496104_0053560 | |||
| 1485 | Ga0496104_0252889 | |||
| 1486 | Ga0496104_0303961 | |||
| 1487 | Ga0496104_0492011 | |||
| 1488 | Ga0496104_0745256 | |||
| 1489 | Ga0496104_0779977 | |||
| 1490 | Ga0496104_0847089 | |||
| 1491 | Ga0496105_0000765 | |||
| 1492 | Ga0496105_0002165 | |||
| 1493 | Ga0496105_0003798 | |||
| 1494 | Ga0496105_0036071 | |||
| 1495 | Ga0496105_0089046 | |||
| 1496 | Ga0496105_0099484 | |||
| 1497 | Ga0496105_0288336 | |||
| 1498 | Ga0496105_0475175 | |||
| 1499 | Ga0496106_0003008 | |||
| 1500 | Ga0496106_0005023 | |||
| 1501 | Ga0496106_0103820 | |||
| 1502 | Ga0496106_0264716 | |||
| 1503 | Ga0496106_0415196 | |||
| 1504 | Ga0496106_1152504 | |||
| 1505 | Ga0496107_0003297 | |||
| 1506 | Ga0496107_0088792 | |||
| 1507 | Ga0496107_0139749 | |||
| 1508 | Ga0496107_0140698 | |||
| 1509 | Ga0496107_0236058 | |||
| 1510 | Ga0496108_0004521 | |||
| 1511 | Ga0496108_0009937 | |||
| 1512 | Ga0496108_0046118 | |||
| 1513 | Ga0496108_0059349 | |||
| 1514 | Ga0496108_0059467 | |||
| 1515 | Ga0496108_0285148 | |||
| 1516 | Ga0496108_0361910 | |||
| 1517 | Ga0496109_0003541 | |||
| 1518 | Ga0496109_0006743 | |||
| 1519 | Ga0496109_0031982 | |||
| 1520 | Ga0496109_0109276 | |||
| 1521 | Ga0496109_0116743 | |||
| 1522 | Ga0496109_0149421 | |||
| 1523 | Ga0496109_0236768 | |||
| 1524 | Ga0496109_0352218 | |||
| 1525 | Ga0496109_0494139 | |||
| 1526 | Ga0496110_0015015 | |||
| 1527 | Ga0496110_0096085 | |||
| 1528 | Ga0496110_0661928 | |||
| 1529 | Ga0496111_0034025 | |||
| 1530 | Ga0496111_0212807 | |||
| 1531 | Ga0496111_0217197 | |||
| 1532 | Ga0496111_0412944 | |||
| 1533 | Ga0496112_0010992 | |||
| 1534 | Ga0496112_0054122 | |||
| 1535 | Ga0496112_0056912 | |||
| 1536 | Ga0496112_0063687 | |||
| 1537 | Ga0496112_0066735 | |||
| 1538 | Ga0496112_0116888 | |||
| 1539 | Ga0496112_0224474 | |||
| 1540 | Ga0496112_0299139 | |||
| 1541 | Ga0496112_0599310 | |||
| 1542 | Ga0496113_0015444 | |||
| 1543 | Ga0496113_0028114 | |||
| 1544 | Ga0496113_0036075 | |||
| 1545 | Ga0496113_0051869 | |||
| 1546 | Ga0496113_0079934 | |||
| 1547 | Ga0496113_0143987 | |||
| 1548 | Ga0496113_0483595 | |||
| 1549 | Ga0496113_0755024 | |||
| 1550 | Ga0496114_0000844 | |||
| 1551 | Ga0496114_0052624 | |||
| 1552 | Ga0496114_0137163 | |||
| 1553 | Ga0496114_0223399 | |||
| 1554 | Ga0496114_1503970 | |||
| 1555 | Ga0496115_0001153 | |||
| 1556 | Ga0496115_0020332 | |||
| 1557 | Ga0496115_0055198 | |||
| 1558 | Ga0496115_0215174 | |||
| 1559 | Ga0496115_0290384 | |||
| 1560 | Ga0496115_0403162 | |||
| 1561 | Ga0501034_0061520 | |||
| 1562 | Ga0501041_0199559 | |||
| 1563 | Ga0501042_1058657 | |||
| 1564 | Ga0501067_0003917 | |||
| 1565 | Ga0501067_0036583 | |||
| 1566 | Ga0501067_0086741 | |||
| 1567 | Ga0501067_0128212 | |||
| 1568 | Ga0501068_0345516 | |||
| 1569 | Ga0501069_0040482 | |||
| 1570 | Ga0501069_0061290 | |||
| 1571 | Ga0501070_0000846 | |||
| 1572 | Ga0501070_0007998 | |||
| 1573 | Ga0501072_0013409 | |||
| 1574 | Ga0501073_0014910 | |||
| 1575 | Ga0501075_0149873 | |||
| 1576 | Ga0501076_0500054 | |||
| 1577 | Ga0501077_0075165 | |||
| 1578 | Ga0501080_0003102 | |||
| 1579 | Ga0501080_0086338 | |||
| 1580 | Ga0501080_0169360 | |||
| 1581 | Ga0501080_0906894 | |||
| 1582 | Ga0501083_0001195 | |||
| 1583 | Ga0501083_1029732 | |||
| 1584 | nmdc:mga05p37_1439215_c1 | |||
| 1585 | nmdc:mga05p37_1907499_c1 | |||
| 1586 | nmdc:mga0n895_1326125_c1 | |||
| 1587 | nmdc:mga0n895_1767257_c1 | |||
| 1588 | nmdc:mga0n895_25599_c1 | |||
| 1589 | nmdc:mga0n895_32658_c1 | |||
| 1590 | nmdc:mga0rr50_1148738_c1 | |||
| 1591 | nmdc:mga0rr50_585477_c1 | |||
| 1592 | nmdc:mga0rr50_73513_c1 | |||
| 1593 | nmdc:mga08x19_224889_c1 | |||
| 1594 | nmdc:mga08x19_30947_c1 | |||
| 1595 | nmdc:mga0a205_2322_c1 | |||
| 1596 | nmdc:mga0a205_845987_c1 | |||
| 1597 | Ga0495601_0000273 | |||
| 1598 | Ga0495601_0001986 | |||
| 1599 | Ga0495601_0018928 | |||
| 1600 | Ga0495601_0019554 | |||
| 1601 | Ga0495601_0056822 | |||
| 1602 | Ga0495601_0224826 | |||
| 1603 | Ga0495601_0443379 | |||
| 1604 | Ga0495612_0005978 | |||
| 1605 | Ga0495612_0034013 | |||
| 1606 | Ga0495612_0528515 | |||
| 1607 | Ga0495595_0005215 | |||
| 1608 | Ga0495595_0492803 | |||
| 1609 | Ga0495619_0000618 | |||
| 1610 | Ga0495619_0010339 | |||
| 1611 | Ga0495619_0012143 | |||
| 1612 | Ga0495619_0015708 | |||
| 1613 | Ga0500566_0059912 | |||
| 1614 | Ga0501084_0196321 | |||
| 1615 | Ga0587076_125614 | |||
| 1616 | Ga0501082_1626581 | |||
| 1617 | Ga0466962_0005959 | |||
| 1618 | Ga0466962_0030625 | |||
| 1619 | Ga0466962_0047525 | |||
| 1620 | Ga0466962_0057328 | |||
| 1621 | Ga0466962_0085665 | |||
| 1622 | Ga0466962_0135781 | |||
| 1623 | Ga0466962_0174194 | |||
| 1624 | Ga0466962_0245387 | |||
| 1625 | Ga0530510_0339030 | |||
| 1626 | Ga0530510_0444491 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d63-assembly1.cif.gz_C-3 | crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei | 0.9021 | 1 | 158 |
| 3d63-assembly1.cif.gz_C-3 | crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei | 0.8915 | 1 | 158 |
| 3ld3-assembly1.cif.gz_A | crystal structure of inorganic phosphatase from anaplasma phagocytophilum at 1.75a resolution | 0.8838 | 2 | 158 |
| 1mjz-assembly1.cif.gz_A | structure of inorganic pyrophosphatase mutant d97n | 0.8809 | 1 | 158 |
| 6n1c-assembly1.cif.gz_F | crystal structure of inorganic pyrophosphatase from legionella pneumophila philadelphia 1 | 0.8792 | 1 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4z71B00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8777 | 4 | 158 | 3.90.80.10 |
| 2prdA00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8754 | 2 | 158 | 3.90.80.10 |
| 1i40A00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8749 | 1 | 158 | 3.90.80.10 |
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8745 | 1 | 158 | 3.90.80.10 |
| 3emjE00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8682 | 5 | 157 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538N2F7-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.968 | 46 | 158 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-D9W7D1-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9658 | 48 | 158 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A1V4TLJ9-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9631 | 44 | 158 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A4Q3IXF4-F1-model_v4 | deleted | 0.9609 | 54 | 158 |
|
| AF-A0A7X6P0E8-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9522 | 34 | 158 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |